Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
YDL161W (ENT1)7.342ON45445416420.0
Skud_4.947.342ON44745514710.0
Smik_4.757.342ON46046114280.0
Suva_4.837.342ON46246514180.0
TDEL0C020507.342ON5012487448e-93
ZYRO0F11550g7.342ON5382456948e-85
KNAG0C038007.342ON4472446851e-84
SAKL0F10934g7.342ON4982516821e-83
NCAS0H006707.342ON4832576776e-83
TPHA0D045607.342ON4872476768e-83
Kpol_2001.707.342ON5332446799e-83
KAFR0L014607.342ON5502606687e-81
CAGL0A03872g7.342ON5102556622e-80
Skud_12.2707.342ON6262766474e-77
NDAI0D006107.342ON4862666351e-76
KAFR0B008907.342ON4142406246e-76
Smik_12.2647.342ON6122656326e-75
Suva_10.3007.342ON6182636317e-75
YLR206W (ENT2)7.342ON6131916292e-74
Kwal_56.246107.342ON5082626193e-74
TBLA0E004807.342ON5992736142e-72
KLTH0H01430g7.342ON5022605951e-70
KLLA0C16731g7.342ON4782485634e-66
Ecym_47317.342ON5142565323e-61
TBLA0E020407.342ON7012554932e-54
KNAG0B026507.342ON6461404903e-54
ACL157C7.342ON5152554763e-53
Kwal_47.168574.346ON3821422463e-22
KLTH0D16896g4.346ON4011422474e-22
NDAI0D032004.346ON4351422475e-22
Kpol_1001.24.346ON4181422457e-22
TBLA0E047604.346ON4261392441e-21
TDEL0D007104.346ON3751422421e-21
Suva_12.2164.346ON4101422422e-21
SAKL0G17952g4.346ON4151422413e-21
KNAG0M003804.346ON4031362403e-21
Skud_10.3494.346ON4101422378e-21
YJR125C (ENT3)4.346ON4081422361e-20
KAFR0B067404.346ON3991422351e-20
Smik_10.4184.346ON4091422351e-20
KLLA0B04587g4.346ON4001422351e-20
ZYRO0B14784g4.346ON4241422324e-20
NCAS0A062104.346ON4231422306e-20
AER155C4.346ON3641422243e-19
TPHA0B004004.346ON3991422244e-19
Ecym_11334.346ON3921422138e-18
CAGL0H04323g4.346ON4121422075e-17
SAKL0H25762g4.17ON2621451902e-15
Kwal_55.206114.17ON2541431893e-15
Kpol_388.54.17ON2681401682e-12
TDEL0G017404.17ON2571401592e-11
TBLA0B062204.346ON3391411612e-11
Ecym_84074.17ON2541431556e-11
KLTH0E05874g4.17ON2551371531e-10
ZYRO0G07876g4.17ON2591351461e-09
TPHA0F002304.17ON2801411471e-09
Suva_10.354.17ON2471331325e-08
KLLA0D03949g4.17ON2251201316e-08
TBLA0G006504.17ON4231421232e-06
ACL061C4.17ON2341341202e-06
NCAS0C058404.17ON2671371184e-06
Skud_12.304.17ON2471271131e-05
NDAI0H002804.17ON3101461034e-04
CAGL0E03806g4.17ON2601031015e-04
KAFR0I014604.17ON2751541016e-04
YLL038C (ENT4)4.17ON247103998e-04
Smik_12.194.17ON247103960.002
YHR161C (YAP1801)5.84ON63743920.012
SAKL0H02530g5.84ON66946880.035
Skud_8.2255.84ON62165870.049
Smik_8.2455.84ON62772830.15
NCAS0B036608.335ON416113790.34
CAGL0E01199g8.335ON41298760.77
KLLA0D16654g8.335ON399165750.96
KLLA0A05522g5.84ON56743751.1
ZYRO0F13684g8.335ON40798722.5
Kpol_344.88.335ON384114722.6
NDAI0J009308.335ON418113695.5
Skud_4.5275.626ON76477688.6
KAFR0F012106.256ON31133679.7
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= YDL161W
         (454 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

YDL161W Chr4 (167714..169078) [1365 bp, 454 aa] {ON}  ENT1Epsin-...   637   0.0  
Skud_4.94 Chr4 (163372..164715) [1344 bp, 447 aa] {ON} YDL161W (...   571   0.0  
Smik_4.75 Chr4 (144483..145865) [1383 bp, 460 aa] {ON} YDL161W (...   554   0.0  
Suva_4.83 Chr4 (155278..156666) [1389 bp, 462 aa] {ON} YDL161W (...   550   0.0  
TDEL0C02050 Chr3 (355071..356576) [1506 bp, 501 aa] {ON} Anc_7.3...   291   8e-93
ZYRO0F11550g Chr6 complement(947131..948747) [1617 bp, 538 aa] {...   271   8e-85
KNAG0C03800 Chr3 (746891..748234) [1344 bp, 447 aa] {ON} Anc_7.3...   268   1e-84
SAKL0F10934g Chr6 (856966..858462) [1497 bp, 498 aa] {ON} some s...   267   1e-83
NCAS0H00670 Chr8 (117595..119046) [1452 bp, 483 aa] {ON} Anc_7.342    265   6e-83
TPHA0D04560 Chr4 complement(994552..996015) [1464 bp, 487 aa] {O...   265   8e-83
Kpol_2001.70 s2001 complement(192214..193815) [1602 bp, 533 aa] ...   266   9e-83
KAFR0L01460 Chr12 complement(270433..272085) [1653 bp, 550 aa] {...   261   7e-81
CAGL0A03872g Chr1 complement(392922..394454) [1533 bp, 510 aa] {...   259   2e-80
Skud_12.270 Chr12 (501192..503072) [1881 bp, 626 aa] {ON} YLR206...   253   4e-77
NDAI0D00610 Chr4 (133678..135138) [1461 bp, 486 aa] {ON} Anc_7.3...   249   1e-76
KAFR0B00890 Chr2 (166365..167609) [1245 bp, 414 aa] {ON} Anc_7.3...   244   6e-76
Smik_12.264 Chr12 (501598..503436) [1839 bp, 612 aa] {ON} YLR206...   248   6e-75
Suva_10.300 Chr10 (527412..529268) [1857 bp, 618 aa] {ON} YLR206...   247   7e-75
YLR206W Chr12 (554578..556419) [1842 bp, 613 aa] {ON}  ENT2Epsin...   246   2e-74
Kwal_56.24610 s56 complement(1073855..1075381) [1527 bp, 508 aa]...   243   3e-74
TBLA0E00480 Chr5 complement(88019..89818) [1800 bp, 599 aa] {ON}...   241   2e-72
KLTH0H01430g Chr8 (132738..134246) [1509 bp, 502 aa] {ON} some s...   233   1e-70
KLLA0C16731g Chr3 complement(1463616..1465052) [1437 bp, 478 aa]...   221   4e-66
Ecym_4731 Chr4 (1427875..1429419) [1545 bp, 514 aa] {ON} similar...   209   3e-61
TBLA0E02040 Chr5 complement(494899..497004) [2106 bp, 701 aa] {O...   194   2e-54
KNAG0B02650 Chr2 (511995..513935) [1941 bp, 646 aa] {ON} Anc_7.3...   193   3e-54
ACL157C Chr3 complement(79325..80872) [1548 bp, 515 aa] {ON} Syn...   187   3e-53
Kwal_47.16857 s47 (145176..146324) [1149 bp, 382 aa] {ON} YJR125...    99   3e-22
KLTH0D16896g Chr4 complement(1395711..1396916) [1206 bp, 401 aa]...   100   4e-22
NDAI0D03200 Chr4 complement(764129..765436) [1308 bp, 435 aa] {O...   100   5e-22
Kpol_1001.2 s1001 (8057..9313) [1257 bp, 418 aa] {ON} (8057..931...    99   7e-22
TBLA0E04760 Chr5 complement(1226806..1228086) [1281 bp, 426 aa] ...    99   1e-21
TDEL0D00710 Chr4 (127174..128301) [1128 bp, 375 aa] {ON} Anc_4.3...    98   1e-21
Suva_12.216 Chr12 complement(334254..335486) [1233 bp, 410 aa] {...    98   2e-21
SAKL0G17952g Chr7 complement(1555520..1556767) [1248 bp, 415 aa]...    97   3e-21
KNAG0M00380 Chr13 (56675..57886) [1212 bp, 403 aa] {ON} Anc_4.34...    97   3e-21
Skud_10.349 Chr10 complement(613398..614630) [1233 bp, 410 aa] {...    96   8e-21
YJR125C Chr10 complement(654737..655963) [1227 bp, 408 aa] {ON} ...    96   1e-20
KAFR0B06740 Chr2 (1406075..1407274) [1200 bp, 399 aa] {ON} Anc_4...    95   1e-20
Smik_10.418 Chr10 complement(643833..645062) [1230 bp, 409 aa] {...    95   1e-20
KLLA0B04587g Chr2 (411097..412299) [1203 bp, 400 aa] {ON} simila...    95   1e-20
ZYRO0B14784g Chr2 complement(1205944..1207218) [1275 bp, 424 aa]...    94   4e-20
NCAS0A06210 Chr1 complement(1229758..1231029) [1272 bp, 423 aa] ...    93   6e-20
AER155C Chr5 complement(929042..930136) [1095 bp, 364 aa] {ON} S...    91   3e-19
TPHA0B00400 Chr2 (83356..84555) [1200 bp, 399 aa] {ON} Anc_4.346...    91   4e-19
Ecym_1133 Chr1 (274069..275247) [1179 bp, 392 aa] {ON} similar t...    87   8e-18
CAGL0H04323g Chr8 (407884..409122) [1239 bp, 412 aa] {ON} simila...    84   5e-17
SAKL0H25762g Chr8 (2256842..2257630) [789 bp, 262 aa] {ON} some ...    78   2e-15
Kwal_55.20611 s55 complement(489968..490732) [765 bp, 254 aa] {O...    77   3e-15
Kpol_388.5 s388 complement(17825..18631) [807 bp, 268 aa] {ON} c...    69   2e-12
TDEL0G01740 Chr7 (342371..343144) [774 bp, 257 aa] {ON} Anc_4.17...    66   2e-11
TBLA0B06220 Chr2 (1466908..1467927) [1020 bp, 339 aa] {ON} Anc_4...    67   2e-11
Ecym_8407 Chr8 (843359..844123) [765 bp, 254 aa] {ON} similar to...    64   6e-11
KLTH0E05874g Chr5 complement(530814..531581) [768 bp, 255 aa] {O...    64   1e-10
ZYRO0G07876g Chr7 complement(636468..637247) [780 bp, 259 aa] {O...    61   1e-09
TPHA0F00230 Chr6 complement(43589..44431) [843 bp, 280 aa] {ON} ...    61   1e-09
Suva_10.35 Chr10 complement(70188..70931) [744 bp, 247 aa] {ON} ...    55   5e-08
KLLA0D03949g Chr4 (333566..334243) [678 bp, 225 aa] {ON} similar...    55   6e-08
TBLA0G00650 Chr7 (140678..141949) [1272 bp, 423 aa] {ON} Anc_4.1...    52   2e-06
ACL061C Chr3 complement(256803..257507) [705 bp, 234 aa] {ON} Sy...    51   2e-06
NCAS0C05840 Chr3 (1202292..1203095) [804 bp, 267 aa] {ON} Anc_4....    50   4e-06
Skud_12.30 Chr12 complement(56967..57710) [744 bp, 247 aa] {ON} ...    48   1e-05
NDAI0H00280 Chr8 complement(48177..49109) [933 bp, 310 aa] {ON} ...    44   4e-04
CAGL0E03806g Chr5 (356594..357376) [783 bp, 260 aa] {ON} similar...    44   5e-04
KAFR0I01460 Chr9 (304865..305692) [828 bp, 275 aa] {ON} Anc_4.17...    44   6e-04
YLL038C Chr12 complement(65775..66518) [744 bp, 247 aa] {ON}  EN...    43   8e-04
Smik_12.19 Chr12 complement(50134..50877) [744 bp, 247 aa] {ON} ...    42   0.002
YHR161C Chr8 complement(420373..422286) [1914 bp, 637 aa] {ON}  ...    40   0.012
SAKL0H02530g Chr8 (250148..252157) [2010 bp, 669 aa] {ON} weakly...    39   0.035
Skud_8.225 Chr8 complement(391820..393685) [1866 bp, 621 aa] {ON...    38   0.049
Smik_8.245 Chr8 complement(397342..399225) [1884 bp, 627 aa] {ON...    37   0.15 
NCAS0B03660 Chr2 complement(653627..654877) [1251 bp, 416 aa] {O...    35   0.34 
CAGL0E01199g Chr5 (108041..109279) [1239 bp, 412 aa] {ON} simila...    34   0.77 
KLLA0D16654g Chr4 complement(1413507..1414706) [1200 bp, 399 aa]...    33   0.96 
KLLA0A05522g Chr1 (507778..509481) [1704 bp, 567 aa] {ON} simila...    33   1.1  
ZYRO0F13684g Chr6 complement(1125731..1126954) [1224 bp, 407 aa]...    32   2.5  
Kpol_344.8 s344 complement(20765..21919) [1155 bp, 384 aa] {ON} ...    32   2.6  
NDAI0J00930 Chr10 (209579..210835) [1257 bp, 418 aa] {ON} Anc_8....    31   5.5  
Skud_4.527 Chr4 complement(938779..941073) [2295 bp, 764 aa] {ON...    31   8.6  
KAFR0F01210 Chr6 (232343..233278) [936 bp, 311 aa] {ON} Anc_6.25...    30   9.7  

>YDL161W Chr4 (167714..169078) [1365 bp, 454 aa] {ON}
           ENT1Epsin-like protein involved in endocytosis and actin
           patch assembly and functionally redundant with Ent2p;
           binds clathrin via a clathrin-binding domain motif at
           C-terminus
          Length = 454

 Score =  637 bits (1642), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 333/454 (73%), Positives = 333/454 (73%)

Query: 1   MSKQFVRSAKNLVKGYSSTQVLVRNATSNDNHQVSKDSLIELAEKSYDSADFFEIMDMLD 60
           MSKQFVRSAKNLVKGYSSTQVLVRNATSNDNHQVSKDSLIELAEKSYDSADFFEIMDMLD
Sbjct: 1   MSKQFVRSAKNLVKGYSSTQVLVRNATSNDNHQVSKDSLIELAEKSYDSADFFEIMDMLD 60

Query: 61  KRLNDKGKYWRHIAKALTVIDYLIRFGSENCVLWCRENLYIIKTLKEFRHEDDEGIDQGQ 120
           KRLNDKGKYWRHIAKALTVIDYLIRFGSENCVLWCRENLYIIKTLKEFRHEDDEGIDQGQ
Sbjct: 61  KRLNDKGKYWRHIAKALTVIDYLIRFGSENCVLWCRENLYIIKTLKEFRHEDDEGIDQGQ 120

Query: 121 IVRVKAKELTALLSDDERLNEEXXXXXXXXXXXXXXXXXXXXSDENDDDLQRAISASRLT 180
           IVRVKAKELTALLSDDERLNEE                    SDENDDDLQRAISASRLT
Sbjct: 121 IVRVKAKELTALLSDDERLNEERNMNIKGRNRKGRRRRGTGRSDENDDDLQRAISASRLT 180

Query: 181 AXXXXXXXXXXXXXXTALQLSKEEEELKRXXXXXXXXXXXXXXXXXXPMYYDIFGNPITP 240
           A              TALQLSKEEEELKR                  PMYYDIFGNPITP
Sbjct: 181 AEEDERRRKQDEDYETALQLSKEEEELKRLQDLQRMQQQQGQQQLQQPMYYDIFGNPITP 240

Query: 241 EEYAXXXXXXXXXXXXXXXXXXPMYYDVFGNPITPXXXXXXXXXXXXXXXXXXXXXXXXX 300
           EEYA                  PMYYDVFGNPITP                         
Sbjct: 241 EEYAQFQLQQQQQQQQQQLQQQPMYYDVFGNPITPEELAQFQQQQQLQEQQYLASMQQQQ 300

Query: 301 XXMSNNPFAKSEQSSSSPKRNQLVAASSPXXXXXXXXXEPLIQNRTGNQSMTDKYSKLNE 360
             MSNNPFAKSEQSSSSPKRNQLVAASSP         EPLIQNRTGNQSMTDKYSKLNE
Sbjct: 301 QAMSNNPFAKSEQSSSSPKRNQLVAASSPQQLQQQKQQEPLIQNRTGNQSMTDKYSKLNE 360

Query: 361 LLATGTGIDTFGNVGEARIPAQHTKTGTFINSQGTGYRQVSDDPNHNPFLNSQYTGLPST 420
           LLATGTGIDTFGNVGEARIPAQHTKTGTFINSQGTGYRQVSDDPNHNPFLNSQYTGLPST
Sbjct: 361 LLATGTGIDTFGNVGEARIPAQHTKTGTFINSQGTGYRQVSDDPNHNPFLNSQYTGLPST 420

Query: 421 SVVPTQTGYGFXXXXXXXXXXXXXXXRGYTLIDL 454
           SVVPTQTGYGF               RGYTLIDL
Sbjct: 421 SVVPTQTGYGFGNQSQQQSQNNGSNNRGYTLIDL 454

>Skud_4.94 Chr4 (163372..164715) [1344 bp, 447 aa] {ON} YDL161W
           (REAL)
          Length = 447

 Score =  571 bits (1471), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 297/455 (65%), Positives = 315/455 (69%), Gaps = 9/455 (1%)

Query: 1   MSKQFVRSAKNLVKGYSSTQVLVRNATSNDNHQVSKDSLIELAEKSYDSADFFEIMDMLD 60
           MSKQFVRSAKNLVKGYSSTQVLVRNATSNDNHQVSKDSLIELAEKSYDSADFFEIMDMLD
Sbjct: 1   MSKQFVRSAKNLVKGYSSTQVLVRNATSNDNHQVSKDSLIELAEKSYDSADFFEIMDMLD 60

Query: 61  KRLNDKGKYWRHIAKALTVIDYLIRFGSENCVLWCRENLYIIKTLKEFRHEDDEGIDQGQ 120
           KRLNDKGKYWRHIAKALTV+DYLIRFGSENCVLWC+ENLYIIKTLKEFRHEDDEG+DQGQ
Sbjct: 61  KRLNDKGKYWRHIAKALTVLDYLIRFGSENCVLWCKENLYIIKTLKEFRHEDDEGVDQGQ 120

Query: 121 IVRVKAKELTALLSDDERLNEEXXXXXXXXXXXXXXXXXXXXSDENDDDLQRAISASRLT 180
           IVRVKAKELT LLSDDERLNEE                    +DE+DDDLQRAI ASR+T
Sbjct: 121 IVRVKAKELTTLLSDDERLNEERNMNIKGRSRKGRKRRGTGRNDEDDDDLQRAIDASRMT 180

Query: 181 AXXXXXXXXXXXXXXTALQLSKEEEELKRXXXXXXXXXXXXXXXXXXPMYYDIFGNPITP 240
           A              TALQLSKEEEELKR                  PMYYDIFGNPITP
Sbjct: 181 AEEDERRRKQDEDYETALQLSKEEEELKRLQDLQRMQQVHAQQQQQQPMYYDIFGNPITP 240

Query: 241 EEYA-XXXXXXXXXXXXXXXXXXPMYYDVFGNPITPXXXXXXXXXXXXXXXXXXXXXXXX 299
           EEYA                    MYYDVFGNPI+P                        
Sbjct: 241 EEYAQFQLQQQQQQLQQQQQQQEAMYYDVFGNPISPEELAHFQQQQYIASLQQQQQVP-- 298

Query: 300 XXXMSNNPFAKSEQSSSSPKRNQLVAASSPXXXXXXXXXEPLIQNRTGNQSMTDKYSKLN 359
               SNNPFAK  Q  +S K++Q   ASS          +PL Q RTGNQSMTDKY KLN
Sbjct: 299 ----SNNPFAKPNQEVTSQKQDQSFMASS--SMQQQQQQQPLTQTRTGNQSMTDKYGKLN 352

Query: 360 ELLATGTGIDTFGNVGEARIPAQHTKTGTFINSQGTGYRQVSDDPNHNPFLNSQYTGLPS 419
           ELLATGTGIDTFGNVG++R+PAQHTKTGTFINSQGTGYRQVS+DP  NPFLNSQYTGLPS
Sbjct: 353 ELLATGTGIDTFGNVGDSRVPAQHTKTGTFINSQGTGYRQVSNDPKQNPFLNSQYTGLPS 412

Query: 420 TSVVPTQTGYGFXXXXXXXXXXXXXXXRGYTLIDL 454
           T++VPTQTGYGF               +GYTLIDL
Sbjct: 413 TNIVPTQTGYGFGNQPQQQSQNNRSNSQGYTLIDL 447

>Smik_4.75 Chr4 (144483..145865) [1383 bp, 460 aa] {ON} YDL161W
           (REAL)
          Length = 460

 Score =  554 bits (1428), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 294/461 (63%), Positives = 317/461 (68%), Gaps = 8/461 (1%)

Query: 1   MSKQFVRSAKNLVKGYSSTQVLVRNATSNDNHQVSKDSLIELAEKSYDSADFFEIMDMLD 60
           MSKQFVRSAKNLVKGYSSTQVLVRNATSNDNHQVSKDSLIELAEKSYDSADFFEIMDMLD
Sbjct: 1   MSKQFVRSAKNLVKGYSSTQVLVRNATSNDNHQVSKDSLIELAEKSYDSADFFEIMDMLD 60

Query: 61  KRLNDKGKYWRHIAKALTVIDYLIRFGSENCVLWCRENLYIIKTLKEFRHEDDEGIDQGQ 120
           KRLNDKGKYWRHIAKALTV+DYLIRFGSENCVLWC+ENLYIIKTLKEFRHEDDEGIDQGQ
Sbjct: 61  KRLNDKGKYWRHIAKALTVLDYLIRFGSENCVLWCKENLYIIKTLKEFRHEDDEGIDQGQ 120

Query: 121 IVRVKAKELTALLSDDERLNEEXXXX-XXXXXXXXXXXXXXXXSDENDDDLQRAISASRL 179
           IVRVK+KELTALLSDDERLNEE                     S++ND+DLQRA+ ASR+
Sbjct: 121 IVRVKSKELTALLSDDERLNEERNMNIKGRNRKGRSRRGTGRSSNDNDNDLQRALDASRM 180

Query: 180 TAXXXXXXXXXXXXXXTALQLSKEEEELKRXXXXXXXXXXXXXXXXXXPMYYDIFGNPIT 239
           TA              TALQLSKEEEELKR                  PMYYDIFGNPIT
Sbjct: 181 TAEEDEKRRKMDEDYETALQLSKEEEELKR-LQDLQRMQQLQTQQQQQPMYYDIFGNPIT 239

Query: 240 PEEYAX-XXXXXXXXXXXXXXXXXPMYYDVFGNPITPXXXXXXXXXXXXXXXXXX---XX 295
           PEEYA                   P+YYDVFGNPITP                       
Sbjct: 240 PEEYAQFQLQQQQQLQQQQLQQQQPLYYDVFGNPITPEELAQFQQQQQQQQQQQQQYLAS 299

Query: 296 XXXXXXXMSNNPFAKSEQSSSSPKRNQ--LVAASSPXXXXXXXXXEPLIQNRTGNQSMTD 353
                  + NNPF+KSEQ S   ++ Q   V +S           EPL Q RTGNQSMTD
Sbjct: 300 VQQQQQGIPNNPFSKSEQKSGIEEQGQSSTVDSSMQQQQQQQKQQEPLTQTRTGNQSMTD 359

Query: 354 KYSKLNELLATGTGIDTFGNVGEARIPAQHTKTGTFINSQGTGYRQVSDDPNHNPFLNSQ 413
           KY+KLNELLATGTGIDTFGNVG+AR+PAQHTKTGTFINSQGTGY+QVS+DP +NPFL+ Q
Sbjct: 360 KYNKLNELLATGTGIDTFGNVGDARVPAQHTKTGTFINSQGTGYKQVSNDPKYNPFLSGQ 419

Query: 414 YTGLPSTSVVPTQTGYGFXXXXXXXXXXXXXXXRGYTLIDL 454
           YTGLPST+VVPTQTGYGF               +GY LIDL
Sbjct: 420 YTGLPSTNVVPTQTGYGFGNQPQQQSQNNHLNNQGYALIDL 460

>Suva_4.83 Chr4 (155278..156666) [1389 bp, 462 aa] {ON} YDL161W
           (REAL)
          Length = 462

 Score =  550 bits (1418), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 290/465 (62%), Positives = 311/465 (66%), Gaps = 14/465 (3%)

Query: 1   MSKQFVRSAKNLVKGYSSTQVLVRNATSNDNHQVSKDSLIELAEKSYDSADFFEIMDMLD 60
           MSKQ VRSAKNLVKGYSSTQVLVRNATSNDN+QVSKDSLIELAEKSYDSADFFEIMDMLD
Sbjct: 1   MSKQLVRSAKNLVKGYSSTQVLVRNATSNDNNQVSKDSLIELAEKSYDSADFFEIMDMLD 60

Query: 61  KRLNDKGKYWRHIAKALTVIDYLIRFGSENCVLWCRENLYIIKTLKEFRHEDDEGIDQGQ 120
           KRLNDKGKYWRHIAKALTV+DYLIRFGSENCVLWC+ENLYIIKTLKEFRH+DDEG DQGQ
Sbjct: 61  KRLNDKGKYWRHIAKALTVLDYLIRFGSENCVLWCKENLYIIKTLKEFRHDDDEGTDQGQ 120

Query: 121 IVRVKAKELTALLSDDERLNEEXXXXXXXXXXXXXXXXXXXXSDENDDDLQRAISASRLT 180
           IVRVKAKELT+LLSD+ERLNEE                    S E+DDDLQRAI ASR+T
Sbjct: 121 IVRVKAKELTSLLSDEERLNEERNMNIKGRNRGGRRRRRTNRSSEDDDDLQRAIDASRMT 180

Query: 181 AXXXXXXXXXXXXXXTALQLSKEEEELKRXXXXXXXXXXXXXXXXXXPMYYDIFGNPITP 240
           A              TALQLSKEEEELKR                  PMY DIFGNPITP
Sbjct: 181 ADEDERRRKQDEDYETALQLSKEEEELKRLQDLQRIQAQQQQQQQQQPMYCDIFGNPITP 240

Query: 241 EEYAXXXXXXXXXXXXXXXXXX----PMYYDVFGNPITPXXXXXXXXXXXXXXXXXXXXX 296
           EEYA                      PMYYD+FGNPI+P                     
Sbjct: 241 EEYAQFQLEQQQQQLLQLQQQQQQQQPMYYDMFGNPISPEELAQFQQEQQQQLYLSSLQQ 300

Query: 297 XXXXXXMSNNPFAKSEQSSSSPKRNQ--LVAASSPXXXXXXXXX-----EPLIQNRTGNQ 349
                  SNNPFAK  Q +S  +++Q  +  +S P              EPL Q RTGNQ
Sbjct: 301 QQAT---SNNPFAKPNQEASPQRQDQPSMNTSSMPQQQQQQQQQQQQQQEPLTQTRTGNQ 357

Query: 350 SMTDKYSKLNELLATGTGIDTFGNVGEARIPAQHTKTGTFINSQGTGYRQVSDDPNHNPF 409
           SMTDKYSKLNELL TGTGIDTFGN G+ R+PAQHTKTGTFINSQGTGYRQVS+DP HNPF
Sbjct: 358 SMTDKYSKLNELLGTGTGIDTFGNFGDTRVPAQHTKTGTFINSQGTGYRQVSNDPKHNPF 417

Query: 410 LNSQYTGLPSTSVVPTQTGYGFXXXXXXXXXXXXXXXRGYTLIDL 454
           LNSQYTGLPST+VVP QTGYGF               +GY LIDL
Sbjct: 418 LNSQYTGLPSTNVVPAQTGYGFGNQPQQQSQTNGTNSQGYALIDL 462

>TDEL0C02050 Chr3 (355071..356576) [1506 bp, 501 aa] {ON} Anc_7.342
           YLR206W
          Length = 501

 Score =  291 bits (744), Expect = 8e-93,   Method: Compositional matrix adjust.
 Identities = 154/248 (62%), Positives = 171/248 (68%), Gaps = 7/248 (2%)

Query: 1   MSKQFVRSAKNLVKGYSSTQVLVRNATSNDNHQVSKDSLIELAEKSYDSADFFEIMDMLD 60
           MSKQFVRSAKN+VKGYSS QVLVRNAT+N++   S D L ELAEK+YDS +FFEIMDM+D
Sbjct: 1   MSKQFVRSAKNVVKGYSSAQVLVRNATANESEGPSVDELDELAEKTYDSVEFFEIMDMID 60

Query: 61  KRLNDKGKYWRHIAKALTVIDYLIRFGSENCVLWCRENLYIIKTLKEFRHEDDEGIDQGQ 120
           KRLNDKGKYWRHIAK+LTV+DYL+RFGSENCVLWCRENLY+IKTL EFR++DD G+DQGQ
Sbjct: 61  KRLNDKGKYWRHIAKSLTVLDYLVRFGSENCVLWCRENLYVIKTLMEFRNDDDGGVDQGQ 120

Query: 121 IVRVKAKELTALLSDDERLNEEXXXXXX-XXXXXXXXXXXXXXSDENDDDLQRAISASRL 179
           I+RVKAKELT LLSDDERL EE                      D  DDDLQRA+  SRL
Sbjct: 121 IIRVKAKELTNLLSDDERLREEREMNRKGRKNGTRRRRRTTGEQDGFDDDLQRALDESRL 180

Query: 180 TAXXXXXXXXXXXXX----XTALQLSKEEEELKRXXXXXXXXXXXXXXXXXXPMYYDIFG 235
           TA                   ALQLSKEEEELKR                    YYDIFG
Sbjct: 181 TAEEDERRRKMLGSEDDDLQAALQLSKEEEELKRLQEMQKLQQQQTQQQPS--QYYDIFG 238

Query: 236 NPITPEEY 243
           NPI+PEEY
Sbjct: 239 NPISPEEY 246

 Score =  150 bits (379), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 66/87 (75%), Positives = 78/87 (89%)

Query: 345 RTGNQSMTDKYSKLNELLATGTGIDTFGNVGEARIPAQHTKTGTFINSQGTGYRQVSDDP 404
           RTG+ +MT+KY +LN+LLATGTGIDTFGN G+ARIPAQHTKTGTFINSQGTGYRQV+ +P
Sbjct: 390 RTGDLAMTEKYGELNKLLATGTGIDTFGNTGDARIPAQHTKTGTFINSQGTGYRQVTGEP 449

Query: 405 NHNPFLNSQYTGLPSTSVVPTQTGYGF 431
             NPFL SQYTG+PS+++VP  TGYGF
Sbjct: 450 KKNPFLQSQYTGIPSSNIVPAHTGYGF 476

>ZYRO0F11550g Chr6 complement(947131..948747) [1617 bp, 538 aa] {ON}
           some similarities with uniprot|Q12518 Saccharomyces
           cerevisiae YDL161W ENT1
          Length = 538

 Score =  271 bits (694), Expect = 8e-85,   Method: Compositional matrix adjust.
 Identities = 141/245 (57%), Positives = 161/245 (65%), Gaps = 5/245 (2%)

Query: 1   MSKQFVRSAKNLVKGYSSTQVLVRNATSNDNHQVSKDSLIELAEKSYDSADFFEIMDMLD 60
           M  QFVRSAKN +KGY+S QVLVR+AT+N+    S D L ELA +SYDS +FFEIMDM+D
Sbjct: 1   MPTQFVRSAKNALKGYTSAQVLVRDATANEVEGPSVDMLDELAHRSYDSVEFFEIMDMID 60

Query: 61  KRLNDKGKYWRHIAKALTVIDYLIRFGSENCVLWCRENLYIIKTLKEFRHEDDEGIDQGQ 120
           KRLNDKGKYWRH+AK+LTV+DYL+RFGSENCVLWCRENLYIIKTL+EFRH+DD   D GQ
Sbjct: 61  KRLNDKGKYWRHVAKSLTVLDYLVRFGSENCVLWCRENLYIIKTLREFRHDDDGTQDGGQ 120

Query: 121 IVRVKAKELTALLSDDERLNEEXXXXXXXXXXXXXXXXXXXXSDENDDDLQRAISASRLT 180
           I+RVKAKELT LL DDERL  E                     +  D ++QRA+ ASRLT
Sbjct: 121 IIRVKAKELTNLLMDDERLRMERGEDKGAPPRMMSPSPPTPRRNSYDSEMQRALDASRLT 180

Query: 181 AXXXXXXXXXXXXX----XTALQLSKEEEELKRXXXXXXXXXXXXXXXXXXPM-YYDIFG 235
           A                  TALQLSKEEEELKR                  P  YYDIFG
Sbjct: 181 AEEDERRRKTLNNEDADLETALQLSKEEEELKRLQELQKAQQDQQRLSQMQPQGYYDIFG 240

Query: 236 NPITP 240
           NPI+P
Sbjct: 241 NPISP 245

 Score =  146 bits (369), Expect = 5e-38,   Method: Compositional matrix adjust.
 Identities = 64/93 (68%), Positives = 82/93 (88%)

Query: 339 EPLIQNRTGNQSMTDKYSKLNELLATGTGIDTFGNVGEARIPAQHTKTGTFINSQGTGYR 398
           +P+   RTGNQS++DKY+ LN+LLA  TG+DTFGNVG+ARIPAQHTKTGTFINSQGTG++
Sbjct: 418 QPMQPVRTGNQSISDKYNDLNQLLAQPTGVDTFGNVGDARIPAQHTKTGTFINSQGTGFK 477

Query: 399 QVSDDPNHNPFLNSQYTGLPSTSVVPTQTGYGF 431
           Q S++P  NPFL +Q+TG+P++SVVP+ TGYGF
Sbjct: 478 QYSNEPKKNPFLPTQFTGIPTSSVVPSHTGYGF 510

>KNAG0C03800 Chr3 (746891..748234) [1344 bp, 447 aa] {ON} Anc_7.342
           YLR206W
          Length = 447

 Score =  268 bits (685), Expect = 1e-84,   Method: Compositional matrix adjust.
 Identities = 133/244 (54%), Positives = 168/244 (68%), Gaps = 5/244 (2%)

Query: 5   FVRSAKNLVKGYSSTQVLVRNATSNDNHQVSKDSLIELAEKSYDSADFFEIMDMLDKRLN 64
            +RSAKN+VKGYS T+VLVR+AT+N++   S++ L +LA+KSY+S +FFEI+DMLDKR+N
Sbjct: 1   MLRSAKNIVKGYSDTEVLVRDATANNSTNPSRELLDDLADKSYNSVEFFEILDMLDKRIN 60

Query: 65  DKGKYWRHIAKALTVIDYLIRFGSENCVLWCRENLYIIKTLKEFRHEDDEGIDQGQIVRV 124
           DKGKYWRH+AKALTV+DYL+RFGSENCV+WC+ENLYIIKTL+EF HED  G D+G+I+RV
Sbjct: 61  DKGKYWRHVAKALTVLDYLVRFGSENCVIWCQENLYIIKTLREFSHEDAGGEDEGKIIRV 120

Query: 125 KAKELTALLSDDERLNEEXXXXXXXXXX-XXXXXXXXXXSDENDDDLQRAISASRLTAXX 183
           KAKELT+LL D+ERL EE                     ++ +D+DLQRAI  S+ TA  
Sbjct: 121 KAKELTSLLMDEERLKEERAMNIRRRGGPKRRSGGSRERNNRSDEDLQRAIEESKRTAEE 180

Query: 184 XXXX----XXXXXXXXTALQLSKEEEELKRXXXXXXXXXXXXXXXXXXPMYYDIFGNPIT 239
                            ALQLS+EEE+L+R                  PMYYD+FGNPIT
Sbjct: 181 EERRRRNGASSEADRQAALQLSREEEDLRRLQEQARLAQQQQQQQQQQPMYYDVFGNPIT 240

Query: 240 PEEY 243
           PEEY
Sbjct: 241 PEEY 244

 Score =  164 bits (415), Expect = 5e-45,   Method: Compositional matrix adjust.
 Identities = 80/128 (62%), Positives = 95/128 (74%), Gaps = 1/128 (0%)

Query: 304 SNNPFAKSEQSSSSPKRNQLVAASSPXXXXXXXXXEPLIQNRTGNQSMTDKYSKLNELLA 363
           SNNPFA +  +  S   +   AA            +PL Q R+GNQ+++DKYS LN LLA
Sbjct: 299 SNNPFALNNATQPSAPAS-TTAARPAAIETPATQTKPLTQTRSGNQAISDKYSALNNLLA 357

Query: 364 TGTGIDTFGNVGEARIPAQHTKTGTFINSQGTGYRQVSDDPNHNPFLNSQYTGLPSTSVV 423
           +GTGIDTFGN GE RIPAQHT+TGTFINSQGTGYRQV++D   NPFLN QYTGLPST++V
Sbjct: 358 SGTGIDTFGNTGEQRIPAQHTQTGTFINSQGTGYRQVNNDDKPNPFLNGQYTGLPSTNIV 417

Query: 424 PTQTGYGF 431
           PTQTG+GF
Sbjct: 418 PTQTGFGF 425

>SAKL0F10934g Chr6 (856966..858462) [1497 bp, 498 aa] {ON} some
           similarities with uniprot|Q12518 Saccharomyces
           cerevisiae YDL161W ENT1
          Length = 498

 Score =  267 bits (682), Expect = 1e-83,   Method: Compositional matrix adjust.
 Identities = 144/251 (57%), Positives = 168/251 (66%), Gaps = 9/251 (3%)

Query: 1   MSKQFVRSAKNLVKGYSSTQVLVRNATSNDNHQVSKDSLIELAEKSYDSADFFEIMDMLD 60
           MSK  +R+AKN+V GYSS QVLVRNATSN+    + D L ELAEK+YD+ +FFEIMDMLD
Sbjct: 1   MSKALLRTAKNVVNGYSSVQVLVRNATSNEPTGPTVDQLDELAEKTYDNVEFFEIMDMLD 60

Query: 61  KRLNDKGKYWRHIAKALTVIDYLIRFGSENCVLWCRENLYIIKTLKEFRHEDDEGIDQGQ 120
           KRLNDKGK WRH+AK+LTV+DYL+R+GSENCVLW +ENLYIIKTL+EF HED+ G+D GQ
Sbjct: 61  KRLNDKGKNWRHVAKSLTVLDYLVRYGSENCVLWSQENLYIIKTLREFMHEDEMGVDHGQ 120

Query: 121 IVRVKAKELTALLSDDERLNEEXXXXXXXXXXXXXXXXXXXXSDENDDDLQRAISASRLT 180
           I+RVKAKELT+LL D+ERL EE                     +E DDDLQRA+  SRLT
Sbjct: 121 IIRVKAKELTSLLRDEERLTEE-RNMRKKRRGKTRRPERSRGGEEYDDDLQRALEESRLT 179

Query: 181 AXXXXXXXXXXXXX------XTALQLSKEEEELKRXXX--XXXXXXXXXXXXXXXPMYYD 232
           A                    TALQLSKEEEEL+R                    PMYYD
Sbjct: 180 AEEEERRRRTDSGSNDDDDFQTALQLSKEEEELRRLRNLQMQQQQTAMFQQQQQQPMYYD 239

Query: 233 IFGNPITPEEY 243
           +FGNPITPEEY
Sbjct: 240 VFGNPITPEEY 250

 Score =  144 bits (363), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 76/134 (56%), Positives = 96/134 (71%), Gaps = 6/134 (4%)

Query: 304 SNNPFAKSEQSSS----SPKRNQLVAASSPXXXXXXXXXEPLIQ-NRTGNQSMTDKYSKL 358
           SNNPFA   Q       +PK ++ VA ++          +  +   RTGNQS++ KY+ L
Sbjct: 329 SNNPFALGRQEPDEEQITPKVSESVATTAGTTTATTTTQQQALNPTRTGNQSISQKYNDL 388

Query: 359 NELLATGTGIDTFGNVGEARIPAQHTKTGTFINSQGTGYRQVSDD-PNHNPFLNSQYTGL 417
           N LLA+GTG+DTFGN G+ RIPAQHT+TG FINSQGTGY+QV++D P +NPFL +QYTGL
Sbjct: 389 NNLLASGTGLDTFGNTGQTRIPAQHTRTGNFINSQGTGYKQVTNDQPKNNPFLAAQYTGL 448

Query: 418 PSTSVVPTQTGYGF 431
           PSTSVVP+ TGYGF
Sbjct: 449 PSTSVVPSYTGYGF 462

 Score = 30.8 bits (68), Expect = 8.5,   Method: Compositional matrix adjust.
 Identities = 11/11 (100%), Positives = 11/11 (100%)

Query: 265 YYDVFGNPITP 275
           YYDVFGNPITP
Sbjct: 237 YYDVFGNPITP 247

>NCAS0H00670 Chr8 (117595..119046) [1452 bp, 483 aa] {ON} Anc_7.342
          Length = 483

 Score =  265 bits (677), Expect = 6e-83,   Method: Compositional matrix adjust.
 Identities = 150/257 (58%), Positives = 174/257 (67%), Gaps = 15/257 (5%)

Query: 1   MSKQFVRSAKNLVKGYSSTQVLVRNATSNDNHQVSKDSLIELAEKSYDSADFFEIMDMLD 60
           MSKQFVRSAKN+VKGYS+TQVLVR+ATSND    S + L ELA++S+DS DFFEIMDMLD
Sbjct: 1   MSKQFVRSAKNMVKGYSTTQVLVRDATSNDASNPSFELLYELAQRSFDSVDFFEIMDMLD 60

Query: 61  KRLNDKGKYWRHIAKALTVIDYLIRFGSENCVLWCRENLYIIKTLKEFRHEDDEGIDQGQ 120
           KRLNDKGKYWRH+AK+LTV+DYL+RFGSENCVLWC+ENLYIIKTL+EFRHEDD G DQGQ
Sbjct: 61  KRLNDKGKYWRHVAKSLTVLDYLVRFGSENCVLWCKENLYIIKTLREFRHEDDGGADQGQ 120

Query: 121 IVRVKAKELTALLSDDERLNEEXXXXXX-------XXXXXXXXXXXXXXSDENDDDLQRA 173
           I+RVKAKELT+LL D+ERL EE                           +DE+ D+LQRA
Sbjct: 121 IIRVKAKELTSLLLDEERLKEERTINLKNRRDGDMKGRRRRRGTRNGRGNDEDQDELQRA 180

Query: 174 ISASRLTAXXXXXXXXXXXX-------XXTALQLSKEEEELKRXXXXXXXXXXXXXXXXX 226
           +  SRLTA                     TALQLSKEEEELK+                 
Sbjct: 181 LEESRLTAEEDERRRRQMAQYDDQDPDLQTALQLSKEEEELKKLQEMQRLQQQQGQMNQP 240

Query: 227 XPMYYDIFGNPITPEEY 243
              Y+DIFGNPI+P+EY
Sbjct: 241 QG-YFDIFGNPISPDEY 256

 Score =  162 bits (411), Expect = 3e-44,   Method: Compositional matrix adjust.
 Identities = 79/114 (69%), Positives = 90/114 (78%), Gaps = 4/114 (3%)

Query: 345 RTGNQSMTDKYSKLNELLATGTGIDTFGNVGEARIPAQHTKTGTFINSQGTGYRQVSDDP 404
           RTGNQS+TDKYS+LN LLATGTGIDTFGN GE RIPAQHT+TGTFINSQGTGYRQV++DP
Sbjct: 370 RTGNQSITDKYSQLNTLLATGTGIDTFGNTGEQRIPAQHTQTGTFINSQGTGYRQVTNDP 429

Query: 405 NHNPFLNSQYTGLPSTSVVPTQTGYGFXXXXXXXXXXXXXXX----RGYTLIDL 454
            +NPFLNSQYTGLPST++V TQTGYGF                   +G++LIDL
Sbjct: 430 KNNPFLNSQYTGLPSTNIVSTQTGYGFGNAPSQQQQQQQQQQQRPDQGFSLIDL 483

>TPHA0D04560 Chr4 complement(994552..996015) [1464 bp, 487 aa] {ON}
           Anc_7.342 YLR206W
          Length = 487

 Score =  265 bits (676), Expect = 8e-83,   Method: Compositional matrix adjust.
 Identities = 148/247 (59%), Positives = 169/247 (68%), Gaps = 12/247 (4%)

Query: 1   MSKQFVRSAKNLVKGYSSTQVLVRNATSNDNHQVSKDSLIELAEKSYDSADFFEIMDMLD 60
           MS QFVRS KN+VKGYSSTQVLVRNAT+N+    + D L ++AEK+YDSADFFEIMDMLD
Sbjct: 1   MSNQFVRSMKNVVKGYSSTQVLVRNATANEGTGPNIDLLADIAEKTYDSADFFEIMDMLD 60

Query: 61  KRLNDKGKYWRHIAKALTVIDYLIRFGSENCVLWCRENLYIIKTLKEFRHEDDE--GIDQ 118
           KRLNDKGKYW+HIAK+LTV+DYL+RFGSENCVLWC+ENLY+IKTL EFR+ED+   G+DQ
Sbjct: 61  KRLNDKGKYWKHIAKSLTVLDYLVRFGSENCVLWCKENLYLIKTLTEFRYEDENSGGVDQ 120

Query: 119 GQIVRVKAKELTALLSDDERLNEEXXXXXXXXXXXXXXXXXXXXSDENDDDLQRAISASR 178
           GQI+RVKAKELTALL DDERL EE                    SDE   DLQRA+  SR
Sbjct: 121 GQIIRVKAKELTALLMDDERLREERRLNNRRDRNRNRRPPARNGSDE---DLQRALEESR 177

Query: 179 LTAXXXXXXXXXX---XXXXTALQLSKEEEELKRXXXXXXXXXXXXXXXXXXPMYYDIFG 235
            TA                  ALQLSKEEEELKR                  P+YYD+FG
Sbjct: 178 RTAEEDERKRRLNQDDSDLQAALQLSKEEEELKR----LQELQSSMHMQQQQPVYYDVFG 233

Query: 236 NPITPEE 242
           NPI+ EE
Sbjct: 234 NPISYEE 240

 Score =  149 bits (377), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 66/88 (75%), Positives = 80/88 (90%)

Query: 344 NRTGNQSMTDKYSKLNELLATGTGIDTFGNVGEARIPAQHTKTGTFINSQGTGYRQVSDD 403
           NRTGN+ MT+KY++LN+LLA+GTGIDTFGN GE RIPAQHT+TGTFINSQGTGYRQ S +
Sbjct: 374 NRTGNKEMTNKYNELNQLLASGTGIDTFGNTGETRIPAQHTQTGTFINSQGTGYRQQSGE 433

Query: 404 PNHNPFLNSQYTGLPSTSVVPTQTGYGF 431
              NPFL++QYTGLPS++++PTQTGYGF
Sbjct: 434 SKVNPFLSNQYTGLPSSNIIPTQTGYGF 461

>Kpol_2001.70 s2001 complement(192214..193815) [1602 bp, 533 aa]
           {ON} complement(192214..193815) [1602 nt, 534 aa]
          Length = 533

 Score =  266 bits (679), Expect = 9e-83,   Method: Compositional matrix adjust.
 Identities = 143/244 (58%), Positives = 165/244 (67%), Gaps = 8/244 (3%)

Query: 1   MSKQFVRSAKNLVKGYSSTQVLVRNATSNDNHQVSKDSLIELAEKSYDSADFFEIMDMLD 60
           M KQFVRSAKN+VKGYSSTQV+VRNATSND+     D+L  LAEK+YDS +FFEIMDMLD
Sbjct: 1   MPKQFVRSAKNVVKGYSSTQVMVRNATSNDSGGPDIDTLDALAEKTYDSVEFFEIMDMLD 60

Query: 61  KRLNDKGKYWRHIAKALTVIDYLIRFGSENCVLWCRENLYIIKTLKEFRHEDDEGIDQGQ 120
           KRLNDKGKYW+HIAK+LTV+DYL+RFGSENCVLWC+ENLYII+TLKEF + DD   DQGQ
Sbjct: 61  KRLNDKGKYWKHIAKSLTVLDYLVRFGSENCVLWCKENLYIIQTLKEFSYIDDSDHDQGQ 120

Query: 121 IVRVKAKELTALLSDDERLNEEXXXXXXXXXXXXXXXXXXXXSDENDDDLQRAISASRLT 180
           I+RVKAKELT+LL+D+ERL +E                       +DD+LQRAI  S+ T
Sbjct: 121 IIRVKAKELTSLLNDEERLRDERGMNRRGGRRERARPRRRPS---DDDELQRAIEESKRT 177

Query: 181 A----XXXXXXXXXXXXXXTALQLSKEEEELK-RXXXXXXXXXXXXXXXXXXPMYYDIFG 235
           A                  TALQLSKEEEELK                    PMYYDIFG
Sbjct: 178 AEDDDRRRRMRDDEEADLQTALQLSKEEEELKRLQELQRLQQQQQQQQQQQQPMYYDIFG 237

Query: 236 NPIT 239
           NPI+
Sbjct: 238 NPIS 241

 Score =  161 bits (407), Expect = 3e-43,   Method: Compositional matrix adjust.
 Identities = 71/87 (81%), Positives = 82/87 (94%)

Query: 345 RTGNQSMTDKYSKLNELLATGTGIDTFGNVGEARIPAQHTKTGTFINSQGTGYRQVSDDP 404
           RTGNQ +TDK+ +LN+LLA+GTGIDTFGN GEARIPAQHTKTGTFINSQGTGYRQV++DP
Sbjct: 384 RTGNQDITDKFGELNQLLASGTGIDTFGNTGEARIPAQHTKTGTFINSQGTGYRQVTNDP 443

Query: 405 NHNPFLNSQYTGLPSTSVVPTQTGYGF 431
            +NPFLNSQYTGLPST++VP+ TGYGF
Sbjct: 444 KNNPFLNSQYTGLPSTNIVPSHTGYGF 470

>KAFR0L01460 Chr12 complement(270433..272085) [1653 bp, 550 aa] {ON}
           Anc_7.342 YLR206W
          Length = 550

 Score =  261 bits (668), Expect = 7e-81,   Method: Compositional matrix adjust.
 Identities = 144/260 (55%), Positives = 170/260 (65%), Gaps = 17/260 (6%)

Query: 1   MSKQFVRSAKNLVKGYSSTQVLVRNATSNDNHQVSKDSLIELAEKSYDSADFFEIMDMLD 60
           MSKQFVRSAKN++KGYSSTQVLVR+ATSNDN   + D+L ++A +SYDS DFFEIMDMLD
Sbjct: 1   MSKQFVRSAKNVMKGYSSTQVLVRDATSNDNRVTNIDTLDDIASRSYDSVDFFEIMDMLD 60

Query: 61  KRLNDKGKYWRHIAKALTVIDYLIRFGSENCVLWCRENLYIIKTLKEFRHEDDEGIDQGQ 120
           KRLNDKGKYW+HI K+LTV+DYL+RFGSENCVLWC+ENLY+IKTL+EFR+EDD GIDQGQ
Sbjct: 61  KRLNDKGKYWKHIVKSLTVLDYLVRFGSENCVLWCKENLYVIKTLREFRYEDDTGIDQGQ 120

Query: 121 IVRVKAKELTALLSDDERLNEEXXXXXXXXXXXXXXXXXXXXSDE-------NDDDLQRA 173
           I+RVKAKELT+LL D+ERL EE                    +         +DDDLQR 
Sbjct: 121 IIRVKAKELTSLLQDEERLREERRFNNRRNRRNNRSANRSRATSRSQSNIGPDDDDLQRV 180

Query: 174 ISASRLTAXXXXXXXXXXX-------XXXTALQLSKEEEELKR---XXXXXXXXXXXXXX 223
           I  S+ TA                      ALQLSKEEEELK                  
Sbjct: 181 IEESKKTAEEDERRRKELARYDEEDPEFQAALQLSKEEEELKNLQDLQRQQQQLQMLQQQ 240

Query: 224 XXXXPMYYDIFGNPITPEEY 243
                +YYD+FGNPI+ +EY
Sbjct: 241 QTSANVYYDVFGNPISYDEY 260

 Score =  144 bits (363), Expect = 4e-37,   Method: Compositional matrix adjust.
 Identities = 64/89 (71%), Positives = 80/89 (89%), Gaps = 1/89 (1%)

Query: 344 NRTGNQSMTDKYSKLNELLATGTGIDTFGNVGEARIPAQHTKTGTFINSQGTGYRQVSDD 403
           NRTGN+ +T+KYS+LN LLA GTG+DTFGN G+ RIPAQHTKTGTFINSQGTGY+QV+++
Sbjct: 388 NRTGNEEITEKYSELNNLLAQGTGVDTFGNTGQERIPAQHTKTGTFINSQGTGYKQVTNE 447

Query: 404 -PNHNPFLNSQYTGLPSTSVVPTQTGYGF 431
              +NPFLN+QYTGLPS+++VP+ TGYGF
Sbjct: 448 RSKNNPFLNTQYTGLPSSNIVPSSTGYGF 476

>CAGL0A03872g Chr1 complement(392922..394454) [1533 bp, 510 aa] {ON}
           highly similar to uniprot|Q05785 Saccharomyces
           cerevisiae YLR206w ENT2
          Length = 510

 Score =  259 bits (662), Expect = 2e-80,   Method: Compositional matrix adjust.
 Identities = 139/255 (54%), Positives = 167/255 (65%), Gaps = 16/255 (6%)

Query: 1   MSKQFVRSAKNLVKGYSSTQVLVRNATSNDNHQVSKDSLIELAEKSYDSADFFEIMDMLD 60
           M  Q VRSAKN+VKGYSSTQV+VR+AT+ND+   S   L +LA+K+YD+ +FFEIMDMLD
Sbjct: 1   MPSQLVRSAKNMVKGYSSTQVMVRDATANDSTSPSVGVLEDLADKTYDTVEFFEIMDMLD 60

Query: 61  KRLNDKGKYWRHIAKALTVIDYLIRFGSENCVLWCRENLYIIKTLKEFRHEDD-EGIDQG 119
           KRLNDKGKYWRH+AK+LTV+DYL+RFGSENCVLWC+ENLYIIKTL+EFRHED+  G D+G
Sbjct: 61  KRLNDKGKYWRHVAKSLTVLDYLVRFGSENCVLWCKENLYIIKTLREFRHEDEVSGSDEG 120

Query: 120 QIVRVKAKELTALLSDDERLNEEXXXXX-------XXXXXXXXXXXXXXXSDENDDDLQR 172
           QI+RVKAKELT+LL+DDERL EE                            +  DDDLQ+
Sbjct: 121 QIIRVKAKELTSLLTDDERLREERALNRANRRNGDAKRRRRRSRSRSTSYRNAYDDDLQK 180

Query: 173 AISASRLTAXXXXXXXXXXXXXX-------TALQLSKEEEELKRXXXXXXXXXXXXXXXX 225
           A+  SR+TA                      ALQLSKEEEELK+                
Sbjct: 181 ALEESRMTAEEEEARRREQAQYENQDPDLLAALQLSKEEEELKKLQDMQRMQELQAQQQQ 240

Query: 226 XXPMYYDIFGNPITP 240
              +YYDIFGNPI+P
Sbjct: 241 QN-VYYDIFGNPISP 254

 Score =  159 bits (401), Expect = 1e-42,   Method: Compositional matrix adjust.
 Identities = 70/89 (78%), Positives = 84/89 (94%)

Query: 343 QNRTGNQSMTDKYSKLNELLATGTGIDTFGNVGEARIPAQHTKTGTFINSQGTGYRQVSD 402
           + RTGNQS++DKYS+LN LLA+GTGIDTFGN GEARIPAQHTKTGTFINSQGTGY+QV++
Sbjct: 360 KTRTGNQSISDKYSELNNLLASGTGIDTFGNTGEARIPAQHTKTGTFINSQGTGYKQVTN 419

Query: 403 DPNHNPFLNSQYTGLPSTSVVPTQTGYGF 431
           +P +NPFL+SQYTGLPST++VP+ TGYGF
Sbjct: 420 EPKNNPFLSSQYTGLPSTNIVPSHTGYGF 448

>Skud_12.270 Chr12 (501192..503072) [1881 bp, 626 aa] {ON} YLR206W
           (REAL)
          Length = 626

 Score =  253 bits (647), Expect = 4e-77,   Method: Compositional matrix adjust.
 Identities = 136/276 (49%), Positives = 167/276 (60%), Gaps = 35/276 (12%)

Query: 1   MSKQFVRSAKNLVKGYSSTQVLVRNATSNDNHQVSKDSLIELAEKSYDSADFFEIMDMLD 60
           M KQFVRSAKN+VKGYSSTQVLVR+AT+ND+   S D+L +LA++SYDS DFFEIMDMLD
Sbjct: 1   MPKQFVRSAKNMVKGYSSTQVLVRDATANDSRTPSIDTLDDLAQRSYDSVDFFEIMDMLD 60

Query: 61  KRLNDKGKYWRHIAKALTVIDYLIRFGSENCVLWCRENLYIIKTLKEFRHEDDEGIDQGQ 120
           KRLNDKGKYWRH+AK+LTV+DYL+RFGSENCVLWCREN Y+IKTL+EFRHE++ G D+GQ
Sbjct: 61  KRLNDKGKYWRHVAKSLTVLDYLVRFGSENCVLWCRENFYVIKTLREFRHENESGFDEGQ 120

Query: 121 IVRVKAKELTALLSDDERLNEEXXXXXXXX----------XXXXXXXXXXXXSDENDDDL 170
           I+RVKAKEL +LL+DDERL EE                              S    D+L
Sbjct: 121 IIRVKAKELVSLLNDDERLREERSMNTRNRGANKAPRPGPRRQRTGSNPRDSSPSYQDEL 180

Query: 171 QRAISASRLTAXXXXXXXXXXXXX-------XTALQLS----------------KEEEEL 207
           ++ +  SR+TA                      ALQLS                K+++ L
Sbjct: 181 EKVLEESRITAQEDEQRRRELAQYDDEDPDFQAALQLSKEEEELKQLQELQRLQKQQQPL 240

Query: 208 KRXXXXXXXXXXXXXXXXXXPMYYDIFGNPITPEEY 243
            +                  P YYDIFGNPI+ +EY
Sbjct: 241 SQ--MPVPVQQQQQQQQQQLPAYYDIFGNPISQDEY 274

 Score =  162 bits (409), Expect = 4e-43,   Method: Compositional matrix adjust.
 Identities = 73/92 (79%), Positives = 85/92 (92%)

Query: 340 PLIQNRTGNQSMTDKYSKLNELLATGTGIDTFGNVGEARIPAQHTKTGTFINSQGTGYRQ 399
           PL Q RTGNQS++DKY+ LN LLATGTG+DTFGN GEARIPAQHTKTGTFINSQGTGY+Q
Sbjct: 450 PLEQTRTGNQSISDKYNDLNVLLATGTGLDTFGNTGEARIPAQHTKTGTFINSQGTGYKQ 509

Query: 400 VSDDPNHNPFLNSQYTGLPSTSVVPTQTGYGF 431
           V+ +P +NPFL++QYTGLPST++VPTQTGYGF
Sbjct: 510 VTSEPKNNPFLSNQYTGLPSTNIVPTQTGYGF 541

>NDAI0D00610 Chr4 (133678..135138) [1461 bp, 486 aa] {ON} Anc_7.342
           YDL161W
          Length = 486

 Score =  249 bits (635), Expect = 1e-76,   Method: Compositional matrix adjust.
 Identities = 142/266 (53%), Positives = 174/266 (65%), Gaps = 24/266 (9%)

Query: 1   MSKQFVRSAKNLVKGYSSTQVLVRNATSNDNHQVSKDSLIELAEKSYDSADFFEIMDMLD 60
           MSKQFVRSAKN++KGYS+TQVLVR+ATSND+   S + L E++++S+DS DFFEIMDMLD
Sbjct: 1   MSKQFVRSAKNMMKGYSTTQVLVRDATSNDSSNPSFEILYEISKRSFDSVDFFEIMDMLD 60

Query: 61  KRLNDKGKYWRHIAKALTVIDYLIRFGSENCVLWCRENLYIIKTLKEFRHEDDEGIDQGQ 120
           KRLNDKGKYW+HIAK+LTV+DYL+RFGSENCVLWC++NLYIIKTLKEF+ EDD  +D+  
Sbjct: 61  KRLNDKGKYWKHIAKSLTVLDYLVRFGSENCVLWCKQNLYIIKTLKEFKLEDD-NVDESS 119

Query: 121 IVRVKAKELTALLSDDERLNEEXXXXXXXXXXXXXXXXXXXXSD------ENDDDLQRAI 174
           I+RVKAKELTALL DDERL EE                    ++      ++D+DLQ+A+
Sbjct: 120 IIRVKAKELTALLQDDERLKEERSINLKNNRRSERKNRSRRGTNATRRGTKSDEDLQKAL 179

Query: 175 SASRLTAXXXXXXXXXXXXX-------XTALQLSKEEEELKRXXXXXXXXXXXXXXXXXX 227
             SR+TA                     TALQLSKEEEELK+                  
Sbjct: 180 EESRITAEEDERRRRELAQYDNQDTDYQTALQLSKEEEELKKLQELQRLQQLQQQQQQQM 239

Query: 228 P----------MYYDIFGNPITPEEY 243
                      +YYDIFGNPI+PEEY
Sbjct: 240 QFQQQPQQQEQVYYDIFGNPISPEEY 265

 Score =  149 bits (376), Expect = 3e-39,   Method: Compositional matrix adjust.
 Identities = 78/132 (59%), Positives = 98/132 (74%), Gaps = 4/132 (3%)

Query: 304 SNNPFAKSEQSSSSPKR---NQLVAASSPXXXXXXXXXEPLIQNRTGNQSMTDKYSKLNE 360
           SNNPFA +   ++SP R    Q     +          +PL Q RTGNQS++DKY++LN 
Sbjct: 325 SNNPFALNATINTSPIRPAEQQPQPQFTAPQQQQQPLQQPLKQTRTGNQSISDKYNELNN 384

Query: 361 LLATGTGIDTFGNVGEARIPAQHTKTGTFINSQGTGYRQVSDDP-NHNPFLNSQYTGLPS 419
           LLA+GTGIDTFGN G+ RIPAQHT+TGTFINSQGTGY+Q+ +DP   NPFLN+QYTGLPS
Sbjct: 385 LLASGTGIDTFGNTGDQRIPAQHTQTGTFINSQGTGYKQIVNDPVKKNPFLNNQYTGLPS 444

Query: 420 TSVVPTQTGYGF 431
           +++VP+ TGYGF
Sbjct: 445 SNIVPSHTGYGF 456

>KAFR0B00890 Chr2 (166365..167609) [1245 bp, 414 aa] {ON} Anc_7.342
           YLR206W
          Length = 414

 Score =  244 bits (624), Expect = 6e-76,   Method: Compositional matrix adjust.
 Identities = 127/240 (52%), Positives = 159/240 (66%), Gaps = 9/240 (3%)

Query: 5   FVRSAKNLVKGYSSTQVLVRNATSNDNHQVSKDSLIELAEKSYDSADFFEIMDMLDKRLN 64
            +RSAKNLVKGYSSTQ LVR+ATSN +     D L ELAE +Y++ +FFEIMDMLDKR+N
Sbjct: 1   MLRSAKNLVKGYSSTQKLVRDATSNSHDNPPIDQLSELAEMTYNNMEFFEIMDMLDKRIN 60

Query: 65  DKGKYWRHIAKALTVIDYLIRFGSENCVLWCRENLYIIKTLKEFRHEDDEGIDQGQIVRV 124
            KGKYW+H+ K+L V+DYL+RFGSENCV+WC+ENLYIIKTL+EF +ED+ G+DQGQ+VRV
Sbjct: 61  SKGKYWKHVIKSLIVLDYLVRFGSENCVIWCKENLYIIKTLREFTYEDESGMDQGQMVRV 120

Query: 125 KAKELTALLSDDERLNEEXXXXXXXXXXXXXXXXXXXXSDENDDDLQRA-ISASRLTAXX 183
           +AKELT+LL D+ERL EE                    + ++DDDL+RA   + R     
Sbjct: 121 RAKELTSLLMDEERLREE---RALNRRGGGNRRRAKSRNSDDDDDLERAKEESRRTAREE 177

Query: 184 XXXXXXXXXXXXTALQLSKEEEELKRXXXXXXXXXXXXXXXXXXPMYYDIFGNPITPEEY 243
                        ALQL++EE+EL+                   PMYYDIFGNPITPEEY
Sbjct: 178 EELRRRQEAERQFALQLNQEEQELR-----ALQQLQQQQQQQQQPMYYDIFGNPITPEEY 232

 Score =  160 bits (404), Expect = 9e-44,   Method: Compositional matrix adjust.
 Identities = 91/191 (47%), Positives = 104/191 (54%), Gaps = 28/191 (14%)

Query: 263 PMYYDVFGNPITPXXXXXXXXXXXXXXXXXXXXXXXXXXXM------------------- 303
           PMYYD+FGNPITP                                               
Sbjct: 217 PMYYDIFGNPITPEEYLQFQQRQAALAQQQALLAQQEQQYWAQQQAAFLSQQQQQQQQPL 276

Query: 304 ---SNNPFAKSEQSSSSPKRNQLVAASSPXXXXXXXXXEPLIQNRTGNQSMTDKYSKLNE 360
              SNNPFA +       K+ Q                 PL Q RTG+QS++DKYS LN 
Sbjct: 277 ATGSNNPFALNN------KKLQQHTPEPSVIDTTLNTQAPLKQTRTGSQSISDKYSALNT 330

Query: 361 LLATGTGIDTFGNVGEARIPAQHTKTGTFINSQGTGYRQVSDDPNHNPFLNSQYTGLPST 420
           LLATGTGIDTFGN G  RIPAQHTKTGTFINSQGTGY+QVS +  +N FLNSQYTGLPS+
Sbjct: 331 LLATGTGIDTFGNTGNQRIPAQHTKTGTFINSQGTGYKQVSTNGFNNVFLNSQYTGLPSS 390

Query: 421 SVVPTQTGYGF 431
           ++VP+QTGYGF
Sbjct: 391 NIVPSQTGYGF 401

>Smik_12.264 Chr12 (501598..503436) [1839 bp, 612 aa] {ON} YLR206W
           (REAL)
          Length = 612

 Score =  248 bits (632), Expect = 6e-75,   Method: Compositional matrix adjust.
 Identities = 139/265 (52%), Positives = 169/265 (63%), Gaps = 26/265 (9%)

Query: 1   MSKQFVRSAKNLVKGYSSTQVLVRNATSNDNHQVSKDSLIELAEKSYDSADFFEIMDMLD 60
           MSKQFVRSAKN++KGYSSTQVLVR+AT+ND+   S D+L +LA++SYDS DFFEIMDMLD
Sbjct: 1   MSKQFVRSAKNMMKGYSSTQVLVRDATANDSRTPSIDTLDDLAQRSYDSVDFFEIMDMLD 60

Query: 61  KRLNDKGKYWRHIAKALTVIDYLIRFGSENCVLWCRENLYIIKTLKEFRHEDDEGIDQGQ 120
           KRLNDKGKYWRH+AK+LTV+DYL+RFGSENCVLWCREN Y+IKTL+EFRHE++ G D+GQ
Sbjct: 61  KRLNDKGKYWRHVAKSLTVLDYLVRFGSENCVLWCRENFYVIKTLREFRHENESGFDEGQ 120

Query: 121 IVRVKAKELTALLSDDERLNEEXXXXXXXXX----XXXXXXXXXXXSDEND------DDL 170
           I+RVKAKEL +LL+DDERL EE                        S+ +D      +DL
Sbjct: 121 IIRVKAKELVSLLNDDERLREERSMNTRNRRDRSAARPRPRRQRTRSNPHDSSPSYQNDL 180

Query: 171 QRAISASRLTAXXXXXXXXXXXXX-------XTALQLSKEEE---------ELKRXXXXX 214
           ++A+  SR+TA                      ALQLSKEEE          L+      
Sbjct: 181 EKALEESRITAQEDEQRRRELAQYDDEDPDFQAALQLSKEEEELKQLQELQRLQNQQQSL 240

Query: 215 XXXXXXXXXXXXXPMYYDIFGNPIT 239
                        P YYDIFGNPI+
Sbjct: 241 SQMQVPVQQQQEQPAYYDIFGNPIS 265

 Score =  161 bits (407), Expect = 8e-43,   Method: Compositional matrix adjust.
 Identities = 73/92 (79%), Positives = 84/92 (91%)

Query: 340 PLIQNRTGNQSMTDKYSKLNELLATGTGIDTFGNVGEARIPAQHTKTGTFINSQGTGYRQ 399
           PL Q RTGNQS++DKY+ LN LLATGTG DTFGN GEARIPAQHTKTGTFINSQGTGY+Q
Sbjct: 425 PLKQTRTGNQSISDKYNDLNTLLATGTGTDTFGNTGEARIPAQHTKTGTFINSQGTGYKQ 484

Query: 400 VSDDPNHNPFLNSQYTGLPSTSVVPTQTGYGF 431
           V ++P +NPFL++QYTGLPST++VPTQTGYGF
Sbjct: 485 VINEPKNNPFLSNQYTGLPSTNIVPTQTGYGF 516

>Suva_10.300 Chr10 (527412..529268) [1857 bp, 618 aa] {ON} YLR206W
           (REAL)
          Length = 618

 Score =  247 bits (631), Expect = 7e-75,   Method: Compositional matrix adjust.
 Identities = 139/263 (52%), Positives = 165/263 (62%), Gaps = 24/263 (9%)

Query: 1   MSKQFVRSAKNLVKGYSSTQVLVRNATSNDNHQVSKDSLIELAEKSYDSADFFEIMDMLD 60
           MSKQFVRSAKN+VKGYSSTQVLVR+AT+ND    S D+L +LA++SYDS DFFEIMDMLD
Sbjct: 1   MSKQFVRSAKNMVKGYSSTQVLVRDATANDPRTPSIDTLDDLAQRSYDSVDFFEIMDMLD 60

Query: 61  KRLNDKGKYWRHIAKALTVIDYLIRFGSENCVLWCRENLYIIKTLKEFRHEDDEGIDQGQ 120
           KRLNDKGKYWRH+AK+LTV+DYL+RFGSENCVLWCREN Y+IKTL+EFRHE++ G D+GQ
Sbjct: 61  KRLNDKGKYWRHVAKSLTVLDYLVRFGSENCVLWCRENFYVIKTLREFRHENESGFDEGQ 120

Query: 121 IVRVKAKELTALLSDDERLNEEXXXXXXXXXXXXXXXXXXXXSDEN-------------- 166
           I+RVKAKEL +LL+DDERL EE                                      
Sbjct: 121 IIRVKAKELVSLLNDDERLREERTMNTRNRRTNKTARPTPTPRPRRQRTRSNLYDSPPTY 180

Query: 167 DDDLQRAISASRLTAXXXXXXXXXXXXX-------XTALQLSKEEEELKRXXXXXXXXXX 219
            +DL++A+  SR+TA                      ALQLSKEEEELK+          
Sbjct: 181 QNDLEKALEESRITAQEDELRRNEMAQYDDDDPDFQAALQLSKEEEELKQLQELQKQQQL 240

Query: 220 XXXXX---XXXPMYYDIFGNPIT 239
                        YYDIFGNPI+
Sbjct: 241 QSQLQMPPQQQAAYYDIFGNPIS 263

 Score =  164 bits (416), Expect = 5e-44,   Method: Compositional matrix adjust.
 Identities = 75/92 (81%), Positives = 84/92 (91%)

Query: 340 PLIQNRTGNQSMTDKYSKLNELLATGTGIDTFGNVGEARIPAQHTKTGTFINSQGTGYRQ 399
           PL Q RTGNQS++DKY+ LN LLATGTG DTFGN GE+RIPAQHTKTGTFINSQGTGY+Q
Sbjct: 433 PLTQTRTGNQSISDKYNDLNVLLATGTGADTFGNTGESRIPAQHTKTGTFINSQGTGYKQ 492

Query: 400 VSDDPNHNPFLNSQYTGLPSTSVVPTQTGYGF 431
           V ++P +NPFLNSQYTGLPSTS+VPTQTGYGF
Sbjct: 493 VVNEPKNNPFLNSQYTGLPSTSIVPTQTGYGF 524

>YLR206W Chr12 (554578..556419) [1842 bp, 613 aa] {ON}
           ENT2Epsin-like protein required for endocytosis and
           actin patch assembly and functionally redundant with
           Ent1p; contains clathrin-binding motif at C-terminus
          Length = 613

 Score =  246 bits (629), Expect = 2e-74,   Method: Compositional matrix adjust.
 Identities = 119/191 (62%), Positives = 147/191 (76%), Gaps = 10/191 (5%)

Query: 1   MSKQFVRSAKNLVKGYSSTQVLVRNATSNDNHQVSKDSLIELAEKSYDSADFFEIMDMLD 60
           MSKQFVRSAKN++KGYSSTQVLVR+AT+ND+   S D+L +LA++SYDS DFFEIMDMLD
Sbjct: 1   MSKQFVRSAKNMMKGYSSTQVLVRDATANDSRTPSIDTLDDLAQRSYDSVDFFEIMDMLD 60

Query: 61  KRLNDKGKYWRHIAKALTVIDYLIRFGSENCVLWCRENLYIIKTLKEFRHEDDEGIDQGQ 120
           KRLNDKGKYWRH+AK+LTV+DYL+RFGSENCVLWCREN Y+IKTL+EFRHE++ G D+GQ
Sbjct: 61  KRLNDKGKYWRHVAKSLTVLDYLVRFGSENCVLWCRENFYVIKTLREFRHENESGFDEGQ 120

Query: 121 IVRVKAKELTALLSDDERLNEEXXX----XXXXXXXXXXXXXXXXXSDEND------DDL 170
           I+RVKAKEL +LL+D+ERL EE                        S+ +D      DDL
Sbjct: 121 IIRVKAKELVSLLNDEERLREERSMNTRNRRANRAARPRPRRQRTRSNPHDSSPSYQDDL 180

Query: 171 QRAISASRLTA 181
           ++A+  SR+TA
Sbjct: 181 EKALEESRITA 191

 Score =  166 bits (419), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 75/92 (81%), Positives = 86/92 (93%)

Query: 340 PLIQNRTGNQSMTDKYSKLNELLATGTGIDTFGNVGEARIPAQHTKTGTFINSQGTGYRQ 399
           PL Q RTGNQS++DKYS LN LLATGTGIDTFGN GEARIPAQHTKTGTFINSQGTGY+Q
Sbjct: 424 PLKQTRTGNQSISDKYSDLNTLLATGTGIDTFGNTGEARIPAQHTKTGTFINSQGTGYKQ 483

Query: 400 VSDDPNHNPFLNSQYTGLPSTSVVPTQTGYGF 431
           V+++P +NPFL++QYTGLPST++VPTQTGYGF
Sbjct: 484 VTNEPKNNPFLSNQYTGLPSTNIVPTQTGYGF 515

>Kwal_56.24610 s56 complement(1073855..1075381) [1527 bp, 508 aa]
           {ON} YDL161W (ENT1) - Ent1p [contig 161] FULL
          Length = 508

 Score =  243 bits (619), Expect = 3e-74,   Method: Compositional matrix adjust.
 Identities = 139/262 (53%), Positives = 163/262 (62%), Gaps = 24/262 (9%)

Query: 1   MSKQFVRSAKNLVKGYSSTQVLVRNATSNDNHQVSKDSLIELAEKSYDSADFFEIMDMLD 60
           MSK  +R AKN+V GYS+TQVL+R ATSND    S D + E+AE+S+DS  FFEIMDMLD
Sbjct: 1   MSKSLIRKAKNVVNGYSTTQVLLREATSNDPEGPSLDIMDEIAERSWDSVSFFEIMDMLD 60

Query: 61  KRLNDKGKYWRHIAKALTVIDYLIRFGSENCVLWCRENLYIIKTLKEFRHEDDEGIDQGQ 120
           KRLNDKGK WRH+AK+LTV+DYL+R GSE+CV W +ENLY+IKTL+EF HED+ GIDQGQ
Sbjct: 61  KRLNDKGKNWRHVAKSLTVLDYLVRCGSEHCVPWAKENLYVIKTLREFMHEDELGIDQGQ 120

Query: 121 IVRVKAKELTALLSDDERLNEEXXXXXXXXXXXXXXXXXXXXSDENDDDLQRAISASRLT 180
           IVRVKA+ELTALL DDERL EE                    +   D+DLQRA+  SRLT
Sbjct: 121 IVRVKARELTALLLDDERLREERSLRTKNRKPRRRPT-----AGSEDEDLQRAMEESRLT 175

Query: 181 AXXXXXXXXXXXX--------XXTALQLSKEEEELKRXXXXXXXXX-----------XXX 221
           A                      TALQLSKEEEEL+R                       
Sbjct: 176 AEQEEAERRRKLEIYDNSSDDLQTALQLSKEEEELRRLRELQMQQQMQQAQQQMFGLSQQ 235

Query: 222 XXXXXXPMYYDIFGNPITPEEY 243
                 PMYYD+FGNPI+ EEY
Sbjct: 236 QTQAQQPMYYDVFGNPISAEEY 257

 Score =  150 bits (379), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 67/87 (77%), Positives = 77/87 (88%)

Query: 345 RTGNQSMTDKYSKLNELLATGTGIDTFGNVGEARIPAQHTKTGTFINSQGTGYRQVSDDP 404
           RTGNQS+T+K+S+LN LLA+GTG+DTFGN G+ RIPAQHTKTG FINSQGTGY+QVS  P
Sbjct: 396 RTGNQSITEKHSELNNLLASGTGLDTFGNTGQTRIPAQHTKTGNFINSQGTGYKQVSSTP 455

Query: 405 NHNPFLNSQYTGLPSTSVVPTQTGYGF 431
            HNPFL  QYTGLPST+VVP+ TGYGF
Sbjct: 456 KHNPFLGQQYTGLPSTNVVPSYTGYGF 482

>TBLA0E00480 Chr5 complement(88019..89818) [1800 bp, 599 aa] {ON}
           Anc_7.342 YLR206W
          Length = 599

 Score =  241 bits (614), Expect = 2e-72,   Method: Compositional matrix adjust.
 Identities = 143/273 (52%), Positives = 168/273 (61%), Gaps = 30/273 (10%)

Query: 1   MSKQFVRSAKNLVKGYSSTQVLVRNATSNDNHQVSKDSLIELAEKSYDSADFFEIMDMLD 60
           MSKQF+RS KN+VKGYSSTQ+LVR+AT+ND +  S D L ++AEK+YDS DFFEIMDMLD
Sbjct: 1   MSKQFLRSTKNMVKGYSSTQILVRDATANDENTPSIDILDDIAEKTYDSVDFFEIMDMLD 60

Query: 61  KRLNDKGKYWRHIAKALTVIDYLIRFGSENCVLWCRENLYIIKTLKEFRHED----DEGI 116
           KRLNDKGKYW+H+AK+LTV+DYLIRFGSENCV WC+ENLY+IKTLKEFR +D    + G 
Sbjct: 61  KRLNDKGKYWKHVAKSLTVLDYLIRFGSENCVFWCKENLYLIKTLKEFRVDDAIDYNTGY 120

Query: 117 DQGQIVRVKAKELTALLSDDERLNEEXX--------------XXXXXXXXXXXXXXXXXX 162
           DQGQIVRV+A ELT+LL DDERL EE                                  
Sbjct: 121 DQGQIVRVRATELTSLLMDDERLREERSLHSRGGRRSAPPPRMAPQRRNTSRSDFNRQRA 180

Query: 163 SDENDDDLQRAISASRLTAXXXXXXXXXXXXXX-----TALQLSKEEEELKRXXXXXXXX 217
            D  DDDLQ+AI  S+ TA                   TALQLSKEEEELK+        
Sbjct: 181 DDHYDDDLQKAIEESKRTAEEDERRRRNREGDQEDDFETALQLSKEEEELKKLQELHAQQ 240

Query: 218 XXXXXXXXXXP-------MYYDIFGNPITPEEY 243
                     P       +Y DIFGNPI+ EE+
Sbjct: 241 IALQNQQNATPTTQNVANVYTDIFGNPISYEEW 273

 Score =  149 bits (377), Expect = 9e-39,   Method: Compositional matrix adjust.
 Identities = 67/93 (72%), Positives = 81/93 (87%)

Query: 339 EPLIQNRTGNQSMTDKYSKLNELLATGTGIDTFGNVGEARIPAQHTKTGTFINSQGTGYR 398
           +P+ Q RTGNQ ++DKY+ LN LLATGTGIDTFGN G+ RIPAQHT TGTFINSQGTGY+
Sbjct: 465 QPIPQMRTGNQEISDKYNNLNTLLATGTGIDTFGNTGDMRIPAQHTATGTFINSQGTGYK 524

Query: 399 QVSDDPNHNPFLNSQYTGLPSTSVVPTQTGYGF 431
           Q  +DP +NPF+++QYTGLPST+VVP+ TGYGF
Sbjct: 525 QYINDPKNNPFMSNQYTGLPSTNVVPSYTGYGF 557

>KLTH0H01430g Chr8 (132738..134246) [1509 bp, 502 aa] {ON} some
           similarities with uniprot|Q12518 Saccharomyces
           cerevisiae YDL161W ENT1
          Length = 502

 Score =  233 bits (595), Expect = 1e-70,   Method: Compositional matrix adjust.
 Identities = 131/260 (50%), Positives = 157/260 (60%), Gaps = 22/260 (8%)

Query: 1   MSKQFVRSAKNLVKGYSSTQVLVRNATSNDNHQVSKDSLIELAEKSYDSADFFEIMDMLD 60
           MSK  +R AKN+V GYS+TQVL+R ATSND    S D + E+AE+S+DS  FFEIMDMLD
Sbjct: 1   MSKSLMRRAKNVVNGYSTTQVLLREATSNDPDGPSLDLMDEIAERSWDSVSFFEIMDMLD 60

Query: 61  KRLNDKGKYWRHIAKALTVIDYLIRFGSENCVLWCRENLYIIKTLKEFRHEDDEGIDQGQ 120
           KRLNDKGK WRH+AK+LTV+DYL+R GSE+CV W +ENLYIIKTL+EF HED+ G+DQGQ
Sbjct: 61  KRLNDKGKNWRHVAKSLTVLDYLVRCGSEHCVPWAKENLYIIKTLREFTHEDETGVDQGQ 120

Query: 121 IVRVKAKELTALLSDDERLNEEXXXXXXXXXXXXXXXXXXXXSDENDDDLQRAISASRLT 180
           IVRVKA+ELTALL D     EE                    SD  DDD+QRA+  SR+T
Sbjct: 121 IVRVKARELTALLQD-----EERLREERELKGRNRRPRRRKNSDSYDDDMQRALEESRMT 175

Query: 181 AXXXXXXXXXXXXX--------XTALQLSK---------EEEELKRXXXXXXXXXXXXXX 223
           A                      TALQLSK         E +  ++              
Sbjct: 176 AEQEEAERRRKLEMYDNSADDLQTALQLSKEEEELRRLRELQMQQQMQQAQQQMFGLQQQ 235

Query: 224 XXXXPMYYDIFGNPITPEEY 243
               PMYYD+FGNPI+ EEY
Sbjct: 236 QTQQPMYYDVFGNPISAEEY 255

 Score =  158 bits (399), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 89/173 (51%), Positives = 103/173 (59%), Gaps = 22/173 (12%)

Query: 304 SNNPFAKSEQSSSSPKRNQLVAASSPXXXXXXXXXEPLIQ-----------------NRT 346
           SNNPFAK+ Q  S+   ++  AASSP                                RT
Sbjct: 330 SNNPFAKNAQQPSAEDPSKYAAASSPQRTQQLSPQLQPQPEQFQQQQQQIPQQPLKQTRT 389

Query: 347 GNQSMTDKYSKLNELLATGTGIDTFGNVGEARIPAQHTKTGTFINSQGTGYRQVSDDPN- 405
           GNQS+TDK+S LN LLA+GTG+DTFGN G+ RIPAQHTKTGTFINSQGTGY+QVS+ P  
Sbjct: 390 GNQSVTDKFSDLNNLLASGTGLDTFGNTGQTRIPAQHTKTGTFINSQGTGYKQVSNMPQG 449

Query: 406 -HNPFLNSQYTGLPSTSVVPTQTGYGFXXXXXXXXXXXXXXX---RGYTLIDL 454
            HNPFL  QYTGLPSTSVVP+ TGYGF                  +G +LIDL
Sbjct: 450 KHNPFLGQQYTGLPSTSVVPSYTGYGFGNQNVQKQTNQNRANGADQGVSLIDL 502

>KLLA0C16731g Chr3 complement(1463616..1465052) [1437 bp, 478 aa]
           {ON} some similarities with uniprot|Q12518 Saccharomyces
           cerevisiae YDL161W ENT1
          Length = 478

 Score =  221 bits (563), Expect = 4e-66,   Method: Compositional matrix adjust.
 Identities = 125/248 (50%), Positives = 153/248 (61%), Gaps = 11/248 (4%)

Query: 1   MSKQFVRSAKNLVKGYSSTQVLVRNATSNDNHQVSKDSLIELAEKSYDSADFFEIMDMLD 60
           MSK F+RSAKNLV GYS  QVLVR+ATSND    S D L ELAE+++D+ +FFEIMDMLD
Sbjct: 1   MSKAFLRSAKNLVNGYSQAQVLVRSATSNDKDGPSVDQLEELAERTFDNVEFFEIMDMLD 60

Query: 61  KRLNDKGKYWRHIAKALTVIDYLIRFGSENCVLWCRENLYIIKTLKEFRHEDD-EGIDQG 119
           KRLNDKG+ WRH+AK+LT +D+L+R GSENCV WC+ENLYIIKTL+EF H D+   ID G
Sbjct: 61  KRLNDKGRNWRHVAKSLTCLDFLVRCGSENCVFWCKENLYIIKTLREFTHTDEFTEIDNG 120

Query: 120 QIVRVKAKELTALLSDDERLNEEXXXXXXXXXXXXXXXXXXXXSDENDDDLQRAISASRL 179
           +IVRVKAKELTALL D+ERL EE                     D++  DLQRA+  SR+
Sbjct: 121 EIVRVKAKELTALLRDEERLKEERMMRLKGRKRGGRKNRRDDNEDDD--DLQRALEESRI 178

Query: 180 TAXXXXXXXXXXXXXX--TALQLSKEEEELKRXXXX------XXXXXXXXXXXXXXPMYY 231
           TA                ++LQ + E  + +                         PMYY
Sbjct: 179 TAEEEERRRKQLMMQGDDSSLQAALELSKEEEELRRLQQLQAQQQAALWQQQQQQQPMYY 238

Query: 232 DIFGNPIT 239
           DIFGNPI+
Sbjct: 239 DIFGNPIS 246

 Score =  152 bits (385), Expect = 1e-40,   Method: Compositional matrix adjust.
 Identities = 66/94 (70%), Positives = 84/94 (89%), Gaps = 1/94 (1%)

Query: 339 EPLIQNRTGNQSMTDKYSKLNELLATGTGIDTFGNVGEARIPAQHTKTGTFINSQGTGYR 398
           +P+ + RTGNQS++DK+S+LN LLA+GTGIDTFGN GE R+PAQHTKTGTFINSQGTGY+
Sbjct: 354 KPVPKQRTGNQSISDKFSELNNLLASGTGIDTFGNTGETRVPAQHTKTGTFINSQGTGYK 413

Query: 399 QVSDD-PNHNPFLNSQYTGLPSTSVVPTQTGYGF 431
           Q+++D P HNPFL SQYTG+PS+++ P+ TGYGF
Sbjct: 414 QITNDAPKHNPFLTSQYTGIPSSAIAPSYTGYGF 447

>Ecym_4731 Chr4 (1427875..1429419) [1545 bp, 514 aa] {ON} similar to
           Ashbya gossypii ACL157C
          Length = 514

 Score =  209 bits (532), Expect = 3e-61,   Method: Compositional matrix adjust.
 Identities = 125/256 (48%), Positives = 150/256 (58%), Gaps = 18/256 (7%)

Query: 1   MSKQFVRSAKNLVKGYSSTQVLVRNATSNDNHQVSKDSLIELAEKSYDSADFFEIMDMLD 60
           MSKQ +RSAKN++ GYS  QVLVRNATSND +  S D + ELAE++Y + +FFEIM MLD
Sbjct: 1   MSKQLLRSAKNVMNGYSQAQVLVRNATSNDEYGPSLDQMEELAERTYSAVEFFEIMVMLD 60

Query: 61  KRLNDKGKYWRHIAKALTVIDYLIRFGSENCVLWCRENLYIIKTLKEFRHEDDE-GIDQG 119
           +RLNDK K WRH+AK+LTV DYL+R G+E CV W REN++II+ L EF H D+  G D G
Sbjct: 61  RRLNDKPKNWRHVAKSLTVTDYLVRTGAEACVDWARENMFIIRKLTEFVHVDESSGTDHG 120

Query: 120 QIVRVKAKELTALLSDDERLNEEXXXXXXXXXXXXXXXXXXXXSDENDDDLQRAISASRL 179
           Q++RVKAKEL ALL DDERL EE                     D  D DL+RA+  SR+
Sbjct: 121 QLIRVKAKELIALLRDDERLKEERNLRLGRGKKNPQNVPETN-PDGVDPDLKRALEESRI 179

Query: 180 TAXXXXXXXXXXXXX------XTALQLSKEEEELKRXXXXXXXXXXXXXXXXXX------ 227
           TA                     ALQLSKEEEEL++                        
Sbjct: 180 TAEEEERRRKLAEKTEDAEELQAALQLSKEEEELRKLRELQQQREQQMAFWQQQQVQQVQ 239

Query: 228 ----PMYYDIFGNPIT 239
               PMYYDIFGNPIT
Sbjct: 240 YQQQPMYYDIFGNPIT 255

 Score =  149 bits (377), Expect = 3e-39,   Method: Compositional matrix adjust.
 Identities = 70/111 (63%), Positives = 85/111 (76%), Gaps = 1/111 (0%)

Query: 345 RTGNQSMTDKYSKLNELLATGTGIDTFGNVGEARIPAQHTKTGTFINSQGTGYRQVSDD- 403
           RTGNQS++DKY +LN LLATGTGIDTFGN G+ARI +QHTKT TFINS GTG++QVS++ 
Sbjct: 404 RTGNQSISDKYGELNALLATGTGIDTFGNTGQARISSQHTKTETFINSHGTGFKQVSNEP 463

Query: 404 PNHNPFLNSQYTGLPSTSVVPTQTGYGFXXXXXXXXXXXXXXXRGYTLIDL 454
           P HNPFL +QYTGLPST++VP+ TGYGF               +G +LIDL
Sbjct: 464 PKHNPFLTTQYTGLPSTNIVPSHTGYGFGNASSFQQTASKPNDQGMSLIDL 514

 Score = 33.1 bits (74), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 11/12 (91%), Positives = 12/12 (100%)

Query: 263 PMYYDVFGNPIT 274
           PMYYD+FGNPIT
Sbjct: 244 PMYYDIFGNPIT 255

>TBLA0E02040 Chr5 complement(494899..497004) [2106 bp, 701 aa] {ON}
           Anc_7.342 YLR206W
          Length = 701

 Score =  194 bits (493), Expect = 2e-54,   Method: Compositional matrix adjust.
 Identities = 108/255 (42%), Positives = 145/255 (56%), Gaps = 22/255 (8%)

Query: 1   MSKQFVRSAKNLVKGYSSTQVLVRNATSNDNHQVSKDSLIELAEKSYDSADFFEIMDMLD 60
           MS QFVRS KN+ KGYS TQVLVR+AT+N++   S D L +L E SYD+ +F +I  +LD
Sbjct: 1   MSHQFVRSTKNMFKGYSPTQVLVRDATANNDSGTSIDVLDQLGEMSYDTHEFRDIFSVLD 60

Query: 61  KRLNDKGKYWRHIAKALTVIDYLIRFGSENCVLWCRENLYIIKTLKEFRHEDDEGIDQGQ 120
           +R++DK KYWRH+AK+LTV+DYL+RFGSE CV W R+N   ++ L++F + D  GIDQGQ
Sbjct: 61  RRISDKPKYWRHVAKSLTVVDYLVRFGSEACVQWARDNARQLEILRDFYYSDSAGIDQGQ 120

Query: 121 IVRVKAKELTALLSDDERLNEEXXXXXXXXXXXX-------XXXXXXXXSDENDDDLQRA 173
           ++RVKA EL  LL D ERL  E                             E+++D+ RA
Sbjct: 121 LIRVKAAELIDLLRDPERLATERGMNMRGRRNALPPRRMGPHRRPSMPRRPEDEEDVDRA 180

Query: 174 ISASRLTAXXXXXXXXXXXXXXT-----ALQLSKEEEELKRXXXXXXXXXXXXXXXXXXP 228
           +  S+ TA                    A++LSKEE+ELKR                  P
Sbjct: 181 LEESKKTAEEDEARRRKDQEREKQDLKEAVKLSKEEDELKR----------LQDEANNKP 230

Query: 229 MYYDIFGNPITPEEY 243
            Y+D  GNPI+ EE+
Sbjct: 231 QYFDENGNPISQEEW 245

 Score =  113 bits (282), Expect = 5e-26,   Method: Compositional matrix adjust.
 Identities = 57/109 (52%), Positives = 70/109 (64%), Gaps = 3/109 (2%)

Query: 346 TGNQSMTDKYSKLNELLATGTGIDTFGNVGEARIPAQHTKTGTFINSQGTGYRQVSDDPN 405
           TGN  ++ KYS LN+LLA GTGIDTFGN G  RIPAQHTKTGTFINSQGTGY+QV+   +
Sbjct: 596 TGNSVISAKYSNLNQLLAQGTGIDTFGNEGATRIPAQHTKTGTFINSQGTGYKQVTSSSS 655

Query: 406 HNPFLNSQYTGLPSTSVVPTQTGYGFXXXXXXXXXXXXXXXRGYTLIDL 454
             P L +QYTGLP+ + V   +                   +G+TL+DL
Sbjct: 656 PIPLLPTQYTGLPAQTAVHVPSPSPL---QPSEKEHQTQQTQGFTLVDL 701

>KNAG0B02650 Chr2 (511995..513935) [1941 bp, 646 aa] {ON} Anc_7.342
           YLR206W
          Length = 646

 Score =  193 bits (490), Expect = 3e-54,   Method: Compositional matrix adjust.
 Identities = 89/140 (63%), Positives = 113/140 (80%), Gaps = 1/140 (0%)

Query: 1   MSKQFVRSAKNLVKGYSSTQVLVRNATSNDNHQVSKDSLIELAEKSYDSADFFEIMDMLD 60
           MS+QFVRSAKN++KGYSSTQVLVR+AT+ND      D+L ++A  S+DS DFFEIMD+L+
Sbjct: 1   MSRQFVRSAKNVMKGYSSTQVLVRDATANDGRTPHLDTLEDIAGLSFDSVDFFEIMDVLE 60

Query: 61  KRLNDKGKYWRHIAKALTVIDYLIRFGSENCVLWCRENLYIIKTLKEFRHEDDE-GIDQG 119
           KRLND GKYWRHI K+LTV+DYL+RFGSE+C  W R++L+++K L+ FR  DD  G DQG
Sbjct: 61  KRLNDSGKYWRHIEKSLTVLDYLVRFGSEHCADWARDHLFLLKALRNFRFVDDGIGFDQG 120

Query: 120 QIVRVKAKELTALLSDDERL 139
           QIVRVKA++L  LL   E+L
Sbjct: 121 QIVRVKARDLVELLQSGEQL 140

 Score =  142 bits (359), Expect = 3e-36,   Method: Compositional matrix adjust.
 Identities = 67/96 (69%), Positives = 79/96 (82%), Gaps = 3/96 (3%)

Query: 339 EPLIQNRTGNQSMTDKYSKLNELLATGTGIDTFGNVGEARIPAQHTKTGTFINSQGTGYR 398
           +P+ +  TGNQ +T+KYS+LN LLA GTG+DTFGN G  RIPAQHT+TGTFINSQGTG++
Sbjct: 489 QPMPRMNTGNQEVTNKYSELNNLLAQGTGVDTFGNEGTQRIPAQHTQTGTFINSQGTGFK 548

Query: 399 QVSD---DPNHNPFLNSQYTGLPSTSVVPTQTGYGF 431
           QV+    DPN NPFLNSQYTGLPST +VP  TGYGF
Sbjct: 549 QVNSEGKDPNSNPFLNSQYTGLPSTGIVPAYTGYGF 584

 Score = 35.4 bits (80), Expect = 0.29,   Method: Compositional matrix adjust.
 Identities = 27/84 (32%), Positives = 33/84 (39%), Gaps = 10/84 (11%)

Query: 166 NDDDLQRAISASRLTAXXXXXXXXXXX-------XXXTALQLSKEEEELKRXXXXXXXXX 218
           +DDDLQRAI  S+ T                       ALQLS+EEEELK          
Sbjct: 204 DDDDLQRAIEESKRTVQEDEERRRQLSMYDEEDPEFQAALQLSREEEELKNLQHLQRLQQ 263

Query: 219 XXXXXXXXXP---MYYDIFGNPIT 239
                         Y D+FGNP++
Sbjct: 264 QQQQQQQQQQLNTAYLDVFGNPVS 287

>ACL157C Chr3 complement(79325..80872) [1548 bp, 515 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YLR206W
           (ENT2) and YDL161W (ENT1)
          Length = 515

 Score =  187 bits (476), Expect = 3e-53,   Method: Compositional matrix adjust.
 Identities = 118/255 (46%), Positives = 149/255 (58%), Gaps = 15/255 (5%)

Query: 1   MSKQFVRSAKNLVKGYSSTQVLVRNATSNDNHQVSKDSLIELAEKSYDSADFFEIMDMLD 60
           MSKQ +RSAKN+V GYS  Q+LVRNATSN+ +  S D + ELAE+SY + +FFEI+ MLD
Sbjct: 1   MSKQLLRSAKNVVNGYSPAQILVRNATSNEEYGPSMDQMEELAERSYSAVEFFEIVVMLD 60

Query: 61  KRLNDKGKYWRHIAKALTVIDYLIRFGSENCVLWCRENLYIIKTLKEFRHEDDE-GIDQG 119
           KRL+DK K+WRH+AK+LTV D+L+R G+E CV W RENLY+ + L EF H D+  G+D G
Sbjct: 61  KRLSDKPKHWRHVAKSLTVTDFLVRTGAETCVDWARENLYLFRRLTEFYHVDESTGVDHG 120

Query: 120 QIVRVKAKELTALLSDDERLNEEXXXXXXXXXXXXXXXXXXXXSDENDDDLQRAISASRL 179
           QI+RVKA+EL ALL D+ERL EE                     D  D DLQRA+  SR+
Sbjct: 121 QIIRVKARELVALLRDEERLREERNMRLGRNPRNRQASVPPPAEDL-DPDLQRALEESRI 179

Query: 180 TAXXXXXXXXXXXXXX-------TALQLS------KEEEELKRXXXXXXXXXXXXXXXXX 226
           TA                      ALQLS      ++  EL++                 
Sbjct: 180 TAEEEERRRREKTNQQQDNEELEVALQLSKEEEELRKLRELQQQREQQMALWQQQQQQQP 239

Query: 227 XPMYYDIFGNPITPE 241
             MYYDIFGNPI+ E
Sbjct: 240 QAMYYDIFGNPISLE 254

 Score =  149 bits (375), Expect = 7e-39,   Method: Compositional matrix adjust.
 Identities = 67/88 (76%), Positives = 80/88 (90%), Gaps = 1/88 (1%)

Query: 345 RTGNQSMTDKYSKLNELLATGTGIDTFGNVGEARIPAQHTKTGTFINSQGTGYRQVSDD- 403
           RTGNQS+TDKYS+LN LLA+GTG+DTFGN G+ RIPAQHTKTGTFINSQGTGY+QV ++ 
Sbjct: 402 RTGNQSITDKYSELNTLLASGTGLDTFGNTGQTRIPAQHTKTGTFINSQGTGYKQVGNEP 461

Query: 404 PNHNPFLNSQYTGLPSTSVVPTQTGYGF 431
           P HNPF+ +QYTGLPST++VP+ TGYGF
Sbjct: 462 PKHNPFIATQYTGLPSTNMVPSHTGYGF 489

>Kwal_47.16857 s47 (145176..146324) [1149 bp, 382 aa] {ON} YJR125C
           (ENT3) - Ent3p [contig 219] FULL
          Length = 382

 Score = 99.4 bits (246), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 54/142 (38%), Positives = 85/142 (59%), Gaps = 1/142 (0%)

Query: 2   SKQFVRSAKNLVKGYSSTQVLVRNATSNDNHQVSKDSLIELAEKSYDSADFFEIMDMLDK 61
           +K++ R A+N+V  Y+  +  VR AT+N+    S   + ++A+ +Y+  +  EI+ M+ +
Sbjct: 15  AKKYFRKAQNVVFNYTEMEAKVREATNNEPWGASSTLMEQIAQGTYNYREREEILGMIFR 74

Query: 62  RLNDK-GKYWRHIAKALTVIDYLIRFGSENCVLWCRENLYIIKTLKEFRHEDDEGIDQGQ 120
           R  +K    WR I KAL ++DYLIR G+E  +   R NL +IK L+ F + D +G DQG 
Sbjct: 75  RFTEKTASEWRQIYKALQLLDYLIRHGAERFIDDTRANLSLIKMLESFHYIDSQGRDQGI 134

Query: 121 IVRVKAKELTALLSDDERLNEE 142
            VR +A EL  LL DD ++  E
Sbjct: 135 NVRNRAHELALLLDDDAKVRAE 156

>KLTH0D16896g Chr4 complement(1395711..1396916) [1206 bp, 401 aa]
           {ON} similar to uniprot|P47160 Saccharomyces cerevisiae
           YJR125C ENT3 Protein containing an N-terminal epsin-like
           domain involved in clathrin recruitment and traffic
           between the Golgi and endosomes associates with the
           clathrin adaptor Gga2p
          Length = 401

 Score = 99.8 bits (247), Expect = 4e-22,   Method: Compositional matrix adjust.
 Identities = 53/142 (37%), Positives = 85/142 (59%), Gaps = 1/142 (0%)

Query: 2   SKQFVRSAKNLVKGYSSTQVLVRNATSNDNHQVSKDSLIELAEKSYDSADFFEIMDMLDK 61
           +K++ R A+N+V  Y+  +  VR AT+N+    S   + ++++ +Y+  +  EI+ M+ +
Sbjct: 15  AKKYFRKAQNMVFNYTEMEAKVREATNNEPWGASSTLMEQISQGTYNYREREEILGMIFR 74

Query: 62  RLNDK-GKYWRHIAKALTVIDYLIRFGSENCVLWCRENLYIIKTLKEFRHEDDEGIDQGQ 120
           R  +K    WR I KAL ++DYLIR G+E  +   R NL +IK L+ F + D +G DQG 
Sbjct: 75  RFTEKTASEWRQIYKALQLLDYLIRHGAERFIDDTRANLSLIKMLESFHYIDSQGRDQGI 134

Query: 121 IVRVKAKELTALLSDDERLNEE 142
            VR +A EL  LL DD ++  E
Sbjct: 135 NVRNRAHELVLLLDDDGKIRTE 156

>NDAI0D03200 Chr4 complement(764129..765436) [1308 bp, 435 aa] {ON}
           Anc_4.346
          Length = 435

 Score = 99.8 bits (247), Expect = 5e-22,   Method: Compositional matrix adjust.
 Identities = 54/142 (38%), Positives = 87/142 (61%), Gaps = 1/142 (0%)

Query: 2   SKQFVRSAKNLVKGYSSTQVLVRNATSNDNHQVSKDSLIELAEKSYDSADFFEIMDMLDK 61
           +K++ R A+N+V  Y+  +  VR AT+N+    S   + ++A+ +Y+  + +EI+ M+ +
Sbjct: 15  AKKYFRKAQNVVFNYTEMESKVREATNNEPWGASSTLMEQIAQGTYNVRERYEIVGMIFR 74

Query: 62  RLNDK-GKYWRHIAKALTVIDYLIRFGSENCVLWCRENLYIIKTLKEFRHEDDEGIDQGQ 120
           R  +K G  WR I KAL ++DYLI+ GSE  +   R +L +I+ L+ F + D EG DQG 
Sbjct: 75  RFTEKAGSEWRQIYKALQLLDYLIKHGSEPFIDDVRSSLKLIQMLETFHYIDSEGRDQGI 134

Query: 121 IVRVKAKELTALLSDDERLNEE 142
            VR +AK L  LL DD  + +E
Sbjct: 135 NVRNRAKLLVELLQDDSNIRQE 156

>Kpol_1001.2 s1001 (8057..9313) [1257 bp, 418 aa] {ON} (8057..9313)
           [1257 nt, 419 aa]
          Length = 418

 Score = 99.0 bits (245), Expect = 7e-22,   Method: Compositional matrix adjust.
 Identities = 53/142 (37%), Positives = 88/142 (61%), Gaps = 1/142 (0%)

Query: 2   SKQFVRSAKNLVKGYSSTQVLVRNATSNDNHQVSKDSLIELAEKSYDSADFFEIMDMLDK 61
           +K++ R A+N++  Y+  +  VR AT+N+    S   + ++++ +Y+  +  EI+ M+ +
Sbjct: 15  AKKYFRKAQNVMFNYTEMEGKVREATNNEPWGASSTLMEQISQGTYNIREREEILSMIFR 74

Query: 62  RLNDK-GKYWRHIAKALTVIDYLIRFGSENCVLWCRENLYIIKTLKEFRHEDDEGIDQGQ 120
           R  +K    WR I KAL +++YLI+ GSE  +   R +L +IK L+ F + D +G DQG 
Sbjct: 75  RFTEKTASEWRQIYKALQLLEYLIKHGSERFIDDVRSSLSLIKMLESFHYIDSQGRDQGI 134

Query: 121 IVRVKAKELTALLSDDERLNEE 142
            VR KA+ LTALL DDE++  E
Sbjct: 135 NVRNKAQSLTALLKDDEQIRAE 156

>TBLA0E04760 Chr5 complement(1226806..1228086) [1281 bp, 426 aa]
           {ON} Anc_4.346 YJR125C
          Length = 426

 Score = 98.6 bits (244), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 50/139 (35%), Positives = 86/139 (61%), Gaps = 1/139 (0%)

Query: 2   SKQFVRSAKNLVKGYSSTQVLVRNATSNDNHQVSKDSLIELAEKSYDSADFFEIMDMLDK 61
           +K++ R A+N+V  Y+  +  VR AT+N+    S   + ++A+ +Y+  +  EI+ M+ +
Sbjct: 15  AKKYFRKAQNVVFNYTDMEAKVREATNNEPWGASSTLMEQIAQGTYNPREREEILSMILR 74

Query: 62  RLNDK-GKYWRHIAKALTVIDYLIRFGSENCVLWCRENLYIIKTLKEFRHEDDEGIDQGQ 120
           R  +K G  WR I KAL +++YLI  G+E  +   R +L +I+ L+ F + D EG DQG 
Sbjct: 75  RFTEKSGNLWRQIYKALQLLEYLITHGAERFIDEARSSLGLIRMLESFHYVDSEGRDQGA 134

Query: 121 IVRVKAKELTALLSDDERL 139
            VR +A+ +T+LLS D+ +
Sbjct: 135 NVRSRAQAMTSLLSSDDAI 153

>TDEL0D00710 Chr4 (127174..128301) [1128 bp, 375 aa] {ON} Anc_4.346
           YJR125C
          Length = 375

 Score = 97.8 bits (242), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 54/142 (38%), Positives = 86/142 (60%), Gaps = 1/142 (0%)

Query: 2   SKQFVRSAKNLVKGYSSTQVLVRNATSNDNHQVSKDSLIELAEKSYDSADFFEIMDMLDK 61
           +K++ R A+N+V  Y+  +  VR AT+N+    S   + ++++ +Y+  +  EI+ M+ +
Sbjct: 15  AKKYFRRAQNVVFNYTDMEAKVREATNNEPWGASTTLMEQISQGTYNMREREEILGMIFR 74

Query: 62  RLNDK-GKYWRHIAKALTVIDYLIRFGSENCVLWCRENLYIIKTLKEFRHEDDEGIDQGQ 120
           RL +K    WR I KAL ++DYLIR  SE  +   R ++ +IK L+ F + D +G DQG 
Sbjct: 75  RLTEKRANEWRQIYKALQLLDYLIRHASERFIDDTRSSISLIKMLESFHYIDSQGRDQGI 134

Query: 121 IVRVKAKELTALLSDDERLNEE 142
            VR +AK L  LLSDDE +  E
Sbjct: 135 NVRNRAKALAELLSDDETIRAE 156

>Suva_12.216 Chr12 complement(334254..335486) [1233 bp, 410 aa] {ON}
           YJR125C (REAL)
          Length = 410

 Score = 97.8 bits (242), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 52/142 (36%), Positives = 86/142 (60%), Gaps = 1/142 (0%)

Query: 2   SKQFVRSAKNLVKGYSSTQVLVRNATSNDNHQVSKDSLIELAEKSYDSADFFEIMDMLDK 61
           +K++ R A+N+V  Y+  +  VR AT+N+    S   + ++++ +Y+  +  EI+ M+ +
Sbjct: 15  AKKYFRKAQNVVFNYTEMEGKVREATNNEPWGASSTLMDQISQGTYNFREREEILSMIFR 74

Query: 62  RLNDK-GKYWRHIAKALTVIDYLIRFGSENCVLWCRENLYIIKTLKEFRHEDDEGIDQGQ 120
           R  +K G  WR I KAL ++DYLI+ GSE  +   R ++ +IK L+ F + D +G DQG 
Sbjct: 75  RFTEKAGSEWRQIYKALQLLDYLIKHGSERFIDDTRSSINLIKILESFHYTDSQGRDQGI 134

Query: 121 IVRVKAKELTALLSDDERLNEE 142
            VR + K L  LLSDD ++  E
Sbjct: 135 NVRTRVKALVELLSDDSKIRAE 156

>SAKL0G17952g Chr7 complement(1555520..1556767) [1248 bp, 415 aa]
           {ON} similar to uniprot|P47160 Saccharomyces cerevisiae
           YJR125C ENT3 Protein containing an N-terminal epsin-like
           domain involved in clathrin recruitment and traffic
           between the Golgi and endosomes associates with the
           clathrin adaptor Gga2p
          Length = 415

 Score = 97.4 bits (241), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 51/142 (35%), Positives = 87/142 (61%), Gaps = 1/142 (0%)

Query: 2   SKQFVRSAKNLVKGYSSTQVLVRNATSNDNHQVSKDSLIELAEKSYDSADFFEIMDMLDK 61
           +K++ R A+N+V  Y+  +  VR AT+N+    S   + +++  +Y+  +  EI+ M+ +
Sbjct: 15  AKKYFRKAQNVVFNYTEMEAKVREATNNEPWGASSTLMEQISAGTYNYREREEILGMIFR 74

Query: 62  RLNDK-GKYWRHIAKALTVIDYLIRFGSENCVLWCRENLYIIKTLKEFRHEDDEGIDQGQ 120
           R  +K    WR I KAL +++YLI+ GSE  +   R NL +IK L+ F + D +G DQG 
Sbjct: 75  RFTEKTASEWRQIYKALQLLEYLIKHGSERFIDDSRANLTLIKMLESFHYTDSQGRDQGI 134

Query: 121 IVRVKAKELTALLSDDERLNEE 142
            VR +A+EL  LL++D+++  E
Sbjct: 135 NVRNRAQELVKLLNNDDQIRAE 156

>KNAG0M00380 Chr13 (56675..57886) [1212 bp, 403 aa] {ON} Anc_4.346
           YJR125C
          Length = 403

 Score = 97.1 bits (240), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 52/136 (38%), Positives = 83/136 (61%), Gaps = 1/136 (0%)

Query: 2   SKQFVRSAKNLVKGYSSTQVLVRNATSNDNHQVSKDSLIELAEKSYDSADFFEIMDMLDK 61
           +K++ R A+N+V  ++  +  VR AT+N+    S   + ++A+ +Y+  +  E+M ML +
Sbjct: 15  AKKYFRKAQNVVFNFTEMESKVREATNNEPWGASSTLMEQIAQGTYNYKEREEVMMMLMR 74

Query: 62  RLNDK-GKYWRHIAKALTVIDYLIRFGSENCVLWCRENLYIIKTLKEFRHEDDEGIDQGQ 120
           R  +K G  WR I KAL ++DYLIR GSE  +   R  L I++ L+ F + D +G DQG 
Sbjct: 75  RFTEKAGSEWRQIYKALQLLDYLIRRGSEKFIDDVRAALRIVRLLESFHYIDSQGRDQGV 134

Query: 121 IVRVKAKELTALLSDD 136
            VR +AK++  LL DD
Sbjct: 135 NVRNRAKQIVELLQDD 150

>Skud_10.349 Chr10 complement(613398..614630) [1233 bp, 410 aa] {ON}
           YJR125C (REAL)
          Length = 410

 Score = 95.9 bits (237), Expect = 8e-21,   Method: Compositional matrix adjust.
 Identities = 52/142 (36%), Positives = 86/142 (60%), Gaps = 1/142 (0%)

Query: 2   SKQFVRSAKNLVKGYSSTQVLVRNATSNDNHQVSKDSLIELAEKSYDSADFFEIMDMLDK 61
           +K++ R A+N+V  Y+  +  VR AT+N+    S   + ++++ +Y+  +  EI+ M+ +
Sbjct: 15  AKKYFRKAQNVVFNYTEMEGKVREATNNEPWGASSTLMDQISQGTYNFREREEILSMIFR 74

Query: 62  RLNDK-GKYWRHIAKALTVIDYLIRFGSENCVLWCRENLYIIKTLKEFRHEDDEGIDQGQ 120
           R  +K G  WR I KAL ++DYLI+ GSE  +   R ++ +IK L+ F + D +G DQG 
Sbjct: 75  RFTEKAGSEWRQIYKALQLLDYLIKHGSERFIDDTRSSINLIKILETFHYIDSQGRDQGI 134

Query: 121 IVRVKAKELTALLSDDERLNEE 142
            VR + K L  LLSDD ++  E
Sbjct: 135 NVRTRVKTLIELLSDDNKIRAE 156

>YJR125C Chr10 complement(654737..655963) [1227 bp, 408 aa] {ON}
           ENT3Protein containing an N-terminal epsin-like domain
           involved in clathrin recruitment and traffic between the
           Golgi and endosomes; associates with the clathrin
           adaptor Gga2p
          Length = 408

 Score = 95.5 bits (236), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 51/142 (35%), Positives = 86/142 (60%), Gaps = 1/142 (0%)

Query: 2   SKQFVRSAKNLVKGYSSTQVLVRNATSNDNHQVSKDSLIELAEKSYDSADFFEIMDMLDK 61
           +K++ R A+N+V  Y+  +  VR AT+N+    S   + ++++ +Y+  +  EI+ M+ +
Sbjct: 15  AKKYFRKAQNVVFNYTEMEGKVREATNNEPWGASSTLMDQISQGTYNFREREEILSMIFR 74

Query: 62  RLNDK-GKYWRHIAKALTVIDYLIRFGSENCVLWCRENLYIIKTLKEFRHEDDEGIDQGQ 120
           R  +K G  WR I KAL ++DYLI+ GSE  +   R ++ +I+ L+ F + D +G DQG 
Sbjct: 75  RFTEKAGSEWRQIYKALQLLDYLIKHGSERFIDDTRNSINLIRILETFHYIDSQGRDQGI 134

Query: 121 IVRVKAKELTALLSDDERLNEE 142
            VR + K L  LLSDD ++  E
Sbjct: 135 NVRTRVKALIELLSDDNKIRAE 156

>KAFR0B06740 Chr2 (1406075..1407274) [1200 bp, 399 aa] {ON}
           Anc_4.346 YJR125C
          Length = 399

 Score = 95.1 bits (235), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 53/142 (37%), Positives = 88/142 (61%), Gaps = 1/142 (0%)

Query: 2   SKQFVRSAKNLVKGYSSTQVLVRNATSNDNHQVSKDSLIELAEKSYDSADFFEIMDMLDK 61
           +K++ R A+N+V  Y+  +  VR AT+N+    S   + ++A+ +Y+  +  EI+ M+ +
Sbjct: 15  AKKYFRKAQNVVFNYTEMEGKVREATNNEPWGASSTLMEQIAQGTYNLREREEILGMIFR 74

Query: 62  RLNDK-GKYWRHIAKALTVIDYLIRFGSENCVLWCRENLYIIKTLKEFRHEDDEGIDQGQ 120
           R  +K G  WR I K+L ++DYLIR GSE  +   R ++ +I+ L+ F + D +G DQG 
Sbjct: 75  RFTEKAGSEWRQIYKSLQLLDYLIRRGSERFIDDVRSSIRLIELLETFHYIDSQGRDQGI 134

Query: 121 IVRVKAKELTALLSDDERLNEE 142
            VR +AK L  LLSDD ++ +E
Sbjct: 135 NVRNRAKALGELLSDDTKIRQE 156

>Smik_10.418 Chr10 complement(643833..645062) [1230 bp, 409 aa] {ON}
           YJR125C (REAL)
          Length = 409

 Score = 95.1 bits (235), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 51/142 (35%), Positives = 86/142 (60%), Gaps = 1/142 (0%)

Query: 2   SKQFVRSAKNLVKGYSSTQVLVRNATSNDNHQVSKDSLIELAEKSYDSADFFEIMDMLDK 61
           +K++ R A+N+V  Y+  +  VR AT+N+    S   + ++++ +Y+  +  EI+ M+ +
Sbjct: 15  AKKYFRKAQNVVFNYTEMEGKVREATNNEPWGASSTLMDQISQGTYNFREREEILSMIFR 74

Query: 62  RLNDK-GKYWRHIAKALTVIDYLIRFGSENCVLWCRENLYIIKTLKEFRHEDDEGIDQGQ 120
           R  +K G  WR I KAL ++DYLI+ GSE  +   R ++ +I+ L+ F + D +G DQG 
Sbjct: 75  RFTEKAGSEWRQIYKALQLLDYLIKHGSERFIDDTRNSINLIRILETFHYIDSQGRDQGI 134

Query: 121 IVRVKAKELTALLSDDERLNEE 142
            VR + K L  LLSDD ++  E
Sbjct: 135 NVRTRVKALIDLLSDDNKIRAE 156

>KLLA0B04587g Chr2 (411097..412299) [1203 bp, 400 aa] {ON} similar
           to uniprot|P47160 Saccharomyces cerevisiae YJR125C ENT3
           Protein containing an N-terminal epsin-like domain
           involved in clathrin recruitment and traffic between the
           Golgi and endosomes associates with the clathrin adaptor
           Gga2p
          Length = 400

 Score = 95.1 bits (235), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 50/142 (35%), Positives = 85/142 (59%), Gaps = 1/142 (0%)

Query: 2   SKQFVRSAKNLVKGYSSTQVLVRNATSNDNHQVSKDSLIELAEKSYDSADFFEIMDMLDK 61
           +K++ R A+N+V  Y+  +  VR AT+N+    S   +  +A+ +Y+  +  EI+ M+ +
Sbjct: 15  AKKYFRKAQNVVFNYTEMEAKVREATNNEPWGASSTLMEHIAQGTYNYREREEILGMIFR 74

Query: 62  RLNDK-GKYWRHIAKALTVIDYLIRFGSENCVLWCRENLYIIKTLKEFRHEDDEGIDQGQ 120
           R  +K    WR I KAL +++YL++ GSE  +   R NL ++K L+ F + D +G DQG 
Sbjct: 75  RFTEKTASEWRQIYKALQLLEYLVKHGSERFIDDVRTNLNLVKMLESFHYIDSQGRDQGI 134

Query: 121 IVRVKAKELTALLSDDERLNEE 142
            VR +A +L  LL  DE++ +E
Sbjct: 135 NVRNRASQLVKLLESDEQIRQE 156

>ZYRO0B14784g Chr2 complement(1205944..1207218) [1275 bp, 424 aa]
           {ON} similar to uniprot|P47160 Saccharomyces cerevisiae
           YJR125C ENT3 Protein containing an N-terminal epsin-like
           domain involved in clathrin recruitment and traffic
           between the Golgi and endosomes associates with the
           clathrin adaptor Gga2p
          Length = 424

 Score = 94.0 bits (232), Expect = 4e-20,   Method: Compositional matrix adjust.
 Identities = 51/142 (35%), Positives = 85/142 (59%), Gaps = 1/142 (0%)

Query: 2   SKQFVRSAKNLVKGYSSTQVLVRNATSNDNHQVSKDSLIELAEKSYDSADFFEIMDMLDK 61
           +K++ R A+N+V  Y+  +  VR AT+N+    S   +  +A+ +Y+  +  EI+ M+ +
Sbjct: 50  AKKYFRKAQNVVFNYTEMEAKVREATNNEPWGTSSTLMEYIAQGTYNLREREEILGMIFR 109

Query: 62  RLNDK-GKYWRHIAKALTVIDYLIRFGSENCVLWCRENLYIIKTLKEFRHEDDEGIDQGQ 120
           R  +K    WR I KAL +++YLI+ GSE  +   R ++ ++K L+ F + D +G DQG 
Sbjct: 110 RFTEKTANEWRQIYKALQLLEYLIKHGSERFIDDTRCSISLLKMLESFHYVDSQGRDQGI 169

Query: 121 IVRVKAKELTALLSDDERLNEE 142
            VR +AK LT LL DD ++  E
Sbjct: 170 NVRTRAKALTELLGDDNKIRAE 191

>NCAS0A06210 Chr1 complement(1229758..1231029) [1272 bp, 423 aa]
           {ON} Anc_4.346
          Length = 423

 Score = 93.2 bits (230), Expect = 6e-20,   Method: Compositional matrix adjust.
 Identities = 51/142 (35%), Positives = 84/142 (59%), Gaps = 1/142 (0%)

Query: 2   SKQFVRSAKNLVKGYSSTQVLVRNATSNDNHQVSKDSLIELAEKSYDSADFFEIMDMLDK 61
           +K++ R A+N+V  Y+  +  VR AT+N+    S   + ++A+ +Y+  +  EI+ M+ +
Sbjct: 15  AKKYFRKAQNVVFNYTEMEGKVREATNNEPWGASSTLMEQIAQGTYNIREREEILSMIFR 74

Query: 62  RLNDK-GKYWRHIAKALTVIDYLIRFGSENCVLWCRENLYIIKTLKEFRHEDDEGIDQGQ 120
           R  +K G  WR I KAL ++DYLI+ GSE  +   R ++ ++K L+ F + D EG DQG 
Sbjct: 75  RFTEKTGSEWRQIYKALQLLDYLIKHGSEKFIDDVRSSVAVLKLLQTFHYIDAEGRDQGI 134

Query: 121 IVRVKAKELTALLSDDERLNEE 142
            VR +   L  LL DD  + +E
Sbjct: 135 NVRNRVTTLIELLRDDNSIRQE 156

>AER155C Chr5 complement(929042..930136) [1095 bp, 364 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YJR125C
           (ENT3)
          Length = 364

 Score = 90.9 bits (224), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 48/142 (33%), Positives = 84/142 (59%), Gaps = 1/142 (0%)

Query: 2   SKQFVRSAKNLVKGYSSTQVLVRNATSNDNHQVSKDSLIELAEKSYDSADFFEIMDMLDK 61
           +K++ R A+N++  Y+  +  VR AT+N+    S   + ++A+ +Y+  +  EI+ M+ +
Sbjct: 15  AKKYFRKAQNVMLNYTGMEAKVREATNNEPWGASSTLMTQIAQGTYNFREREEILAMILR 74

Query: 62  RLNDK-GKYWRHIAKALTVIDYLIRFGSENCVLWCRENLYIIKTLKEFRHEDDEGIDQGQ 120
           R  +K    WR I K++ +++YL++ GSE  +   R NL +I+ L+ F + D +G DQG 
Sbjct: 75  RFLEKSANEWRQIYKSMQLLEYLVKHGSERFIDDVRSNLNLIRMLETFHYIDSQGRDQGI 134

Query: 121 IVRVKAKELTALLSDDERLNEE 142
            VR + K L  LL DDE +  E
Sbjct: 135 NVRNRTKALVKLLEDDELIRAE 156

>TPHA0B00400 Chr2 (83356..84555) [1200 bp, 399 aa] {ON} Anc_4.346
           YJR125C
          Length = 399

 Score = 90.9 bits (224), Expect = 4e-19,   Method: Compositional matrix adjust.
 Identities = 50/142 (35%), Positives = 84/142 (59%), Gaps = 1/142 (0%)

Query: 2   SKQFVRSAKNLVKGYSSTQVLVRNATSNDNHQVSKDSLIELAEKSYDSADFFEIMDMLDK 61
           +K++ R A+N++  Y+  +  VR AT+N+    S   + ++A+ +Y+  +  EI+ M+ +
Sbjct: 15  AKKYFRKAQNVMFNYTDMEAKVREATNNEPWGASSTLMKQIAQGTYNIREREEILGMVFR 74

Query: 62  RLNDK-GKYWRHIAKALTVIDYLIRFGSENCVLWCRENLYIIKTLKEFRHEDDEGIDQGQ 120
           R  +K    WR I K+L + DYLI+ GSE  +   R ++ +IK L+ F + D +G DQG 
Sbjct: 75  RYTEKTASEWRQIYKSLQLTDYLIKHGSERFIDDVRTSISLIKMLESFHYIDSQGRDQGI 134

Query: 121 IVRVKAKELTALLSDDERLNEE 142
            VR KA+ L A L DD+ +  E
Sbjct: 135 NVRNKAQSLVAFLKDDDLIRAE 156

>Ecym_1133 Chr1 (274069..275247) [1179 bp, 392 aa] {ON} similar to
           Ashbya gossypii AER155C
          Length = 392

 Score = 86.7 bits (213), Expect = 8e-18,   Method: Compositional matrix adjust.
 Identities = 47/142 (33%), Positives = 84/142 (59%), Gaps = 1/142 (0%)

Query: 2   SKQFVRSAKNLVKGYSSTQVLVRNATSNDNHQVSKDSLIELAEKSYDSADFFEIMDMLDK 61
           +K++ R A+N+V  Y+  +  VR AT+N++       + ++A+ +Y+  +  EI+ M+ +
Sbjct: 15  AKKYFRKAQNVVFNYTGMEAKVREATNNESWGAPSSLMAQIAQGTYNYRERKEILGMIFR 74

Query: 62  RLNDK-GKYWRHIAKALTVIDYLIRFGSENCVLWCRENLYIIKTLKEFRHEDDEGIDQGQ 120
           R  +K    WR I K++ +++YLI  GSE  +   R  L +IK L+ F + D +G DQG 
Sbjct: 75  RFVEKTASEWRQIYKSVQLLEYLIYHGSEGFIDDVRSGLNLIKMLESFHYIDSQGRDQGI 134

Query: 121 IVRVKAKELTALLSDDERLNEE 142
            VR + + L  LL++DE++  E
Sbjct: 135 NVRNRTQALVQLLNNDEQIRIE 156

>CAGL0H04323g Chr8 (407884..409122) [1239 bp, 412 aa] {ON} similar
           to uniprot|P47160 Saccharomyces cerevisiae YJR125c ENT3
           cytoskeletal adaptor
          Length = 412

 Score = 84.3 bits (207), Expect = 5e-17,   Method: Compositional matrix adjust.
 Identities = 53/142 (37%), Positives = 87/142 (61%), Gaps = 1/142 (0%)

Query: 2   SKQFVRSAKNLVKGYSSTQVLVRNATSNDNHQVSKDSLIELAEKSYDSADFFEIMDMLDK 61
           +K++ R A+N+V  Y+  +  VR AT+N+    S   + ++A+ +Y+  +  EI+ M+ +
Sbjct: 15  AKKYFRKAQNVVYNYTDMESKVREATNNEPWGASSTLMEQIAQGTYNIREREEILGMIFR 74

Query: 62  RLNDK-GKYWRHIAKALTVIDYLIRFGSENCVLWCRENLYIIKTLKEFRHEDDEGIDQGQ 120
           R  +K G  WR I KAL +++YLI+ GSE  +   R ++ I+K L+ F + D +G DQG 
Sbjct: 75  RFTEKSGSEWRQIYKALQLLEYLIKHGSERFIDDTRNSISIVKLLESFHYIDSQGRDQGV 134

Query: 121 IVRVKAKELTALLSDDERLNEE 142
            VR +A  LTALL+DD  +  E
Sbjct: 135 NVRNRAAALTALLADDSSIRAE 156

>SAKL0H25762g Chr8 (2256842..2257630) [789 bp, 262 aa] {ON} some
           similarities with uniprot|Q07872 Saccharomyces
           cerevisiae YLL038C ENT4 Protein of unknown function
           contains an N-terminal epsin-like domain
          Length = 262

 Score = 77.8 bits (190), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 50/145 (34%), Positives = 82/145 (56%), Gaps = 12/145 (8%)

Query: 5   FVRSAKNLVKGYSSTQVLVRNATSNDNHQVSKDSLI-ELAEKSYDSADFFEIMDMLDKRL 63
           F+RS +N+  G S+T+V V+ AT +D +  +  +L+ E++  +Y +    EI  ++ +RL
Sbjct: 3   FIRSVRNM--GQSTTEVKVKKATDDDEYSGATGALMNEISVLTYSAKTLREITQVIHRRL 60

Query: 64  NDKGKYWR-------HIAKALTVIDYLIRFGSENCVLWCRENLYIIKTLKEFRHEDDEGI 116
           +  G Y +       HI K LT+I YLI  GS + V W R+  Y++ TL+EF    D+  
Sbjct: 61  S--GNYRKSSHRNAVHILKTLTLISYLINNGSNDFVSWIRQYAYLVDTLREFNVSADKDR 118

Query: 117 DQGQIVRVKAKELTALLSDDERLNE 141
              + VR+ + +L+ LL DD  L E
Sbjct: 119 KMAEQVRMLSIKLSKLLKDDLMLQE 143

>Kwal_55.20611 s55 complement(489968..490732) [765 bp, 254 aa] {ON}
           YLL038C (ENT4) - Ent4p [contig 144] FULL
          Length = 254

 Score = 77.4 bits (189), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 51/143 (35%), Positives = 76/143 (53%), Gaps = 8/143 (5%)

Query: 5   FVRSAKNLVKGYSSTQVLVRNATSNDNHQVSKDSLI-ELAEKSYDSADFFEIMDMLDKRL 63
            +++ +N+  G SST+V  RNAT++D H  +  SL+ EL+  +Y      EI  ++ KRL
Sbjct: 3   LLKTVRNI--GQSSTEVKTRNATNDDEHNGATGSLMNELSVLTYSPRTLREITQVIRKRL 60

Query: 64  NDKGKYWRH-----IAKALTVIDYLIRFGSENCVLWCRENLYIIKTLKEFRHEDDEGIDQ 118
           +   +   H     + K LT+I YLI  GS+  V+W R  LY+I TLKEF          
Sbjct: 61  SGNSRMSSHKNAVHLLKTLTLIAYLINNGSDEFVVWIRSYLYLIDTLKEFNGGSRTKERM 120

Query: 119 GQIVRVKAKELTALLSDDERLNE 141
              +R  A  L A+L D+E L +
Sbjct: 121 ASQIRNLASSLAAILRDEELLRQ 143

>Kpol_388.5 s388 complement(17825..18631) [807 bp, 268 aa] {ON}
           complement(17825..18631) [807 nt, 269 aa]
          Length = 268

 Score = 69.3 bits (168), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 48/140 (34%), Positives = 76/140 (54%), Gaps = 12/140 (8%)

Query: 8   SAKNLVKGYSSTQVLVRNATSNDNHQVSKDSLI-ELAEKSYDSADFFEIMDMLDKRLNDK 66
           S +N V+  S+T+  V+ AT ++    +  +L+ E++  +Y      EI+ +L KRL   
Sbjct: 6   SVRNFVQ--SATEAKVKEATDDNETSGATGTLMNEISVLTYSPKTLKEIIQVLKKRLTGS 63

Query: 67  GKY-----WRHIAKALTVIDYLIRFGSENCVLWCRENLYIIKTLKEFR--HEDDEGIDQG 119
            K        HI K +T+I YLI  GS + + W R N+ I + LK+F   HEDDE +   
Sbjct: 64  SKKSSHRNCVHILKTMTLISYLINNGSNDFIAWARSNIMIFEVLKDFEVIHEDDEKM--A 121

Query: 120 QIVRVKAKELTALLSDDERL 139
           + +R  A +L  L++DDE L
Sbjct: 122 EQIRYIAGDLCILINDDELL 141

>TDEL0G01740 Chr7 (342371..343144) [774 bp, 257 aa] {ON} Anc_4.17
           YLL038C
          Length = 257

 Score = 65.9 bits (159), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 45/140 (32%), Positives = 77/140 (55%), Gaps = 12/140 (8%)

Query: 8   SAKNLVKGYSSTQVLVRNATSNDNHQVSKDSLI-ELAEKSYDSADFFEIMDMLDKRLNDK 66
           S + LV+  S+T++ V+ AT  +    +  +L+ E++  +Y      EI+ ++ KRL   
Sbjct: 6   SVRTLVQ--STTELKVKQATDENESSGATGTLMNEISVLTYSPKTLKEIVQVVRKRLMGH 63

Query: 67  G-----KYWRHIAKALTVIDYLIRFGSENCVLWCRENLYIIKTLKEFRHED--DEGIDQG 119
           G     K   H+ K LT++ YL+  GS + + W R N+ ++  LKEF  +D  DE I  G
Sbjct: 64  GRRNSHKICIHLVKTLTLVTYLMNNGSNDFIAWVRGNMALVDCLKEFNVQDRNDEKI--G 121

Query: 120 QIVRVKAKELTALLSDDERL 139
           Q +R  +++L  L+ DD+ L
Sbjct: 122 QQIRAMSQDLCTLIKDDDLL 141

>TBLA0B06220 Chr2 (1466908..1467927) [1020 bp, 339 aa] {ON}
           Anc_4.346 YJR125C
          Length = 339

 Score = 66.6 bits (161), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 43/141 (30%), Positives = 74/141 (52%), Gaps = 1/141 (0%)

Query: 2   SKQFVRSAKNLVKGYSSTQVLVRNATSNDNHQVSKDSLIELAEKSYDSADFFEIMDMLDK 61
           +K+F R A+N +   +  +  VR AT+ND    S   + ++   +++     +I++ML  
Sbjct: 15  AKKFFRMAENFLFNLTDMESKVREATNNDPWGTSVILMAQINAGTFEINQRADIINMLLN 74

Query: 62  RLNDK-GKYWRHIAKALTVIDYLIRFGSENCVLWCRENLYIIKTLKEFRHEDDEGIDQGQ 120
           R  +K G  WR I K++ ++ YL+  GS   V   + NL +IK L  F   DD+G +Q  
Sbjct: 75  RFLEKNGSQWRQIYKSVLLLQYLLINGSTEFVSEVKLNLTLIKNLMLFEFIDDQGYNQSS 134

Query: 121 IVRVKAKELTALLSDDERLNE 141
            +    + L  L++DD  LN+
Sbjct: 135 KISKATERLIELMTDDHLLND 155

>Ecym_8407 Chr8 (843359..844123) [765 bp, 254 aa] {ON} similar to
           Ashbya gossypii ACL061C
          Length = 254

 Score = 64.3 bits (155), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 46/143 (32%), Positives = 75/143 (52%), Gaps = 12/143 (8%)

Query: 5   FVRSAKNLVKGYSSTQVLVRNATSNDNHQVSKDSLI-ELAEKSYDSADFFEIMDMLDKRL 63
           F+ S ++L  G SST V V+ AT +  H  +  SL+ E+A  +Y      EI  +L KRL
Sbjct: 3   FLSSVRHL--GSSSTTVKVKKATDDSEHNGAYGSLMNEIAILTYSPNTLREITQVLKKRL 60

Query: 64  NDKGKYWR-------HIAKALTVIDYLIRFGSENCVLWCRENLYIIKTLKEFRHEDDEGI 116
              G Y +       ++ K LT+I +L+  GSE C+ W R +L +I++ ++F   D E  
Sbjct: 61  --VGNYKKTPSKRAVNLLKTLTLIRFLVINGSEECIAWLRRHLVLIRSFQDFTLRDGEKK 118

Query: 117 DQGQIVRVKAKELTALLSDDERL 139
                +++ + +L  LL+D   L
Sbjct: 119 QMVNQIQLLSCKLCQLLTDSNLL 141

>KLTH0E05874g Chr5 complement(530814..531581) [768 bp, 255 aa] {ON}
           similar to uniprot|Q07872 Saccharomyces cerevisiae
           YLL038C ENT4 Protein of unknown function contains an N-
           terminal epsin-like domain
          Length = 255

 Score = 63.5 bits (153), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 47/137 (34%), Positives = 72/137 (52%), Gaps = 14/137 (10%)

Query: 15  GYSSTQVLVRNATSNDNHQVSKDSLI-ELAEKSYDSADFFEIMDMLDKRL---NDKGKYW 70
           G S T++  +NAT++D +  +  SL+ E++  +Y S    EI  ++ KRL   N K  + 
Sbjct: 11  GQSQTEIKTKNATNDDEYSGATGSLMNEISVLTYSSRTLREITAVVRKRLSGNNRKSSHK 70

Query: 71  R--HIAKALTVIDYLIRFGSENCVLWCRENLYIIKTLKEF----RHEDDEGIDQGQIVRV 124
              HI K LT+  YLI  GS   V W R  +Y+I +LKEF    R ++   +     +R 
Sbjct: 71  NAVHILKTLTLTAYLINNGSNEFVAWIRSYVYLIDSLKEFTIGSRGQERMAVQ----IRS 126

Query: 125 KAKELTALLSDDERLNE 141
            A  L+ +L DDE L +
Sbjct: 127 LASTLSVILRDDELLRQ 143

>ZYRO0G07876g Chr7 complement(636468..637247) [780 bp, 259 aa] {ON}
           similar to uniprot|Q07872 Saccharomyces cerevisiae
           YLL038C ENT4 Protein of unknown function contains an N-
           terminal epsin-like domain
          Length = 259

 Score = 60.8 bits (146), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 47/135 (34%), Positives = 70/135 (51%), Gaps = 10/135 (7%)

Query: 13  VKGYSSTQVLVRNATSNDNHQVSKDSLI-ELAEKSYDSADFFEIMDMLDKRLNDKGKYWR 71
           V G SST++ VR AT+ D    +  +L+ E++  +Y      EI  +L +RL+  G+   
Sbjct: 9   VFGPSSTELKVRKATNEDEKTGATGTLMNEISVLTYSPKTVREITQVLKRRLSSYGRRTS 68

Query: 72  H-----IAKALTVIDYLIRFGSENCVLWCRENLYIIKTLK--EFRHEDDEGIDQGQIVRV 124
           H     I KALT+I YLI  GSE  V W R NL   + LK  E   + DE +   + +R 
Sbjct: 69  HKNSIHIVKALTLILYLINNGSEEFVAWVRGNLIYFECLKSCEVSQKRDEPL--AKQIRS 126

Query: 125 KAKELTALLSDDERL 139
            + ++   + DDE L
Sbjct: 127 MSNQICDCVKDDELL 141

>TPHA0F00230 Chr6 complement(43589..44431) [843 bp, 280 aa] {ON}
           Anc_4.17 YLL038C
          Length = 280

 Score = 61.2 bits (147), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 43/141 (30%), Positives = 73/141 (51%), Gaps = 8/141 (5%)

Query: 8   SAKNLVKGYSSTQVLVRNATSNDNHQVSKDSLI-ELAEKSYDSADFFEIMDMLDKRLN-- 64
           S +N V+  S T+  VR AT +D    +  +L+ E++  +Y      EI+ +L KRL   
Sbjct: 6   SVRNFVQ--SPTESKVRQATDDDETSGATGTLMNEISVLTYSPKTLKEIVQILKKRLTGY 63

Query: 65  ---DKGKYWRHIAKALTVIDYLIRFGSENCVLWCRENLYIIKTLKEFRHEDDEGIDQGQI 121
              +  K   HI K LT+I YLI  GS + + W R N+ + + LK F  ++ E    GQ 
Sbjct: 64  SKKNSHKNCVHILKTLTLITYLINNGSNDFIAWTRSNIMLFEYLKNFEVQNLEDEKMGQQ 123

Query: 122 VRVKAKELTALLSDDERLNEE 142
           +     ++  +++DD+ L ++
Sbjct: 124 IVFICNDICNIINDDDMLEQK 144

>Suva_10.35 Chr10 complement(70188..70931) [744 bp, 247 aa] {ON}
           YLL038C (REAL)
          Length = 247

 Score = 55.5 bits (132), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 37/133 (27%), Positives = 68/133 (51%), Gaps = 7/133 (5%)

Query: 17  SSTQVLVRNATSNDNHQVSKDSLI-ELAEKSYDSADFFEIMDMLDKRL------NDKGKY 69
           S T+  V+ ATS D    +  +L+ E++  +Y      EI+ ++ KRL       +  + 
Sbjct: 13  SPTESKVKQATSEDETSGATGTLMNEISILTYSPKTVREIIQIVRKRLLLGQNRRNSHRS 72

Query: 70  WRHIAKALTVIDYLIRFGSENCVLWCRENLYIIKTLKEFRHEDDEGIDQGQIVRVKAKEL 129
              + K LT++ YL+  GS   + W + N+ +I+ L++F+ +D      G+ +R  ++ L
Sbjct: 73  CIQVMKTLTLVSYLMNNGSNEFIKWLKGNMILIEILEDFQAQDARDDRNGEEIRKLSRNL 132

Query: 130 TALLSDDERLNEE 142
             LL DDE L  +
Sbjct: 133 HELLQDDELLERQ 145

>KLLA0D03949g Chr4 (333566..334243) [678 bp, 225 aa] {ON} similar to
           uniprot|Q07872 Saccharomyces cerevisiae YLL038C ENT4
           Protein of unknown function contains an N- terminal
           epsin- like domain
          Length = 225

 Score = 55.1 bits (131), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 37/120 (30%), Positives = 68/120 (56%), Gaps = 10/120 (8%)

Query: 15  GYSSTQVLVRNAT-SNDNHQVSKDSLIELAEKSYDSADFFEIMDMLDKRLNDKGKYWR-- 71
           G S+TQ+ V+ AT SN+++  +   + EL+  +Y      EI +++ KRL +     +  
Sbjct: 11  GQSTTQLKVKQATDSNESYGATGTLMNELSVLTYSEKSANEIYEVIRKRLMNGSSRLKNS 70

Query: 72  -----HIAKALTVIDYLIRFGSENCVLWCRENLYIIKTLKEFRHEDDEGIDQGQIVRVKA 126
                 + K LT+I+YL+  GSE  VLW R +L  I+ LK++   +D+  D+ ++ ++K+
Sbjct: 71  HDSVVQVLKTLTLIEYLLYNGSEEFVLWMRRHLAYIEALKDYHCSNDK--DKSKVKQIKS 128

>TBLA0G00650 Chr7 (140678..141949) [1272 bp, 423 aa] {ON} Anc_4.17
           YLL038C
          Length = 423

 Score = 52.0 bits (123), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 42/142 (29%), Positives = 72/142 (50%), Gaps = 9/142 (6%)

Query: 8   SAKNLVKGYSSTQVLVRNATS-NDNHQVSKDSLIELAEKSYDSADFFEIMDMLDKRLNDK 66
           S +N V+  S T++ VR AT  N+N   +   + E++  +Y +    EI+ +L KRL   
Sbjct: 6   SVRNFVQ--SPTELKVRTATDDNENSGATGTLMNEISVLTYSTKTNKEIVTVLKKRLTGY 63

Query: 67  GKYWRH-----IAKALTVIDYLIRFGSENCVLWCRENLYIIKTLKEFRHEDDEGIDQGQI 121
           GK   H     I K LT+I YL+  GS   + W  EN  + + +K F   D    ++  I
Sbjct: 64  GKKSSHRNCIHIIKTLTLIAYLMNNGSLEFIRWINENQLLFEVMKNFEVSDTIHDEKFAI 123

Query: 122 -VRVKAKELTALLSDDERLNEE 142
            +R  ++ +  L+++ E L ++
Sbjct: 124 QIRDLSERILELINNRELLEQK 145

>ACL061C Chr3 complement(256803..257507) [705 bp, 234 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YLL038C
           (ENT4)
          Length = 234

 Score = 50.8 bits (120), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 37/134 (27%), Positives = 62/134 (46%), Gaps = 6/134 (4%)

Query: 15  GYSSTQVLVRNATSNDNHQVSKDSLI-ELAEKSYDSADFFEIMDMLDKRLNDKG-----K 68
           G S T   VR AT ++    +  +LI E+   +Y      ++  +L KRL+        K
Sbjct: 11  GSSPTAAKVRKATDDNEFVGASSALISEITILTYSCKTLLDVTRVLKKRLSGNANKSSHK 70

Query: 69  YWRHIAKALTVIDYLIRFGSENCVLWCRENLYIIKTLKEFRHEDDEGIDQGQIVRVKAKE 128
              HI KALT+ +YLI  GSE+ V W +    +++ LK+F   ++        +R  +  
Sbjct: 71  NAVHILKALTLTNYLIANGSEDFVQWLQGCAVLLRRLKDFTTGNERDSHMASQIRSFSLS 130

Query: 129 LTALLSDDERLNEE 142
           L  L+ +   L + 
Sbjct: 131 LLELMQNPALLEDH 144

>NCAS0C05840 Chr3 (1202292..1203095) [804 bp, 267 aa] {ON} Anc_4.17
           YLL038C
          Length = 267

 Score = 50.1 bits (118), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 42/137 (30%), Positives = 66/137 (48%), Gaps = 8/137 (5%)

Query: 13  VKGY--SSTQVLVRNATSNDNHQVSKDSLI-ELAEKSYDSADFFEIMDMLDKRLNDKGKY 69
           VK +  S T+  V+ AT+ D    +  +L+ E++  +Y      EI+ +L KRL+   + 
Sbjct: 7   VKSFVQSPTESKVKQATNEDETMGATGTLMNEISVLTYSPKTLKEIVQVLKKRLSGYSRK 66

Query: 70  WRH-----IAKALTVIDYLIRFGSENCVLWCRENLYIIKTLKEFRHEDDEGIDQGQIVRV 124
             H     I K LT++ YLI  GS   V W R N  +I  L   + E  +    G  ++ 
Sbjct: 67  TSHKNCIFIIKTLTLMAYLINNGSNEFVAWIRNNSSLISNLISEKVEYPKDDKMGPEIKS 126

Query: 125 KAKELTALLSDDERLNE 141
            A +L  L+ DD+ L E
Sbjct: 127 IAADLMELIQDDDLLEE 143

>Skud_12.30 Chr12 complement(56967..57710) [744 bp, 247 aa] {ON}
           YLL038C (REAL)
          Length = 247

 Score = 48.1 bits (113), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 34/127 (26%), Positives = 63/127 (49%), Gaps = 7/127 (5%)

Query: 17  SSTQVLVRNATSNDNHQVSKDSLI-ELAEKSYDSADFFEIMDMLDKRL------NDKGKY 69
           S T+  V+ ATS D    +  +L+ E++  +Y      EI+ ++ KRL       +  + 
Sbjct: 13  SPTESKVKQATSEDETSGATGTLMNEISILTYSPKTVREIIQVIRKRLLLGQNRRNSHRN 72

Query: 70  WRHIAKALTVIDYLIRFGSENCVLWCRENLYIIKTLKEFRHEDDEGIDQGQIVRVKAKEL 129
              + K LT++ YL+  GS   + W + N+ +I+ L+ F  +D     + + +R  ++ L
Sbjct: 73  CIQVMKTLTLVSYLMNNGSNEFIKWLKGNMILIEILENFHIQDVRDERKREEIRKLSRNL 132

Query: 130 TALLSDD 136
             LL DD
Sbjct: 133 LELLQDD 139

>NDAI0H00280 Chr8 complement(48177..49109) [933 bp, 310 aa] {ON}
           Anc_4.17 YLL038C
          Length = 310

 Score = 44.3 bits (103), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 40/146 (27%), Positives = 77/146 (52%), Gaps = 17/146 (11%)

Query: 8   SAKNLVKGYSSTQVLVRNATSNDNHQVSKDSLI-ELAEKSYDSADFFEIMDMLDKRLND- 65
           + KN V+  + T+  V+ AT ++    +  +L+ E++  +Y      +I+ ++ KRL+  
Sbjct: 6   TVKNFVQ--TPTESKVKQATDDNETTGATGTLMNEISVLTYSPKTLKDIIQVIKKRLSSA 63

Query: 66  --KGKYWRH-----IAKALTVIDYLIRFGSENCVLWCRENLYIIKTLKE---FRHEDDEG 115
               K   H     I K LT+I YLI  GS   + W R N Y+++ + +   F+ +D+  
Sbjct: 64  TSSNKKLSHKTSVYIIKTLTLISYLINNGSNEFIEWLRLNFYLVENITKKCNFQLQDNSA 123

Query: 116 IDQ--GQIVRVKAKELTALLSDDERL 139
             +  GQI +V A+++T L++++  L
Sbjct: 124 DSKMIGQI-KVIAEDMTNLINNENLL 148

>CAGL0E03806g Chr5 (356594..357376) [783 bp, 260 aa] {ON} similar to
           uniprot|Q07872 Saccharomyces cerevisiae YLL038c ENT4
          Length = 260

 Score = 43.5 bits (101), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 27/103 (26%), Positives = 56/103 (54%), Gaps = 8/103 (7%)

Query: 14  KGY--SSTQVLVRNATSNDNHQVSKDSLI-ELAEKSYDSADFFEIMDMLDKRLN-----D 65
           KG+  S T++ VR AT ++    +  +L+ E++  +Y      +++ ++ KRL+     +
Sbjct: 8   KGFLLSPTELKVRQATDDNELAGATGTLMNEISVLTYSKKTLKDVIQVIRKRLSGVNKRN 67

Query: 66  KGKYWRHIAKALTVIDYLIRFGSENCVLWCRENLYIIKTLKEF 108
             +   H+ K LT++ YL+  GS + + W + + Y+I+ L  F
Sbjct: 68  SHRTCLHVLKTLTLVSYLLNNGSNDFIAWLKSSKYVIEYLSSF 110

>KAFR0I01460 Chr9 (304865..305692) [828 bp, 275 aa] {ON} Anc_4.17
           YLL038C
          Length = 275

 Score = 43.5 bits (101), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 44/154 (28%), Positives = 74/154 (48%), Gaps = 24/154 (15%)

Query: 5   FVRSAKNLVKGYSSTQVLVRNATSNDNHQVSKDSLI-ELAEKSYDSADFFEIMDMLDKRL 63
           F  S +NLV  YS T++ VR AT  +    S  +L+ E++  +Y +    EI+ +L K+L
Sbjct: 3   FFNSVRNLV--YSQTELKVRQATDENEIIRSTGTLMNEISVLTYSAKTLKEIIGILKKKL 60

Query: 64  -------NDKG----KYWRHIAKALTVIDYLIRFGSENCVLWCREN---LYIIKTLKEFR 109
                  N  G    K    + K  T+I YL+  GS + + W + N   L I+  +    
Sbjct: 61  SLLYGLKNGNGIISHKVCVQVLKTFTLISYLLNNGSNDFINWLKLNNGVLQILAKVDSNN 120

Query: 110 H----EDDEGIDQGQIVRVKAKELTALLSDDERL 139
           H    ED   ++Q Q +    K++  L++D++ L
Sbjct: 121 HITDDEDLHILNQAQKI---TKDIILLINDNKLL 151

>YLL038C Chr12 complement(65775..66518) [744 bp, 247 aa] {ON}
           ENT4Protein of unknown function, contains an N-terminal
           epsin-like domain; proposed to be involved in the
           trafficking of Arn1p in the absence of ferrichrome
          Length = 247

 Score = 42.7 bits (99), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 27/103 (26%), Positives = 54/103 (52%), Gaps = 7/103 (6%)

Query: 17  SSTQVLVRNATSNDNHQVSKDSLI-ELAEKSYDSADFFEIMDMLDKRL------NDKGKY 69
           S T+  V+ AT+ D    +  +L+ E++  +Y      EI+ ++ KRL       +  + 
Sbjct: 13  SPTESKVKQATNEDETSGATGTLMNEISILTYSPKTVREIIQVIRKRLLLGQNRRNSHRN 72

Query: 70  WRHIAKALTVIDYLIRFGSENCVLWCRENLYIIKTLKEFRHED 112
              + K LT++ YL+  GS   + W + N+ +I+ L++F+ +D
Sbjct: 73  CIQVMKTLTLVSYLMNNGSNEFIKWLKGNMILIEILEDFQVQD 115

>Smik_12.19 Chr12 complement(50134..50877) [744 bp, 247 aa] {ON}
           YLL038C (REAL)
          Length = 247

 Score = 41.6 bits (96), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 26/103 (25%), Positives = 54/103 (52%), Gaps = 7/103 (6%)

Query: 17  SSTQVLVRNATSNDNHQVSKDSLI-ELAEKSYDSADFFEIMDMLDKRL------NDKGKY 69
           S T+  V+ AT+ D    +  +L+ E++  +Y      EI+ ++ KRL       +  + 
Sbjct: 13  SPTESKVKQATNEDETSGATGTLMNEISILTYSPKTVREIIQVVRKRLLLGQNRRNSHRN 72

Query: 70  WRHIAKALTVIDYLIRFGSENCVLWCRENLYIIKTLKEFRHED 112
              + K LT++ YL+  GS   + W + N+ +++ L++F+ +D
Sbjct: 73  CIQVMKTLTLVSYLMNNGSNEFIKWLKSNMILVEILEDFQVQD 115

>YHR161C Chr8 complement(420373..422286) [1914 bp, 637 aa] {ON}
          YAP1801Protein involved in clathrin cage assembly;
          binds Pan1p and clathrin; homologous to Yap1802p,
          member of the AP180 protein family
          Length = 637

 Score = 40.0 bits (92), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 18/43 (41%), Positives = 27/43 (62%), Gaps = 2/43 (4%)

Query: 51 DFFEIMDMLDKRLNDKGKYWRHIAKALTVIDYLIRFGSENCVL 93
          DF+EI+  LD R+ND    W  + K+L V+  +IR GS++  L
Sbjct: 36 DFYEIVKGLDSRINDTA--WTIVYKSLLVVHLMIREGSKDVAL 76

>SAKL0H02530g Chr8 (250148..252157) [2010 bp, 669 aa] {ON} weakly
          similar to uniprot|P53309 Saccharomyces cerevisiae
          YGR241C YAP1802 Yeast Assembly Polypeptide, member of
          AP180 protein family, binds Pan1p and clathrin; member
          of clathrin assembly polypeptide AP180 family and
          weakly similar to uniprot|P38856 Saccharomyces
          cerevisiae YHR161C YAP1801 Yeast Assembly Polypeptide
          member of AP180 protein family binds Pan1p and clathrin
          clathrin assembly protein
          Length = 669

 Score = 38.5 bits (88), Expect = 0.035,   Method: Compositional matrix adjust.
 Identities = 17/46 (36%), Positives = 27/46 (58%), Gaps = 2/46 (4%)

Query: 48 DSADFFEIMDMLDKRLNDKGKYWRHIAKALTVIDYLIRFGSENCVL 93
          DS++F EIM  L+ R+ND    W  + K+L VI  ++R G  +  +
Sbjct: 33 DSSEFMEIMKALESRINDTA--WTIVYKSLIVIHLMMRDGDRDVTI 76

>Skud_8.225 Chr8 complement(391820..393685) [1866 bp, 621 aa] {ON}
           YHR161C (REAL)
          Length = 621

 Score = 38.1 bits (87), Expect = 0.049,   Method: Compositional matrix adjust.
 Identities = 21/65 (32%), Positives = 33/65 (50%), Gaps = 7/65 (10%)

Query: 51  DFFEIMDMLDKRLNDKGKYWRHIAKALTVIDYLIRFGSENCVLWCRENLYIIKTLKEFRH 110
           DF+EI+  LD R+ND    W  + K L V+  ++R G ++  L      Y  + L+ F  
Sbjct: 36  DFYEIVKALDSRVNDTA--WTIVYKTLLVVHLMMREGKKDVALR-----YYSRNLEFFSI 88

Query: 111 EDDEG 115
           E+  G
Sbjct: 89  ENIRG 93

>Smik_8.245 Chr8 complement(397342..399225) [1884 bp, 627 aa] {ON}
          YHR161C (REAL)
          Length = 627

 Score = 36.6 bits (83), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 21/72 (29%), Positives = 37/72 (51%), Gaps = 2/72 (2%)

Query: 22 LVRNATSNDNHQVSKDSLIELAEKSYDSADFFEIMDMLDKRLNDKGKYWRHIAKALTVID 81
          LV+ AT   +    +  L  +   +    DF+EI+  L+ R+ND    W  + K+L V+ 
Sbjct: 7  LVKGATKIKSAPPKQKYLDPILLGTSSEEDFYEIVKGLNFRINDTA--WTIVYKSLLVVH 64

Query: 82 YLIRFGSENCVL 93
           +IR G+++  L
Sbjct: 65 LMIREGAKDVAL 76

>NCAS0B03660 Chr2 complement(653627..654877) [1251 bp, 416 aa] {ON}
           Anc_8.335 YDR153C
          Length = 416

 Score = 35.0 bits (79), Expect = 0.34,   Method: Compositional matrix adjust.
 Identities = 32/113 (28%), Positives = 46/113 (40%), Gaps = 24/113 (21%)

Query: 6   VRSAKNLVKGYSSTQVLVRNATSNDNHQVSKDSLIELAEKSYDSADFFEIMDMLDKRLND 65
            R A+N++  Y   QV +R AT+ D    +   L ++    Y     + +++   KRL D
Sbjct: 20  ARFAQNVIVQYEPYQVDIRRATNTDAWGPTPKHLSKVLRNRY-QVPLYLMVEYTLKRLVD 78

Query: 66  K-------------------GKYWRHIAKALTVIDYLIRFGSE----NCVLWC 95
                               G  WR + K L VID+LI   SE    N VL C
Sbjct: 79  HIASRPKNFYEKARKEYVNYGAEWRVVLKCLVVIDFLILNVSEGDELNQVLSC 131

>CAGL0E01199g Chr5 (108041..109279) [1239 bp, 412 aa] {ON} similar
           to uniprot|Q03769 Saccharomyces cerevisiae YDR153c ENT5
          Length = 412

 Score = 33.9 bits (76), Expect = 0.77,   Method: Compositional matrix adjust.
 Identities = 27/98 (27%), Positives = 41/98 (41%), Gaps = 20/98 (20%)

Query: 6   VRSAKNLVKGYSSTQVLVRNATSNDNHQVSKDSLIELAEKSYDSADFFEIMDMLDKRLND 65
            R A+N++  Y   QV VR AT+ D+   +   L ++    Y     + I + + KRL D
Sbjct: 20  ARFAQNVIVQYEPYQVDVRRATNTDSWGPTPKHLAKVLRNRY-QVPLYLITEYILKRLID 78

Query: 66  K-------------------GKYWRHIAKALTVIDYLI 84
                               G  WR + K L VI+YL+
Sbjct: 79  HIAQRPKNLYEKARKDYVNYGSEWRVVLKCLVVIEYLL 116

>KLLA0D16654g Chr4 complement(1413507..1414706) [1200 bp, 399 aa]
           {ON} similar to uniprot|Q6Q5U2 Saccharomyces cerevisiae
           YDR153C ENT5 Protein containing an N-terminal epsin-like
           domain involved in clathrin recruitment and traffic
           between the Golgi and endosomes associates with the
           clathrin adaptor Gga2p clathrin adaptor complex AP-1 and
           clathrin
          Length = 399

 Score = 33.5 bits (75), Expect = 0.96,   Method: Compositional matrix adjust.
 Identities = 36/165 (21%), Positives = 69/165 (41%), Gaps = 29/165 (17%)

Query: 6   VRSAKNLVKGYSSTQVLVRNATSNDNHQVSKDSLIELAEKSYDSADFF-------EIMDM 58
            R A+N++  Y   Q+ +R AT+ D+   +   L ++    Y+ + F         ++D 
Sbjct: 20  ARFAQNVIVQYEPYQIDIRRATNTDSWGPTPKHLAKVMRHRYEVSMFLMTEYTLKRLVDH 79

Query: 59  LDKRLNDK-----------GKYWRHIAKALTVIDYLI----RFGSENCVLWCRENLYIIK 103
           + KR  +            G  WR + K L +++YL+    R    + VL C +    I 
Sbjct: 80  MAKRPKNMYEKARKQYVNYGNEWRVVLKCLVLLEYLLMRSDRGKETDQVLSCLQAHKHIL 139

Query: 104 TLKEFRHEDDEGIDQGQI------VRVKAKELTALLSDDERLNEE 142
           T +  ++  D   D G++      ++ K + +  L+ D   L  E
Sbjct: 140 TKETMQYRVDFSSD-GKMELHERGIKKKCEHIIQLIEDTSYLKRE 183

>KLLA0A05522g Chr1 (507778..509481) [1704 bp, 567 aa] {ON} similar
          to uniprot|P53309 Saccharomyces cerevisiae YGR241C
          YAP1802 Yeast Assembly Polypeptide, member of AP180
          protein family, binds Pan1p and clathrin; member of
          clathrin assembly polypeptide AP180 family
          Length = 567

 Score = 33.5 bits (75), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 16/43 (37%), Positives = 26/43 (60%), Gaps = 2/43 (4%)

Query: 51 DFFEIMDMLDKRLNDKGKYWRHIAKALTVIDYLIRFGSENCVL 93
          DF EI++ L++R+ND    W  + K+L V   +IR G ++  L
Sbjct: 36 DFGEIVNALEERINDSA--WTVVFKSLAVAHLMIRDGDKDIAL 76

>ZYRO0F13684g Chr6 complement(1125731..1126954) [1224 bp, 407 aa]
           {ON} highly similar to uniprot|Q6Q5U2 Saccharomyces
           cerevisiae YDR153C ENT5 Protein containing an N-terminal
           epsin-like domain involved in clathrin recruitment and
           traffic between the Golgi and endosomes associates with
           the clathrin adaptor Gga2p clathrin adaptor complex AP-1
           and clathrin
          Length = 407

 Score = 32.3 bits (72), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 27/98 (27%), Positives = 41/98 (41%), Gaps = 20/98 (20%)

Query: 6   VRSAKNLVKGYSSTQVLVRNATSNDNHQVSKDSLIELAEKSYDSADFFEIMDMLDKRLND 65
            R A+N++  Y   QV VR AT+ D+   +   L ++    Y     + I +   KRL D
Sbjct: 20  ARFAQNMIVQYEPYQVDVRRATNTDSWGPTPKHLEKVLRNRY-QVPMYLITEYTLKRLID 78

Query: 66  K-------------------GKYWRHIAKALTVIDYLI 84
                               G  WR + K LTV++YL+
Sbjct: 79  HIATRPKNFYEKARKEYVNYGSEWRVVLKCLTVVEYLL 116

>Kpol_344.8 s344 complement(20765..21919) [1155 bp, 384 aa] {ON}
           complement(20765..21919) [1155 nt, 385 aa]
          Length = 384

 Score = 32.3 bits (72), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 34/114 (29%), Positives = 48/114 (42%), Gaps = 22/114 (19%)

Query: 7   RSAKNLVKGYSSTQVLVRNATSNDNHQVSKDSLIELAEKSYDSADFF-------EIMDML 59
           R  +N++  Y   Q+ +R AT+ D    +   L ++    Y    +         I+D L
Sbjct: 21  RFMQNMIVQYEPYQIDIRRATNTDAWGPTTKHLQKVIRNKYSVPLYLMTEYVLKRIVDHL 80

Query: 60  DKR---LNDK--------GKYWRHIAKALTVIDYLIRFGSE----NCVLWCREN 98
            KR   L +K        G  WR I K L VI+YL+   SE    N V  C EN
Sbjct: 81  AKRPKNLYEKARKEYVNYGSEWRIILKCLIVIEYLLLNVSEPEELNQVKSCLEN 134

>NDAI0J00930 Chr10 (209579..210835) [1257 bp, 418 aa] {ON} Anc_8.335
           YDR153C
          Length = 418

 Score = 31.2 bits (69), Expect = 5.5,   Method: Compositional matrix adjust.
 Identities = 30/113 (26%), Positives = 47/113 (41%), Gaps = 24/113 (21%)

Query: 6   VRSAKNLVKGYSSTQVLVRNATSNDNHQVSKDSLIELAEKSYDSADFFEIMDMLDKRLND 65
            R A+N++  Y   QV +R AT+ D    +   L ++    Y     + +++   KRL D
Sbjct: 20  ARFAQNVIVQYEPYQVDIRRATNTDAWGPTPKHLQKVLRNRY-QVPLYLMVEYTLKRLVD 78

Query: 66  K-------------------GKYWRHIAKALTVIDYL---IRFGSE-NCVLWC 95
                               G  WR + K LTV++YL   +  G E N V+ C
Sbjct: 79  HIAVKPKNFYERARKEYVNYGAEWRVVLKCLTVVEYLMLNVDDGDELNQVVRC 131

>Skud_4.527 Chr4 complement(938779..941073) [2295 bp, 764 aa] {ON}
           YDR264C (REAL)
          Length = 764

 Score = 30.8 bits (68), Expect = 8.6,   Method: Compositional matrix adjust.
 Identities = 19/77 (24%), Positives = 35/77 (45%), Gaps = 11/77 (14%)

Query: 24  RNATSNDNHQVSKDSLIELAEKSYDSADFFEIMDMLDKRL-----------NDKGKYWRH 72
           RN  ++ N +V +D L+     +    D   + +M+  RL           +  G +W  
Sbjct: 58  RNEQADHNDEVEEDPLLTRYHTACQKGDLATVKEMIHGRLLEVNKDGDTVEHITGLHWAS 117

Query: 73  IAKALTVIDYLIRFGSE 89
           I   L+V+D+LI  G++
Sbjct: 118 INNRLSVVDFLISQGAD 134

>KAFR0F01210 Chr6 (232343..233278) [936 bp, 311 aa] {ON} Anc_6.256
           YPL230W
          Length = 311

 Score = 30.4 bits (67), Expect = 9.7,   Method: Compositional matrix adjust.
 Identities = 15/33 (45%), Positives = 18/33 (54%)

Query: 398 RQVSDDPNHNPFLNSQYTGLPSTSVVPTQTGYG 430
           R   + P HN + + QY  LP  SV PTQT Y 
Sbjct: 211 RNAQNYPTHNSYHDRQYFLLPINSVPPTQTQYS 243

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.313    0.130    0.370 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 37,022,779
Number of extensions: 1402473
Number of successful extensions: 3200
Number of sequences better than 10.0: 90
Number of HSP's gapped: 3177
Number of HSP's successfully gapped: 123
Length of query: 454
Length of database: 53,481,399
Length adjustment: 113
Effective length of query: 341
Effective length of database: 40,524,141
Effective search space: 13818732081
Effective search space used: 13818732081
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.9 bits)
S2: 67 (30.4 bits)