Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
YDL160C-A (MHF2)7.341ON80804013e-52
Smik_4.767.341ON80803241e-40
Suva_4.847.341ON81802721e-32
Skud_4.957.341ON79802669e-32
ZYRO0F11528g7.341ON121821587e-15
TDEL0C020607.341ON88721445e-13
KNAG0C038107.341ON82791427e-13
Kwal_YGOB_Anc_7.3417.341ON86801375e-12
TPHA0F029107.341ON108981361e-11
KAFR0B009007.341ON78811304e-11
NDAI0A019507.341ON122851327e-11
NCAS0A140807.341ON78801272e-10
Kpol_530.377.341ON88811262e-10
SAKL0F10956g7.341ON86821263e-10
KLTH0H01452g7.341ON86651237e-10
CAGL0I03432g7.341ON149601232e-09
Ecym_45207.341ON91661175e-09
ACL158W7.341ON95671151e-08
TBLA0E004707.341ON116831101e-07
KLLA0C16709g7.341ON79701044e-07
KAFR0C052305.501ON47572690.16
SAKL0E08250g2.263ON68741640.77
KLLA0C11627g4.98ON75842631.1
KLLA0B10890g3.482ON52147593.5
Suva_15.1786.14ON47662593.9
KNAG0D027005.54ON56350585.3
KAFR0C033408.71ON82930585.7
ZYRO0A00814g8.862ON31147578.4
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= YDL160C-A
         (80 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

YDL160C-A Chr4 complement(169366..169608) [243 bp, 80 aa] {ON}  ...   159   3e-52
Smik_4.76 Chr4 complement(146162..146401) [240 bp, 80 aa] {ON} Y...   129   1e-40
Suva_4.84 Chr4 complement(156977..157219) [243 bp, 81 aa] {ON} Y...   109   1e-32
Skud_4.95 Chr4 complement(164983..165219) [237 bp, 79 aa] {ON} Y...   107   9e-32
ZYRO0F11528g Chr6 (946636..947001) [366 bp, 121 aa] {ON} some si...    65   7e-15
TDEL0C02060 Chr3 complement(356665..356931) [267 bp, 88 aa] {ON}...    60   5e-13
KNAG0C03810 Chr3 complement(748315..748563) [249 bp, 82 aa] {ON}...    59   7e-13
Kwal_YGOB_Anc_7.341 s56 (1073424..1073684) [261 bp, 86 aa] {ON} ...    57   5e-12
TPHA0F02910 Chr6 (644434..644760) [327 bp, 108 aa] {ON} Anc_7.34...    57   1e-11
KAFR0B00900 Chr2 complement(167674..167910) [237 bp, 78 aa] {ON}...    55   4e-11
NDAI0A01950 Chr1 (434811..435179) [369 bp, 122 aa] {ON} Anc_7.34...    55   7e-11
NCAS0A14080 Chr1 (2768035..2768271) [237 bp, 78 aa] {ON}               54   2e-10
Kpol_530.37 s530 complement(86462..86728) [267 bp, 88 aa] {ON} c...    53   2e-10
SAKL0F10956g Chr6 complement(858747..859007) [261 bp, 86 aa] {ON...    53   3e-10
KLTH0H01452g Chr8 complement(134324..134584) [261 bp, 86 aa] {ON...    52   7e-10
CAGL0I03432g Chr9 complement(292162..292611) [450 bp, 149 aa] {O...    52   2e-09
Ecym_4520 Chr4 (1036442..1036717) [276 bp, 91 aa] {ON} similar t...    50   5e-09
ACL158W Chr3 (78852..79139) [288 bp, 95 aa] {ON} Syntenic homolo...    49   1e-08
TBLA0E00470 Chr5 (86619..86969) [351 bp, 116 aa] {ON} Anc_7.341 ...    47   1e-07
KLLA0C16709g Chr3 (1463056..1463295) [240 bp, 79 aa] {ON} conser...    45   4e-07
KAFR0C05230 Chr3 complement(1047104..1048531) [1428 bp, 475 aa] ...    31   0.16 
SAKL0E08250g Chr5 complement(665150..667213) [2064 bp, 687 aa] {...    29   0.77 
KLLA0C11627g Chr3 complement(1002978..1005254) [2277 bp, 758 aa]...    29   1.1  
KLLA0B10890g Chr2 (954119..955684) [1566 bp, 521 aa] {ON} simila...    27   3.5  
Suva_15.178 Chr15 (305907..307337) [1431 bp, 476 aa] {ON} YOR003...    27   3.9  
KNAG0D02700 Chr4 (486330..488021) [1692 bp, 563 aa] {ON} Anc_5.5...    27   5.3  
KAFR0C03340 Chr3 (680435..682924) [2490 bp, 829 aa] {ON} Anc_8.7...    27   5.7  
ZYRO0A00814g Chr1 complement(57722..58657) [936 bp, 311 aa] {ON}...    27   8.4  

>YDL160C-A Chr4 complement(169366..169608) [243 bp, 80 aa] {ON}
          MHF2Protein of unknown function; ortholog of human
          MHF2, and component of the heterotetrameric MHF
          histone-fold complex that in humans interacts with both
          DNA and Mph1p ortholog FANCM to stabilize and remodel
          blocked replication forks and repair damaged DNA; mhf2
          srs2 double mutants are MMS hypersensitive
          Length = 80

 Score =  159 bits (401), Expect = 3e-52,   Method: Compositional matrix adjust.
 Identities = 80/80 (100%), Positives = 80/80 (100%)

Query: 1  MLSKEALIKILSQNEGGNDMKIADEVVPMIQKYLDIFIDEAVLRSLQSHKDINGERGDKS 60
          MLSKEALIKILSQNEGGNDMKIADEVVPMIQKYLDIFIDEAVLRSLQSHKDINGERGDKS
Sbjct: 1  MLSKEALIKILSQNEGGNDMKIADEVVPMIQKYLDIFIDEAVLRSLQSHKDINGERGDKS 60

Query: 61 PLELSHQDLERIVGLLLMDM 80
          PLELSHQDLERIVGLLLMDM
Sbjct: 61 PLELSHQDLERIVGLLLMDM 80

>Smik_4.76 Chr4 complement(146162..146401) [240 bp, 80 aa] {ON}
          YDL160C-A (REAL)
          Length = 80

 Score =  129 bits (324), Expect = 1e-40,   Method: Compositional matrix adjust.
 Identities = 63/80 (78%), Positives = 71/80 (88%)

Query: 1  MLSKEALIKILSQNEGGNDMKIADEVVPMIQKYLDIFIDEAVLRSLQSHKDINGERGDKS 60
          MLSKEAL+KILSQN  G D++I+DEV+PMIQKYLDIFI+EA LRSLQSHKDIN E   K 
Sbjct: 1  MLSKEALVKILSQNNCGKDIEISDEVIPMIQKYLDIFIEEAALRSLQSHKDINKEHDKKD 60

Query: 61 PLELSHQDLERIVGLLLMDM 80
          PLELSHQDLER+VG+LLMDM
Sbjct: 61 PLELSHQDLERVVGVLLMDM 80

>Suva_4.84 Chr4 complement(156977..157219) [243 bp, 81 aa] {ON}
          YDL160C-A (REAL)
          Length = 81

 Score =  109 bits (272), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 56/80 (70%), Positives = 65/80 (81%)

Query: 1  MLSKEALIKILSQNEGGNDMKIADEVVPMIQKYLDIFIDEAVLRSLQSHKDINGERGDKS 60
          +L KEA+IKILSQN    ++KI D+V+PMIQKYL+IFI+EA LRSLQSHKD +G      
Sbjct: 2  ILPKEAIIKILSQNNSDKNIKIDDKVIPMIQKYLEIFIEEAALRSLQSHKDSSGAHDGDG 61

Query: 61 PLELSHQDLERIVGLLLMDM 80
          PLELSH DLERIVGLLLMDM
Sbjct: 62 PLELSHLDLERIVGLLLMDM 81

>Skud_4.95 Chr4 complement(164983..165219) [237 bp, 79 aa] {ON}
          YDL160C-A (REAL)
          Length = 79

 Score =  107 bits (266), Expect = 9e-32,   Method: Compositional matrix adjust.
 Identities = 59/80 (73%), Positives = 65/80 (81%), Gaps = 1/80 (1%)

Query: 1  MLSKEALIKILSQNEGGNDMKIADEVVPMIQKYLDIFIDEAVLRSLQSHKDINGERGDKS 60
          MLSK+ALIKILSQN    D+KI D+V+PMIQ YLDIFI+EA LRSLQS KD +G   D  
Sbjct: 1  MLSKDALIKILSQNNFRKDIKIDDKVLPMIQNYLDIFIEEAALRSLQSQKDASGGHRD-G 59

Query: 61 PLELSHQDLERIVGLLLMDM 80
          PLELSH DLERIVGLLLMDM
Sbjct: 60 PLELSHLDLERIVGLLLMDM 79

>ZYRO0F11528g Chr6 (946636..947001) [366 bp, 121 aa] {ON} some
           similarities with uniprot|Q3E829 Saccharomyces
           cerevisiae YDL160C-A Identified by homology to Ashbya
           gossypii
          Length = 121

 Score = 65.5 bits (158), Expect = 7e-15,   Method: Compositional matrix adjust.
 Identities = 36/82 (43%), Positives = 55/82 (67%), Gaps = 3/82 (3%)

Query: 1   MLSKEALIKILS-QNEGGNDMKIADEVVPMIQKYLDIFIDEAVLRSLQSHKDINGERGD- 58
           M+ KE +++IL  Q        I +E V M+QKYL++F+ EAV RS+ ++KD  G  GD 
Sbjct: 41  MVPKETIVRILKLQAFEHESTTITEETVTMLQKYLEVFVREAVQRSV-ANKDSQGSHGDG 99

Query: 59  KSPLELSHQDLERIVGLLLMDM 80
              ++L+H+DLE+I G+LL+DM
Sbjct: 100 DGEIQLNHEDLEKITGMLLLDM 121

>TDEL0C02060 Chr3 complement(356665..356931) [267 bp, 88 aa] {ON}
          Anc_7.341 YDL160C-A
          Length = 88

 Score = 60.1 bits (144), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 32/72 (44%), Positives = 48/72 (66%), Gaps = 7/72 (9%)

Query: 13 QNEGGNDMKIADEVVPMIQKYLDIFIDEAVLRSLQSHKDI----NGERGDKSPLELSHQD 68
          +NE  N   I DE V M+QKY+++F+ EAVLRS  + + I    +G + + + + L+H+D
Sbjct: 20 ENESTN---ITDETVGMMQKYMEVFVREAVLRSSANKEQIKVEHSGAQRNSNEIVLTHED 76

Query: 69 LERIVGLLLMDM 80
          LE I GLLL+DM
Sbjct: 77 LENITGLLLLDM 88

>KNAG0C03810 Chr3 complement(748315..748563) [249 bp, 82 aa] {ON}
          Anc_7.341 YDL160C-A
          Length = 82

 Score = 59.3 bits (142), Expect = 7e-13,   Method: Compositional matrix adjust.
 Identities = 31/79 (39%), Positives = 53/79 (67%), Gaps = 6/79 (7%)

Query: 2  LSKEALIKILSQNEGGNDMKIADEVVPMIQKYLDIFIDEAVLRSLQSHKDINGERGDKSP 61
          +S+E L +IL+Q+       I D+ +  +QKY++ ++ E +LRSL+ +KD+       +P
Sbjct: 9  ISRETLSRILTQSFKNKSTTIDDQALTSVQKYVETYVQEIILRSLE-NKDLG-----VNP 62

Query: 62 LELSHQDLERIVGLLLMDM 80
           EL+ +D+ERI+GLLL+DM
Sbjct: 63 AELTERDIERILGLLLLDM 81

>Kwal_YGOB_Anc_7.341 s56 (1073424..1073684) [261 bp, 86 aa] {ON}
          ANNOTATED BY YGOB -
          Length = 86

 Score = 57.4 bits (137), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 29/80 (36%), Positives = 51/80 (63%), Gaps = 3/80 (3%)

Query: 4  KEALIKILSQNEGGND-MKIADEVVPMIQKYLDIFIDEAVLRSLQSHKDINGERGDK--S 60
          K+ + +I       ND  +I +  + ++ +YL+IF+ EA+LRS+++   +  E  D+  S
Sbjct: 7  KDTIARIFQTCSFQNDSTRITETTLTLVDEYLEIFVREAILRSIENKDQVKDEHQDQLGS 66

Query: 61 PLELSHQDLERIVGLLLMDM 80
           + L+H+DLER+ GLLL+DM
Sbjct: 67 QVVLTHKDLERVSGLLLLDM 86

>TPHA0F02910 Chr6 (644434..644760) [327 bp, 108 aa] {ON} Anc_7.341
           YDL160C-A
          Length = 108

 Score = 57.0 bits (136), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 35/98 (35%), Positives = 56/98 (57%), Gaps = 19/98 (19%)

Query: 2   LSKEALIKILSQNEGGNDMKIADEVVPMIQKYLDIFIDEAVLRSLQS--HKDINGERGDK 59
           + K+ + +IL     G + +I+ E V ++QKY+++F+ EAVLRS+++   K  N E   K
Sbjct: 10  IPKDTIARILQLESFGEETRISAESVGILQKYMELFVREAVLRSIENREQKQSNIEALKK 69

Query: 60  SP-----------------LELSHQDLERIVGLLLMDM 80
           +P                 +EL+H+DLE I GLLL+DM
Sbjct: 70  APAKANPDQLQTFQHSFNGIELTHEDLEEISGLLLLDM 107

>KAFR0B00900 Chr2 complement(167674..167910) [237 bp, 78 aa] {ON}
          Anc_7.341 YDL160C-A
          Length = 78

 Score = 54.7 bits (130), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 33/81 (40%), Positives = 49/81 (60%), Gaps = 7/81 (8%)

Query: 2  LSKEALIKILSQ--NEGGNDMKIADEVVPMIQKYLDIFIDEAVLRSLQSHKDINGERGDK 59
          + KE + +IL    NE G +  I  E V  + KY D+ I+E VLRSL++ ++I     + 
Sbjct: 3  IPKETISRILLNKLNENGENFSINTETVESVTKYTDVLIEEMVLRSLENKENI----AEA 58

Query: 60 SPLELSHQDLERIVGLLLMDM 80
          +P  L   DLE+I+GLLL+DM
Sbjct: 59 TP-TLDVDDLEKIIGLLLLDM 78

>NDAI0A01950 Chr1 (434811..435179) [369 bp, 122 aa] {ON} Anc_7.341
           YDL160C-A
          Length = 122

 Score = 55.5 bits (132), Expect = 7e-11,   Method: Compositional matrix adjust.
 Identities = 34/85 (40%), Positives = 49/85 (57%), Gaps = 9/85 (10%)

Query: 5   EALIKIL-SQNEGGNDMKIADEVVPMIQKYLDIFIDEAVLRSLQSHKDIN--------GE 55
           E + KIL S++    D  I  E + MIQ+Y+D+FI EAV+RS ++               
Sbjct: 38  ETIEKILRSESFQNKDTTITKETILMIQRYMDLFIKEAVIRSYENKVATQVEDFDDEEDA 97

Query: 56  RGDKSPLELSHQDLERIVGLLLMDM 80
             +   +EL+H DLERIVGLLLM++
Sbjct: 98  DEEDKTIELTHLDLERIVGLLLMEL 122

>NCAS0A14080 Chr1 (2768035..2768271) [237 bp, 78 aa] {ON}
          Length = 78

 Score = 53.5 bits (127), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 31/80 (38%), Positives = 51/80 (63%), Gaps = 5/80 (6%)

Query: 2  LSKEALIKILSQNEGGN-DMKIADEVVPMIQKYLDIFIDEAVLRSLQSHKDINGERGDKS 60
          + KE + +IL      N D K+ +E + MIQ+Y+++FI EA+ RSL + +   G    ++
Sbjct: 3  IPKETIAQILQLEAFENADTKMTEETLSMIQRYMELFIREAMCRSLDNKEKELG----QT 58

Query: 61 PLELSHQDLERIVGLLLMDM 80
           + +  +DLER+VGLLL+DM
Sbjct: 59 DIVIDEKDLERVVGLLLLDM 78

>Kpol_530.37 s530 complement(86462..86728) [267 bp, 88 aa] {ON}
          complement(86462..86728) [267 nt, 89 aa]
          Length = 88

 Score = 53.1 bits (126), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 28/81 (34%), Positives = 51/81 (62%), Gaps = 2/81 (2%)

Query: 2  LSKEALIKILSQNE-GGNDMKIADEVVPMIQKYLDIFIDEAVLRSLQSHKDINGERGDKS 60
          + KE + ++L  +    +  +I ++VV  +QKY+++F+ EA++RS+++   +  E     
Sbjct: 7  IPKETIARLLETSSFEHSSTRITEDVVEGLQKYMELFVREAIMRSIETKAKLEEENSFTG 66

Query: 61 -PLELSHQDLERIVGLLLMDM 80
            +EL+H DLE I GLLL+DM
Sbjct: 67 VRVELTHTDLEEIAGLLLLDM 87

>SAKL0F10956g Chr6 complement(858747..859007) [261 bp, 86 aa] {ON}
          similar to uniprot|Q3E829 Saccharomyces cerevisiae
          YDL160C-A Putative protein of unknown function
          Length = 86

 Score = 53.1 bits (126), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 31/82 (37%), Positives = 49/82 (59%), Gaps = 4/82 (4%)

Query: 2  LSKEALIKILSQNEGGND-MKIADEVVPMIQKYLDIFIDEAVLRSLQSHKDINGERG--D 58
          L K+ + +I        D  +I ++ V +  KY+++F+ EAVLRSL++ + +  E    D
Sbjct: 6  LPKDTIARIFQTCSFTQDSTRITEDTVALTNKYIELFVREAVLRSLENKEKVKPETESLD 65

Query: 59 KSPLELSHQDLERIVGLLLMDM 80
             + LSH+DLE I GLLL+DM
Sbjct: 66 NGTV-LSHEDLEEISGLLLLDM 86

>KLTH0H01452g Chr8 complement(134324..134584) [261 bp, 86 aa] {ON}
          weakly similar to uniprot|Q3E829 Saccharomyces
          cerevisiae YDL160c-a
          Length = 86

 Score = 52.0 bits (123), Expect = 7e-10,   Method: Compositional matrix adjust.
 Identities = 23/65 (35%), Positives = 44/65 (67%), Gaps = 2/65 (3%)

Query: 18 NDMKIADEVVPMIQKYLDIFIDEAVLRSLQSHKDINGERGDK--SPLELSHQDLERIVGL 75
          +  +I +  + ++  YL++F+ EA+LRS+++ + +  E  D+    + L+H+DLER+ GL
Sbjct: 22 DSTRITESTLSLVDAYLEVFVREALLRSIENKEQVKSEHQDQLGDQVVLTHKDLERVSGL 81

Query: 76 LLMDM 80
          LL+DM
Sbjct: 82 LLLDM 86

>CAGL0I03432g Chr9 complement(292162..292611) [450 bp, 149 aa] {ON}
           some similarities with KLLA0C16709g Kluyveromyces lactis
           and DEHA0G05016g Debaryomyces hansenii and CA5994|IPF677
           Candida albicans
          Length = 149

 Score = 52.0 bits (123), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 26/60 (43%), Positives = 38/60 (63%)

Query: 21  KIADEVVPMIQKYLDIFIDEAVLRSLQSHKDINGERGDKSPLELSHQDLERIVGLLLMDM 80
           +I  +VV  +Q+Y+D+F  EAVLRS++ H         +   E++H DLE I GLLL+DM
Sbjct: 90  RIESDVVDALQRYIDVFAREAVLRSIEHHDASQEGLEQEQDKEITHTDLENIAGLLLLDM 149

>Ecym_4520 Chr4 (1036442..1036717) [276 bp, 91 aa] {ON} similar to
          Ashbya gossypii ACL158W
          Length = 91

 Score = 49.7 bits (117), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 25/66 (37%), Positives = 41/66 (62%), Gaps = 3/66 (4%)

Query: 18 NDMKIADEVVPMIQKYLDIFIDEAVLRSLQSHKDINGERGDKSPLE---LSHQDLERIVG 74
          +  +I ++ + + +KY+ +F+ EAVLRSL++   +  E G  S +E   L H DLE I G
Sbjct: 26 DSTRITEDTITLTEKYIKLFVREAVLRSLENKDKVKKEDGKGSLIEGPVLHHTDLEEISG 85

Query: 75 LLLMDM 80
          +LL+D 
Sbjct: 86 ILLLDF 91

>ACL158W Chr3 (78852..79139) [288 bp, 95 aa] {ON} Syntenic homolog
          of Saccharomyces cerevisiae YDL161CX; YDL161CX was
          overlooked in Saccharomyces cerevisiae
          Length = 95

 Score = 48.9 bits (115), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 26/67 (38%), Positives = 44/67 (65%), Gaps = 5/67 (7%)

Query: 18 NDMKIADEVVPMIQKYLDIFIDEAVLRSLQSHKDINGE-RGD---KSPLELSHQDLERIV 73
          +  KI ++ V ++++Y+ +FI EAVLRSL++ + +  E R D   + P+ L H DLE I 
Sbjct: 30 DSTKITEDAVTLVERYMKLFIREAVLRSLENKEKVKQETRADSFAEGPV-LQHTDLEEIS 88

Query: 74 GLLLMDM 80
          G+L++D 
Sbjct: 89 GVLILDF 95

>TBLA0E00470 Chr5 (86619..86969) [351 bp, 116 aa] {ON} Anc_7.341
           YDL160C-A
          Length = 116

 Score = 47.0 bits (110), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 29/83 (34%), Positives = 44/83 (53%), Gaps = 21/83 (25%)

Query: 19  DMKIADEVVPMIQKYLDIFIDEAVLRSLQSHKD-INGERG--DKSP-------------- 61
           + +I    V  +QKY+++FI EA LRSL++ ++ I+ E+      P              
Sbjct: 34  NTRITKNTVTKLQKYMELFIREAALRSLENKEEQISNEKSAVKNEPGLEDTKIFNDNNKL 93

Query: 62  ----LELSHQDLERIVGLLLMDM 80
               +ELSH+ LE I GLLL+DM
Sbjct: 94  NDNDIELSHEALEAITGLLLLDM 116

>KLLA0C16709g Chr3 (1463056..1463295) [240 bp, 79 aa] {ON}
          conserved hypothetical protein
          Length = 79

 Score = 44.7 bits (104), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 26/70 (37%), Positives = 42/70 (60%), Gaps = 8/70 (11%)

Query: 13 QNEGGND--MKIADEVVPMIQKYLDIFIDEAVLRSLQSHKDINGERGDKSPLELSHQDLE 70
          Q EG  D   +I +E + +++ Y+++F+ E VLRSL++  D+     DK+   +   DLE
Sbjct: 15 QTEGFQDSNTRITEECMQLLEPYIELFVREGVLRSLENKADM---LADKT---VDFVDLE 68

Query: 71 RIVGLLLMDM 80
           + GLLLMD 
Sbjct: 69 AVAGLLLMDF 78

>KAFR0C05230 Chr3 complement(1047104..1048531) [1428 bp, 475 aa]
           {ON} Anc_5.501 YOR155C
          Length = 475

 Score = 31.2 bits (69), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 19/72 (26%), Positives = 43/72 (59%), Gaps = 5/72 (6%)

Query: 7   LIKILSQNEGGNDMKIADEVVPMIQKYLDIFIDEAVLRSLQSHKDINGERGDKS-----P 61
           ++K+ S+N+  + +  A++ +  ++K L++  +  ++R  ++   + G+R DKS     P
Sbjct: 305 IMKVWSENDIQDTLDFAEKTLHTLKKRLNLPSEVPIIRKKRAVGIVPGKRFDKSLQKNIP 364

Query: 62  LELSHQDLERIV 73
           ++LS + LE IV
Sbjct: 365 VKLSREQLEEIV 376

>SAKL0E08250g Chr5 complement(665150..667213) [2064 bp, 687 aa] {ON}
           similar to uniprot|P40483 Saccharomyces cerevisiae
           YIL108W Hypothetical ORF
          Length = 687

 Score = 29.3 bits (64), Expect = 0.77,   Method: Composition-based stats.
 Identities = 13/41 (31%), Positives = 24/41 (58%)

Query: 13  QNEGGNDMKIADEVVPMIQKYLDIFIDEAVLRSLQSHKDIN 53
           Q EGGND+ +A + + +  + +  F +E +LR+   H+  N
Sbjct: 112 QREGGNDLALAIKKLRVGARLMQAFTNEQMLRNGFGHRTFN 152

>KLLA0C11627g Chr3 complement(1002978..1005254) [2277 bp, 758 aa]
           {ON} similar to uniprot|P39007 Saccharomyces cerevisiae
           YGL022W STT3 Subunit of the oligosaccharyltransferase
           complex of the ER lumen
          Length = 758

 Score = 28.9 bits (63), Expect = 1.1,   Method: Composition-based stats.
 Identities = 17/42 (40%), Positives = 24/42 (57%), Gaps = 2/42 (4%)

Query: 30  IQKYLDIFIDEAVLRSLQSHKDINGERGDKSPLELSHQDLER 71
           I K  DI++D +V  S +S KD+   + DK   E S  DLE+
Sbjct: 420 ISKLFDIYLDFSVALSTKSPKDVKSVKLDKEKKETS--DLEQ 459

>KLLA0B10890g Chr2 (954119..955684) [1566 bp, 521 aa] {ON} similar
          to uniprot|Q06512 Saccharomyces cerevisiae YPR144C NOC4
          Nucleolar protein forms a complex with Nop14p that
          mediates maturation and nuclear export of 40S ribosomal
          subunits
          Length = 521

 Score = 27.3 bits (59), Expect = 3.5,   Method: Composition-based stats.
 Identities = 14/47 (29%), Positives = 26/47 (55%)

Query: 1  MLSKEALIKILSQNEGGNDMKIADEVVPMIQKYLDIFIDEAVLRSLQ 47
          MLSKE + ++      GND K  + +V +I  Y ++  +  +L +L+
Sbjct: 1  MLSKEEIKQVWKSISTGNDRKHYNSLVNLIHGYNELLKENELLHNLE 47

>Suva_15.178 Chr15 (305907..307337) [1431 bp, 476 aa] {ON} YOR003W
           (REAL)
          Length = 476

 Score = 27.3 bits (59), Expect = 3.9,   Method: Composition-based stats.
 Identities = 17/62 (27%), Positives = 34/62 (54%), Gaps = 4/62 (6%)

Query: 11  LSQNEGGN----DMKIADEVVPMIQKYLDIFIDEAVLRSLQSHKDINGERGDKSPLELSH 66
           L Q E GN    + K+  +   +  +Y+  F +++ +RS++SHK +  E  ++S  +L+ 
Sbjct: 45  LGQQETGNFHLQEPKVVYKAESLPYRYIIAFHEDSSVRSIESHKRMIQEVQNESVSKLAK 104

Query: 67  QD 68
            D
Sbjct: 105 DD 106

>KNAG0D02700 Chr4 (486330..488021) [1692 bp, 563 aa] {ON} Anc_5.54
           YHR184W
          Length = 563

 Score = 26.9 bits (58), Expect = 5.3,   Method: Compositional matrix adjust.
 Identities = 17/50 (34%), Positives = 30/50 (60%), Gaps = 2/50 (4%)

Query: 33  YLDIFID--EAVLRSLQSHKDINGERGDKSPLELSHQDLERIVGLLLMDM 80
           + +IFI+  + V  S ++ +D++ +  +KS +ELSH D  R V +L   M
Sbjct: 315 FREIFIEFTQQVYNSTKNLEDVSKKYVEKSIMELSHIDERRTVEVLTKSM 364

>KAFR0C03340 Chr3 (680435..682924) [2490 bp, 829 aa] {ON} Anc_8.71
           YFL004W
          Length = 829

 Score = 26.9 bits (58), Expect = 5.7,   Method: Composition-based stats.
 Identities = 13/30 (43%), Positives = 19/30 (63%)

Query: 9   KILSQNEGGNDMKIADEVVPMIQKYLDIFI 38
           +ILS+NEGG      +  + M QKY++ FI
Sbjct: 321 RILSENEGGIGYNFEEVRLKMKQKYINNFI 350

>ZYRO0A00814g Chr1 complement(57722..58657) [936 bp, 311 aa] {ON}
           similar to uniprot|Q12746 Saccharomyces cerevisiae
           YML125C Protein required for cell viability
          Length = 311

 Score = 26.6 bits (57), Expect = 8.4,   Method: Composition-based stats.
 Identities = 14/47 (29%), Positives = 24/47 (51%)

Query: 8   IKILSQNEGGNDMKIADEVVPMIQKYLDIFIDEAVLRSLQSHKDING 54
           I +L  NE  ND+ + DE+  ++ KY    ++  V R   + K + G
Sbjct: 208 ISLLYANETENDILLKDELDELVDKYPHFEVNYVVNRPSSNWKGLRG 254

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.317    0.138    0.367 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 8,142,449
Number of extensions: 293254
Number of successful extensions: 997
Number of sequences better than 10.0: 30
Number of HSP's gapped: 982
Number of HSP's successfully gapped: 30
Length of query: 80
Length of database: 53,481,399
Length adjustment: 52
Effective length of query: 28
Effective length of database: 47,518,767
Effective search space: 1330525476
Effective search space used: 1330525476
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 59 (27.3 bits)