Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
YDL164C (CDC9)7.343ON75575536390.0
Skud_4.937.343ON75575532370.0
Smik_4.747.343ON84575632030.0
Suva_4.827.343ON75575531270.0
NCAS0A141107.343ON75373725880.0
NDAI0A019407.343ON76571725270.0
TDEL0C020407.343ON70571625200.0
CAGL0I03410g7.343ON72472125150.0
KNAG0C037407.343ON72772124820.0
KAFR0B008307.343ON71062224640.0
ZYRO0F11572g7.343ON73172024240.0
Kpol_2001.717.343ON72672423600.0
SAKL0F10912g7.343ON69361323560.0
Kwal_56.246167.343ON71571923200.0
KLTH0H01408g7.343ON72363922700.0
TPHA0D045707.343ON73673622190.0
KLLA0D12496g7.343ON70061321910.0
ACL155W7.343ON69771921280.0
TBLA0E020507.343ON72061520620.0
TPHA0M002606.18ON9662322602e-22
ACR008W6.18ON9814052593e-22
Smik_15.1746.18ON9452392575e-22
KNAG0F028706.18ON9542672478e-21
YOR005C (DNL4)6.18ON9442682461e-20
TBLA0G010406.18ON9722422461e-20
CAGL0E02695g6.18ON9462352414e-20
NCAS0D026506.18ON9502402398e-20
TDEL0G045106.18ON9694092371e-19
ZYRO0C07854g6.18ON9444342362e-19
Suva_15.1806.18ON9482402362e-19
KLLA0D01089g6.18ON9073722352e-19
Skud_15.1666.18ON9472392353e-19
KLTH0C11286g6.18ON9512372229e-18
Kwal_56.224146.18ON9632592183e-17
KAFR0A050506.18ON9482362155e-17
Kpol_1032.76.18ON9652242121e-16
NDAI0I022606.18ON9672682075e-16
KNAG0A071902.571ON48952724.5
AFR049W2.113ON717115725.0
KNAG0E028106.4ON71650716.7
CAGL0D06622g4.39ON117889717.8
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= YDL164C
         (755 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

YDL164C Chr4 complement(164987..167254) [2268 bp, 755 aa] {ON}  ...  1406   0.0  
Skud_4.93 Chr4 complement(160642..162909) [2268 bp, 755 aa] {ON}...  1251   0.0  
Smik_4.74 Chr4 complement(141744..144281) [2538 bp, 845 aa] {ON}...  1238   0.0  
Suva_4.82 Chr4 complement(152544..154811) [2268 bp, 755 aa] {ON}...  1209   0.0  
NCAS0A14110 Chr1 (2774465..2776726) [2262 bp, 753 aa] {ON} Anc_7...  1001   0.0  
NDAI0A01940 Chr1 complement(432302..434599) [2298 bp, 765 aa] {O...   978   0.0  
TDEL0C02040 Chr3 complement(352579..354696) [2118 bp, 705 aa] {O...   975   0.0  
CAGL0I03410g Chr9 complement(289606..291780) [2175 bp, 724 aa] {...   973   0.0  
KNAG0C03740 Chr3 (737968..740151) [2184 bp, 727 aa] {ON} Anc_7.3...   960   0.0  
KAFR0B00830 Chr2 (157155..159287) [2133 bp, 710 aa] {ON} Anc_7.3...   953   0.0  
ZYRO0F11572g Chr6 (949236..951431) [2196 bp, 731 aa] {ON} simila...   938   0.0  
Kpol_2001.71 s2001 (195103..197283) [2181 bp, 726 aa] {ON} (1951...   913   0.0  
SAKL0F10912g Chr6 complement(854430..856511) [2082 bp, 693 aa] {...   912   0.0  
Kwal_56.24616 s56 (1076178..1078325) [2148 bp, 715 aa] {ON} YDL1...   898   0.0  
KLTH0H01408g Chr8 complement(129752..131923) [2172 bp, 723 aa] {...   879   0.0  
TPHA0D04570 Chr4 (996539..998749) [2211 bp, 736 aa] {ON} Anc_7.3...   859   0.0  
KLLA0D12496g Chr4 complement(1059684..1061786) [2103 bp, 700 aa]...   848   0.0  
ACL155W Chr3 (81492..83585) [2094 bp, 697 aa] {ON} Syntenic homo...   824   0.0  
TBLA0E02050 Chr5 (498038..500200) [2163 bp, 720 aa] {ON} Anc_7.3...   798   0.0  
TPHA0M00260 Chr13 complement(50326..53226) [2901 bp, 966 aa] {ON...   104   2e-22
ACR008W Chr3 (368913..371858) [2946 bp, 981 aa] {ON} Syntenic ho...   104   3e-22
Smik_15.174 Chr15 complement(301851..304688) [2838 bp, 945 aa] {...   103   5e-22
KNAG0F02870 Chr6 (543177..546041) [2865 bp, 954 aa] {ON} Anc_6.1...   100   8e-21
YOR005C Chr15 complement(334509..337343) [2835 bp, 944 aa] {ON} ...    99   1e-20
TBLA0G01040 Chr7 complement(258966..261884) [2919 bp, 972 aa] {O...    99   1e-20
CAGL0E02695g Chr5 complement(254591..257431) [2841 bp, 946 aa] {...    97   4e-20
NCAS0D02650 Chr4 (508606..511458) [2853 bp, 950 aa] {ON} Anc_6.1...    97   8e-20
TDEL0G04510 Chr7 (819479..822388) [2910 bp, 969 aa] {ON} Anc_6.1...    96   1e-19
ZYRO0C07854g Chr3 (595546..598380) [2835 bp, 944 aa] {ON} simila...    96   2e-19
Suva_15.180 Chr15 complement(308983..311829) [2847 bp, 948 aa] {...    96   2e-19
KLLA0D01089g Chr4 complement(97438..100161) [2724 bp, 907 aa] {O...    95   2e-19
Skud_15.166 Chr15 complement(294550..297393) [2844 bp, 947 aa] {...    95   3e-19
KLTH0C11286g Chr3 (926742..929597) [2856 bp, 951 aa] {ON} simila...    90   9e-18
Kwal_56.22414 s56 complement(117198..120089) [2892 bp, 963 aa] {...    89   3e-17
KAFR0A05050 Chr1 (1003515..1006361) [2847 bp, 948 aa] {ON} Anc_6...    87   5e-17
Kpol_1032.7 s1032 complement(12295..15192) [2898 bp, 965 aa] {ON...    86   1e-16
NDAI0I02260 Chr9 complement(514711..517614) [2904 bp, 967 aa] {O...    84   5e-16
KNAG0A07190 Chr1 complement(1129595..1131064) [1470 bp, 489 aa] ...    32   4.5  
AFR049W Chr6 (517312..519465) [2154 bp, 717 aa] {ON} Syntenic ho...    32   5.0  
KNAG0E02810 Chr5 (564828..566978) [2151 bp, 716 aa] {ON} Anc_6.4...    32   6.7  
CAGL0D06622g Chr4 complement(629323..632859) [3537 bp, 1178 aa] ...    32   7.8  

>YDL164C Chr4 complement(164987..167254) [2268 bp, 755 aa] {ON}
           CDC9DNA ligase found in the nucleus and mitochondria, an
           essential enzyme that joins Okazaki fragments during DNA
           replication; also acts in nucleotide excision repair,
           base excision repair, and recombination
          Length = 755

 Score = 1406 bits (3639), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 691/755 (91%), Positives = 691/755 (91%)

Query: 1   MRRLLTGCLLSSARXXXXXXXXXXXXXXXXXXXXXXXQATLARFFTSMKNKPTEGTPSPK 60
           MRRLLTGCLLSSAR                       QATLARFFTSMKNKPTEGTPSPK
Sbjct: 1   MRRLLTGCLLSSARPLKSRLPLLMSSSLPSSAGKKPKQATLARFFTSMKNKPTEGTPSPK 60

Query: 61  KSSKHMLEDRMDNVSGEEEYATKKLKQTAVTHTVAAPSSMGXXXXXXXXXXXXXGVADSP 120
           KSSKHMLEDRMDNVSGEEEYATKKLKQTAVTHTVAAPSSMG             GVADSP
Sbjct: 61  KSSKHMLEDRMDNVSGEEEYATKKLKQTAVTHTVAAPSSMGSNFSSIPSSAPSSGVADSP 120

Query: 121 QQSQRLVGEVEDALSSNNNDHYSSNIPYSEVCEVFNKIEAISSRLEIIRICSDFFIKIMK 180
           QQSQRLVGEVEDALSSNNNDHYSSNIPYSEVCEVFNKIEAISSRLEIIRICSDFFIKIMK
Sbjct: 121 QQSQRLVGEVEDALSSNNNDHYSSNIPYSEVCEVFNKIEAISSRLEIIRICSDFFIKIMK 180

Query: 181 QSSKNLIPTTYLFINRLGPDYXXXXXXXXXXXXXMKTISETCGKSMSQIKLKYKDIGDLG 240
           QSSKNLIPTTYLFINRLGPDY             MKTISETCGKSMSQIKLKYKDIGDLG
Sbjct: 181 QSSKNLIPTTYLFINRLGPDYEAGLELGLGENLLMKTISETCGKSMSQIKLKYKDIGDLG 240

Query: 241 EIAMGARNVQPTMFKPKPLTVGEVFKNLRAIAKTQGKDSQLKKMKLIKRMLTACKGIEAK 300
           EIAMGARNVQPTMFKPKPLTVGEVFKNLRAIAKTQGKDSQLKKMKLIKRMLTACKGIEAK
Sbjct: 241 EIAMGARNVQPTMFKPKPLTVGEVFKNLRAIAKTQGKDSQLKKMKLIKRMLTACKGIEAK 300

Query: 301 FLIRSLESKLRIGLAEKTVLISLSKALLLHDENREDSPDKDVPMDVLESAQQKIRDAFCQ 360
           FLIRSLESKLRIGLAEKTVLISLSKALLLHDENREDSPDKDVPMDVLESAQQKIRDAFCQ
Sbjct: 301 FLIRSLESKLRIGLAEKTVLISLSKALLLHDENREDSPDKDVPMDVLESAQQKIRDAFCQ 360

Query: 361 VPNYEIVINSCLEHGIMNLDKYCTLRPGIPLKPMLAKPTKAINEVLDRFQGETFTSEYKY 420
           VPNYEIVINSCLEHGIMNLDKYCTLRPGIPLKPMLAKPTKAINEVLDRFQGETFTSEYKY
Sbjct: 361 VPNYEIVINSCLEHGIMNLDKYCTLRPGIPLKPMLAKPTKAINEVLDRFQGETFTSEYKY 420

Query: 421 DGERAQVHLLNDGTMRIYSRNGENMTERYPEINITDFIQDLDTTKNLILDCEAVAWDKDQ 480
           DGERAQVHLLNDGTMRIYSRNGENMTERYPEINITDFIQDLDTTKNLILDCEAVAWDKDQ
Sbjct: 421 DGERAQVHLLNDGTMRIYSRNGENMTERYPEINITDFIQDLDTTKNLILDCEAVAWDKDQ 480

Query: 481 GKILPFQVLSTRKRKDVELNDVKVKVCLFAFDILCYNDERLINKSLKERREYLTKVTKVV 540
           GKILPFQVLSTRKRKDVELNDVKVKVCLFAFDILCYNDERLINKSLKERREYLTKVTKVV
Sbjct: 481 GKILPFQVLSTRKRKDVELNDVKVKVCLFAFDILCYNDERLINKSLKERREYLTKVTKVV 540

Query: 541 PGEFQYATQITTNNLDELQKFLDESVNHSCEGLMVKMLEGPESHYEPSKRSRNWLKLKKD 600
           PGEFQYATQITTNNLDELQKFLDESVNHSCEGLMVKMLEGPESHYEPSKRSRNWLKLKKD
Sbjct: 541 PGEFQYATQITTNNLDELQKFLDESVNHSCEGLMVKMLEGPESHYEPSKRSRNWLKLKKD 600

Query: 601 YLEGVGDSLDLCVLXXXXXXXXXXXXXXXFLLGCYNQDTGEFETCCKIGTGFSDEMLQLL 660
           YLEGVGDSLDLCVL               FLLGCYNQDTGEFETCCKIGTGFSDEMLQLL
Sbjct: 601 YLEGVGDSLDLCVLGAYYGRGKRTGTYGGFLLGCYNQDTGEFETCCKIGTGFSDEMLQLL 660

Query: 661 HDRLTPTIIDGPKATFVFDSSAEPDVWFEPTTLFEVLTADLSLSPIYKAGSATFDKGVSL 720
           HDRLTPTIIDGPKATFVFDSSAEPDVWFEPTTLFEVLTADLSLSPIYKAGSATFDKGVSL
Sbjct: 661 HDRLTPTIIDGPKATFVFDSSAEPDVWFEPTTLFEVLTADLSLSPIYKAGSATFDKGVSL 720

Query: 721 RFPRFLRIREDKGVEDATSSDQIVELYENQSHMQN 755
           RFPRFLRIREDKGVEDATSSDQIVELYENQSHMQN
Sbjct: 721 RFPRFLRIREDKGVEDATSSDQIVELYENQSHMQN 755

>Skud_4.93 Chr4 complement(160642..162909) [2268 bp, 755 aa] {ON}
           YDL164C (REAL)
          Length = 755

 Score = 1251 bits (3237), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 612/755 (81%), Positives = 651/755 (86%)

Query: 1   MRRLLTGCLLSSARXXXXXXXXXXXXXXXXXXXXXXXQATLARFFTSMKNKPTEGTPSPK 60
           MRRLL G L S AR                       QATLARFF+SMKN+P+  + SP+
Sbjct: 1   MRRLLAGLLFSPARSLNPRLSLLMPPSLPSSAGKKPKQATLARFFSSMKNEPSGSSSSPE 60

Query: 61  KSSKHMLEDRMDNVSGEEEYATKKLKQTAVTHTVAAPSSMGXXXXXXXXXXXXXGVADSP 120
           K+ KH LE+ +DN S E   ATKKLKQ +   T+ APS+MG                D  
Sbjct: 61  KAPKHKLENNIDNNSSEGADATKKLKQVSTVQTLVAPSTMGSSPFSLPSSAPSSSGVDVS 120

Query: 121 QQSQRLVGEVEDALSSNNNDHYSSNIPYSEVCEVFNKIEAISSRLEIIRICSDFFIKIMK 180
           Q+S+    +VE   SSN+NDHYSSNIPYSEVCEVFNKIEAISSRLEIIRICSDFFIKIM 
Sbjct: 121 QESREFTPQVEKEPSSNDNDHYSSNIPYSEVCEVFNKIEAISSRLEIIRICSDFFIKIMN 180

Query: 181 QSSKNLIPTTYLFINRLGPDYXXXXXXXXXXXXXMKTISETCGKSMSQIKLKYKDIGDLG 240
           QSSKNLIPTTYLFINRLGPDY             MKTISE+CGKSMSQIKLKYK++GDLG
Sbjct: 181 QSSKNLIPTTYLFINRLGPDYEAGLELGLGENLLMKTISESCGKSMSQIKLKYKEMGDLG 240

Query: 241 EIAMGARNVQPTMFKPKPLTVGEVFKNLRAIAKTQGKDSQLKKMKLIKRMLTACKGIEAK 300
           EIAMGARNVQPTMFKPK LTVGEVFKNLR IAKTQGKDSQL+KMKLIKRMLTAC+G+EAK
Sbjct: 241 EIAMGARNVQPTMFKPKALTVGEVFKNLRTIAKTQGKDSQLRKMKLIKRMLTACQGVEAK 300

Query: 301 FLIRSLESKLRIGLAEKTVLISLSKALLLHDENREDSPDKDVPMDVLESAQQKIRDAFCQ 360
           FLIRSLESKLRIGLAEKTVLISLSKALLLHDEN+E+SPDK++PMDVLESAQQ+IRDAFCQ
Sbjct: 301 FLIRSLESKLRIGLAEKTVLISLSKALLLHDENKENSPDKEIPMDVLESAQQRIRDAFCQ 360

Query: 361 VPNYEIVINSCLEHGIMNLDKYCTLRPGIPLKPMLAKPTKAINEVLDRFQGETFTSEYKY 420
           VPNYEIVINSCL HGIMNLDKYCTLRPGIPLKPMLAKPTKAINEVLDRFQGETFTSEYKY
Sbjct: 361 VPNYEIVINSCLNHGIMNLDKYCTLRPGIPLKPMLAKPTKAINEVLDRFQGETFTSEYKY 420

Query: 421 DGERAQVHLLNDGTMRIYSRNGENMTERYPEINITDFIQDLDTTKNLILDCEAVAWDKDQ 480
           DGERAQVHLLNDGTMRIYSRNGENMTERYPEI ITDFIQDL++TKNLILDCEAVAWDK+Q
Sbjct: 421 DGERAQVHLLNDGTMRIYSRNGENMTERYPEIKITDFIQDLNSTKNLILDCEAVAWDKEQ 480

Query: 481 GKILPFQVLSTRKRKDVELNDVKVKVCLFAFDILCYNDERLINKSLKERREYLTKVTKVV 540
            KILPFQ+LSTRKRKDVEL+DVKVKVCLFAFDILCYNDERLINKSL+ERRE+L KVTKVV
Sbjct: 481 KKILPFQILSTRKRKDVELHDVKVKVCLFAFDILCYNDERLINKSLRERREHLAKVTKVV 540

Query: 541 PGEFQYATQITTNNLDELQKFLDESVNHSCEGLMVKMLEGPESHYEPSKRSRNWLKLKKD 600
           PGEFQYATQI TNNLDELQKFLDESVN+SCEGLMVKML+GPESHYEPSKRSRNWLKLKKD
Sbjct: 541 PGEFQYATQIITNNLDELQKFLDESVNNSCEGLMVKMLDGPESHYEPSKRSRNWLKLKKD 600

Query: 601 YLEGVGDSLDLCVLXXXXXXXXXXXXXXXFLLGCYNQDTGEFETCCKIGTGFSDEMLQLL 660
           YLEGVGDSLDLCVL               FLLGCYNQDTGEFETCCKIGTGFSDEMLQLL
Sbjct: 601 YLEGVGDSLDLCVLGAYYGRGKRTGTYGGFLLGCYNQDTGEFETCCKIGTGFSDEMLQLL 660

Query: 661 HDRLTPTIIDGPKATFVFDSSAEPDVWFEPTTLFEVLTADLSLSPIYKAGSATFDKGVSL 720
           H+RLTPTIIDGPKATFVFD+SAEPDVWFEPTTLFEVLTADLSLSPIYKAGSATFDKGVSL
Sbjct: 661 HERLTPTIIDGPKATFVFDASAEPDVWFEPTTLFEVLTADLSLSPIYKAGSATFDKGVSL 720

Query: 721 RFPRFLRIREDKGVEDATSSDQIVELYENQSHMQN 755
           RFPRFLRIREDKGVEDATSSDQI+ELYENQSH+QN
Sbjct: 721 RFPRFLRIREDKGVEDATSSDQIIELYENQSHVQN 755

>Smik_4.74 Chr4 complement(141744..144281) [2538 bp, 845 aa] {ON}
           YDL164C (REAL)
          Length = 845

 Score = 1238 bits (3203), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 612/756 (80%), Positives = 642/756 (84%), Gaps = 1/756 (0%)

Query: 1   MRRLLTGCLLSSARXXXXXXXXXXXXXXXXXXXXXXXQATLARFFTSMKNKPTEGTPSPK 60
           MRRLL G L+SS                         QATLARFFTSMKNKP+  T  P 
Sbjct: 90  MRRLLGGLLISSTHPLILRLPLSMSSSLPSSAGKKPKQATLARFFTSMKNKPSGNTSPPD 149

Query: 61  KSSKHMLEDRMDNVSGEEEYATKKLKQTAVTHTVAAPSSMGXXXXXXXXXXXXXGVADSP 120
           KS+KHML+D +D+ S       KK +Q AV         M                AD  
Sbjct: 150 KSAKHMLQDSVDDDSSVGVRNVKKSQQVAVAQAATVQPFMSSFPSSLPSSAPSSSGADLS 209

Query: 121 QQSQRLVGEVED-ALSSNNNDHYSSNIPYSEVCEVFNKIEAISSRLEIIRICSDFFIKIM 179
           Q+ Q L  +VED  ++SN++DHYSSNIPYS+VCEVFN+IEAISSRLEIIRICSDFFIK+M
Sbjct: 210 QKFQGLGPKVEDFEMNSNDSDHYSSNIPYSDVCEVFNQIEAISSRLEIIRICSDFFIKVM 269

Query: 180 KQSSKNLIPTTYLFINRLGPDYXXXXXXXXXXXXXMKTISETCGKSMSQIKLKYKDIGDL 239
           KQSSKNLIPTTYLFINRLGPDY             MKTISE+CGKSMSQIKLKYK+IGDL
Sbjct: 270 KQSSKNLIPTTYLFINRLGPDYEAGLELGLGENLLMKTISESCGKSMSQIKLKYKEIGDL 329

Query: 240 GEIAMGARNVQPTMFKPKPLTVGEVFKNLRAIAKTQGKDSQLKKMKLIKRMLTACKGIEA 299
           GEIAMGARNVQPTMFKPKPLTVGEVFKNLR IAKTQGKDSQL+K+KLIKRMLTAC+G+EA
Sbjct: 330 GEIAMGARNVQPTMFKPKPLTVGEVFKNLRTIAKTQGKDSQLRKIKLIKRMLTACQGVEA 389

Query: 300 KFLIRSLESKLRIGLAEKTVLISLSKALLLHDENREDSPDKDVPMDVLESAQQKIRDAFC 359
           KFLIRSLESKLRIGLAEKTVLISLSKALLLHDENRE+S DKD+PMDVLESAQQKIRDAFC
Sbjct: 390 KFLIRSLESKLRIGLAEKTVLISLSKALLLHDENRENSADKDIPMDVLESAQQKIRDAFC 449

Query: 360 QVPNYEIVINSCLEHGIMNLDKYCTLRPGIPLKPMLAKPTKAINEVLDRFQGETFTSEYK 419
           QVPNYEIVINSCLEHGIMNLDKYCTLRPGIPLKPMLAKPTKAINEVLDRFQGETFTSEYK
Sbjct: 450 QVPNYEIVINSCLEHGIMNLDKYCTLRPGIPLKPMLAKPTKAINEVLDRFQGETFTSEYK 509

Query: 420 YDGERAQVHLLNDGTMRIYSRNGENMTERYPEINITDFIQDLDTTKNLILDCEAVAWDKD 479
           YDGERAQVHLLNDGTMRIYSRNGENMTERYPEI ITDFIQDLD TKNLILDCEAVAWDKD
Sbjct: 510 YDGERAQVHLLNDGTMRIYSRNGENMTERYPEIKITDFIQDLDITKNLILDCEAVAWDKD 569

Query: 480 QGKILPFQVLSTRKRKDVELNDVKVKVCLFAFDILCYNDERLINKSLKERREYLTKVTKV 539
           Q KILPFQVLSTRKRKDVELNDVKV+VCLFAFDILC+NDERLIN SL+ERREYLTKVTKV
Sbjct: 570 QAKILPFQVLSTRKRKDVELNDVKVRVCLFAFDILCHNDERLINMSLRERREYLTKVTKV 629

Query: 540 VPGEFQYATQITTNNLDELQKFLDESVNHSCEGLMVKMLEGPESHYEPSKRSRNWLKLKK 599
           VPGEFQYATQI TNNLDELQKFLDESVNHSCEGLMVKML+G ESHYEPSKRSRNWLKLKK
Sbjct: 630 VPGEFQYATQIITNNLDELQKFLDESVNHSCEGLMVKMLDGSESHYEPSKRSRNWLKLKK 689

Query: 600 DYLEGVGDSLDLCVLXXXXXXXXXXXXXXXFLLGCYNQDTGEFETCCKIGTGFSDEMLQL 659
           DYLEGVGDSLDLCVL               FLLGCYNQDTGEFETCCKIGTGFSDEMLQL
Sbjct: 690 DYLEGVGDSLDLCVLGAYYGRGKRTGTYGGFLLGCYNQDTGEFETCCKIGTGFSDEMLQL 749

Query: 660 LHDRLTPTIIDGPKATFVFDSSAEPDVWFEPTTLFEVLTADLSLSPIYKAGSATFDKGVS 719
           LH RLTPTIIDGPKAT+VFDSSAEPDVWFEPTTLFEVLTADLSLSPIYKAGS TFDKGVS
Sbjct: 750 LHARLTPTIIDGPKATYVFDSSAEPDVWFEPTTLFEVLTADLSLSPIYKAGSTTFDKGVS 809

Query: 720 LRFPRFLRIREDKGVEDATSSDQIVELYENQSHMQN 755
           LRFPRFLRIREDKGVEDATSSDQIVELYENQSH+QN
Sbjct: 810 LRFPRFLRIREDKGVEDATSSDQIVELYENQSHVQN 845

>Suva_4.82 Chr4 complement(152544..154811) [2268 bp, 755 aa] {ON}
           YDL164C (REAL)
          Length = 755

 Score = 1209 bits (3127), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 595/755 (78%), Positives = 635/755 (84%)

Query: 1   MRRLLTGCLLSSARXXXXXXXXXXXXXXXXXXXXXXXQATLARFFTSMKNKPTEGTPSPK 60
           M R L G +L+S R                       QATLARFFTSMKNKP+ G+ SP+
Sbjct: 1   MHRSLAGLILTSVRPSSSKLLLFMSSSLPSSAGKKPKQATLARFFTSMKNKPSGGSSSPE 60

Query: 61  KSSKHMLEDRMDNVSGEEEYATKKLKQTAVTHTVAAPSSMGXXXXXXXXXXXXXGVADSP 120
           K+ KH +E+  + +S E   A KKLK  +   T    S M                 D+ 
Sbjct: 61  KAVKHKIENGTNEISSEGASAIKKLKHLSAVQTPVEQSDMSSSSSPLPSSAPSSSGVDAS 120

Query: 121 QQSQRLVGEVEDALSSNNNDHYSSNIPYSEVCEVFNKIEAISSRLEIIRICSDFFIKIMK 180
           Q+S+ L  +VE+     +NDHYSSNIPYSEVCEVFN+IEAISSRLEIIRICSDFFIKIMK
Sbjct: 121 QKSRELTPKVEEEQGPIDNDHYSSNIPYSEVCEVFNEIEAISSRLEIIRICSDFFIKIMK 180

Query: 181 QSSKNLIPTTYLFINRLGPDYXXXXXXXXXXXXXMKTISETCGKSMSQIKLKYKDIGDLG 240
           QSSKNLIPTTYLFINRLGPDY             MKTISE+CGKSM+QIKLKYK+IGDLG
Sbjct: 181 QSSKNLIPTTYLFINRLGPDYEPGLELGLGENLLMKTISESCGKSMNQIKLKYKEIGDLG 240

Query: 241 EIAMGARNVQPTMFKPKPLTVGEVFKNLRAIAKTQGKDSQLKKMKLIKRMLTACKGIEAK 300
           EIAMGARNVQPTMFKPKPLTVGEVFKNLR+IAKTQGKDSQL+KMKLIKRMLTAC+G+EAK
Sbjct: 241 EIAMGARNVQPTMFKPKPLTVGEVFKNLRSIAKTQGKDSQLRKMKLIKRMLTACQGVEAK 300

Query: 301 FLIRSLESKLRIGLAEKTVLISLSKALLLHDENREDSPDKDVPMDVLESAQQKIRDAFCQ 360
           FLIRSLESKLRIGLAEKTVLISLSKALLLH  N E+S   D+PMDVLESAQQKIRDAFCQ
Sbjct: 301 FLIRSLESKLRIGLAEKTVLISLSKALLLHGGNGENSHVNDIPMDVLESAQQKIRDAFCQ 360

Query: 361 VPNYEIVINSCLEHGIMNLDKYCTLRPGIPLKPMLAKPTKAINEVLDRFQGETFTSEYKY 420
           VPNYEIVINSCLEHGIMNLDK+CTL+PGIPLKPMLAKPTKAINEVLDRFQGETFTSEYKY
Sbjct: 361 VPNYEIVINSCLEHGIMNLDKFCTLKPGIPLKPMLAKPTKAINEVLDRFQGETFTSEYKY 420

Query: 421 DGERAQVHLLNDGTMRIYSRNGENMTERYPEINITDFIQDLDTTKNLILDCEAVAWDKDQ 480
           DGERAQVHLL+DGTMRIYSRNGENMTERYPEI ITDFIQDLD TKNLILDCEAVAWDK+Q
Sbjct: 421 DGERAQVHLLDDGTMRIYSRNGENMTERYPEIKITDFIQDLDATKNLILDCEAVAWDKEQ 480

Query: 481 GKILPFQVLSTRKRKDVELNDVKVKVCLFAFDILCYNDERLINKSLKERREYLTKVTKVV 540
           GKILPFQVLSTRKRKDVEL+DVKV+VCLFAFD+LC+N ERLINKSL+ERRE LTKVTKVV
Sbjct: 481 GKILPFQVLSTRKRKDVELSDVKVRVCLFAFDVLCHNGERLINKSLRERRECLTKVTKVV 540

Query: 541 PGEFQYATQITTNNLDELQKFLDESVNHSCEGLMVKMLEGPESHYEPSKRSRNWLKLKKD 600
           PGEFQYATQI T+NLDELQKFLDESVN SCEGLMVKMLEGPESHYEPSKRSRNWLKLKKD
Sbjct: 541 PGEFQYATQIVTDNLDELQKFLDESVNQSCEGLMVKMLEGPESHYEPSKRSRNWLKLKKD 600

Query: 601 YLEGVGDSLDLCVLXXXXXXXXXXXXXXXFLLGCYNQDTGEFETCCKIGTGFSDEMLQLL 660
           YLEGVGDSLDLCVL               FLLGCYNQDTGEFETCCKIGTGFSDE LQ L
Sbjct: 601 YLEGVGDSLDLCVLGAYYGRGKRTGTYGGFLLGCYNQDTGEFETCCKIGTGFSDESLQQL 660

Query: 661 HDRLTPTIIDGPKATFVFDSSAEPDVWFEPTTLFEVLTADLSLSPIYKAGSATFDKGVSL 720
           H+RLTPTIIDGPKATFVFDSSAEPDVWFEPTTLFEVLTADLSLSPIYKAGS TF KGVSL
Sbjct: 661 HERLTPTIIDGPKATFVFDSSAEPDVWFEPTTLFEVLTADLSLSPIYKAGSTTFAKGVSL 720

Query: 721 RFPRFLRIREDKGVEDATSSDQIVELYENQSHMQN 755
           RFPRFLRIREDKGVEDATSS+QIVELYENQSH+QN
Sbjct: 721 RFPRFLRIREDKGVEDATSSEQIVELYENQSHVQN 755

>NCAS0A14110 Chr1 (2774465..2776726) [2262 bp, 753 aa] {ON}
           Anc_7.343 YDL164C
          Length = 753

 Score = 1001 bits (2588), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 496/737 (67%), Positives = 582/737 (78%), Gaps = 34/737 (4%)

Query: 38  QATLARFFTSMKN-KPTEG-------------------TPSPKKSSKHMLEDRMDNVSGE 77
           QATLA+FF+SMKN KP +                    T + KK+ + +L     N++  
Sbjct: 31  QATLAKFFSSMKNEKPADKKDPEDSTTTTTEKPSLSPYTANSKKTFEEILNRPASNLASS 90

Query: 78  EEYATKKLKQTAVTHTVAAPSSMGXXXXXXXXXXXXXGVADSPQQSQRLVGEVEDALSSN 137
            +     +  T     ++   S G               +  P         +E+ ++ +
Sbjct: 91  SQ-GVSDIASTPSIPNISTDESTGPDLKKQKLEESNLEPSKEPT--------IEN-VTQD 140

Query: 138 NNDHYSSNIPYSEVCEVFNKIEAISSRLEIIRICSDFFIKIMKQSSKNLIPTTYLFINRL 197
           +   Y S+IPY EVC +F +IE+ SSRL II++CSDFFIKIMK++ +NLIP TYLFIN+L
Sbjct: 141 STKPYFSSIPYREVCNLFQEIESTSSRLAIIKLCSDFFIKIMKENPQNLIPVTYLFINKL 200

Query: 198 GPDYXXXXXXXXXXXXXMKTISETCGKSMSQIKLKYKDIGDLGEIAMGARNVQPTMFKPK 257
           GPDY             MKTISE+CGKS++Q++ KY+++GDLG+IAM ARNVQPTMFKPK
Sbjct: 201 GPDYEPGLELGLGEGLLMKTISESCGKSLAQVRNKYRELGDLGQIAMDARNVQPTMFKPK 260

Query: 258 PLTVGEVFKNLRAIAKTQGKDSQLKKMKLIKRMLTACKGIEAKFLIRSLESKLRIGLAEK 317
           PLTVGEVF+NLR IAK++GKDSQ +K+KLIKRMLTAC+G EAKFLIRSLESKLRIGLAEK
Sbjct: 261 PLTVGEVFENLRLIAKSEGKDSQTRKIKLIKRMLTACEGTEAKFLIRSLESKLRIGLAEK 320

Query: 318 TVLISLSKALLLHDENREDSPDKDVPMDVLESAQQKIRDAFCQVPNYEIVINSCLEHGIM 377
           TVLISLSKALL+H    E   +KD  M++LE+A+QKIRDAFCQVPNYEIVINSCL++GIM
Sbjct: 321 TVLISLSKALLVH----ECKDNKDFDMELLETAEQKIRDAFCQVPNYEIVINSCLKYGIM 376

Query: 378 NLDKYCTLRPGIPLKPMLAKPTKAINEVLDRFQGETFTSEYKYDGERAQVHLLNDGTMRI 437
            L+ +C+LRPGIPLKPMLAKPTKAINE+LDRFQGE FTSEYKYDGERAQVHLL+DGTMRI
Sbjct: 377 ELETHCSLRPGIPLKPMLAKPTKAINEILDRFQGEIFTSEYKYDGERAQVHLLSDGTMRI 436

Query: 438 YSRNGENMTERYPEINITDFIQDLDTTKNLILDCEAVAWDKDQGKILPFQVLSTRKRKDV 497
           YSRNGENMTERYPEI+I DFI D   T  LILDCEAVAWD +Q KILPFQVLSTRKRKDV
Sbjct: 437 YSRNGENMTERYPEIHIRDFIADPLVTSTLILDCEAVAWDNEQNKILPFQVLSTRKRKDV 496

Query: 498 ELNDVKVKVCLFAFDILCYNDERLINKSLKERREYLTKVTKVVPGEFQYATQITTNNLDE 557
           +L DVKVKVCLFAFDILC+NDE+LINKSL+ERR+ L +VTK V GEFQYAT++T++NLDE
Sbjct: 497 DLKDVKVKVCLFAFDILCHNDEKLINKSLRERRQILQEVTKSVTGEFQYATEMTSSNLDE 556

Query: 558 LQKFLDESVNHSCEGLMVKMLEGPESHYEPSKRSRNWLKLKKDYLEGVGDSLDLCVLXXX 617
           LQKFLD+SV+ SCEGLMVKML+G ESHYEPSKRSRNWLKLKKDYLEG+GDSLDLCV+   
Sbjct: 557 LQKFLDQSVHDSCEGLMVKMLDGIESHYEPSKRSRNWLKLKKDYLEGIGDSLDLCVIGAY 616

Query: 618 XXXXXXXXXXXXFLLGCYNQDTGEFETCCKIGTGFSDEMLQLLHDRLTPTIIDGPKATFV 677
                       FLLGCYNQDTGEFETCCKIGTGFSDEMLQ L+ RLTPT++DGPKATFV
Sbjct: 617 YGRGKRTGMYGGFLLGCYNQDTGEFETCCKIGTGFSDEMLQQLYTRLTPTVLDGPKATFV 676

Query: 678 FDSSAEPDVWFEPTTLFEVLTADLSLSPIYKAGSATFDKGVSLRFPRFLRIREDKGVEDA 737
           +DSSAEPDVWFEPT LFEVLTADLSLSPIYKAGS+T+DKG+SLRFPRF+R REDKGVEDA
Sbjct: 677 YDSSAEPDVWFEPTLLFEVLTADLSLSPIYKAGSSTYDKGISLRFPRFIRTREDKGVEDA 736

Query: 738 TSSDQIVELYENQSHMQ 754
           TSS+QI+ELYENQ+H Q
Sbjct: 737 TSSEQIIELYENQAHTQ 753

>NDAI0A01940 Chr1 complement(432302..434599) [2298 bp, 765 aa] {ON}
           Anc_7.343 YDL164C
          Length = 765

 Score =  978 bits (2527), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 487/717 (67%), Positives = 569/717 (79%), Gaps = 7/717 (0%)

Query: 38  QATLARFFTSMKNK-PTEGTPSPKKSSKHMLEDRMDNVSGEEEYATKKLKQTAVTHTVAA 96
           QATL RFF+S+ +K PT+ T    +S +   E+  D+ S        +L  ++ + ++ A
Sbjct: 51  QATLGRFFSSINHKKPTKDTALKNESKEETKEENKDD-SDSIPRKKIRLSTSSSSPSIMA 109

Query: 97  PSSMGXXXXXXXXXXXXXGVADSPQQSQRLVGEVEDALSSNNNDHYSSNIPYSEVCEVFN 156
            S                  A +      +V +      +  +  +   IPY EVC++F 
Sbjct: 110 ESKPKSPIKLNTERSSSPASASASTTPTPIVADHTLDPKTAVSKPFLCAIPYKEVCQLFQ 169

Query: 157 KIEAISSRLEIIRICSDFFIKIMKQSSKNLIPTTYLFINRLGPDYXXXXXXXXXXXXXMK 216
           +IE  SSRL II++CSDF IKIMKQ  +NLIP TYLFIN+LGPDY             MK
Sbjct: 170 EIETTSSRLSIIKLCSDFLIKIMKQDPQNLIPVTYLFINKLGPDYEPGLELGLGEGLLMK 229

Query: 217 TISETCGKSMSQIKLKYKDIGDLGEIAMGARNVQPTMFKPKPLTVGEVFKNLRAIAKTQG 276
           TISE+CGKS++QI+ +Y+++GDLG+IA+ ARNVQPTMFKPKPLTVGEVF NL+ IAK  G
Sbjct: 230 TISESCGKSLTQIRAQYRELGDLGQIALEARNVQPTMFKPKPLTVGEVFNNLKMIAKAAG 289

Query: 277 KDSQLKKMKLIKRMLTACK-GIEAKFLIRSLESKLRIGLAEKTVLISLSKALLLHDENRE 335
           KDSQ KK+KLIKRMLTAC+ G+EAKFLIRSLESKLRIGLAEKTVLISLSKALL+    +E
Sbjct: 290 KDSQTKKIKLIKRMLTACEDGVEAKFLIRSLESKLRIGLAEKTVLISLSKALLV----KE 345

Query: 336 DSPDKDVPMDVLESAQQKIRDAFCQVPNYEIVINSCLEHGIMNLDKYCTLRPGIPLKPML 395
              +KD  M++LE+A+ KIRDAFCQVPNYEIVINSCL++GIMNL+++C+LRPGIPLKPML
Sbjct: 346 FDANKDFDMELLETAEGKIRDAFCQVPNYEIVINSCLQYGIMNLNEHCSLRPGIPLKPML 405

Query: 396 AKPTKAINEVLDRFQGETFTSEYKYDGERAQVHLLNDGTMRIYSRNGENMTERYPEINIT 455
           AKPTKAINE+LDRFQGETFTSEYKYDGERAQVHLL DGTMRIYSRNGENMTERYPEI+I 
Sbjct: 406 AKPTKAINEILDRFQGETFTSEYKYDGERAQVHLLEDGTMRIYSRNGENMTERYPEIHIG 465

Query: 456 DFIQDLDTTKNLILDCEAVAWDKDQGKILPFQVLSTRKRKDVELNDVKVKVCLFAFDILC 515
           DF++D + TK LILDCEAVAWDK+Q KILPFQVLSTRKRKDV   DVKV+VCLFAFDILC
Sbjct: 466 DFVKDRNETKTLILDCEAVAWDKEQQKILPFQVLSTRKRKDVLAKDVKVRVCLFAFDILC 525

Query: 516 YNDERLINKSLKERREYLTKVTKVVPGEFQYATQITTNNLDELQKFLDESVNHSCEGLMV 575
           +N  +LIN SLKERRE L +VT   PGEFQYAT++TT+NLDELQKFLD+SVN SCEGLMV
Sbjct: 526 HNSNKLINYSLKERREILHRVTTPAPGEFQYATELTTSNLDELQKFLDQSVNDSCEGLMV 585

Query: 576 KMLEGPESHYEPSKRSRNWLKLKKDYLEGVGDSLDLCVLXXXXXXXXXXXXXXXFLLGCY 635
           KMLEG ESHYEPSKRSRNWLKLKKDYLEG+GDSLDLCVL               FLLGCY
Sbjct: 586 KMLEGEESHYEPSKRSRNWLKLKKDYLEGIGDSLDLCVLGAYYGRGKRTGTYGGFLLGCY 645

Query: 636 NQDTGEFETCCKIGTGFSDEMLQLLHDRLTPTIIDGPKATFVFDSSAEPDVWFEPTTLFE 695
           N +TGEFETCCKIGTGFSDEMLQ LH++L  T+IDGPKAT+++DSSAEPDVWFEP+ LFE
Sbjct: 646 NDNTGEFETCCKIGTGFSDEMLQQLHEKLKATVIDGPKATYIYDSSAEPDVWFEPSLLFE 705

Query: 696 VLTADLSLSPIYKAGSATFDKGVSLRFPRFLRIREDKGVEDATSSDQIVELYENQSH 752
           VLTADLSLSPIYKAGS+ +DKGVSLRFPRF+RIREDKGVEDATSS+QI+ELYENQSH
Sbjct: 706 VLTADLSLSPIYKAGSSAYDKGVSLRFPRFIRIREDKGVEDATSSEQIIELYENQSH 762

>TDEL0C02040 Chr3 complement(352579..354696) [2118 bp, 705 aa] {ON}
           Anc_7.343 YDL164C
          Length = 705

 Score =  975 bits (2520), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 487/716 (68%), Positives = 568/716 (79%), Gaps = 35/716 (4%)

Query: 38  QATLARFFTSMKNKPTEGTPSPKKSSKHMLEDRMDNVSGEEEYATKKLKQTAVTHTVAAP 97
           QATLARFF++++    + T         ++E R DN   ++E  TKK K ++        
Sbjct: 24  QATLARFFSAVQK---DDTKEKVNGDVKIIESR-DN---QDEPVTKKFKSSSPVKL--QT 74

Query: 98  SSMGXXXXXXXXXXXXXGVADSPQQSQRLVGEVEDALSSNNNDHYSSNIPYSEVCEVFNK 157
           SS+                  SP +S      VE      + D Y S +PYS+VC VF +
Sbjct: 75  SSL------------------SPVKS----AGVESGDKPVSPDLYYSKVPYSDVCNVFQE 112

Query: 158 IEAISSRLEIIRICSDFFIKIMKQSSKNLIPTTYLFINRLGPDYXXXXXXXXXXXXXMKT 217
           IE  SSRL II+ICS+FF +IMK + +NLIPTTYLFINRLGPDY             MKT
Sbjct: 113 IEGTSSRLSIIKICSEFFSRIMKDNPQNLIPTTYLFINRLGPDYEPGLELGLGEGLLMKT 172

Query: 218 ISETCGKSMSQIKLKYKDIGDLGEIAMGARNVQPTMFKPKPLTVGEVFKNLRAIAKTQGK 277
           ISE CGKS+ Q+K +Y+++GDLG+IA+ ARNVQPTMFKPKPLTVGEVF+NLRAIA +QGK
Sbjct: 173 ISEACGKSLVQVKNRYREMGDLGQIALEARNVQPTMFKPKPLTVGEVFENLRAIAHSQGK 232

Query: 278 DSQLKKMKLIKRMLTACKGIEAKFLIRSLESKLRIGLAEKTVLISLSKALLLHDENREDS 337
           DSQ +K+KLIKRMLTAC+G+EAKFLIRSLESKLRIGLAEKTVLISLSKALL +    E  
Sbjct: 233 DSQTRKIKLIKRMLTACEGVEAKFLIRSLESKLRIGLAEKTVLISLSKALLTN----EGE 288

Query: 338 PDKDVPMDVLESAQQKIRDAFCQVPNYEIVINSCLEHGIMNLDKYCTLRPGIPLKPMLAK 397
             K+  M+++E A+ KIRDAFCQVPNYEIVIN+CL++GIM LDK+C LRPGIPLKPMLAK
Sbjct: 289 TGKEPSMELVEQAEAKIRDAFCQVPNYEIVINACLDYGIMELDKHCRLRPGIPLKPMLAK 348

Query: 398 PTKAINEVLDRFQGETFTSEYKYDGERAQVHLLNDGTMRIYSRNGENMTERYPEINITDF 457
           PTK+I EVLDRFQG+TFTSEYKYDGERAQVHLL DGTMRIYSRNGENMTERYPEI+I DF
Sbjct: 349 PTKSITEVLDRFQGQTFTSEYKYDGERAQVHLLEDGTMRIYSRNGENMTERYPEISIRDF 408

Query: 458 IQDLDTTKNLILDCEAVAWDKDQGKILPFQVLSTRKRKDVELNDVKVKVCLFAFDILCYN 517
           + DL+ TK LILDCEAVAWDK Q KILPFQVLSTRKRKDVE  DVKV+VCLFAFDI+C+N
Sbjct: 409 VADLEHTKTLILDCEAVAWDKVQQKILPFQVLSTRKRKDVEAKDVKVRVCLFAFDIICHN 468

Query: 518 DERLINKSLKERREYLTKVTKVVPGEFQYATQITTNNLDELQKFLDESVNHSCEGLMVKM 577
            ER INKSL+ERRE L +VTK V GEFQYA ++TT++++ELQKFLD+SV  SCEGLMVKM
Sbjct: 469 GERQINKSLRERRELLAQVTKPVAGEFQYAVELTTSSVEELQKFLDQSVKDSCEGLMVKM 528

Query: 578 LEGPESHYEPSKRSRNWLKLKKDYLEGVGDSLDLCVLXXXXXXXXXXXXXXXFLLGCYNQ 637
           L+GPESHYEPSKRSRNWLKLKKDYL+GVGDSLDLCVL               FLLGCYNQ
Sbjct: 529 LDGPESHYEPSKRSRNWLKLKKDYLDGVGDSLDLCVLGAYYGRGKRTGTYGGFLLGCYNQ 588

Query: 638 DTGEFETCCKIGTGFSDEMLQLLHDRLTPTIIDGPKATFVFDSSAEPDVWFEPTTLFEVL 697
           D+GEFETCCKIGTGFSDEMLQ L++R + T +DGPKAT+VFDSSAEPDVWFEPTTLFEVL
Sbjct: 589 DSGEFETCCKIGTGFSDEMLQQLYERFSKTTLDGPKATYVFDSSAEPDVWFEPTTLFEVL 648

Query: 698 TADLSLSPIYKAGSATFDKGVSLRFPRFLRIREDKGVEDATSSDQIVELYENQSHM 753
           TADLSLSP+YKAG++T+DKGVSLRFPRF+R+R+DK VEDATSS QIVELY++QSH+
Sbjct: 649 TADLSLSPVYKAGASTYDKGVSLRFPRFVRLRDDKSVEDATSSAQIVELYQDQSHV 704

>CAGL0I03410g Chr9 complement(289606..291780) [2175 bp, 724 aa] {ON}
           highly similar to uniprot|P04819 Saccharomyces
           cerevisiae YDL164c CDC9 DNA ligase
          Length = 724

 Score =  973 bits (2515), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 484/721 (67%), Positives = 572/721 (79%), Gaps = 29/721 (4%)

Query: 38  QATLARFFTSMKNKPTEGTPSPKKSSKHMLEDRMDNVSGEEEYATKK-LKQTAVTHTVAA 96
           QATLARFF+S+K K  +G    KK  +  ++    +++  E  A K  LK+  +  T   
Sbjct: 30  QATLARFFSSVK-KDADGD---KKGEQADVKTAAVDLNSHEVDANKSPLKKMKLEST--- 82

Query: 97  PSSMGXXXXXXXXXXXXXG--VADSPQQSQRLVGEVEDALSSNNNDHYSSNIPYSEVCEV 154
             S+              G  +A +P+Q                +  +   +PYS++C +
Sbjct: 83  -GSLTATKNGNQGKEEHEGTPIASTPRQV---------------DSKFFCKVPYSDLCNL 126

Query: 155 FNKIEAISSRLEIIRICSDFFIKIMKQSSKNLIPTTYLFINRLGPDYXXXXXXXXXXXXX 214
           F +IE  SSRL II++CSDFFIKIMK+  +NLIP TYLFIN+LGPDY             
Sbjct: 127 FEEIEGTSSRLAIIKLCSDFFIKIMKEDPQNLIPVTYLFINKLGPDYEPGLELGLGENLL 186

Query: 215 MKTISETCGKSMSQIKLKYKDIGDLGEIAMGARNVQPTMFKPKPLTVGEVFKNLRAIAKT 274
           MKTISE+CGKSM QIK +Y++IGDLG+IA+ ARNVQPTMFKPKPL VGEVF+NL+ IAK+
Sbjct: 187 MKTISESCGKSMQQIKNQYREIGDLGQIALEARNVQPTMFKPKPLVVGEVFENLKTIAKS 246

Query: 275 QGKDSQLKKMKLIKRMLTACKGIEAKFLIRSLESKLRIGLAEKTVLISLSKALLLHDENR 334
           QGKDSQ KKMKLIKRMLTAC+G EAKFLIRSLESKLRIGLAEKTVLI+LSKALL+HDE  
Sbjct: 247 QGKDSQTKKMKLIKRMLTACQGTEAKFLIRSLESKLRIGLAEKTVLIALSKALLIHDEKY 306

Query: 335 EDSPDKDVPMDVLESAQQKIRDAFCQVPNYEIVINSCLEHGIMNLDKYCTLRPGIPLKPM 394
            +   K+  MDV+E A+QKIRDAFCQVPNYE+VIN+CL++GIM LD++CT++PGIPLKPM
Sbjct: 307 SN---KEPSMDVVEQAEQKIRDAFCQVPNYELVINACLDYGIMKLDEHCTIQPGIPLKPM 363

Query: 395 LAKPTKAINEVLDRFQGETFTSEYKYDGERAQVHLLNDGTMRIYSRNGENMTERYPEINI 454
           LAKPTKAINEVLDRFQG+TFTSEYKYDGERAQVHLL DGTMRIYSRNGENMTERYPEI I
Sbjct: 364 LAKPTKAINEVLDRFQGQTFTSEYKYDGERAQVHLLKDGTMRIYSRNGENMTERYPEIQI 423

Query: 455 TDFIQDLDTTKNLILDCEAVAWDKDQGKILPFQVLSTRKRKDVELNDVKVKVCLFAFDIL 514
            DF+ D  +T +LILDCEAVAWDK+Q KILPFQVL+TRKRKDV +N+VKV+VCLFAFDIL
Sbjct: 424 KDFLADPASTTSLILDCEAVAWDKEQNKILPFQVLTTRKRKDVNINEVKVRVCLFAFDIL 483

Query: 515 CYNDERLINKSLKERREYLTKVTKVVPGEFQYATQITTNNLDELQKFLDESVNHSCEGLM 574
            +ND RLIN+ L +RRE L +VTK V GEFQYATQ+TT+NLDELQKFLDESV +SCEGLM
Sbjct: 484 LHNDMRLINEPLSKRREVLHEVTKPVEGEFQYATQMTTSNLDELQKFLDESVKNSCEGLM 543

Query: 575 VKMLEGPESHYEPSKRSRNWLKLKKDYLEGVGDSLDLCVLXXXXXXXXXXXXXXXFLLGC 634
           VKM++G ES+YEPSKRSRNWLKLKKDYLEGVGDSLDLCVL               FLLGC
Sbjct: 544 VKMMDGVESYYEPSKRSRNWLKLKKDYLEGVGDSLDLCVLGAYFGRGKRTGTYGGFLLGC 603

Query: 635 YNQDTGEFETCCKIGTGFSDEMLQLLHDRLTPTIIDGPKATFVFDSSAEPDVWFEPTTLF 694
           YN D+ +FETCCKIGTGFS+EMLQ L+++L+PT+IDGPK T+VFDSSAEPDVWFEPT LF
Sbjct: 604 YNADSEDFETCCKIGTGFSEEMLQTLYEKLSPTVIDGPKGTYVFDSSAEPDVWFEPTMLF 663

Query: 695 EVLTADLSLSPIYKAGSATFDKGVSLRFPRFLRIREDKGVEDATSSDQIVELYENQSHMQ 754
           EVLTADLSLSPIYKAGS+ +DKG+SLRFPRFLRIR+DK VEDATSS+QI+E+Y+NQSH+ 
Sbjct: 664 EVLTADLSLSPIYKAGSSVYDKGISLRFPRFLRIRDDKSVEDATSSEQIIEMYQNQSHVA 723

Query: 755 N 755
           N
Sbjct: 724 N 724

>KNAG0C03740 Chr3 (737968..740151) [2184 bp, 727 aa] {ON} Anc_7.343
           YDL164C
          Length = 727

 Score =  960 bits (2482), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 471/721 (65%), Positives = 566/721 (78%), Gaps = 22/721 (3%)

Query: 38  QATLARFFTSMK----NKPTEGTPSPKKSSKHMLEDRMDNVSGEEEYATKKLKQTAVTHT 93
           Q TL  FFTS+K    N P   TP      K M +D    +      ATK  ++      
Sbjct: 24  QMTLNNFFTSVKKSDTNTPASTTP------KKMEKDESPQIP-----ATKTAEEKHENMD 72

Query: 94  VAAPSSMGXXXXXXXXXXXXXGVADSPQQSQRLVGEVEDALSSNNNDHYSSNIPYSEVCE 153
           V     +                + +P  S+++  +++D   +N+   + S +PY+++C 
Sbjct: 73  VDTDPVISSSEVSAKRNSPLTSPSPTPVVSKKI--KIQD--ENNDTKEFYSTVPYADLCN 128

Query: 154 VFNKIEAISSRLEIIRICSDFFIKIMKQSSKNLIPTTYLFINRLGPDYXXXXXXXXXXXX 213
           +F +IE ISSRL II++CS F I +MK   +NLIP TYLFIN+LGPDY            
Sbjct: 129 LFQEIEGISSRLAIIKLCSSFLISVMKLDPRNLIPMTYLFINKLGPDYMPGLELGLGENL 188

Query: 214 XMKTISETCGKSMSQIKLKYKDIGDLGEIAMGARNVQPTMFKPKPLTVGEVFKNLRAIAK 273
            +KTI+E+CG+S+ QIK KY +IGDLG+IA+ AR VQPTMFKPKPLTVGEVF+NL++IA 
Sbjct: 189 LIKTIAESCGRSLQQIKTKYHEIGDLGQIALEARKVQPTMFKPKPLTVGEVFQNLKSIAS 248

Query: 274 TQGKDSQLKKMKLIKRMLTACKGIEAKFLIRSLESKLRIGLAEKTVLISLSKALLLHDEN 333
           +QGKDSQ KK+KLIKRMLT+C+G+EAKFLIRSLESKLRIGLAEKTVLISLSKALL+++  
Sbjct: 249 SQGKDSQTKKIKLIKRMLTSCQGVEAKFLIRSLESKLRIGLAEKTVLISLSKALLVYEYG 308

Query: 334 REDSPDKDVPMDVLESAQQKIRDAFCQVPNYEIVINSCLEHGIMNLDKYCTLRPGIPLKP 393
             D   KD+ M+ +E+A+QKIRDAFCQVPNYE+VI+SCL+HGIMNLD++C+LRP IPLKP
Sbjct: 309 ESD---KDIDMETVENAEQKIRDAFCQVPNYEVVIDSCLKHGIMNLDQHCSLRPAIPLKP 365

Query: 394 MLAKPTKAINEVLDRFQGETFTSEYKYDGERAQVHLLNDGTMRIYSRNGENMTERYPEIN 453
           MLAKPTK+I+E+ DRFQ + FT EYKYDGERAQVHLL DGTMRIYSRNGENMTERYPEI+
Sbjct: 366 MLAKPTKSISEIFDRFQDQKFTCEYKYDGERAQVHLLEDGTMRIYSRNGENMTERYPEIH 425

Query: 454 ITDFIQDLDTTKNLILDCEAVAWDKDQGKILPFQVLSTRKRKDVELNDVKVKVCLFAFDI 513
           I DF+ DL  TK+LILDCEAVAWDK+Q KILPFQVLSTRKRKDV++N++KV+VCLFAFDI
Sbjct: 426 IRDFVTDLSHTKSLILDCEAVAWDKEQNKILPFQVLSTRKRKDVDINEIKVRVCLFAFDI 485

Query: 514 LCYNDERLINKSLKERREYLTKVTKVVPGEFQYATQITTNNLDELQKFLDESVNHSCEGL 573
           L +NDE+LINKSL+ERR+ L  +TK V GEFQ+AT++TT NL+ELQ FLD+SV +SCEGL
Sbjct: 486 LLHNDEKLINKSLQERRDILHSITKEVTGEFQFATEMTTTNLEELQSFLDQSVKNSCEGL 545

Query: 574 MVKMLEGPESHYEPSKRSRNWLKLKKDYLEGVGDSLDLCVLXXXXXXXXXXXXXXXFLLG 633
           MVKMLEG ESHYEPSKRSRNWLKLKKDYL GVGDSLDLCVL               FLLG
Sbjct: 546 MVKMLEGEESHYEPSKRSRNWLKLKKDYLAGVGDSLDLCVLGAYFGRGKRTGNYGGFLLG 605

Query: 634 CYNQDTGEFETCCKIGTGFSDEMLQLLHDRLTPTIIDGPKATFVFDSSAEPDVWFEPTTL 693
           CYNQDTGEFET CKIGTGFSDE+LQ LH+RL  T+ID PKAT+VFD SAEPDVWFEPT L
Sbjct: 606 CYNQDTGEFETACKIGTGFSDEVLQQLHERLKSTVIDLPKATYVFDPSAEPDVWFEPTLL 665

Query: 694 FEVLTADLSLSPIYKAGSATFDKGVSLRFPRFLRIREDKGVEDATSSDQIVELYENQSHM 753
           FEVLTADLSLSP+YKAGS+T+DKGVSLRFPRFLR+REDKGVEDATSS+QIVE+YENQ+++
Sbjct: 666 FEVLTADLSLSPVYKAGSSTYDKGVSLRFPRFLRLREDKGVEDATSSEQIVEMYENQANL 725

Query: 754 Q 754
           Q
Sbjct: 726 Q 726

>KAFR0B00830 Chr2 (157155..159287) [2133 bp, 710 aa] {ON} Anc_7.343
           YDL164C
          Length = 710

 Score =  953 bits (2464), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 449/622 (72%), Positives = 533/622 (85%), Gaps = 4/622 (0%)

Query: 132 DALSSNNNDHYSSNIPYSEVCEVFNKIEAISSRLEIIRICSDFFIKIMKQSSKNLIPTTY 191
           D+  +     +  +IPY++VC +F +IE ISSRL+II++CS+FF K MKQ++ NLIP TY
Sbjct: 91  DSSETTVKQEFVCDIPYADVCVLFQEIENISSRLQIIKLCSEFFTKAMKQNTANLIPLTY 150

Query: 192 LFINRLGPDYXXXXXXXXXXXXXMKTISETCGKSMSQIKLKYKDIGDLGEIAMGARNVQP 251
           LFIN+LGPDY             MKTISE+CGKS+ Q+KL YKDIGDLG IAM ARNVQP
Sbjct: 151 LFINKLGPDYEMGLELGLGENLLMKTISESCGKSLQQVKLDYKDIGDLGTIAMNARNVQP 210

Query: 252 TMFKPKPLTVGEVFKNLRAIAKTQGKDSQLKKMKLIKRMLTACKGIEAKFLIRSLESKLR 311
           TMFKPKPLTVG VF+NL+ IAK+ GKDSQLKK++LIK++LTACKGIEAK+LIRSLESKLR
Sbjct: 211 TMFKPKPLTVGYVFQNLKLIAKSSGKDSQLKKIRLIKKLLTACKGIEAKYLIRSLESKLR 270

Query: 312 IGLAEKTVLISLSKALLLHDENREDSPDKDVPMDVLESAQQKIRDAFCQVPNYEIVINSC 371
           IGLAEK+VLISLSKALL+++ N    PD    M+++E A+QKIRDAFCQ+PNYEIVINSC
Sbjct: 271 IGLAEKSVLISLSKALLINEYNNTLDPD----MELIEKAEQKIRDAFCQIPNYEIVINSC 326

Query: 372 LEHGIMNLDKYCTLRPGIPLKPMLAKPTKAINEVLDRFQGETFTSEYKYDGERAQVHLLN 431
           L++GIMNLD++C+LRPGIPLKPMLAKPTK I EV DRFQ   FTSEYKYDGERAQVHL+N
Sbjct: 327 LKYGIMNLDEHCSLRPGIPLKPMLAKPTKTIMEVFDRFQNIHFTSEYKYDGERAQVHLMN 386

Query: 432 DGTMRIYSRNGENMTERYPEINITDFIQDLDTTKNLILDCEAVAWDKDQGKILPFQVLST 491
           DG+MRIYSRNGENMTERYPEIN+TDFI+DL+ TK+LI+DCEAVAWD+++ KILPFQVLST
Sbjct: 387 DGSMRIYSRNGENMTERYPEINVTDFIKDLNLTKSLIIDCEAVAWDREEKKILPFQVLST 446

Query: 492 RKRKDVELNDVKVKVCLFAFDILCYNDERLINKSLKERREYLTKVTKVVPGEFQYATQIT 551
           RKRKDV++ D+KV++CLFAFDILC+NDE+LINKSL+ERRE L  VT+ V GEF YA +++
Sbjct: 447 RKRKDVDIKDIKVRICLFAFDILCHNDEKLINKSLRERREILHSVTREVHGEFTYAKELS 506

Query: 552 TNNLDELQKFLDESVNHSCEGLMVKMLEGPESHYEPSKRSRNWLKLKKDYLEGVGDSLDL 611
           TNNLDELQ FLD+SV  SCEGLMVK+L+G +SHYEPSKRSRNWLKLKKDYL+GVGDSLDL
Sbjct: 507 TNNLDELQLFLDQSVKDSCEGLMVKVLDGEDSHYEPSKRSRNWLKLKKDYLDGVGDSLDL 566

Query: 612 CVLXXXXXXXXXXXXXXXFLLGCYNQDTGEFETCCKIGTGFSDEMLQLLHDRLTPTIIDG 671
           CVL               FLLGCYNQDTGEFET CKIGTGFSDE+LQ L+DRL  T IDG
Sbjct: 567 CVLGAFYGRGKRTGTYGGFLLGCYNQDTGEFETACKIGTGFSDEVLQSLYDRLKSTTIDG 626

Query: 672 PKATFVFDSSAEPDVWFEPTTLFEVLTADLSLSPIYKAGSATFDKGVSLRFPRFLRIRED 731
           PKAT+++DSSA+PDVWFEPT LFEVLTADLS+SPIYKAG++T+ KG+SLRFPRF+R+RED
Sbjct: 627 PKATYIYDSSAQPDVWFEPTLLFEVLTADLSMSPIYKAGASTYSKGISLRFPRFIRLRED 686

Query: 732 KGVEDATSSDQIVELYENQSHM 753
           K VE+ATSS+QI+ELYENQSH+
Sbjct: 687 KSVEEATSSEQIIELYENQSHV 708

>ZYRO0F11572g Chr6 (949236..951431) [2196 bp, 731 aa] {ON} similar
           to uniprot|P04819 Saccharomyces cerevisiae YDL164C CDC9
           DNA ligase found in the nucleus and mitochondria an
           essential enzyme that joins Okazaki fragments during DNA
           replication also acts in nucleotide excision repair base
           excision repair and recombination
          Length = 731

 Score =  938 bits (2424), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 465/720 (64%), Positives = 558/720 (77%), Gaps = 24/720 (3%)

Query: 38  QATLARFFTSMK--NKPTE--GTPSPKKSSKHMLEDRMDNVSGEEEYATKKLKQTAVTHT 93
           QATLA+FF+S+K  N PT+   TP+   ++    E  + + S E+E +         +  
Sbjct: 31  QATLAKFFSSVKDRNSPTKKNATPAFPTTTNVKRESPVRSNSNEKESSPMFDDSNGRS-- 88

Query: 94  VAAPSSMGXXXXXXXXXXXXXGVADSPQQSQRLVGEVEDALSSNNNDHYSSNIPYSEVCE 153
            +A SS G               +DS            ++ S NN D + S +PY++VC 
Sbjct: 89  -SACSSAGLEMESAPAPKKLKMESDS------------NSTSKNNQDDHFSTVPYADVCN 135

Query: 154 VFNKIEAISSRLEIIRICSDFFIKIMKQSSKNLIPTTYLFINRLGPDYXXXXXXXXXXXX 213
           +F +IE+ SSRL II+ICSDFF +I+K+ S+NL+PTTYLFIN+LGPDY            
Sbjct: 136 IFQEIESTSSRLSIIKICSDFFTQIVKEDSRNLVPTTYLFINKLGPDYEPGMELGLGEGL 195

Query: 214 XMKTISETCGKSMSQIKLKYKDIGDLGEIAMGARNVQPTMFKPKPLTVGEVFKNLRAIAK 273
            MKTISE+CGKS++Q+K +Y+++GDLG+IAM ARNVQPTMFKPKPLTVGEVF NLR IA 
Sbjct: 196 LMKTISESCGKSLAQVKNRYREMGDLGQIAMEARNVQPTMFKPKPLTVGEVFVNLRNIAN 255

Query: 274 TQGKDSQLKKMKLIKRMLTACKGIEAKFLIRSLESKLRIGLAEKTVLISLSKALLLHDEN 333
            QGKDSQ KK+KLIKRMLTAC+G+EAKFLIRSLESKLRIGLAEKTVLISLS ALL H++ 
Sbjct: 256 AQGKDSQNKKIKLIKRMLTACQGVEAKFLIRSLESKLRIGLAEKTVLISLSNALLRHEQG 315

Query: 334 REDSPDKDVPMDVLESAQQKIRDAFCQVPNYEIVINSCLEHGIMNLDKYCTLRPGIPLKP 393
            +  P  +     ++ A+Q IRDAFCQVPNYEIVIN+CLEHGI  L K+C L PGIPLKP
Sbjct: 316 LDVEPSDEA----VDKAEQSIRDAFCQVPNYEIVINTCLEHGISQLHKHCQLTPGIPLKP 371

Query: 394 MLAKPTKAINEVLDRFQGETFTSEYKYDGERAQVHLLNDGTMRIYSRNGENMTERYPEIN 453
           MLAKPTKAI EVLDRFQG+ F SEYKYDGERAQ+HLL DGTMRIYSRNGENMTERYPEI+
Sbjct: 372 MLAKPTKAITEVLDRFQGQLFVSEYKYDGERAQLHLLPDGTMRIYSRNGENMTERYPEID 431

Query: 454 ITDFIQDLDTTKNLILDCEAVAWDKDQGKILPFQVLSTRKRKDVELNDVKVKVCLFAFDI 513
           I DF+ D  +T++LILDCEAVAWDK+QGKILPFQVLSTRKRKDV+  DVKV+VCLFAFD+
Sbjct: 432 IRDFLSD-PSTESLILDCEAVAWDKEQGKILPFQVLSTRKRKDVDAKDVKVRVCLFAFDL 490

Query: 514 LCYNDERLINKSLKERREYLTKVTKVVPGEFQYATQITTNNLDELQKFLDESVNHSCEGL 573
           LC+N E LINKSL+ER++ L KVTK V GEF+YA ++ T N++ELQ FLD+SV  SCEGL
Sbjct: 491 LCHNGEPLINKSLRERQDDLQKVTKPVDGEFRYANKLITANIEELQHFLDQSVKDSCEGL 550

Query: 574 MVKMLEGPESHYEPSKRSRNWLKLKKDYLEGVGDSLDLCVLXXXXXXXXXXXXXXXFLLG 633
           MVKML+GPESHYEPSKRSRNWLKLKKDYL GVGDSLDLCVL               FLLG
Sbjct: 551 MVKMLDGPESHYEPSKRSRNWLKLKKDYLNGVGDSLDLCVLGAYYGRGKRTGTYGGFLLG 610

Query: 634 CYNQDTGEFETCCKIGTGFSDEMLQLLHDRLTPTIIDGPKATFVFDSSAEPDVWFEPTTL 693
           CYNQDTGE+ETCCKIGTGFS+E+LQ L+DRL PT ++ P A +V+DS+ +PDVWFEPT L
Sbjct: 611 CYNQDTGEYETCCKIGTGFSEELLQQLYDRLKPTAMEAPAAFYVYDSAQQPDVWFEPTLL 670

Query: 694 FEVLTADLSLSPIYKAGSATFDKGVSLRFPRFLRIREDKGVEDATSSDQIVELYENQSHM 753
           FEVL ADLSLSP+YKAGSA +DKG+SLRFPRFLRIR+DK VE+ATSS+Q+V+LYE Q+H+
Sbjct: 671 FEVLAADLSLSPVYKAGSAQYDKGISLRFPRFLRIRDDKSVEEATSSEQVVDLYEAQAHL 730

>Kpol_2001.71 s2001 (195103..197283) [2181 bp, 726 aa] {ON}
           (195103..197283) [2181 nt, 727 aa]
          Length = 726

 Score =  913 bits (2360), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 463/724 (63%), Positives = 547/724 (75%), Gaps = 32/724 (4%)

Query: 38  QATLARFFTSMKNKPTEGTPSPKKSSKHMLEDRMDNVSGEEEYAT-KKLK-QTAVTHTVA 95
           QATLARFF+SM          PK+            ++ +++  T KK+K  +  T T +
Sbjct: 29  QATLARFFSSM----------PKRKIDDDSSTDSTTINKDDDSDTSKKIKLNSDETPTTS 78

Query: 96  APSSMGXXXXXXXXXXXXXGVADSPQQSQRLVGEVEDALSSNNNDHYSSNIPYSEVCEVF 155
           A S                 +  SPQ+      +V    S+     + S +PY+++CEVF
Sbjct: 79  AGS---------VTSKDEPSLTSSPQKPIVTPAKVP---SNTKPVKFFSTVPYADLCEVF 126

Query: 156 NKIEAISSRLEIIRICSDFFIKIMKQSSKNLIPTTYLFINRLGPDYXXXXXXXXXXXXXM 215
            ++E+ SSRL II+ICSDF IK+MKQ  +NL+P TYLFIN+LGPDY             M
Sbjct: 127 QEVESTSSRLSIIKICSDFLIKVMKQDPQNLVPITYLFINKLGPDYEPGLELGLGEGLLM 186

Query: 216 KTISETCGKSMSQIKLKYKDIGDLGEIAMGARNVQPTMFKPKPLTVGEVFKNLRAIAKTQ 275
           KTISE+CGKSM Q+K +Y++IGDLG+IA  ARNVQPTMFKPKPLTVGEVF+NL+ IA++Q
Sbjct: 187 KTISESCGKSMQQLKNQYREIGDLGQIAQDARNVQPTMFKPKPLTVGEVFQNLKDIAQSQ 246

Query: 276 GKDSQLKKMKLIKRMLTACKGIEAKFLIRSLESKLRIGLAEKTVLISLSKALLLHDENRE 335
           GKDSQ +KM+LIKRMLTACKG+EAKFLIRSLESKLRIGLAEKTVLISLSKALLL+    E
Sbjct: 247 GKDSQQRKMRLIKRMLTACKGVEAKFLIRSLESKLRIGLAEKTVLISLSKALLLN----E 302

Query: 336 DSPDKDVPMDVLESAQQKIRDAFCQVPNYEIVINSCLEHGIMNLDKYCTLRPGIPLKPML 395
               KD  M+++E+A++KIRDAFCQVPNYEI+I SCL  GIM LD  C LRPGIPLKPML
Sbjct: 303 YETSKDPSMELIETAEEKIRDAFCQVPNYEIIIQSCLNDGIMELDNNCKLRPGIPLKPML 362

Query: 396 AKPTKAINEVLDRFQGETFTSEYKYDGERAQVHLLNDGTMRIYSRNGENMTERYPEINIT 455
           AKPTKAINEVLD FQGE FT EYKYDGER QVHLL++G MRIYSRNGENMTERYPE++I 
Sbjct: 363 AKPTKAINEVLDAFQGEEFTCEYKYDGERGQVHLLSNGEMRIYSRNGENMTERYPELHIE 422

Query: 456 DFI----QDLDTTKNLILDCEAVAWDKDQGKILPFQVLSTRKRKDVELNDVKVKVCLFAF 511
           DF+     + D   +LILDCE VAWD +Q KILPFQVLSTRKRK VEL DVKV+VCLFAF
Sbjct: 423 DFLVKDESNTDKEVSLILDCEVVAWDNEQNKILPFQVLSTRKRKGVELKDVKVRVCLFAF 482

Query: 512 DILCYNDERLINKSLKERREYLTKVTKVVPGEFQYATQITTNNLDELQKFLDESVNHSCE 571
           DIL YN E LI K+L+ERR+ L +VTK VPGEFQYAT + T  LDE+QKFLD+++  SCE
Sbjct: 483 DILYYNGEGLITKTLRERRKILHEVTKCVPGEFQYATSLITAELDEIQKFLDQAIKDSCE 542

Query: 572 GLMVKMLEGPESHYEPSKRSRNWLKLKKDYLEGVGDSLDLCVLXXXXXXXXXXXXXXXFL 631
           GLMVK+L+G ES YEPSKRSRNWLKLKKDYL GVGDSLDLCV+               FL
Sbjct: 543 GLMVKILDGEESRYEPSKRSRNWLKLKKDYLAGVGDSLDLCVMGAYYGKGKRTGTYGGFL 602

Query: 632 LGCYNQDTGEFETCCKIGTGFSDEMLQLLHDRLTPTIIDGPKATFVFDSSAEPDVWFEPT 691
           LGCYNQD+GE+ETCCKIGTGFSDEML  L++      I+ PK+ + FDSSAEPD+WFEP 
Sbjct: 603 LGCYNQDSGEYETCCKIGTGFSDEMLTKLYELFREEEIEVPKSFYNFDSSAEPDIWFEPK 662

Query: 692 TLFEVLTADLSLSPIYKAGSATFDKGVSLRFPRFLRIREDKGVEDATSSDQIVELYENQS 751
            LFEVLTADLSLSPIYKAGSAT+DKG+SLRFPRFLRIR+DK VEDATSSDQI+E+YENQS
Sbjct: 663 VLFEVLTADLSLSPIYKAGSATYDKGISLRFPRFLRIRDDKSVEDATSSDQIIEMYENQS 722

Query: 752 HMQN 755
           H+Q+
Sbjct: 723 HIQS 726

>SAKL0F10912g Chr6 complement(854430..856511) [2082 bp, 693 aa] {ON}
           similar to uniprot|P04819 Saccharomyces cerevisiae
           YDL164C CDC9 DNA ligase found in the nucleus and
           mitochondria an essential enzyme that joins Okazaki
           fragments during DNA replication also acts in nucleotide
           excision repair base excision repair and recombination
          Length = 693

 Score =  912 bits (2356), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 424/613 (69%), Positives = 517/613 (84%), Gaps = 5/613 (0%)

Query: 142 YSSNIPYSEVCEVFNKIEAISSRLEIIRICSDFFIKIMKQSSKNLIPTTYLFINRLGPDY 201
           + S IPYS+VC +F++IE+ SSRL I++ICS+FF  ++KQ+  NL+P TYLFINRLGPDY
Sbjct: 85  HHSKIPYSDVCNIFSEIESTSSRLSIVKICSNFFYSVLKQNPSNLVPITYLFINRLGPDY 144

Query: 202 XXXXXXXXXXXXXMKTISETCGKSMSQIKLKYKDIGDLGEIAMGARNVQPTMFKPKPLTV 261
                        MKTI+E+CGKS+ Q++ KY++IGDLGE+A  AR VQPTMFKPKPLTV
Sbjct: 145 EPGLELGLGEGLLMKTIAESCGKSLQQVRAKYREIGDLGEVAQEARAVQPTMFKPKPLTV 204

Query: 262 GEVFKNLRAIAKTQGKDSQLKKMKLIKRMLTACKGIEAKFLIRSLESKLRIGLAEKTVLI 321
           GEVF NL++IAK+QGKDSQ +K++LIKRMLTAC+G+EAKFLIRSLESKLRIGLAEKTVLI
Sbjct: 205 GEVFNNLKSIAKSQGKDSQTRKIQLIKRMLTACQGVEAKFLIRSLESKLRIGLAEKTVLI 264

Query: 322 SLSKALLLHDENREDSPDKDVPMDVLESAQQKIRDAFCQVPNYEIVINSCLEHGIMNLDK 381
           SLSKALL ++ + E+        +++E+A+Q++RDAFCQVPNYEIVIN+CLEHGIM ++K
Sbjct: 265 SLSKALLSYEHDGEEPSS-----ELVENAEQRVRDAFCQVPNYEIVINTCLEHGIMEVNK 319

Query: 382 YCTLRPGIPLKPMLAKPTKAINEVLDRFQGETFTSEYKYDGERAQVHLLNDGTMRIYSRN 441
           +C L+PGIPLKPMLAKP+K+I EVLDRF GE FT EYKYDGERAQVHLL DG+M IYSRN
Sbjct: 320 HCVLKPGIPLKPMLAKPSKSITEVLDRFHGEKFTCEYKYDGERAQVHLLPDGSMNIYSRN 379

Query: 442 GENMTERYPEINITDFIQDLDTTKNLILDCEAVAWDKDQGKILPFQVLSTRKRKDVELND 501
           GENMTERYPE++I D++ D +TT +LILDCEAVAWD +QGKILPFQ+LSTRKRK VE  D
Sbjct: 380 GENMTERYPELHIRDYLADPETTHSLILDCEAVAWDTEQGKILPFQILSTRKRKGVEAKD 439

Query: 502 VKVKVCLFAFDILCYNDERLINKSLKERREYLTKVTKVVPGEFQYATQITTNNLDELQKF 561
           VKV+VCLFAFD+LCYN + LIN SL ERREYL +V K V G+FQ+A ++ ++NL+++QK+
Sbjct: 440 VKVRVCLFAFDMLCYNGQSLINNSLLERREYLQRVLKPVTGQFQFANELNSSNLEDVQKY 499

Query: 562 LDESVNHSCEGLMVKMLEGPESHYEPSKRSRNWLKLKKDYLEGVGDSLDLCVLXXXXXXX 621
           L++SV  +CEGLMVK+LEG ESHYEPSKRSRNWLKLKKDYL+GVGDSLDLCVL       
Sbjct: 500 LEQSVKDACEGLMVKVLEGEESHYEPSKRSRNWLKLKKDYLQGVGDSLDLCVLGAYYGRG 559

Query: 622 XXXXXXXXFLLGCYNQDTGEFETCCKIGTGFSDEMLQLLHDRLTPTIIDGPKATFVFDSS 681
                   FLLGCYNQDTGEFETCCKIGTGFSDEML  L+++L P+ ++ PKA +V+DSS
Sbjct: 560 KRTGTYGGFLLGCYNQDTGEFETCCKIGTGFSDEMLVSLYEKLKPSSLEQPKAFYVYDSS 619

Query: 682 AEPDVWFEPTTLFEVLTADLSLSPIYKAGSATFDKGVSLRFPRFLRIREDKGVEDATSSD 741
           AEPDVWFEPT LFEVLTADLSLSPIYKAG++ + KG+SLRFPRF+RIR+DK VEDATSS+
Sbjct: 620 AEPDVWFEPTMLFEVLTADLSLSPIYKAGNSAYGKGISLRFPRFIRIRDDKDVEDATSSE 679

Query: 742 QIVELYENQSHMQ 754
           QIVELYE+Q ++Q
Sbjct: 680 QIVELYESQVNLQ 692

>Kwal_56.24616 s56 (1076178..1078325) [2148 bp, 715 aa] {ON} YDL164C
           (CDC9) - DNA ligase [contig 161] FULL
          Length = 715

 Score =  898 bits (2320), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 441/719 (61%), Positives = 544/719 (75%), Gaps = 22/719 (3%)

Query: 38  QATLARFFTSMK--NKPTEG-TPSPKKSSKHMLEDRMDNVSGEEEYATKKLKQTAVTHTV 94
           QATLA+FF+S K  N   EG   S KKS  + ++ + ++  G +    +   +T     +
Sbjct: 15  QATLAKFFSSKKRSNDEKEGPQESAKKSQLNAIDAKPESSKGSQPNVDETNHETLQKPQL 74

Query: 95  AAPSSMGXXXXXXXXXXXXXGVADSPQQSQRLVGEVEDALSSNNNDHYSSNIPYSEVCEV 154
           +A                   +  +    ++  G+V     S   D   SN+ YSE+C V
Sbjct: 75  SAAEP-----------KTEFAMNPAKLAVEKSHGDVAKIGISAPKD---SNVMYSEMCSV 120

Query: 155 FNKIEAISSRLEIIRICSDFFIKIMKQSSKNLIPTTYLFINRLGPDYXXXXXXXXXXXXX 214
           FN+IE  SSRL+I+++CSDF   ++ ++ K+L+P TYL IN+LGPDY             
Sbjct: 121 FNEIEGTSSRLQIVKLCSDFLYSVLTKTRKDLVPITYLLINKLGPDYQPGLELGLGEGLL 180

Query: 215 MKTISETCGKSMSQIKLKYKDIGDLGEIAMGARNVQPTMFKPKPLTVGEVFKNLRAIAKT 274
           MKTISE+CGKS+ Q+K +Y+++GDLG IA  AR+VQPTMFKPKPLT G VF NL+ IA+ 
Sbjct: 181 MKTISESCGKSLQQVKARYRELGDLGRIAQEARSVQPTMFKPKPLTTGMVFANLQDIARA 240

Query: 275 QGKDSQLKKMKLIKRMLTACKGIEAKFLIRSLESKLRIGLAEKTVLISLSKALLLHDENR 334
           QGKDSQL+K++LIK+MLTAC+G+EAKFLIRSLESKLRIGLAEK+VL++LSKA+L H+   
Sbjct: 241 QGKDSQLRKVQLIKKMLTACEGVEAKFLIRSLESKLRIGLAEKSVLVALSKAILTHEHG- 299

Query: 335 EDSPDKDVPMDVLESAQQKIRDAFCQVPNYEIVINSCLEHGIMNLDKYCTLRPGIPLKPM 394
                K+   D++++A+QKIRDAFCQVPNYEIVIN+ LEHGIM L+K+C L PGIPLKPM
Sbjct: 300 ----GKEPSSDLVDAAEQKIRDAFCQVPNYEIVINAALEHGIMELEKHCVLTPGIPLKPM 355

Query: 395 LAKPTKAINEVLDRFQGETFTSEYKYDGERAQVHLLNDGTMRIYSRNGENMTERYPEINI 454
           LAKP+K+I+EVLDRFQG+ FT EYKYDGERAQVHLL DG+MRIYSRNGENMTERYPEINI
Sbjct: 356 LAKPSKSISEVLDRFQGQRFTCEYKYDGERAQVHLLPDGSMRIYSRNGENMTERYPEINI 415

Query: 455 TDFIQDLDTTKNLILDCEAVAWDKDQGKILPFQVLSTRKRKDVELNDVKVKVCLFAFDIL 514
           +DF+   D T  LILDCEAVAWDKD+  ILPFQVLSTRKRK V   DVKV+VCLFAFDIL
Sbjct: 416 SDFVAHPDETHTLILDCEAVAWDKDKNVILPFQVLSTRKRKGVVAEDVKVRVCLFAFDIL 475

Query: 515 CYNDERLINKSLKERREYLTKVTKVVPGEFQYATQITTNNLDELQKFLDESVNHSCEGLM 574
           CYNDE LINKSL ERR YL ++ K VPGE Q A+++TT +LDE+Q +LD+SV   CEGLM
Sbjct: 476 CYNDEPLINKSLAERRTYLERILKPVPGELQLASEVTTMSLDEMQLYLDQSVKDCCEGLM 535

Query: 575 VKMLEGPESHYEPSKRSRNWLKLKKDYLEGVGDSLDLCVLXXXXXXXXXXXXXXXFLLGC 634
           VK+L+G ESHYEPSKRSRNWLKLKKDYL+GVGDSLDLCVL               FLLGC
Sbjct: 536 VKVLDGEESHYEPSKRSRNWLKLKKDYLQGVGDSLDLCVLGAYYGRGKRTGTYGGFLLGC 595

Query: 635 YNQDTGEFETCCKIGTGFSDEMLQLLHDRLTPTIIDGPKATFVFDSSAEPDVWFEPTTLF 694
           YNQDTGEFETCCKIGTGFSDEMLQ L+++L+PT I  PKA +V+  SA+PDVW EP+ LF
Sbjct: 596 YNQDTGEFETCCKIGTGFSDEMLQNLYEKLSPTEIPEPKAFYVYSESAQPDVWLEPSMLF 655

Query: 695 EVLTADLSLSPIYKAGSATFDKGVSLRFPRFLRIREDKGVEDATSSDQIVELYENQSHM 753
           EVLTADLSLSP+YKAG +++ KG+SLRFPRF+RIR+DK VEDATSS+Q++E YE+QSH+
Sbjct: 656 EVLTADLSLSPVYKAGGSSYGKGISLRFPRFIRIRDDKSVEDATSSEQVIEFYESQSHI 714

>KLTH0H01408g Chr8 complement(129752..131923) [2172 bp, 723 aa] {ON}
           similar to uniprot|P04819 Saccharomyces cerevisiae
           YDL164C CDC9 DNA ligase found in the nucleus and
           mitochondria an essential enzyme that joins Okazaki
           fragments during DNA replication also acts in nucleotide
           excision repair base excision repair and recombination
          Length = 723

 Score =  879 bits (2270), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 417/639 (65%), Positives = 507/639 (79%), Gaps = 6/639 (0%)

Query: 116 VADSPQQSQRLVGEVE-DALSSNNNDHYSSNIPYSEVCEVFNKIEAISSRLEIIRICSDF 174
           + DS + ++R V   + D      +    S I Y+E+C VFN+IE  SSRL+I+++C DF
Sbjct: 89  LPDSDEPAKRAVAATKGDPAKLGASAPKDSKILYAEMCNVFNEIEGTSSRLQIVKLCGDF 148

Query: 175 FIKIMKQSSKNLIPTTYLFINRLGPDYXXXXXXXXXXXXXMKTISETCGKSMSQIKLKYK 234
              ++ ++ K+++P TYL IN+LGPDY             MKTISE+CGKS+ QIK +Y+
Sbjct: 149 LYSVLLKARKDIVPITYLLINKLGPDYQPGLELGLGEGLLMKTISESCGKSLQQIKARYR 208

Query: 235 DIGDLGEIAMGARNVQPTMFKPKPLTVGEVFKNLRAIAKTQGKDSQLKKMKLIKRMLTAC 294
           ++GDLG IA  AR VQPTMFKPKPLT GEVF NL+AIA++QGKDSQL+K++LIKRMLTAC
Sbjct: 209 ELGDLGRIAQEARAVQPTMFKPKPLTTGEVFSNLQAIARSQGKDSQLRKVQLIKRMLTAC 268

Query: 295 KGIEAKFLIRSLESKLRIGLAEKTVLISLSKALLLHDENREDSPDKDVPMDVLESAQQKI 354
           +G+EAKFLIRSLESKLRIGLAEK+VL++LSKALL ++ N      K+   +++++A+QKI
Sbjct: 269 QGLEAKFLIRSLESKLRIGLAEKSVLVALSKALLTYEHN-----GKEPSSELVDTAEQKI 323

Query: 355 RDAFCQVPNYEIVINSCLEHGIMNLDKYCTLRPGIPLKPMLAKPTKAINEVLDRFQGETF 414
           RDAFCQVPNY+IVI + LEHGIM LDK+C L PGIPLKPMLAKP+K+I+EVLDRFQG+ F
Sbjct: 324 RDAFCQVPNYQIVIETALEHGIMELDKHCVLTPGIPLKPMLAKPSKSISEVLDRFQGQRF 383

Query: 415 TSEYKYDGERAQVHLLNDGTMRIYSRNGENMTERYPEINITDFIQDLDTTKNLILDCEAV 474
           T EYKYDGERAQVHLL DG+MRIYSRNGENMTERYPEI I+DFI D   T  LILDCEAV
Sbjct: 384 TCEYKYDGERAQVHLLPDGSMRIYSRNGENMTERYPEIRISDFIADPARTHTLILDCEAV 443

Query: 475 AWDKDQGKILPFQVLSTRKRKDVELNDVKVKVCLFAFDILCYNDERLINKSLKERREYLT 534
           AWDK++  ILPFQVLSTRKRK V + DVKV+VCLFAFDILCYNDE LI + L ERR  L 
Sbjct: 444 AWDKEKNTILPFQVLSTRKRKGVAVEDVKVRVCLFAFDILCYNDEPLITRPLAERRACLE 503

Query: 535 KVTKVVPGEFQYATQITTNNLDELQKFLDESVNHSCEGLMVKMLEGPESHYEPSKRSRNW 594
           +    VPGE Q A+++TT +LDELQ +LD++V   CEGLMVK+LEG ESHYEPSKRSRNW
Sbjct: 504 RALVPVPGELQLASEVTTMSLDELQHYLDQAVRDCCEGLMVKILEGEESHYEPSKRSRNW 563

Query: 595 LKLKKDYLEGVGDSLDLCVLXXXXXXXXXXXXXXXFLLGCYNQDTGEFETCCKIGTGFSD 654
           LKLKKDYL+GVGDSLDLCVL               FLLGCYNQD+GE+ETCCKIGTGFS+
Sbjct: 564 LKLKKDYLQGVGDSLDLCVLGAYYGRGKRTGTYGGFLLGCYNQDSGEYETCCKIGTGFSE 623

Query: 655 EMLQLLHDRLTPTIIDGPKATFVFDSSAEPDVWFEPTTLFEVLTADLSLSPIYKAGSATF 714
           EMLQ L DRL+PT I  PKA +V   SA PDVWFEPT LFEVLTADLSLSP+YKAG++++
Sbjct: 624 EMLQTLFDRLSPTAIPTPKAFYVHSESAPPDVWFEPTLLFEVLTADLSLSPVYKAGTSSY 683

Query: 715 DKGVSLRFPRFLRIREDKGVEDATSSDQIVELYENQSHM 753
            KG+SLRFPRF+R+R+DK  E+ATSS+Q+VE YE+QSH+
Sbjct: 684 GKGISLRFPRFIRLRDDKTPEEATSSEQVVEFYESQSHV 722

>TPHA0D04570 Chr4 (996539..998749) [2211 bp, 736 aa] {ON} Anc_7.343
           YDL164C
          Length = 736

 Score =  859 bits (2219), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 443/736 (60%), Positives = 528/736 (71%), Gaps = 64/736 (8%)

Query: 38  QATLARFFTSMKNKPTEGTPSPKKSSKHMLEDRMDNVSGEEEYATKKLKQTAVTHTVAAP 97
           QATLARFFTSM  K     P+ + ++K             E +  KK K           
Sbjct: 47  QATLARFFTSMGKKTP---PAVEVATKQ---------ESPENHVDKKRK----------- 83

Query: 98  SSMGXXXXXXXXXXXXXGVADSPQQSQRLVGEVEDALSSNNNDHYSSNIPYSEVCEVFNK 157
                             V   P QS   VG  E A S    D   S + YSEVC +F +
Sbjct: 84  ------------------VEVHPSQS---VGASEKAESPP--DQTKSTVLYSEVCNLFQQ 120

Query: 158 IEAISSRLEIIRICSDFFIKIMKQSSKNLIPTTYLFINRLGPDYXXXXXXXXXXXXXMKT 217
           IE  SSRL II++CS+FFI+++K +  ++I   YLFINRLGPDY             +KT
Sbjct: 121 IEETSSRLAIIKLCSEFFIRVIKNNPSDIIIVAYLFINRLGPDYEPGLELGLGENLLIKT 180

Query: 218 ISETCGKSMSQIKLKYKDIGDLGEIAMGARNVQPTMFKPKPLTVGEVFKNLRAIAKTQGK 277
           ISE  GKS+ QIKL+ K+ GDLG IA  ARN+QPTMFKPKPLT+ +VF NL+ IA   GK
Sbjct: 181 ISEAYGKSIKQIKLELKETGDLGTIARDARNIQPTMFKPKPLTISDVFNNLKKIASATGK 240

Query: 278 DSQLKKMKLIKRMLTACKGIEAKFLIRSLESKLRIGLAEKTVLISLSKALLLHDENREDS 337
           DSQL+K+KLIK+ML+A KG+EAKFLIRSLESKLRIGLAEKTVLISLSKALLLH+  +E  
Sbjct: 241 DSQLRKIKLIKQMLSASKGLEAKFLIRSLESKLRIGLAEKTVLISLSKALLLHEHWKEKG 300

Query: 338 PDK----DV-PMDVLESAQQKIRDAFCQVPNYEIVINSCLEHGIMNLDKYCTLRPGIPLK 392
             K    DV  MD++E A+ K+R+A CQVPNYEIVIN CL+ GI+N+DK CTLRPGIPLK
Sbjct: 301 ESKFDEEDVESMDLIEQAEAKLREAHCQVPNYEIVINLCLQDGILNIDKTCTLRPGIPLK 360

Query: 393 PMLAKPTKAINEVLDRFQGETFTSEYKYDGERAQVHLLNDGTMRIYSRNGENMTERYPEI 452
           PMLAKPTKAI EVL+ FQG+ F SEYKYDGERAQVHLL  G MRIYSRNGENMTERYPE+
Sbjct: 361 PMLAKPTKAITEVLNAFQGKEFISEYKYDGERAQVHLLEGGEMRIYSRNGENMTERYPEL 420

Query: 453 NITDFI-------------QDLDTTKNLILDCEAVAWDKDQGKILPFQVLSTRKRKDVEL 499
           ++ DF+               +   K++ILDCE VAWD +Q KILPFQVL+TRKRK+V+L
Sbjct: 421 DVKDFLCVVKAITNDQEGENAIQPVKDIILDCEVVAWDVEQKKILPFQVLTTRKRKNVDL 480

Query: 500 NDVKVKVCLFAFDILCYNDERLINKSLKERREYLTKVTKVVPGEFQYATQITTNNLDELQ 559
            DVKV+VCLFAFD+L  N+E +INKSL+ER+E L KVT +VPGEFQYAT + T+++DELQ
Sbjct: 481 KDVKVRVCLFAFDLLYLNNEGMINKSLRERQEILRKVTVLVPGEFQYATSLITSDMDELQ 540

Query: 560 KFLDESVNHSCEGLMVKMLEGPESHYEPSKRSRNWLKLKKDYLEGVGDSLDLCVLXXXXX 619
            FLD++V +SCEGLMVKML+G ESHYEPSKRSRNWLKLKKDYL+GVGDSLDL V+     
Sbjct: 541 TFLDQAVKNSCEGLMVKMLDGEESHYEPSKRSRNWLKLKKDYLDGVGDSLDLVVMGAYFG 600

Query: 620 XXXXXXXXXXFLLGCYNQDTGEFETCCKIGTGFSDEMLQLLHDRLTPTIIDGPKATFVFD 679
                     FLLGCYN+DT EFETCCKIGTGFSDEML  LH  L PT ID P  T+++D
Sbjct: 601 KGKRTGSYGGFLLGCYNEDTQEFETCCKIGTGFSDEMLGNLHTLLQPTEIDNPPMTYIYD 660

Query: 680 SSAEPDVWFEPTTLFEVLTADLSLSPIYKAGSATFDKGVSLRFPRFLRIREDKGVEDATS 739
           SSAEPDVWF+   LFEVLTADLSLSP+YKAG++ +DKG+SLRFPRFLRIREDK V D T+
Sbjct: 661 SSAEPDVWFQAKVLFEVLTADLSLSPVYKAGNSRYDKGISLRFPRFLRIREDKDVTDGTT 720

Query: 740 SDQIVELYENQSHMQN 755
           S+ I+E YE+QSH+QN
Sbjct: 721 SEDIIEFYESQSHIQN 736

>KLLA0D12496g Chr4 complement(1059684..1061786) [2103 bp, 700 aa]
           {ON} similar to uniprot|P04819 Saccharomyces cerevisiae
           YDL164C CDC9 DNA ligase found in the nucleus and
           mitochondria an essential enzyme that joins Okazaki
           fragments during DNA replication also acts in nucleotide
           excision repair base excision repair and recombination,
          Length = 700

 Score =  848 bits (2191), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 404/613 (65%), Positives = 484/613 (78%), Gaps = 5/613 (0%)

Query: 142 YSSNIPYSEVCEVFNKIEAISSRLEIIRICSDFFIKIMKQSSKNLIPTTYLFINRLGPDY 201
           + SNIP++E+C+ F  IE  SSRL I  ICS F   ++++  ++L+P TYLFI++LGPDY
Sbjct: 93  FHSNIPFAELCDTFQAIEVTSSRLAITAICSKFLYSVLERDPESLVPITYLFIHKLGPDY 152

Query: 202 XXXXXXXXXXXXXMKTISETCGKSMSQIKLKYKDIGDLGEIAMGARNVQPTMFKPKPLTV 261
                        +KTISE CGKS+ QI+ KY++IGDLGEIAM ARNVQPTMFKPKPLTV
Sbjct: 153 EPGLELGLGESLLIKTISEACGKSIQQIRNKYREIGDLGEIAMQARNVQPTMFKPKPLTV 212

Query: 262 GEVFKNLRAIAKTQGKDSQLKKMKLIKRMLTACKGIEAKFLIRSLESKLRIGLAEKTVLI 321
           GEVF NL +IAK+ GKDSQ +K  LIK+MLTACKG EAKFLIRSLESKLRIGLAEKTVLI
Sbjct: 213 GEVFNNLVSIAKSNGKDSQSRKGSLIKKMLTACKGYEAKFLIRSLESKLRIGLAEKTVLI 272

Query: 322 SLSKALLLHDENREDSPDKDVPMDVLESAQQKIRDAFCQVPNYEIVINSCLEHGIMNLDK 381
           S+SKA+L H+ N ++        +++E A+  IRDAFCQVPNYE++IN  L++GIMNL++
Sbjct: 273 SVSKAILTHEHNGQEPS-----TEMVEQAESLIRDAFCQVPNYEMIINVALQYGIMNLNQ 327

Query: 382 YCTLRPGIPLKPMLAKPTKAINEVLDRFQGETFTSEYKYDGERAQVHLLNDGTMRIYSRN 441
           +  LRPGIPL+PMLAKPTK+I+EVLDRFQG  FT EYKYDGERAQVHL  DG+M+IYSRN
Sbjct: 328 HIKLRPGIPLQPMLAKPTKSISEVLDRFQGTKFTCEYKYDGERAQVHLCRDGSMKIYSRN 387

Query: 442 GENMTERYPEINITDFIQDLDTTKNLILDCEAVAWDKDQGKILPFQVLSTRKRKDVELND 501
           GE+MTERYPEI++  +++DL  TK+ I+D EAVAWD++QGKILPFQVLSTRKRK VEL D
Sbjct: 388 GEDMTERYPEIDVKHYVKDLGATKSFIVDSEAVAWDQEQGKILPFQVLSTRKRKGVELKD 447

Query: 502 VKVKVCLFAFDILCYNDERLINKSLKERREYLTKVTKVVPGEFQYATQITTNNLDELQKF 561
           VKV+VCL+AFDILC NDE LINKS  ERR+ L        G+F +A ++TT N DELQK+
Sbjct: 448 VKVRVCLYAFDILCLNDEPLINKSFHERRQILLDTFNGTQGQFDFANELTTTNFDELQKY 507

Query: 562 LDESVNHSCEGLMVKMLEGPESHYEPSKRSRNWLKLKKDYLEGVGDSLDLCVLXXXXXXX 621
           LD+SV  SCEGLMVKMLEG ESHYEPSKRSRNWLKLKKDYLEGVGDSLDL VL       
Sbjct: 508 LDQSVKDSCEGLMVKMLEGEESHYEPSKRSRNWLKLKKDYLEGVGDSLDLVVLGAYYGRG 567

Query: 622 XXXXXXXXFLLGCYNQDTGEFETCCKIGTGFSDEMLQLLHDRLTPTIIDGPKATFVFDSS 681
                   FLLGCYN D+ EFETCCKIGTGFSDEMLQ L+ +L  T ++ P    ++DSS
Sbjct: 568 KRTGTYGGFLLGCYNLDSEEFETCCKIGTGFSDEMLQDLYTKLKDTTVEHPSTNVIYDSS 627

Query: 682 AEPDVWFEPTTLFEVLTADLSLSPIYKAGSATFDKGVSLRFPRFLRIREDKGVEDATSSD 741
           A  DVWFEP+ LFEVLTADLSLSP+YKAG   F KG+SLRFPRF+RIR+DK V DATSSD
Sbjct: 628 APADVWFEPSMLFEVLTADLSLSPVYKAGFEAFGKGISLRFPRFVRIRDDKNVTDATSSD 687

Query: 742 QIVELYENQSHMQ 754
           Q++E YE+Q+HM+
Sbjct: 688 QVIEFYESQAHMK 700

>ACL155W Chr3 (81492..83585) [2094 bp, 697 aa] {ON} Syntenic homolog
           of Saccharomyces cerevisiae YDL164C (CDC9)
          Length = 697

 Score =  824 bits (2128), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 413/719 (57%), Positives = 510/719 (70%), Gaps = 35/719 (4%)

Query: 38  QATLARFFTSMKNKPTEGTPSPKKSSKHMLEDRMDNVSGEEEYATKKLKQTAVTHTVAAP 97
           QATL RFFT++K +P +G  +                      AT K  +      +AAP
Sbjct: 7   QATLGRFFTALK-RPQDGATAA---------------------ATVKKSKVEAAECLAAP 44

Query: 98  SSMGXXXXXXXXXXXXXGVADSPQQSQRL---VGEVEDALSSNNNDHYSSNIPYSEVCEV 154
           +                 +AD P     L      V  A SS      S+++ Y+++C V
Sbjct: 45  AG---HEQDAEVKNSLPELADKPAPGGVLPQAASAVPRAQSSPVKPAASTSVMYADLCAV 101

Query: 155 FNKIEAISSRLEIIRICSDFFIKIMKQSSKNLIPTTYLFINRLGPDYXXXXXXXXXXXXX 214
           F  +EA SSRL I ++C+DF   ++K    +LIP TYLFINRLGPDY             
Sbjct: 102 FEAVEATSSRLSITKLCADFMYSVLKCDPGHLIPVTYLFINRLGPDYEPGLELGLGEGIL 161

Query: 215 MKTISETCGKSMSQIKLKYKDIGDLGEIAMGARNVQPTMFKPKPLTVGEVFKNLRAIAKT 274
           +KTIS+ CGKS +Q++  Y++ GDLG +A  AR VQPTMFKPKPLTV +VF  L+AIA+ 
Sbjct: 162 IKTISDACGKSAAQVRSSYRECGDLGTVAQQARVVQPTMFKPKPLTVRDVFSTLQAIAQA 221

Query: 275 QGKDSQLKKMKLIKRMLTACKGIEAKFLIRSLESKLRIGLAEKTVLISLSKALLLHD-EN 333
           +GKDSQ KK++LIK+MLTAC+G+EAK+LIRSLESKLRIGLAEKTVL++LSKA+L H+ + 
Sbjct: 222 EGKDSQGKKIRLIKKMLTACQGMEAKYLIRSLESKLRIGLAEKTVLVALSKAILTHEHDG 281

Query: 334 REDSPDKDVPMDVLESAQQKIRDAFCQVPNYEIVINSCLEHGIMNLDKYCTLRPGIPLKP 393
           +E SP++      +++A+  +RD FCQVPNYE++IN+ L++GIMNL ++C L PGIPLKP
Sbjct: 282 KEPSPEQ------VDAAEALVRDTFCQVPNYEMIINAALQYGIMNLPQHCVLTPGIPLKP 335

Query: 394 MLAKPTKAINEVLDRFQGETFTSEYKYDGERAQVHLLNDGTMRIYSRNGENMTERYPEIN 453
           MLAKPTK+I EVLDRFQG+ FT EYKYDGERAQVHL+ DGT+RIYSRN ENMTERYPEI 
Sbjct: 336 MLAKPTKSITEVLDRFQGQRFTCEYKYDGERAQVHLMEDGTIRIYSRNSENMTERYPEIQ 395

Query: 454 ITDFIQDLDTTKNLILDCEAVAWDKDQGKILPFQVLSTRKRKDVELNDVKVKVCLFAFDI 513
              F+ +  TT++LI+DCEAVAWD ++ KILPFQVLSTRKRK VEL DVKV+VCLFAFD+
Sbjct: 396 FHQFLANPQTTRSLIIDCEAVAWDNEKQKILPFQVLSTRKRKGVELKDVKVRVCLFAFDL 455

Query: 514 LCYNDERLINKSLKERREYLTKVTKVVPGEFQYATQITTNNLDELQKFLDESVNHSCEGL 573
           L  N E L+  SL +RR++L  V KVVPGE Q+A +ITT  L ELQ +L++SV+ SCEGL
Sbjct: 456 LYLNGESLLKCSLADRRKHLYSVLKVVPGELQFANEITTMELSELQTYLEQSVSASCEGL 515

Query: 574 MVKMLEGPESHYEPSKRSRNWLKLKKDYLEGVGDSLDLCVLXXXXXXXXXXXXXXXFLLG 633
           MVKML+G ES YEPSKRSRNWLKLKKDYLEGVGDSLDL VL               FLLG
Sbjct: 516 MVKMLDGEESQYEPSKRSRNWLKLKKDYLEGVGDSLDLAVLGAYYGRGKRTGTYGGFLLG 575

Query: 634 CYNQDTGEFETCCKIGTGFSDEMLQLLHDRLTPTIIDGPKATFVFDSSAEPDVWFEPTTL 693
           CYN D  EFETCCKIGTGFS+E+LQ LH +L  T+I  P+    +D S+ PDVWFEP  L
Sbjct: 576 CYNPDLEEFETCCKIGTGFSEEVLQSLHAQLKDTVIAAPRGDVSYDDSSPPDVWFEPAML 635

Query: 694 FEVLTADLSLSPIYKAGSATFDKGVSLRFPRFLRIREDKGVEDATSSDQIVELYENQSH 752
           FEVLTADLSLSP+YKAG   + KG+SLRFPRFLRIREDK V DATSSDQIVE Y+ Q++
Sbjct: 636 FEVLTADLSLSPVYKAGRDVYGKGISLRFPRFLRIREDKSVTDATSSDQIVEFYQRQAN 694

>TBLA0E02050 Chr5 (498038..500200) [2163 bp, 720 aa] {ON} Anc_7.343
           YDL164C
          Length = 720

 Score =  798 bits (2062), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 380/615 (61%), Positives = 479/615 (77%), Gaps = 8/615 (1%)

Query: 143 SSNIPYSEVCEVFNKIEAISSRLEIIRICSDFFIKIMKQSSKNLIPTTYLFINRLGPDYX 202
           +S++PY+++C++F  IE+ SSRL I  +C+ FF + ++     L+P TYL IN+LGPDY 
Sbjct: 112 TSSLPYADLCQLFETIESESSRLTITNLCTAFFSRTLQLDPSLLVPVTYLCINKLGPDYS 171

Query: 203 XXXXXXXXXXXXMKTISETCGKSMSQIKLKYKDIGDLGEIAMGARNVQPT--MFKPKPLT 260
                       +K I   CG S  Q+KL+Y+ +GDLG++AM  R +QPT  MFK +PLT
Sbjct: 172 GVELGLGEGLL-LKAIGSACGVSQQQLKLQYRKLGDLGQLAMSTRVLQPTITMFKLEPLT 230

Query: 261 VGEVFKNLRAIAKTQGKDSQLKKMKLIKRMLTACKGIEAKFLIRSLESKLRIGLAEKTVL 320
           + +VF  L  IA +QGKDSQ +K+ +IKR+LT+C+G+EAKFLIRSLESKLRIGLAEKTVL
Sbjct: 231 ITKVFDTLAKIAASQGKDSQNQKINMIKRLLTSCQGVEAKFLIRSLESKLRIGLAEKTVL 290

Query: 321 ISLSKALLLHDENREDSPDKDVPMDVLESAQQKIRDAFCQVPNYEIVINSCLEHGIMNLD 380
            SL++AL++H++  ++  D D       +A+Q I+D+FCQ+PNYEI+I + L++G+  L 
Sbjct: 291 TSLARALVIHEKGNDNIQDDDY-----SNAEQIIKDSFCQIPNYEIIITTSLQYGVSQLA 345

Query: 381 KYCTLRPGIPLKPMLAKPTKAINEVLDRFQGETFTSEYKYDGERAQVHLLNDGTMRIYSR 440
            +  L PGIPLKPMLAKPTK+I+EVLD FQ   FTSEYKYDGERAQVHLL DG+MRIYSR
Sbjct: 346 SHIKLTPGIPLKPMLAKPTKSISEVLDTFQNIQFTSEYKYDGERAQVHLLPDGSMRIYSR 405

Query: 441 NGENMTERYPEINITDFIQDLDTTKNLILDCEAVAWDKDQGKILPFQVLSTRKRKDVELN 500
           NGE+MT+RYPE+NI D++ D  TT  LILDCEAVAWD +  KILPFQVLSTRKRK V+L 
Sbjct: 406 NGEDMTQRYPELNIQDYLVDSTTTTQLILDCEAVAWDVELQKILPFQVLSTRKRKSVDLK 465

Query: 501 DVKVKVCLFAFDILCYNDERLINKSLKERREYLTKVTKVVPGEFQYATQITTNNLDELQK 560
           D+KV+VCLFAFDIL +N++ LIN +L+ERR+ L  +TK  PG+FQ+AT++TT+NLDELQ 
Sbjct: 466 DIKVRVCLFAFDILRHNNDSLINNTLRERRDILHSITKPCPGQFQFATELTTSNLDELQT 525

Query: 561 FLDESVNHSCEGLMVKMLEGPESHYEPSKRSRNWLKLKKDYLEGVGDSLDLCVLXXXXXX 620
           FLD+++  SCEGLMVK L+G +SHYEPSKRSRNWLKLKKDYL+G+GDSLDLCVL      
Sbjct: 526 FLDKAIKDSCEGLMVKSLDGTDSHYEPSKRSRNWLKLKKDYLQGMGDSLDLCVLGAYYGR 585

Query: 621 XXXXXXXXXFLLGCYNQDTGEFETCCKIGTGFSDEMLQLLHDRLTPTIIDGPKATFVFDS 680
                    FLL CYNQDT EFETCCKIGTGFSDEMLQ L++ L  T I+ P+A FVFDS
Sbjct: 586 GKRTGTYGGFLLACYNQDTEEFETCCKIGTGFSDEMLQTLYNGLKETAIESPRANFVFDS 645

Query: 681 SAEPDVWFEPTTLFEVLTADLSLSPIYKAGSATFDKGVSLRFPRFLRIREDKGVEDATSS 740
           SAEPDVWF PT +FEVLTADLSLSPIYKAGS  + KG+SLRFPRF+RIR DK V DATSS
Sbjct: 646 SAEPDVWFNPTMVFEVLTADLSLSPIYKAGSTVYGKGISLRFPRFIRIRTDKSVNDATSS 705

Query: 741 DQIVELYENQSHMQN 755
           +Q+++ YENQSH+Q+
Sbjct: 706 EQVIDFYENQSHLQS 720

>TPHA0M00260 Chr13 complement(50326..53226) [2901 bp, 966 aa] {ON}
           Anc_6.18 YOR005C
          Length = 966

 Score =  104 bits (260), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 68/232 (29%), Positives = 120/232 (51%), Gaps = 11/232 (4%)

Query: 391 LKPMLAKPTKAINEVLDRFQGETFTSEYKYDGERAQVHLLNDG-TMRIYSRNGENMTERY 449
            +P LAK      EVL R     FT E K DGER Q+H ++ G  ++ +SR G + T  Y
Sbjct: 264 FEPQLAKKVNLSYEVLSRRMNNKFTIEEKMDGERIQIHYMDYGHQIKYFSRRGNDYTYLY 323

Query: 450 PE----INITDFIQDLDTTKNLILDCEAVAWDKDQGKILPFQVLSTRKRKDVELNDVKVK 505
            +      I+ ++Q  +  K  ILD E V++DK +  ILPF ++ +     ++++ ++  
Sbjct: 324 GKDKSTATISKYLQLNEDVKECILDGEMVSYDKSRNCILPFGMVKSGAANSLKIDGLEND 383

Query: 506 VC---LFAFDILCYNDERLINKSLKERREYLTKVTKVVPGEFQYATQITTNNLDELQKFL 562
           +C      FD+L  N   L N  L +R+EYL+ +        +       ++ + ++  L
Sbjct: 384 LCSPLFIVFDVLFLNGSPLTNLPLYQRKEYLSNILTPKKSHIEILKFSIAHDSESIRSAL 443

Query: 563 DESVNHSCEGLMVKMLEGPESHYEPSKRSRNWLKLKKDYLEGVGDSLDLCVL 614
             +++   EG+++K     +S Y    R+ +W+K+K +YLE  G++LDL V+
Sbjct: 444 QAAISVGSEGIVLKKY---DSLYSVGDRNNDWIKVKPEYLEQFGENLDLIVI 492

>ACR008W Chr3 (368913..371858) [2946 bp, 981 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YOR005C (DNL4)
          Length = 981

 Score =  104 bits (259), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 103/405 (25%), Positives = 168/405 (41%), Gaps = 66/405 (16%)

Query: 384 TLRPGIPLKPMLAKPTKAINEVLDRFQGETFTSEYKYDGERAQVHLLNDG-TMRIYSRNG 442
           ++R G    P +A+  K   E +    G  F  E K DG+R QVH ++ G ++  +SRNG
Sbjct: 287 SVRIGYAFAPHMAQRVKIPYEKVSTKLGNDFYVEEKMDGDRIQVHYMDYGNSIAYFSRNG 346

Query: 443 ENMTERYPEIN----ITDFIQDLDTTKNLILDCEAVAWDKDQGKILPFQVLSTRKRKDVE 498
            N T  Y E +    I++ ++ ++  K  ILD E V++DK+   ILPF +  +     V 
Sbjct: 347 INYTYLYGENSSKGSISNHLKFVEGVKECILDGEMVSYDKEMQCILPFGLTKSGASHQVN 406

Query: 499 L-----NDVKVKVCLFAFDILCYNDERLINKSLKERREYLTKVTKVVPGEFQYATQITTN 553
                  +   +     FD+L  N + L N+ + +R+EYL K+           +    +
Sbjct: 407 FETTGHTEPTYRPLYAVFDLLYLNGQLLTNQDVVKRKEYLEKILIPSKNVVHLLSGPRCS 466

Query: 554 NLDELQKFLDESVNHSCEGLMVKMLEGPESHYEPSKRSRNWLKLKKDYLEGVGDSLDLCV 613
           + + +   L  +V H  EG+++K      S Y   KR  +W+K+K +YLE  G+++DL V
Sbjct: 467 DAEAITAALGAAVAHGSEGIVLKK---ARSKYSVGKRDDSWIKIKPEYLENFGENMDLVV 523

Query: 614 LXXXXXXXXXXXXXXXFLLGCYNQDTGE----------------------------FETC 645
           +               F+      D  E                            F + 
Sbjct: 524 I------GRDKGRKDSFICALAVTDDSEKNNPSSYESGSDSDSDSEPIIVQPKIEKFISF 577

Query: 646 CKIGTGFSDEMLQLLHDRLT-----PTIIDGPKATFVFDSSAEPDVWFEP--TTLFEVLT 698
           C I  G S+E  + + DRLT     P     P   +V   +  P  W +P  + + EV  
Sbjct: 578 CSIANGISNEEFKEI-DRLTRGNWFPYDERKPPTDWVEFGTKTPREWIDPKNSVVLEVKA 636

Query: 699 ADL----SLSPIYKAGSATFDKGVSLRFPRFLRIREDKGVEDATS 739
             +    S S +YK GS  ++           RIR DK    A++
Sbjct: 637 RSIDNEESKSDLYKTGSTLYNAYCK-------RIRHDKNWSTAST 674

>Smik_15.174 Chr15 complement(301851..304688) [2838 bp, 945 aa] {ON}
           YOR005C (REAL)
          Length = 945

 Score =  103 bits (257), Expect = 5e-22,   Method: Compositional matrix adjust.
 Identities = 71/239 (29%), Positives = 115/239 (48%), Gaps = 11/239 (4%)

Query: 384 TLRPGIPLKPMLAKPTKAINEVLDRFQGETFTSEYKYDGERAQVHLLNDG-TMRIYSRNG 442
           T++ G    P LAK      E + R     F  E K DGER QVH +N G ++R YSR G
Sbjct: 247 TIKVGFAFAPQLAKKVNLPYEKICRALHNDFLVEEKMDGERIQVHYMNYGKSVRFYSRRG 306

Query: 443 ENMTERY----PEINITDFIQDLDTTKNLILDCEAVAWDKDQGKILPFQVLSTRKRKDVE 498
            + T  Y        I+  +   D  +  +LD E V +D  +  ILPF ++    +  + 
Sbjct: 307 IDYTYLYGASLSSGTISHHLDFTDNVRECVLDGEMVTFDARRKVILPFGLVKGSAKDALS 366

Query: 499 ---LNDVKVKVCLFAFDILCYNDERLINKSLKERREYLTKVTKVVPGEFQYATQITTNNL 555
              +N+V        FD+L  N   L    L +R+EYL  +   V    +        N+
Sbjct: 367 FNSINNVDFHPLYVVFDLLYLNGTSLTPLPLHQRKEYLESILTPVKNVVEMVRTSRCYNV 426

Query: 556 DELQKFLDESVNHSCEGLMVKMLEGPESHYEPSKRSRNWLKLKKDYLEGVGDSLDLCVL 614
           + ++K L+ +++   EG+++K      S Y  + R+ NW+K+K +YLE  G++LDL ++
Sbjct: 427 ESIKKSLEVAISLGSEGVVLKYYN---SSYNVASRNNNWIKVKPEYLEEFGENLDLVII 482

>KNAG0F02870 Chr6 (543177..546041) [2865 bp, 954 aa] {ON} Anc_6.18
           YOR005C
          Length = 954

 Score = 99.8 bits (247), Expect = 8e-21,   Method: Compositional matrix adjust.
 Identities = 72/267 (26%), Positives = 131/267 (49%), Gaps = 11/267 (4%)

Query: 356 DAFCQVPNYEIVINSCLEHGIMNLDKYCTLRPGIPLKPMLAKPTKAINEVLDRFQGETFT 415
           D F  V +   V     E  +   ++  TL+ G    P LAK      E + +  G  F+
Sbjct: 220 DYFSVVSDLSSVTKKLYEPSVRLRNEDLTLKIGSAFAPHLAKRLNISYEKILKKLGSDFS 279

Query: 416 SEYKYDGERAQVHLLNDGT-MRIYSRNGENMTERY----PEINITDFIQDLDTTKNLILD 470
            E K DGER Q+H ++ G  ++  SR G + T  Y        I  +++  +  K  ILD
Sbjct: 280 IEEKMDGERIQIHYMDYGNEIKFLSRRGTDYTYLYGGDTSTGTIACYLKLNENVKECILD 339

Query: 471 CEAVAWDKDQGKILPFQVLSTRKRKDVE---LNDVKVKVCLFAFDILCYNDERLINKSLK 527
            E V +D+++  ILPF ++ +  +  +    +++        AFD++  N   L++  L 
Sbjct: 340 GEMVTYDQEKQMILPFGLVKSSAKNFLSKESISNGSYHPLFMAFDLVYLNGTSLVDLPLY 399

Query: 528 ERREYLTKVTKVVPGEFQYATQITTNNLDELQKFLDESVNHSCEGLMVKMLEGPESHYEP 587
           +R++YL+K+     G     +    NNL+ + K L  +++   EG+++K L    S Y  
Sbjct: 400 QRKDYLSKILTKCNGFVDIVSFARCNNLESITKSLAAAISVGSEGIILKKL---NSRYMV 456

Query: 588 SKRSRNWLKLKKDYLEGVGDSLDLCVL 614
           + R+ +W+K+K  YL+  G+++DL ++
Sbjct: 457 ASRNDSWIKIKPQYLKQFGENMDLIII 483

>YOR005C Chr15 complement(334509..337343) [2835 bp, 944 aa] {ON}
           DNL4DNA ligase required for nonhomologous end-joining
           (NHEJ), forms stable heterodimer with required cofactor
           Lif1p, interacts with Nej1p; involved in meiosis, not
           essential for vegetative growth
          Length = 944

 Score = 99.4 bits (246), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 70/268 (26%), Positives = 129/268 (48%), Gaps = 11/268 (4%)

Query: 355 RDAFCQVPNYEIVINSCLEHGIMNLDKYCTLRPGIPLKPMLAKPTKAINEVLDRFQGETF 414
           +D    + + ++V +   +  +   D   +++ G    P LAK      E + R   + F
Sbjct: 218 QDYLSVISDLKVVTSKLYDPKVRLKDDDLSIKVGFAFAPQLAKKVNLSYEKICRTLHDDF 277

Query: 415 TSEYKYDGERAQVHLLNDG-TMRIYSRNGENMTERY----PEINITDFIQDLDTTKNLIL 469
             E K DGER QVH +N G +++ +SR G + T  Y        I+  ++  D+ K  +L
Sbjct: 278 LVEEKMDGERIQVHYMNYGESIKFFSRRGIDYTYLYGASLSSGTISQHLRFTDSVKECVL 337

Query: 470 DCEAVAWDKDQGKILPFQVLSTRKRKDV---ELNDVKVKVCLFAFDILCYNDERLINKSL 526
           D E V +D  +  ILPF ++    ++ +    +N+V        FD+L  N   L    L
Sbjct: 338 DGEMVTFDAKRRVILPFGLVKGSAKEALSFNSINNVDFHPLYMVFDLLYLNGTSLTPLPL 397

Query: 527 KERREYLTKVTKVVPGEFQYATQITTNNLDELQKFLDESVNHSCEGLMVKMLEGPESHYE 586
            +R++YL  +   +    +         ++ ++K L+ +++   EG+++K      S Y 
Sbjct: 398 HQRKQYLNSILSPLKNIVEIVRSSRCYGVESIKKSLEVAISLGSEGVVLKYY---NSSYN 454

Query: 587 PSKRSRNWLKLKKDYLEGVGDSLDLCVL 614
            + R+ NW+K+K +YLE  G++LDL V+
Sbjct: 455 VASRNNNWIKVKPEYLEEFGENLDLIVI 482

>TBLA0G01040 Chr7 complement(258966..261884) [2919 bp, 972 aa] {ON}
           Anc_6.18 YOR005C
          Length = 972

 Score = 99.4 bits (246), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 74/242 (30%), Positives = 123/242 (50%), Gaps = 17/242 (7%)

Query: 384 TLRPGIPLKPMLAKPTK-AINEVLDRFQGETFTSEYKYDGERAQVHLLNDG-TMRIYSRN 441
           +++ G    P LAK    + + + +R   + F  E K DGER Q+H +N G T++ +SR+
Sbjct: 268 SIKVGYIFAPQLAKRLMLSYDTISNRLNNDFFIEE-KMDGERIQLHYMNYGETVKFFSRH 326

Query: 442 GENMTERY----PEINITDFIQDLDTTKNLILDCEAVAWDKDQGKILPFQVL-----STR 492
           G + T  Y        I  F++     K  +LD E V +D    K+LPF ++     S  
Sbjct: 327 GTDYTYLYGNDKSAGTIAKFLRLHKNVKECVLDGEMVTFDSTSKKVLPFGLVKSSASSQL 386

Query: 493 KRKDVELNDVKVKVCLFAFDILCYNDERLINKSLKERREYLTKVTKVVPGEFQYATQITT 552
            +KD++ ND         FDIL  N   LI+  L +R+E+L  V        +  + I  
Sbjct: 387 NKKDID-ND-SFHPLFMVFDILYLNGSSLIDLPLFKRKEFLNTVLTPYKDYVEILSSIRC 444

Query: 553 NNLDELQKFLDESVNHSCEGLMVKMLEGPESHYEPSKRSRNWLKLKKDYLEGVGDSLDLC 612
            +  +++K LD +++   EG+++K      S Y P+ R  NW+K+K +YLE  G+++DL 
Sbjct: 445 TDSIQIKKGLDAAISVGSEGIVLKQYI---SKYIPNARHNNWIKVKPEYLEEFGENMDLI 501

Query: 613 VL 614
           V+
Sbjct: 502 VI 503

>CAGL0E02695g Chr5 complement(254591..257431) [2841 bp, 946 aa] {ON}
           similar to uniprot|Q08387 Saccharomyces cerevisiae
           YOR005c DNL4 DNA ligase IV
          Length = 946

 Score = 97.4 bits (241), Expect = 4e-20,   Method: Compositional matrix adjust.
 Identities = 64/235 (27%), Positives = 116/235 (49%), Gaps = 11/235 (4%)

Query: 388 GIPLKPMLAKPTKAINEVLDRFQGETFTSEYKYDGERAQVHLLNDGT-MRIYSRNGENMT 446
           G+   P LA       + +    G  F  E K DGER Q+H  N G+ ++ YSR   + T
Sbjct: 266 GLAFAPQLATKLHVSYQKIGEKLGWDFFIEEKMDGERIQMHYTNFGSDIKFYSRRATDYT 325

Query: 447 ERYPEI----NITDFIQDLDTTKNLILDCEAVAWDKDQGKILPFQVLSTRKRKDVELNDV 502
             Y        + +FI      K+ +LDCE V +D +   +LPF ++ +  +  +  + +
Sbjct: 326 YLYGNNLKTGTLANFINLNKNVKDCVLDCEVVTFDSNNKIVLPFGMVKSSAKNMLSQDGI 385

Query: 503 KVK---VCLFAFDILCYNDERLINKSLKERREYLTKVTKVVPGEFQYATQITTNNLDELQ 559
             +     L  FD+L  N   L++    +RREYL ++        +    I  N+   ++
Sbjct: 386 DTQGFHPLLMVFDVLYLNGATLVDLPYYKRREYLKQILTPTAHRIEIIKSIRANDEQMIK 445

Query: 560 KFLDESVNHSCEGLMVKMLEGPESHYEPSKRSRNWLKLKKDYLEGVGDSLDLCVL 614
           K L+++++   EG+++K     +S Y  + RS +W+K+K +YLE  G+++DL ++
Sbjct: 446 KSLEKALSVGSEGIILKRY---DSRYVIASRSDDWIKIKPEYLEQFGENMDLVLM 497

>NCAS0D02650 Chr4 (508606..511458) [2853 bp, 950 aa] {ON} Anc_6.18
           YOR005C
          Length = 950

 Score = 96.7 bits (239), Expect = 8e-20,   Method: Compositional matrix adjust.
 Identities = 73/240 (30%), Positives = 118/240 (49%), Gaps = 13/240 (5%)

Query: 384 TLRPGIPLKPMLAKPTKAINEVLDRFQGETFTSEYKYDGERAQVHLLNDG-TMRIYSRNG 442
            + PG    P LAK      E +       F  E K DGER Q+H  + G  ++ +SR G
Sbjct: 255 VINPGFAFAPQLAKKLSISYEKICMKLKNDFIIEEKMDGERIQLHYQDYGEKLKFFSRRG 314

Query: 443 ENMTERYPEINITDFI-QDLDTTKNL---ILDCEAVAWDKDQGKILPFQVLSTRKR---- 494
            + T  Y E     FI + L   K++   ILD E + +DK Q  ILPF ++ +  R    
Sbjct: 315 TDYTYLYGESIHDGFIGKHLKLNKDVKDCILDGEMITYDKTQNMILPFGLVKSSARSMLT 374

Query: 495 KDVELNDVKVKVCLFAFDILCYNDERLINKSLKERREYLTKVTKVVPGEFQYATQITTNN 554
           KD  +N+   +     FD++  N   L N  L  R+EYL  +    P   +  +     N
Sbjct: 375 KDGIMNE-GYQPLFMVFDLIFMNGTSLANIPLNVRKEYLNGIFTPEPHIIELLSSYHRFN 433

Query: 555 LDELQKFLDESVNHSCEGLMVKMLEGPESHYEPSKRSRNWLKLKKDYLEGVGDSLDLCVL 614
            D ++K L+ +++   EG+++K  +   S Y  + R+ +W+K+K +YLE  G+++DL V+
Sbjct: 434 EDSIRKSLELAISMGSEGIVLKRYD---SRYTVASRNDDWIKVKPEYLEQFGENMDLIVI 490

>TDEL0G04510 Chr7 (819479..822388) [2910 bp, 969 aa] {ON} Anc_6.18
           YOR005C
          Length = 969

 Score = 95.9 bits (237), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 94/409 (22%), Positives = 166/409 (40%), Gaps = 55/409 (13%)

Query: 388 GIPLKPMLAKPTKAINEVLDRFQGETFTSEYKYDGERAQVHLLNDGT-MRIYSRNGENMT 446
           G    P LAK      E +       F  E K DGER QVH ++ G  +R  SR G + T
Sbjct: 268 GYAFVPQLAKKMTISYEKICTKLNNDFLIEEKMDGERIQVHYMDYGAKIRFLSRRGVDYT 327

Query: 447 ERYPEI----NITDFIQDLDTTKNLILDCEAVAWDKDQGKILPFQVLSTRKRKDVELNDV 502
           + Y E      + +++      ++ +LD E + +D D+  +LPF ++ +  R+ +    +
Sbjct: 328 QLYGENLQSGTVANYLNFDSNVRDCVLDGEMITFDTDRNVVLPFGMVKSSARQALSTEGI 387

Query: 503 ---KVKVCLFAFDILCYNDERLINKSLKERREYLTKVTKVVPGEFQYATQITTNNLDELQ 559
                +  L   D++  N   LI   L +R+E+L +V K  P   +    +  +    ++
Sbjct: 388 CSQGHRPMLMVLDLVYLNGVSLIKLPLYQRKEFLNRVLKPCPHAVEILPYVRCSEHTAIR 447

Query: 560 KFLDESVNHSCEGLMVKMLEGPESHYEPSKRSRNWLKLKKDYLEGVGDSLDLCVLXXXXX 619
           K L++S++   EG+++K  +   + YE   R+  W+K+K +YLE  G++LDL ++     
Sbjct: 448 KSLEKSISMGSEGIVLKSYK---ARYEIGARNDYWIKVKPEYLEQFGENLDLVIIGRTPG 504

Query: 620 XXXXXXXXXXFLLGCYNQDTGEFE------------------------------TCCKIG 649
                        G   +D  E E                              + C I 
Sbjct: 505 KKDSLMCGLAVYEG--EEDLNEIEAKRESAIVNLDSEGDELDDTDGKKIIKYFISFCVIA 562

Query: 650 TGFSDEMLQLLHDRLTPTIIDG----PKATFVFDSSAEPDVWFEP--TTLFEVLTADLSL 703
            G S +  + +  +     +      P A  +   S  P+ W +P  + + EV    L  
Sbjct: 563 NGISQQEFKEIDRKTRGAWVKSDQRLPSADLLRFGSKIPEEWIDPKNSIMLEVKARSLDN 622

Query: 704 SPIYKAGSATFDKGVSLRFPRFLRIREDKGVEDATSSDQIVELYENQSH 752
           +   ++    F  G +L      RIR+DK   D T      EL++ + H
Sbjct: 623 T---ESSKKKFAAGCTLHGGYCRRIRDDK---DWTGCYSFSELWQERLH 665

>ZYRO0C07854g Chr3 (595546..598380) [2835 bp, 944 aa] {ON} similar
           to uniprot|Q08387 Saccharomyces cerevisiae YOR005C DNL4
           DNA ligase required for nonhomologous end- joining
           (NHEJ) forms stable heterodimer with required cofactor
           Lif1p catalyzes DNA ligation as part of a complex with
           Lif1p and Nej1p involved in meiosis not essential for
           vegetative growth
          Length = 944

 Score = 95.5 bits (236), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 104/434 (23%), Positives = 181/434 (41%), Gaps = 51/434 (11%)

Query: 355 RDAFCQVPNYEIVINSCLE--HGIMNLDKYCTLRPGIPLKPMLAKPTK-AINEVLDRFQG 411
           RD    V + + V +   +  H + N D    L  G+P  P LAK    + ++V  R + 
Sbjct: 220 RDYLSVVSDLKTVADKLWDPSHRLKNDDLGVNL--GLPFAPFLAKRLYISYDKVALRLKS 277

Query: 412 ETFTSEYKYDGERAQVHLLNDG-TMRIYSRNGENMTERYPEI----NITDFIQDLDTTKN 466
           + +  E K DGER Q+H ++ G  ++ +SR G + T  Y E      +  ++Q     + 
Sbjct: 278 DFYIEE-KMDGERIQLHYMDYGRKLKWFSRRGNDYTYLYGEDIGTGTVAKYLQLDPKVRE 336

Query: 467 LILDCEAVAWDKDQGKILPFQVLSTRKRKDVELNDV---KVKVCLFAFDILCYNDERLIN 523
            +LD E +++D ++  +LPF ++ +  R  +    +     +      D L  N   LIN
Sbjct: 337 CVLDGEMISFDTEENSVLPFGLVKSSARDSLTAEGILTQGYRPLYMVIDFLYLNGVSLIN 396

Query: 524 KSLKERREYLTKVTKVVPGEFQYATQITTNNLDELQKFLDESVNHSCEGLMVKMLEGPES 583
             L  R++YL+ +    P   +    +   +   ++  L++++    EG+++K  +   S
Sbjct: 397 VPLNTRKQYLSAILNPCPHAVEIIQSMHCYDDTSIKSSLEKAIMMGSEGIILKHFK---S 453

Query: 584 HYEPSKRSRNWLKLKKDYLEGVGDSLDLCVLXXXXXXXXXXXXXXXFLLG---------- 633
            YE   R+ NW+K+K +YLE  G++LDL V+                L G          
Sbjct: 454 KYEIGARTDNWIKIKPEYLEQFGENLDLLVIGRDPGKKDSLMCGLAVLEGDEEPGAQSDK 513

Query: 634 -CYNQDTGE----------FETCCKIGTGFSDEMLQLLH----DRLTPTIIDGPKATFVF 678
              N D+ E          F + C I  G S E  + +      +   T    P     F
Sbjct: 514 QVVNLDSEEEEEPRKAVKKFISFCTIANGISQEEFKQIERKTAGKWKNTEDHKPPKILEF 573

Query: 679 DSSAEPDVWFEP--TTLFEVLTADLSLSPIYKAGSATFDKGVSLRFPRFLRIREDKGVED 736
            S   P+ W  P  + + EV    L  +   ++    F  G +L      RIREDK   +
Sbjct: 574 GSKL-PEEWIYPEDSVVLEVKARSLDNT---ESSGRKFKVGCTLHGGYCRRIREDK---N 626

Query: 737 ATSSDQIVELYENQ 750
            T    + EL++ +
Sbjct: 627 WTECYTLYELWQER 640

>Suva_15.180 Chr15 complement(308983..311829) [2847 bp, 948 aa] {ON}
           YOR005C (REAL)
          Length = 948

 Score = 95.5 bits (236), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 67/240 (27%), Positives = 118/240 (49%), Gaps = 13/240 (5%)

Query: 384 TLRPGIPLKPMLAKPTKAINEVLDRFQGETFTSEYKYDGERAQVHLLNDG-TMRIYSRNG 442
           +++ G    P LAK      E +       F  E K DGER QVH +N G +++ +SR G
Sbjct: 247 SIKVGFAFAPQLAKKVNLSYEKICHALRNDFFVEEKMDGERIQVHYMNYGKSIKFFSRRG 306

Query: 443 ENMTERYPEIN-----ITDFIQDLDTTKNLILDCEAVAWDKDQGKILPFQVLSTRKRKDV 497
            + T  Y  +N     I+ +++  D+ K  +LD E V +D  +  ILPF ++    ++ +
Sbjct: 307 IDYTYLY-GVNLLSGTISQYLKFSDSVKECVLDGEMVTFDAMRKVILPFGLVKGSAKEAL 365

Query: 498 ELNDVK---VKVCLFAFDILCYNDERLINKSLKERREYLTKVTKVVPGEFQYATQITTNN 554
             ND+           FD+L  N   L    L +R+EYL+ +        +        +
Sbjct: 366 SFNDINNNDFHPLYMVFDLLYLNGTSLTPLPLYQRKEYLSSILIPSKSVVEIVRYSRCYD 425

Query: 555 LDELQKFLDESVNHSCEGLMVKMLEGPESHYEPSKRSRNWLKLKKDYLEGVGDSLDLCVL 614
            + ++K L+ +++   EG+++K      S Y  + R+ NW+K+K +YLE  G++LDL ++
Sbjct: 426 AESVKKSLEVAISLGSEGVVLKHYS---SSYNVASRNNNWIKVKPEYLEEFGENLDLIII 482

>KLLA0D01089g Chr4 complement(97438..100161) [2724 bp, 907 aa] {ON}
           similar to uniprot|Q08387 Saccharomyces cerevisiae
           YOR005C DNL4 DNA ligase required for nonhomologous end-
           joining (NHEJ) forms stable heterodimer with required
           cofactor Lif1p catalyzes DNA ligation as part of a
           complex with Lif1p and Nej1p involved in meiosis not
           essential for vegetative growth
          Length = 907

 Score = 95.1 bits (235), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 91/372 (24%), Positives = 161/372 (43%), Gaps = 35/372 (9%)

Query: 391 LKPMLAKPTKAINEVLDRFQGETFTSEYKYDGERAQVHLLNDG-TMRIYSRNGENMTERY 449
            +P LAK T    E +       F  E K DGER Q+H +N G  ++  SR G + +  Y
Sbjct: 247 FEPQLAKRTHLSYERVASKLQHDFIIEEKMDGERLQIHYINYGEQIKYLSRRGVDFSYLY 306

Query: 450 PEIN----ITDFIQDLDTTKNLILDCEAVAWDKDQGKILPFQVLSTRKRKDV--ELNDV- 502
            E +    I+  ++     K+ ILD E + +D ++  +LPF ++ +     +  EL  + 
Sbjct: 307 GENSSSGPISPSLKLHFNVKDCILDGEMITYDTEKDIVLPFGLVKSSAMNQIQSELAGIA 366

Query: 503 ---KVKVCLFAFDILCYNDERLINKSLKERREYLTKVTKVVPGEFQYATQITTNNLDELQ 559
                K    AFD++  N + L N +L+ R++YLTK+   V    +    +   N + ++
Sbjct: 367 PTESYKPLFVAFDLVYLNGKSLTNLALERRKDYLTKILTPVERSVEIIQYMKAINAEAIK 426

Query: 560 KFLDESVNHSCEGLMVKMLEGPESHYEPSKRSRNWLKLKKDYLEGVGDSLDLCVLXXXXX 619
             L+++++   EG+++K L    S Y    R+ +W+K+K +YLE  G+++DL ++     
Sbjct: 427 DSLEQAISMGSEGIVLKHL---HSKYFVGSRNTDWIKIKPEYLEQFGENMDLLII----- 478

Query: 620 XXXXXXXXXXFLLGCYNQDTGE------FETCCKIGTGFSDEMLQLLHDRLTPTII---- 669
                     F  G    D  E      F + C I  G S+E  + +  +          
Sbjct: 479 -GREQGKKDSFFCGLSISDPNEVAEKPRFISFCTIANGLSNEEFKDIERKTWGKWHIFSE 537

Query: 670 DGPKATFVFDSSAEPDVWFEP--TTLFEVLTADLSLSPIYKAGSATFDKGVSLRFPRFLR 727
           D P    +   +  P  W  P  + + EV    +      ++    +  G +L F    +
Sbjct: 538 DPPSPNLLGFGTKVPYEWIHPEDSVVLEVKARAIDTK---ESEKRKYRSGCTLHFGYCKQ 594

Query: 728 IREDKGVEDATS 739
           IR DK  +   S
Sbjct: 595 IRYDKDWKTVAS 606

>Skud_15.166 Chr15 complement(294550..297393) [2844 bp, 947 aa] {ON}
           YOR005C (REAL)
          Length = 947

 Score = 95.1 bits (235), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 64/239 (26%), Positives = 117/239 (48%), Gaps = 11/239 (4%)

Query: 384 TLRPGIPLKPMLAKPTKAINEVLDRFQGETFTSEYKYDGERAQVHLLNDG-TMRIYSRNG 442
           +++ G    P LAK      E + R     F  E K DGER QVH +N G +++ +SR G
Sbjct: 247 SIKVGFAFAPQLAKKVSLPYEKICRALHNDFLIEEKMDGERIQVHYMNYGKSIKFFSRRG 306

Query: 443 ENMTERY----PEINITDFIQDLDTTKNLILDCEAVAWDKDQGKILPFQVLSTRKRKDVE 498
            + T  Y        I+ +++  +T K  +LD E V +D  +  ILPF ++    +  + 
Sbjct: 307 IDYTYLYGASLSSGTISQYLKLTNTVKECVLDGEMVTFDSTRKVILPFGLVKGSAKGVLS 366

Query: 499 LNDVK---VKVCLFAFDILCYNDERLINKSLKERREYLTKVTKVVPGEFQYATQITTNNL 555
            +D+     +     FD+L  N+  L    L +R++YL+ +        +        ++
Sbjct: 367 CSDINNSDFRPLYMVFDLLYLNEISLAPLPLHQRKKYLSSILTPFKNVVEIVQSTRCYDV 426

Query: 556 DELQKFLDESVNHSCEGLMVKMLEGPESHYEPSKRSRNWLKLKKDYLEGVGDSLDLCVL 614
             ++  L+ +++   EG+++K      S Y  + R+ NW+K+K +YLE  G++LDL ++
Sbjct: 427 QSVKNSLEVAISLGSEGVVLKYYN---SSYNIASRNYNWIKVKPEYLEEFGENLDLIII 482

>KLTH0C11286g Chr3 (926742..929597) [2856 bp, 951 aa] {ON} similar
           to uniprot|Q08387 Saccharomyces cerevisiae YOR005C DNL4
           DNA ligase required for nonhomologous end- joining
           (NHEJ) forms stable heterodimer with required cofactor
           Lif1p catalyzes DNA ligation as part of a complex with
           Lif1p and Nej1p involved in meiosis not essential for
           vegetative growth
          Length = 951

 Score = 90.1 bits (222), Expect = 9e-18,   Method: Compositional matrix adjust.
 Identities = 64/237 (27%), Positives = 115/237 (48%), Gaps = 13/237 (5%)

Query: 388 GIPLKPMLAKPTKAINEVLDRFQGETFTSEYKYDGERAQVHLLNDGT-MRIYSRNGENMT 446
           G    P LAK      E +       F  E K DGER Q+H +N G+ ++  SR G + +
Sbjct: 262 GHAFAPHLAKRLHVSYERICSKLKHDFILEEKMDGERIQLHYVNGGSVLKFLSRRGIDFS 321

Query: 447 ERY-PEIN---ITDFIQDLDTTKNLILDCEAVAWDKDQGKILPFQVLSTRKRKDVELNDV 502
             Y  E+    I+ +++     ++ +LD E V++DK +  ILPF ++ +    ++  ++V
Sbjct: 322 HLYGQEVARGVISQYLKLKSDVRDCVLDGEMVSYDKKRKIILPFGIVKSAAVDELINSEV 381

Query: 503 K-----VKVCLFAFDILCYNDERLINKSLKERREYLTKVTKVVPGEFQYATQITTNNLDE 557
                  +     FD++  N   L    L  R+EYL ++   VP   +    I   +   
Sbjct: 382 GNENDGYRPLYMVFDLVYLNGVSLTKVPLHIRKEYLKEILSPVPDVVEILKGIRACDAKA 441

Query: 558 LQKFLDESVNHSCEGLMVKMLEGPESHYEPSKRSRNWLKLKKDYLEGVGDSLDLCVL 614
           ++ F+  ++    EG++VK      S YE   R+ +W+K+K +Y E +G+++DL V+
Sbjct: 442 IKNFMQRAIEMGSEGVIVKQ---ASSTYEVGARNDHWVKIKPEYFEDLGETMDLVVI 495

>Kwal_56.22414 s56 complement(117198..120089) [2892 bp, 963 aa] {ON}
           YOR005C (DNL4) - ATP dependent DNA ligase [contig 185]
           FULL
          Length = 963

 Score = 88.6 bits (218), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 66/259 (25%), Positives = 125/259 (48%), Gaps = 14/259 (5%)

Query: 367 VINSCLEHGIMNLDKY-CTLRPGIPLKPMLAKPTKAINEVLDRFQGETFTSEYKYDGERA 425
           V++  L +  M L K   ++  G    P LAK      E +     + F  E K DGER 
Sbjct: 254 VLSETLWNPTMRLGKNELSINIGRAFAPHLAKRLHLSYERVCAKLKQDFIIEEKMDGERI 313

Query: 426 QVHLLNDGT-MRIYSRNGENMTERYPEI----NITDFIQDLDTTKNLILDCEAVAWDKDQ 480
           Q+H +  G  +R  SR G + T  Y +      I+  ++  +  ++ +LD E V++DK++
Sbjct: 314 QLHYIERGAKIRFLSRRGTDFTHLYGDSLEHGVISQHLKFKNDVQDCVLDGEMVSFDKEK 373

Query: 481 GKILPFQVLSTRKRKDVELNDVKV-----KVCLFAFDILCYNDERLINKSLKERREYLTK 535
             +LPF ++ +   +++  +D KV     +     FD++  N   L    L  R+ YL  
Sbjct: 374 NVVLPFGIVKSTAMEELMNSDTKVDTDGYRPLYMIFDLVYLNGVSLTRLPLHLRKSYLRS 433

Query: 536 VTKVVPGEFQYATQITTNNLDELQKFLDESVNHSCEGLMVKMLEGPESHYEPSKRSRNWL 595
           +   V    +  + +  +  + ++  L+ ++    EG+++K    P   YE   R+ +W+
Sbjct: 434 ILSPVANIVEILSDVRASEPNAIKVSLERAIEMGSEGIILKQFSSP---YEIGARNDSWI 490

Query: 596 KLKKDYLEGVGDSLDLCVL 614
           K+K +Y E +G+++DL V+
Sbjct: 491 KIKPEYFEELGETMDLVVI 509

>KAFR0A05050 Chr1 (1003515..1006361) [2847 bp, 948 aa] {ON} Anc_6.18
           YOR005C
          Length = 948

 Score = 87.4 bits (215), Expect = 5e-17,   Method: Compositional matrix adjust.
 Identities = 64/236 (27%), Positives = 118/236 (50%), Gaps = 13/236 (5%)

Query: 388 GIPLKPMLAKP-TKAINEVLDRFQGETFTSEYKYDGERAQVHLLNDGT-MRIYSRNGENM 445
           G    P LAK  + + +++  + + + F  E K DGER Q+H ++ G  ++  SR G + 
Sbjct: 251 GYAFAPHLAKKLSISYDKICKKLKNDFFIEE-KMDGERIQIHYMDYGNDIKFLSRRGVDY 309

Query: 446 TERYPEI----NITDFIQDLDTTKNLILDCEAVAWDKDQGKILPFQVLSTRKRKDV---E 498
           T  Y E      I  +++     K  +LD E V +D+DQ  +LPF ++ +     +   E
Sbjct: 310 TYLYGENLSTGTIACYLKLNRDVKECVLDGEMVTYDEDQDILLPFGMVKSAAMNALTKEE 369

Query: 499 LNDVKVKVCLFAFDILCYNDERLINKSLKERREYLTKVTKVVPGEFQYATQITTNNLDEL 558
           ++       L  FD++  N   L+   L +R++YL  V +      Q       +N + +
Sbjct: 370 ISGQDYHPLLMVFDLVFLNGSSLVEFPLYQRKDYLASVLEPYRARVQIVNFTRCSNENII 429

Query: 559 QKFLDESVNHSCEGLMVKMLEGPESHYEPSKRSRNWLKLKKDYLEGVGDSLDLCVL 614
           +K L+ +++   EG+++K      S Y    R+ +W+K+K +YLE  G+++DL V+
Sbjct: 430 RKSLEHAISVGSEGIVLK---NYNSRYMIGSRNDSWIKIKPEYLEQFGENMDLIVI 482

>Kpol_1032.7 s1032 complement(12295..15192) [2898 bp, 965 aa] {ON}
           complement(12295..15192) [2898 nt, 966 aa]
          Length = 965

 Score = 86.3 bits (212), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 61/224 (27%), Positives = 113/224 (50%), Gaps = 12/224 (5%)

Query: 399 TKAINEVLDRFQGETFTSEYKYDGERAQVHLLNDGT-MRIYSRNGENMTERYPEIN---- 453
           T + + +  R + + F  E K DGER Q+H +N G  ++  SR G + +  Y +      
Sbjct: 285 TYSYDTIARRLKNDFFIEE-KMDGERIQLHYMNYGAKLKFLSRRGLDYSYLYGDNRNNGA 343

Query: 454 ITDFIQDLDTTKNLILDCEAVAWDKDQGKILPFQVLSTRKRKDVELNDVK---VKVCLFA 510
           I  ++      K  ILD E V +D  +  ILPF ++ +   + + ++D++         A
Sbjct: 344 IGRYLNFHKDVKECILDGEMVTYDSVKNCILPFGLVKSSAMQSLSVSDIEPDGYHPLYMA 403

Query: 511 FDILCYNDERLINKSLKERREYLTKVTKVVPGEFQYATQITTNNLDELQKFLDESVNHSC 570
           FD++  N   L    L +R+ YL K+    P   +    +  N+   ++  L++++    
Sbjct: 404 FDLVYLNGSSLSTLPLHQRKNYLDKLLIPCPDFVEILPALHCNDSSLIKSSLEKAIELGS 463

Query: 571 EGLMVKMLEGPESHYEPSKRSRNWLKLKKDYLEGVGDSLDLCVL 614
           EG+++K  +   S Y  +KRS +W+K+K +YLE  G+++DL V+
Sbjct: 464 EGIILKRFD---SQYLVAKRSDDWIKIKPEYLEQFGENMDLIVI 504

>NDAI0I02260 Chr9 complement(514711..517614) [2904 bp, 967 aa] {ON}
           Anc_6.18 YOR005C
          Length = 967

 Score = 84.3 bits (207), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 67/268 (25%), Positives = 123/268 (45%), Gaps = 11/268 (4%)

Query: 355 RDAFCQVPNYEIVINSCLEHGIMNLDKYCTLRPGIPLKPMLAKPTKAINEVLDRFQGETF 414
           +D    V + + V N   +  +   +   T+  G P  P  AK      E +       F
Sbjct: 234 QDYLSVVSDLKTVANKLWDPAVHLKNDDLTINVGSPFAPQSAKKLSISYEKICAKLKHDF 293

Query: 415 TSEYKYDGERAQVHLLNDGT-MRIYSRNGENMTERYPEI----NITDFIQDLDTTKNLIL 469
             E K DGER Q+H  + G  +   SR G + T  Y E      ++ ++   +  +N +L
Sbjct: 294 FIEEKMDGERIQLHYQDYGNKLSFLSRRGTDYTYLYGESIKDGTVSKYLHLDNNVQNCVL 353

Query: 470 DCEAVAWDKDQGKILPFQVLSTRKRKDVELNDVK---VKVCLFAFDILCYNDERLINKSL 526
           D E V +DK++  +LPF ++ +  R  +    V     +  L  FD++  N   L+N  L
Sbjct: 354 DGEMVTFDKERNALLPFGLVKSSARSIITQEGVANEGYRPLLMVFDLVYLNGVSLVNIPL 413

Query: 527 KERREYLTKVTKVVPGEFQYATQITTNNLDELQKFLDESVNHSCEGLMVKMLEGPESHYE 586
            +R+ YL K+        +       ++   ++  L+ +++   EG+++K      S Y 
Sbjct: 414 YQRKLYLEKIFTPERHIVELLRSKRCSDERSIKNALEHAISIGSEGVVLKHYN---SRYT 470

Query: 587 PSKRSRNWLKLKKDYLEGVGDSLDLCVL 614
            + R+ +W+K+K +YLE  G+++DL V+
Sbjct: 471 VASRNDDWIKVKPEYLEQFGENMDLIVI 498

>KNAG0A07190 Chr1 complement(1129595..1131064) [1470 bp, 489 aa]
           {ON} Anc_2.571 YKL047W
          Length = 489

 Score = 32.3 bits (72), Expect = 4.5,   Method: Compositional matrix adjust.
 Identities = 16/52 (30%), Positives = 31/52 (59%)

Query: 331 DENREDSPDKDVPMDVLESAQQKIRDAFCQVPNYEIVINSCLEHGIMNLDKY 382
           DE   D  D+   + +L++  ++IR    ++  YE+++N+ L  GI NLD++
Sbjct: 295 DELNCDVVDESKKLKILDNKGKQIRATPYELELYELMLNTVLREGITNLDRF 346

>AFR049W Chr6 (517312..519465) [2154 bp, 717 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YNL144C and YHR131C
          Length = 717

 Score = 32.3 bits (72), Expect = 5.0,   Method: Compositional matrix adjust.
 Identities = 33/115 (28%), Positives = 51/115 (44%), Gaps = 12/115 (10%)

Query: 240 GEIAMGARNVQPTMFKPKPLTVGEVFKNLRAIAKTQGKDSQLKKMKLIKRMLTACKGIEA 299
           GE+  G  +   TMF  K  + GEV ++    + T+G +S + +  L        +G EA
Sbjct: 383 GELQAGFASRLRTMFWSKKASRGEVQRSRTVHSDTKGLNSSVAESLLGPSASLGARGSEA 442

Query: 300 KFLIRSLESKLRIGLAEKTVLISLSKALLLHDENREDSPDKDVPMD--VLESAQQ 352
                     LR  L+E+ V  S S +LL   E R  + +  +  D   LES +Q
Sbjct: 443 ----------LRCRLSERCVYQSASSSLLQVSEQRAAAHEDQMGSDSSSLESHRQ 487

>KNAG0E02810 Chr5 (564828..566978) [2151 bp, 716 aa] {ON} Anc_6.4
           YPL269W
          Length = 716

 Score = 32.0 bits (71), Expect = 6.7,   Method: Compositional matrix adjust.
 Identities = 19/50 (38%), Positives = 26/50 (52%), Gaps = 1/50 (2%)

Query: 535 KVTKVVPGEFQYATQITTNNLDELQKFLDESVNHSCEGLMVKMLEGPESH 584
           K  K+V G F   T+I  +N+  LQK LDE++    E +  K  E P  H
Sbjct: 134 KELKIVSGVFLEFTEIVNDNMTTLQKILDENIEQLFE-IQEKRFESPVRH 182

>CAGL0D06622g Chr4 complement(629323..632859) [3537 bp, 1178 aa]
           {ON} weakly similar to uniprot|P23201 Saccharomyces
           cerevisiae YLL021w SPA2 involved in cell polarity
          Length = 1178

 Score = 32.0 bits (71), Expect = 7.8,   Method: Compositional matrix adjust.
 Identities = 24/89 (26%), Positives = 40/89 (44%), Gaps = 16/89 (17%)

Query: 360 QVPNYE---IVINSCLEHGIMNLDKYCTLRPGIPLKPMLAKPTKAINEVLDRFQGETFTS 416
           Q+P +    +++ + + H I  L  Y T  P IP+  + A    +I E+L  F     ++
Sbjct: 485 QLPEFHDQNVIVKAAVSHAITTLRYYTTYGPLIPVVTLQA----SITEILFSFCTLIKSA 540

Query: 417 EYKYDGERAQVHLLNDGTMRIYSRNGENM 445
           + KYDG+            R+ S N  NM
Sbjct: 541 KIKYDGKE---------IARLNSDNTNNM 560

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.317    0.134    0.384 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 73,040,524
Number of extensions: 3089074
Number of successful extensions: 10040
Number of sequences better than 10.0: 47
Number of HSP's gapped: 10189
Number of HSP's successfully gapped: 47
Length of query: 755
Length of database: 53,481,399
Length adjustment: 117
Effective length of query: 638
Effective length of database: 40,065,477
Effective search space: 25561774326
Effective search space used: 25561774326
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 70 (31.6 bits)