Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
YDL122W (UBP1)2.307ON80980936380.0
Smik_4.1152.307ON79075832400.0
Skud_4.1332.307ON78775931750.0
Suva_4.1252.307ON79376031270.0
Kpol_1003.532.307ON78873820410.0
TDEL0G023702.307ON74772420110.0
TPHA0G008502.307ON78273020060.0
NCAS0B061302.307ON77071119900.0
CAGL0H10582g2.307ON79074419710.0
SAKL0E07106g2.307ON79177819200.0
KLTH0G10934g2.307ON75876719150.0
ZYRO0A02420g2.307ON74573618960.0
Kwal_27.114442.307ON75773618360.0
AGR389C2.307ON77573418360.0
KNAG0A054502.307ON76476317250.0
NDAI0B034302.307ON85661117230.0
KAFR0A069102.307ON67856916860.0
TBLA0B060802.307ON82454715450.0
KLLA0E08801g2.307ON77156114510.0
TBLA0B071602.307ON3843287897e-97
NCAS0G036802.307ON4824083211e-30
NDAI0G007802.307ON4863562775e-25
SAKL0H10076g8.540ON7672601362e-07
TBLA0H036008.540ON4821861324e-07
KLLA0E23387g8.540ON7821841245e-06
Kwal_27.120308.540ON7492251147e-05
KLTH0E12540g8.540ON7521821139e-05
YNL186W (UBP10)2.69ON792601112e-04
ZYRO0A05962g8.742ON465851092e-04
Suva_16.2408.540ON5231841092e-04
Kwal_33.144302.69ON511651083e-04
KAFR0E009308.540ON4981831083e-04
TBLA0B097602.69ON898601084e-04
Skud_15.2865.443ON1278491084e-04
SAKL0E13002g2.69ON739601074e-04
Smik_13.4318.742ON471581065e-04
KLTH0B07150g2.69ON756601066e-04
KNAG0F012202.69ON784801066e-04
YMR223W (UBP8)8.742ON471581048e-04
Suva_14.1562.69ON788601058e-04
TDEL0B036708.742ON463841049e-04
Skud_13.3928.742ON473581040.001
Kpol_1044.242.69ON724601040.001
Suva_13.4078.742ON471581030.001
Smik_15.3015.443ON1272491040.001
ZYRO0G01606g5.443ON1305841040.001
NDAI0F034102.69ON870601040.001
NCAS0G018002.69ON875711040.001
KAFR0L017307.390ON701691030.001
NCAS0C021108.540ON4941891030.001
ZYRO0D03982g8.540ON8212461030.001
Skud_14.1482.69ON776601020.002
Kwal_14.20088.188ON424461010.002
KLLA0D08459g2.69ON750651020.002
NDAI0E008108.742ON493581010.002
YOR124C (UBP2)5.443ON1272491010.002
TDEL0B030608.540ON7341801010.002
Suva_8.1765.443ON1270491000.003
Kpol_1062.235.443ON1266511000.004
NDAI0C059008.188ON82662990.004
TDEL0D025805.443ON127251990.004
KAFR0A042108.742ON44060980.004
SAKL0G02728g5.443ON123770980.005
NDAI0E041807.390ON82770980.005
AEL242W8.540ON613174970.005
KNAG0G029308.742ON45961970.006
ZYRO0C09812g2.69ON70260970.006
Ecym_45145.443ON124652980.006
CAGL0J11352g2.69ON77160970.007
TBLA0A064705.443ON132051970.008
NCAS0H021005.443ON126949960.008
TPHA0O016402.69ON74659960.009
Kwal_26.91518.742ON45462950.009
TDEL0A011002.69ON66160950.011
Smik_14.1442.69ON76360950.011
Ecym_11668.540ON696188950.011
Smik_5.3098.188ON80537950.011
KNAG0A019708.540ON471162940.012
KNAG0B041905.443ON126248940.017
CAGL0M11198g8.742ON46158930.018
CAGL0A04477g7.390ON77082930.021
Suva_5.2728.188ON78837920.025
Skud_5.2818.188ON82337920.026
NDAI0C015505.443ON129549920.031
KAFR0A075802.69ON80260910.032
NCAS0B005808.742ON46661910.032
CAGL0H05335g8.540ON483187900.033
TBLA0D010708.742ON483100900.035
SAKL0H04994g8.742ON45464900.036
Kwal_55.213935.443ON123351910.038
ACL164C5.443ON138965900.042
Kpol_513.255.18ON119050900.043
Ecym_62488.742ON46662890.044
TPHA0G005608.742ON46394890.044
Smik_16.1638.540ON501186890.045
Kpol_1032.288.188ON88234900.045
NCAS0B042808.188ON92252900.050
TDEL0B020805.712ON1025291890.053
Kpol_1064.488.742ON46657890.056
TPHA0L016708.540ON524190890.057
CAGL0G05247g8.188ON94787890.059
Smik_2.497.390ON74565890.065
KLLA0C06974g8.742ON44658880.068
TBLA0D006207.390ON117165890.069
Kpol_1018.937.390ON75565880.069
NDAI0E028208.540ON495191880.075
KLTH0H07678g8.188ON86135880.080
ABL145W2.69ON74960880.085
KLTH0F15862g5.443ON124148880.087
KNAG0B023707.390ON75382870.087
Smik_11.3625.712ON721296870.096
Kpol_2001.785.712ON403277860.10
YER144C (UBP5)8.188ON80537870.10
YBL067C (UBP13)7.390ON74765870.10
Skud_10.221.137ON125536870.11
AFR007W8.188ON84834870.11
Suva_2.507.390ON75065860.11
CAGL0I05522g7.390ON72480860.12
SAKL0H18986g8.188ON89339860.12
KNAG0D019308.188ON98635860.13
TPHA0P006807.390ON72766860.14
NDAI0I025305.18ON119750860.15
NCAS0A143707.390ON72977850.15
KLLA0E02377g5.443ON122051860.15
Ecym_61848.188ON85134860.15
KAFR0C025908.188ON97834860.15
AFR296C5.712ON1169232860.16
KAFR0I026005.18ON121350850.17
AFR551W8.742ON46962840.18
NDAI0C059508.202ON108082850.18
Skud_2.387.390ON74868840.20
KNAG0C035807.390ON77670840.21
Skud_16.2098.540ON503186830.23
KLLA0C03476g1.137ON125246840.23
TPHA0E017105.443ON128351840.24
TDEL0C056401.137ON117830840.25
NCAS0A039108.188ON79561840.25
KLTH0D12760g8.742ON45374830.25
KNAG0G016708.202ON89783830.27
CAGL0I06600g8.202ON81649830.27
ZYRO0C17908g1.137ON120430830.29
SAKL0E15136g5.712ON1037185830.31
CAGL0G02563gsingletonON631200820.33
Kpol_1055.318.202ON82242820.35
Kpol_1045.417.390ON71265820.38
NCAS0D023905.18ON121147820.39
Skud_11.3385.712ON712311820.40
Suva_13.4955.18ON123052820.41
Smik_13.5215.18ON123150820.41
AGL357W5.18ON116661820.43
YMR304W (UBP15)5.18ON123050820.43
KAFR0C004103.270ON76923820.44
CAGL0H06721g5.712ON108138810.47
Skud_13.4785.18ON123150810.48
NDAI0A036808.188ON111639810.49
YJL197W (UBP12)1.137ON125436810.51
Kpol_1024.448.540ON49623810.51
Skud_4.3238.188ON92661810.52
Suva_2.2288.188ON92738810.54
TBLA0C012001.369ON50354800.55
KLLA0E10275g8.188ON79659810.57
Smik_10.371.137ON124736810.57
AGR139C8.202ON78939810.58
YDR069C (DOA4)8.188ON92638810.59
Ecym_46857.390ON77865800.60
Suva_6.2761.137ON125636810.62
KNAG0G015908.188ON67138800.62
Smik_4.3078.188ON92938800.62
KLTH0H13354g1.369ON49531800.64
Kwal_55.196455.712ON97030800.66
TPHA0C027708.188ON97034800.67
NCAS0A038408.202ON91783800.69
Klac_YGOB_Anc_5.18b5.18ON116651800.70
Kpol_2001.541.137ON122351800.74
AGR370W7.390ON74065800.74
KAFR0H001505.712ON656303790.75
NCAS0G001705.712ON103030800.77
TBLA0C070205.18ON124750800.78
SAKL0D03322g3.270ON76575790.78
NCAS0I031401.137ON120130790.87
YPL072W (UBP16)8.540ON49939790.88
ZYRO0D07062g5.18ON119350790.90
ZYRO0G06798g8.188ON87734790.92
TPHA0L022905.18ON119347790.94
YKR098C (UBP11)5.712ON717294781.0
Kwal_33.136281.137ON116030791.1
SAKL0H18656g8.202ON77235781.1
NDAI0F002005.712ON110524781.1
TBLA0F036108.188ON114434781.2
Skud_2.1773.270ON78227781.3
TPHA0A025401.137ON128655781.4
Ecym_55448.202ON83435771.5
Kpol_534.231.369ON49618761.6
TBLA0J006001.137ON146228771.9
KLTH0B09944g5.18ON118950762.1
KNAG0J008003.270ON76581762.2
KAFR0D050705.443ON122743762.2
KAFR0D021605.712ON84638762.3
KNAG0C021801.137ON123170762.4
YBR058C (UBP14)3.270ON78131752.5
CAGL0I02244g5.74ON169108722.5
CAGL0K10494g1.369ON49540752.6
TDEL0A016208.202ON79548752.6
TBLA0E017605.712ON1212169752.8
CAGL0L01639g1.137ON114730752.9
KNAG0C019401.369ON49942742.9
Ecym_56715.18ON117663752.9
TPHA0D046605.712ON1045169753.0
TPHA0A025101.369ON50530743.0
CAGL0M13783g5.18ON119648743.4
KAFR0F015601.137ON117128743.6
Suva_11.3355.712ON724299743.6
Kwal_14.19578.202ON44435733.7
NDAI0H035501.369ON50240733.7
Suva_4.2953.270ON78221743.8
Smik_2.1893.270ON78219743.8
Kwal_34.162681.369ON44919734.0
Kpol_251.73.270ON48019734.1
KLTH0E00814g5.712ON974282734.2
ZYRO0G01188g1.369ON50040734.2
TPHA0J026205.443ON122531734.5
Kpol_1016.15.443ON125186735.4
SAKL0D10120g1.369ON49230716.2
KLLA0E01013g8.202ON77485717.6
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= YDL122W
         (809 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

YDL122W Chr4 (242552..244981) [2430 bp, 809 aa] {ON}  UBP1Ubiqui...  1405   0.0  
Smik_4.115 Chr4 (219167..221539) [2373 bp, 790 aa] {ON} YDL122W ...  1252   0.0  
Skud_4.133 Chr4 (238225..240588) [2364 bp, 787 aa] {ON} YDL122W ...  1227   0.0  
Suva_4.125 Chr4 (231011..233392) [2382 bp, 793 aa] {ON} YDL122W ...  1209   0.0  
Kpol_1003.53 s1003 (121699..124065) [2367 bp, 788 aa] {ON} (1216...   790   0.0  
TDEL0G02370 Chr7 (456393..458636) [2244 bp, 747 aa] {ON} Anc_2.3...   779   0.0  
TPHA0G00850 Chr7 (158945..161293) [2349 bp, 782 aa] {ON} Anc_2.3...   777   0.0  
NCAS0B06130 Chr2 complement(1159264..1161576) [2313 bp, 770 aa] ...   771   0.0  
CAGL0H10582g Chr8 complement(1029876..1032248) [2373 bp, 790 aa]...   763   0.0  
SAKL0E07106g Chr5 complement(584164..586539) [2376 bp, 791 aa] {...   744   0.0  
KLTH0G10934g Chr7 (919304..921580) [2277 bp, 758 aa] {ON} simila...   742   0.0  
ZYRO0A02420g Chr1 (190417..192654) [2238 bp, 745 aa] {ON} simila...   734   0.0  
Kwal_27.11444 s27 complement(802766..805039) [2274 bp, 757 aa] {...   711   0.0  
AGR389C Chr7 complement(1444377..1446704) [2328 bp, 775 aa] {ON}...   711   0.0  
KNAG0A05450 Chr1 (806796..809090) [2295 bp, 764 aa] {ON} Anc_2.3...   669   0.0  
NDAI0B03430 Chr2 complement(868578..871148) [2571 bp, 856 aa] {ON}    668   0.0  
KAFR0A06910 Chr1 complement(1393653..1395689) [2037 bp, 678 aa] ...   654   0.0  
TBLA0B06080 Chr2 (1437254..1439728) [2475 bp, 824 aa] {ON} Anc_2...   599   0.0  
KLLA0E08801g Chr5 (784991..787306) [2316 bp, 771 aa] {ON} simila...   563   0.0  
TBLA0B07160 Chr2 complement(1696047..1697201) [1155 bp, 384 aa] ...   308   7e-97
NCAS0G03680 Chr7 complement(682617..684065) [1449 bp, 482 aa] {O...   128   1e-30
NDAI0G00780 Chr7 (164452..165912) [1461 bp, 486 aa] {ON}              111   5e-25
SAKL0H10076g Chr8 (863358..865661) [2304 bp, 767 aa] {ON} simila...    57   2e-07
TBLA0H03600 Chr8 complement(877069..878517) [1449 bp, 482 aa] {O...    55   4e-07
KLLA0E23387g Chr5 complement(2079405..2081753) [2349 bp, 782 aa]...    52   5e-06
Kwal_27.12030 s27 complement(1056215..1058464) [2250 bp, 749 aa]...    49   7e-05
KLTH0E12540g Chr5 complement(1111576..1113834) [2259 bp, 752 aa]...    48   9e-05
YNL186W Chr14 (289498..291876) [2379 bp, 792 aa] {ON}  UBP10Ubiq...    47   2e-04
ZYRO0A05962g Chr1 complement(474545..475942) [1398 bp, 465 aa] {...    47   2e-04
Suva_16.240 Chr16 (429066..430637) [1572 bp, 523 aa] {ON} YPL072...    47   2e-04
Kwal_33.14430 s33 (669559..671094) [1536 bp, 511 aa] {ON} YNL186...    46   3e-04
KAFR0E00930 Chr5 (198914..200410) [1497 bp, 498 aa] {ON} Anc_8.5...    46   3e-04
TBLA0B09760 Chr2 complement(2316180..2318876) [2697 bp, 898 aa] ...    46   4e-04
Skud_15.286 Chr15 complement(511346..515182) [3837 bp, 1278 aa] ...    46   4e-04
SAKL0E13002g Chr5 complement(1070150..1072369) [2220 bp, 739 aa]...    46   4e-04
Smik_13.431 Chr13 (700800..702215) [1416 bp, 471 aa] {ON} YMR223...    45   5e-04
KLTH0B07150g Chr2 complement(574195..576465) [2271 bp, 756 aa] {...    45   6e-04
KNAG0F01220 Chr6 (219798..222152) [2355 bp, 784 aa] {ON} Anc_2.6...    45   6e-04
YMR223W Chr13 (716715..718130) [1416 bp, 471 aa] {ON}  UBP8Ubiqu...    45   8e-04
Suva_14.156 Chr14 (285613..287979) [2367 bp, 788 aa] {ON} YNL186...    45   8e-04
TDEL0B03670 Chr2 complement(656511..657902) [1392 bp, 463 aa] {O...    45   9e-04
Skud_13.392 Chr13 (690758..692179) [1422 bp, 473 aa] {ON} YMR223...    45   0.001
Kpol_1044.24 s1044 (56564..58738) [2175 bp, 724 aa] {ON} (56564....    45   0.001
Suva_13.407 Chr13 (697513..698928) [1416 bp, 471 aa] {ON} YMR223...    44   0.001
Smik_15.301 Chr15 complement(515941..519759) [3819 bp, 1272 aa] ...    45   0.001
ZYRO0G01606g Chr7 complement(123893..127810) [3918 bp, 1305 aa] ...    45   0.001
NDAI0F03410 Chr6 complement(820002..822614) [2613 bp, 870 aa] {O...    45   0.001
NCAS0G01800 Chr7 (319652..322279) [2628 bp, 875 aa] {ON} Anc_2.69      45   0.001
KAFR0L01730 Chr12 (316860..318965) [2106 bp, 701 aa] {ON} Anc_7....    44   0.001
NCAS0C02110 Chr3 (398702..400186) [1485 bp, 494 aa] {ON} Anc_8.5...    44   0.001
ZYRO0D03982g Chr4 (324687..327152) [2466 bp, 821 aa] {ON} weakly...    44   0.001
Skud_14.148 Chr14 (278827..281157) [2331 bp, 776 aa] {ON} YNL186...    44   0.002
Kwal_14.2008 s14 (571638..572912) [1275 bp, 424 aa] {ON} YDR069C...    44   0.002
KLLA0D08459g Chr4 complement(718046..720298) [2253 bp, 750 aa] {...    44   0.002
NDAI0E00810 Chr5 complement(163826..165307) [1482 bp, 493 aa] {O...    44   0.002
YOR124C Chr15 complement(554824..558642) [3819 bp, 1272 aa] {ON}...    44   0.002
TDEL0B03060 Chr2 (545366..547570) [2205 bp, 734 aa] {ON} Anc_8.5...    44   0.002
Suva_8.176 Chr8 complement(312595..316407) [3813 bp, 1270 aa] {O...    43   0.003
Kpol_1062.23 s1062 (51365..55165) [3801 bp, 1266 aa] {ON} (51365...    43   0.004
NDAI0C05900 Chr3 complement(1350639..1353119) [2481 bp, 826 aa] ...    43   0.004
TDEL0D02580 Chr4 (493355..497173) [3819 bp, 1272 aa] {ON} Anc_5....    43   0.004
KAFR0A04210 Chr1 (843659..844981) [1323 bp, 440 aa] {ON} Anc_8.7...    42   0.004
SAKL0G02728g Chr7 complement(223607..227320) [3714 bp, 1237 aa] ...    42   0.005
NDAI0E04180 Chr5 complement(941527..944010) [2484 bp, 827 aa] {O...    42   0.005
AEL242W Chr5 (182610..184451) [1842 bp, 613 aa] {ON} Syntenic ho...    42   0.005
KNAG0G02930 Chr7 (644555..645934) [1380 bp, 459 aa] {ON} Anc_8.7...    42   0.006
ZYRO0C09812g Chr3 complement(743861..745969) [2109 bp, 702 aa] {...    42   0.006
Ecym_4514 Chr4 complement(1025172..1028912) [3741 bp, 1246 aa] {...    42   0.006
CAGL0J11352g Chr10 complement(1103473..1105788) [2316 bp, 771 aa...    42   0.007
TBLA0A06470 Chr1 (1588461..1592423) [3963 bp, 1320 aa] {ON} Anc_...    42   0.008
NCAS0H02100 Chr8 complement(406897..410706) [3810 bp, 1269 aa] {...    42   0.008
TPHA0O01640 Chr15 complement(325844..328084) [2241 bp, 746 aa] {...    42   0.009
Kwal_26.9151 s26 complement(1095026..1096390) [1365 bp, 454 aa] ...    41   0.009
TDEL0A01100 Chr1 (186399..188384) [1986 bp, 661 aa] {ON} Anc_2.6...    41   0.011
Smik_14.144 Chr14 (268784..271075) [2292 bp, 763 aa] {ON} YNL186...    41   0.011
Ecym_1166 Chr1 (339106..341196) [2091 bp, 696 aa] {ON} similar t...    41   0.011
Smik_5.309 Chr5 complement(462971..465388) [2418 bp, 805 aa] {ON...    41   0.011
KNAG0A01970 Chr1 (157670..159085) [1416 bp, 471 aa] {ON} Anc_8.5...    41   0.012
KNAG0B04190 Chr2 (795803..799591) [3789 bp, 1262 aa] {ON} Anc_5....    41   0.017
CAGL0M11198g Chr13 (1102767..1104152) [1386 bp, 461 aa] {ON} sim...    40   0.018
CAGL0A04477g Chr1 (442089..444401) [2313 bp, 770 aa] {ON} simila...    40   0.021
Suva_5.272 Chr5 complement(429119..431485) [2367 bp, 788 aa] {ON...    40   0.025
Skud_5.281 Chr5 complement(448432..450903) [2472 bp, 823 aa] {ON...    40   0.026
NDAI0C01550 Chr3 (327953..331840) [3888 bp, 1295 aa] {ON} Anc_5....    40   0.031
KAFR0A07580 Chr1 complement(1528362..1530770) [2409 bp, 802 aa] ...    40   0.032
NCAS0B00580 Chr2 (86690..88090) [1401 bp, 466 aa] {ON} Anc_8.742       40   0.032
CAGL0H05335g Chr8 complement(512683..514134) [1452 bp, 483 aa] {...    39   0.033
TBLA0D01070 Chr4 complement(275843..277294) [1452 bp, 483 aa] {O...    39   0.035
SAKL0H04994g Chr8 complement(445232..446596) [1365 bp, 454 aa] {...    39   0.036
Kwal_55.21393 s55 (816177..819878) [3702 bp, 1233 aa] {ON} YOR12...    40   0.038
ACL164C Chr3 complement(67792..71961) [4170 bp, 1389 aa] {ON} Sy...    39   0.042
Kpol_513.25 s513 (71125..74697) [3573 bp, 1190 aa] {ON} (71125.....    39   0.043
Ecym_6248 Chr6 (468203..469603) [1401 bp, 466 aa] {ON} similar t...    39   0.044
TPHA0G00560 Chr7 complement(105403..106794) [1392 bp, 463 aa] {O...    39   0.044
Smik_16.163 Chr16 (301703..303208) [1506 bp, 501 aa] {ON} YPL072...    39   0.045
Kpol_1032.28 s1032 complement(57514..60162) [2649 bp, 882 aa] {O...    39   0.045
NCAS0B04280 Chr2 (777104..779872) [2769 bp, 922 aa] {ON} Anc_8.188     39   0.050
TDEL0B02080 Chr2 (369534..372611) [3078 bp, 1025 aa] {ON} Anc_5....    39   0.053
Kpol_1064.48 s1064 (88495..89895) [1401 bp, 466 aa] {ON} (88495....    39   0.056
TPHA0L01670 Chr12 complement(351116..352690) [1575 bp, 524 aa] {...    39   0.057
CAGL0G05247g Chr7 complement(491024..493867) [2844 bp, 947 aa] {...    39   0.059
Smik_2.49 Chr2 complement(87575..89812) [2238 bp, 745 aa] {ON} Y...    39   0.065
KLLA0C06974g Chr3 complement(604344..605684) [1341 bp, 446 aa] {...    39   0.068
TBLA0D00620 Chr4 complement(159706..163221) [3516 bp, 1171 aa] {...    39   0.069
Kpol_1018.93 s1018 (248094..250361) [2268 bp, 755 aa] {ON} (2480...    39   0.069
NDAI0E02820 Chr5 (598119..599606) [1488 bp, 495 aa] {ON} Anc_8.5...    39   0.075
KLTH0H07678g Chr8 (677217..679802) [2586 bp, 861 aa] {ON} simila...    39   0.080
ABL145W Chr2 (124839..127088) [2250 bp, 749 aa] {ON} Syntenic ho...    39   0.085
KLTH0F15862g Chr6 (1288742..1292467) [3726 bp, 1241 aa] {ON} sim...    39   0.087
KNAG0B02370 Chr2 complement(463599..465860) [2262 bp, 753 aa] {O...    38   0.087
Smik_11.362 Chr11 complement(623098..625263) [2166 bp, 721 aa] {...    38   0.096
Kpol_2001.78 s2001 complement(213762..214973) [1212 bp, 403 aa] ...    38   0.10 
YER144C Chr5 complement(457806..460223) [2418 bp, 805 aa] {ON}  ...    38   0.10 
YBL067C Chr2 complement(93639..95882) [2244 bp, 747 aa] {ON}  UB...    38   0.10 
Skud_10.22 Chr10 (38735..42502) [3768 bp, 1255 aa] {ON} YJL197W ...    38   0.11 
AFR007W Chr6 (448632..451178) [2547 bp, 848 aa] {ON} Syntenic ho...    38   0.11 
Suva_2.50 Chr2 complement(90700..92952) [2253 bp, 750 aa] {ON} Y...    38   0.11 
CAGL0I05522g Chr9 complement(521749..523923) [2175 bp, 724 aa] {...    38   0.12 
SAKL0H18986g Chr8 (1683752..1686433) [2682 bp, 893 aa] {ON} simi...    38   0.12 
KNAG0D01930 Chr4 (324705..327665) [2961 bp, 986 aa] {ON} Anc_8.1...    38   0.13 
TPHA0P00680 Chr16 (139640..141823) [2184 bp, 727 aa] {ON} Anc_7....    38   0.14 
NDAI0I02530 Chr9 (584472..588065) [3594 bp, 1197 aa] {ON} Anc_5....    38   0.15 
NCAS0A14370 Chr1 (2830136..2832325) [2190 bp, 729 aa] {ON} Anc_7...    37   0.15 
KLLA0E02377g Chr5 complement(218647..222309) [3663 bp, 1220 aa] ...    38   0.15 
Ecym_6184 Chr6 (341652..344207) [2556 bp, 851 aa] {ON} similar t...    38   0.15 
KAFR0C02590 Chr3 complement(503330..506266) [2937 bp, 978 aa] {O...    38   0.15 
AFR296C Chr6 complement(972519..976028) [3510 bp, 1169 aa] {ON} ...    38   0.16 
KAFR0I02600 Chr9 (525365..529006) [3642 bp, 1213 aa] {ON} Anc_5....    37   0.17 
AFR551W Chr6 (1427498..1428907) [1410 bp, 469 aa] {ON} Syntenic ...    37   0.18 
NDAI0C05950 Chr3 complement(1361343..1364585) [3243 bp, 1080 aa]...    37   0.18 
Skud_2.38 Chr2 complement(77293..79539) [2247 bp, 748 aa] {ON} Y...    37   0.20 
KNAG0C03580 Chr3 complement(699604..701934) [2331 bp, 776 aa] {O...    37   0.21 
Skud_16.209 Chr16 (389855..391366) [1512 bp, 503 aa] {ON} YPL072...    37   0.23 
KLLA0C03476g Chr3 (314815..318573) [3759 bp, 1252 aa] {ON} simil...    37   0.23 
TPHA0E01710 Chr5 (343977..347828) [3852 bp, 1283 aa] {ON} Anc_5....    37   0.24 
TDEL0C05640 Chr3 complement(1005536..1009072) [3537 bp, 1178 aa]...    37   0.25 
NCAS0A03910 Chr1 (791578..793965) [2388 bp, 795 aa] {ON} Anc_8.188     37   0.25 
KLTH0D12760g Chr4 (1045108..1046469) [1362 bp, 453 aa] {ON} simi...    37   0.25 
KNAG0G01670 Chr7 complement(366899..369592) [2694 bp, 897 aa] {O...    37   0.27 
CAGL0I06600g Chr9 (639096..641546) [2451 bp, 816 aa] {ON} simila...    37   0.27 
ZYRO0C17908g Chr3 complement(1393864..1397478) [3615 bp, 1204 aa...    37   0.29 
SAKL0E15136g Chr5 complement(1258870..1261983) [3114 bp, 1037 aa...    37   0.31 
CAGL0G02563g Chr7 complement(235498..237393) [1896 bp, 631 aa] {...    36   0.33 
Kpol_1055.31 s1055 complement(78247..80715) [2469 bp, 822 aa] {O...    36   0.35 
Kpol_1045.41 s1045 complement(95233..97371) [2139 bp, 712 aa] {O...    36   0.38 
NCAS0D02390 Chr4 complement(451930..455565) [3636 bp, 1211 aa] {...    36   0.39 
Skud_11.338 Chr11 complement(614651..616789) [2139 bp, 712 aa] {...    36   0.40 
Suva_13.495 Chr13 (857778..861470) [3693 bp, 1230 aa] {ON} YMR30...    36   0.41 
Smik_13.521 Chr13 (857682..861377) [3696 bp, 1231 aa] {ON} YMR30...    36   0.41 
AGL357W Chr7 (33383..36883) [3501 bp, 1166 aa] {ON} Syntenic hom...    36   0.43 
YMR304W Chr13 (874987..878679) [3693 bp, 1230 aa] {ON}  UBP15Ubi...    36   0.43 
KAFR0C00410 Chr3 complement(85302..87611) [2310 bp, 769 aa] {ON}...    36   0.44 
CAGL0H06721g Chr8 complement(667816..671061) [3246 bp, 1081 aa] ...    36   0.47 
Skud_13.478 Chr13 (848446..852141) [3696 bp, 1231 aa] {ON} YMR30...    36   0.48 
NDAI0A03680 Chr1 (837931..841281) [3351 bp, 1116 aa] {ON}              36   0.49 
YJL197W Chr10 (63805..67569) [3765 bp, 1254 aa] {ON}  UBP12Ubiqu...    36   0.51 
Kpol_1024.44 s1024 (118060..119550) [1491 bp, 496 aa] {ON} (1180...    36   0.51 
Skud_4.323 Chr4 complement(560596..563376) [2781 bp, 926 aa] {ON...    36   0.52 
Suva_2.228 Chr2 complement(385322..388105) [2784 bp, 927 aa] {ON...    36   0.54 
TBLA0C01200 Chr3 complement(258492..259981,260188..260209) [1512...    35   0.55 
KLLA0E10275g Chr5 (906675..909065) [2391 bp, 796 aa] {ON} simila...    36   0.57 
Smik_10.37 Chr10 (61787..65530) [3744 bp, 1247 aa] {ON} YJL197W ...    36   0.57 
AGR139C Chr7 complement(1010460..1012829) [2370 bp, 789 aa] {ON}...    36   0.58 
YDR069C Chr4 complement(584939..587719) [2781 bp, 926 aa] {ON}  ...    36   0.59 
Ecym_4685 Chr4 complement(1332993..1335329) [2337 bp, 778 aa] {O...    35   0.60 
Suva_6.276 Chr6 complement(481843..485613) [3771 bp, 1256 aa] {O...    36   0.62 
KNAG0G01590 Chr7 complement(354369..356384) [2016 bp, 671 aa] {O...    35   0.62 
Smik_4.307 Chr4 complement(551719..554508) [2790 bp, 929 aa] {ON...    35   0.62 
KLTH0H13354g Chr8 complement(1165485..1166953,1167017..1167035) ...    35   0.64 
Kwal_55.19645 s55 (62575..65487) [2913 bp, 970 aa] {ON} YIL156W ...    35   0.66 
TPHA0C02770 Chr3 (604690..607602) [2913 bp, 970 aa] {ON} Anc_8.1...    35   0.67 
NCAS0A03840 Chr1 (780031..782784) [2754 bp, 917 aa] {ON} Anc_8.2...    35   0.69 
Klac_YGOB_Anc_5.18b Chr3 (1201452..1202573,1202576..1204954) [35...    35   0.70 
Kpol_2001.54 s2001 complement(144924..148595) [3672 bp, 1223 aa]...    35   0.74 
AGR370W Chr7 (1416579..1418801) [2223 bp, 740 aa] {ON} Syntenic ...    35   0.74 
KAFR0H00150 Chr8 (14149..16119) [1971 bp, 656 aa] {ON} Anc_5.712...    35   0.75 
NCAS0G00170 Chr7 (22237..25329) [3093 bp, 1030 aa] {ON} Anc_5.712      35   0.77 
TBLA0C07020 Chr3 (1694706..1698449) [3744 bp, 1247 aa] {ON} Anc_...    35   0.78 
SAKL0D03322g Chr4 (270137..272434) [2298 bp, 765 aa] {ON} simila...    35   0.78 
NCAS0I03140 Chr9 complement(576993..580598) [3606 bp, 1201 aa] {...    35   0.87 
YPL072W Chr16 (418512..420011) [1500 bp, 499 aa] {ON}  UBP16Deub...    35   0.88 
ZYRO0D07062g Chr4 complement(609322..612903) [3582 bp, 1193 aa] ...    35   0.90 
ZYRO0G06798g Chr7 (544095..546728) [2634 bp, 877 aa] {ON} some s...    35   0.92 
TPHA0L02290 Chr12 (479360..482941) [3582 bp, 1193 aa] {ON} Anc_5...    35   0.94 
YKR098C Chr11 complement(633026..635179) [2154 bp, 717 aa] {ON} ...    35   1.0  
Kwal_33.13628 s33 (324581..328063) [3483 bp, 1160 aa] {ON} YJL19...    35   1.1  
SAKL0H18656g Chr8 (1658629..1660947) [2319 bp, 772 aa] {ON} some...    35   1.1  
NDAI0F00200 Chr6 (35966..39283) [3318 bp, 1105 aa] {ON} Anc_5.712      35   1.1  
TBLA0F03610 Chr6 (890140..893574) [3435 bp, 1144 aa] {ON} Anc_8....    35   1.2  
Skud_2.177 Chr2 complement(322000..324348) [2349 bp, 782 aa] {ON...    35   1.3  
TPHA0A02540 Chr1 (543606..547466) [3861 bp, 1286 aa] {ON} Anc_1....    35   1.4  
Ecym_5544 Chr5 (1102256..1104760) [2505 bp, 834 aa] {ON} similar...    34   1.5  
Kpol_534.23 s534 (53632..53653,53786..55254) [1491 bp, 496 aa] {...    34   1.6  
TBLA0J00600 Chr10 (129182..133570) [4389 bp, 1462 aa] {ON} Anc_1...    34   1.9  
KLTH0B09944g Chr2 complement(826050..829619) [3570 bp, 1189 aa] ...    34   2.1  
KNAG0J00800 Chr10 complement(134836..137133) [2298 bp, 765 aa] {...    34   2.2  
KAFR0D05070 Chr4 complement(996195..999878) [3684 bp, 1227 aa] {...    34   2.2  
KAFR0D02160 Chr4 (432966..435506) [2541 bp, 846 aa] {ON} Anc_5.7...    34   2.3  
KNAG0C02180 Chr3 (429789..433484) [3696 bp, 1231 aa] {ON} Anc_1....    34   2.4  
YBR058C Chr2 complement(353672..356017) [2346 bp, 781 aa] {ON}  ...    33   2.5  
CAGL0I02244g Chr9 complement(195217..195726) [510 bp, 169 aa] {O...    32   2.5  
CAGL0K10494g Chr11 (1023698..1025185) [1488 bp, 495 aa] {ON} hig...    33   2.6  
TDEL0A01620 Chr1 (291670..294057) [2388 bp, 795 aa] {ON} Anc_8.2...    33   2.6  
TBLA0E01760 Chr5 complement(430209..433847) [3639 bp, 1212 aa] {...    33   2.8  
CAGL0L01639g Chr12 (178104..181547) [3444 bp, 1147 aa] {ON} simi...    33   2.9  
KNAG0C01940 Chr3 complement(375973..377472) [1500 bp, 499 aa] {O...    33   2.9  
Ecym_5671 Chr5 complement(1362706..1366236) [3531 bp, 1176 aa] {...    33   2.9  
TPHA0D04660 Chr4 complement(1017401..1020538) [3138 bp, 1045 aa]...    33   3.0  
TPHA0A02510 Chr1 (536076..536097,536233..537728) [1518 bp, 505 a...    33   3.0  
CAGL0M13783g Chr13 (1354198..1357788) [3591 bp, 1196 aa] {ON} si...    33   3.4  
KAFR0F01560 Chr6 (310936..314451) [3516 bp, 1171 aa] {ON} Anc_1....    33   3.6  
Suva_11.335 Chr11 complement(617850..620024) [2175 bp, 724 aa] {...    33   3.6  
Kwal_14.1957 s14 (549510..550844) [1335 bp, 444 aa] {ON} YER151C...    33   3.7  
NDAI0H03550 Chr8 complement(865851..867359) [1509 bp, 502 aa] {O...    33   3.7  
Suva_4.295 Chr4 complement(520439..522787) [2349 bp, 782 aa] {ON...    33   3.8  
Smik_2.189 Chr2 complement(335612..337960) [2349 bp, 782 aa] {ON...    33   3.8  
Kwal_34.16268 s34 (268814..270163) [1350 bp, 449 aa] {ON} YFR010...    33   4.0  
Kpol_251.7 s251 (12280..13719) [1440 bp, 480 aa] {ON} (12280..13...    33   4.1  
KLTH0E00814g Chr5 (80059..82983) [2925 bp, 974 aa] {ON} similar ...    33   4.2  
ZYRO0G01188g Chr7 (95655..95676,95759..97239) [1503 bp, 500 aa] ...    33   4.2  
TPHA0J02620 Chr10 complement(580898..584575) [3678 bp, 1225 aa] ...    33   4.5  
Kpol_1016.1 s1016 (585..4340) [3756 bp, 1251 aa] {ON} (585..4340...    33   5.4  
SAKL0D10120g Chr4 complement(845029..846491,846566..846581) [147...    32   6.2  
KLLA0E01013g Chr5 (104991..107315) [2325 bp, 774 aa] {ON} some s...    32   7.6  

>YDL122W Chr4 (242552..244981) [2430 bp, 809 aa] {ON}
           UBP1Ubiquitin-specific protease that removes ubiquitin
           from ubiquitinated proteins; cleaves at the C terminus
           of ubiquitin fusions irrespective of their size; capable
           of cleaving polyubiquitin chains
          Length = 809

 Score = 1405 bits (3638), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 697/809 (86%), Positives = 697/809 (86%)

Query: 1   MDLFIESKINSLLQFLFGSRQDFLRNFKTWSXXXXXLSIYLLIFGIVVFFYKKPDHLNYI 60
           MDLFIESKINSLLQFLFGSRQDFLRNFKTWS     LSIYLLIFGIVVFFYKKPDHLNYI
Sbjct: 1   MDLFIESKINSLLQFLFGSRQDFLRNFKTWSNNNNNLSIYLLIFGIVVFFYKKPDHLNYI 60

Query: 61  VESVSEMTTNFRNNNSLSRWLPRSKFTHLDEEILKRGGFIAGLVNDGNTCFMNSVLQSLA 120
           VESVSEMTTNFRNNNSLSRWLPRSKFTHLDEEILKRGGFIAGLVNDGNTCFMNSVLQSLA
Sbjct: 61  VESVSEMTTNFRNNNSLSRWLPRSKFTHLDEEILKRGGFIAGLVNDGNTCFMNSVLQSLA 120

Query: 121 SSRELMEFLDNNVIRTYXXXXXXXXXXXXXXXXSAQDEATHKKNTRXXXXXXXXXXXXLN 180
           SSRELMEFLDNNVIRTY                SAQDEATHKKNTR            LN
Sbjct: 121 SSRELMEFLDNNVIRTYEEIEQNEHNEEGNGQESAQDEATHKKNTRKGGKVYGKHKKKLN 180

Query: 181 RXXXXXXXXXXXXXPDITFSVALRDLLSALNAKYYRDKPYFKTNSLLKAMSKSPRKNILL 240
           R             PDITFSVALRDLLSALNAKYYRDKPYFKTNSLLKAMSKSPRKNILL
Sbjct: 181 RKSSSKEDEEKSQEPDITFSVALRDLLSALNAKYYRDKPYFKTNSLLKAMSKSPRKNILL 240

Query: 241 GYDQEDAQEFFQNILAELESNVKSLNTEKLDTTPVAKSELPDDALVGQLNLGEVGTVYIP 300
           GYDQEDAQEFFQNILAELESNVKSLNTEKLDTTPVAKSELPDDALVGQLNLGEVGTVYIP
Sbjct: 241 GYDQEDAQEFFQNILAELESNVKSLNTEKLDTTPVAKSELPDDALVGQLNLGEVGTVYIP 300

Query: 301 TEQIDPNSILHDKSIQNFTPFKLMTPLDGITAERIGCLQCGENGGIRYSVFSGLSLNLPN 360
           TEQIDPNSILHDKSIQNFTPFKLMTPLDGITAERIGCLQCGENGGIRYSVFSGLSLNLPN
Sbjct: 301 TEQIDPNSILHDKSIQNFTPFKLMTPLDGITAERIGCLQCGENGGIRYSVFSGLSLNLPN 360

Query: 361 ENIGSTLKLSQLLSDWSKPEIIEGVECNRCALTAAHSHLFGQLKEFEKKPEGSIPEKLIN 420
           ENIGSTLKLSQLLSDWSKPEIIEGVECNRCALTAAHSHLFGQLKEFEKKPEGSIPEKLIN
Sbjct: 361 ENIGSTLKLSQLLSDWSKPEIIEGVECNRCALTAAHSHLFGQLKEFEKKPEGSIPEKLIN 420

Query: 421 AVKDRVHQIEEVLAKPVIDDEDYKKLHTANMVRKCSKSKQILISRPPPLLSIHINRSVFD 480
           AVKDRVHQIEEVLAKPVIDDEDYKKLHTANMVRKCSKSKQILISRPPPLLSIHINRSVFD
Sbjct: 421 AVKDRVHQIEEVLAKPVIDDEDYKKLHTANMVRKCSKSKQILISRPPPLLSIHINRSVFD 480

Query: 481 PRTYMIRKNNSKVLFKSRLNLAPWCCDINEINLDARLPMSKKEKAAQQDSSEDENIGGEY 540
           PRTYMIRKNNSKVLFKSRLNLAPWCCDINEINLDARLPMSKKEKAAQQDSSEDENIGGEY
Sbjct: 481 PRTYMIRKNNSKVLFKSRLNLAPWCCDINEINLDARLPMSKKEKAAQQDSSEDENIGGEY 540

Query: 541 YTKLHXXXXXXXXXXXXXXXXXXXXGNYASHYNHTKDISNYDPLNGEVDGVTSDDEDEYI 600
           YTKLH                    GNYASHYNHTKDISNYDPLNGEVDGVTSDDEDEYI
Sbjct: 541 YTKLHERFEQEFEDSEEEKEYDDAEGNYASHYNHTKDISNYDPLNGEVDGVTSDDEDEYI 600

Query: 601 EETDALGNTIKKRIIEHSXXXXXXXXXXXXLQEIDNVSLDEPKINVEDQLETSSDEEDVI 660
           EETDALGNTIKKRIIEHS            LQEIDNVSLDEPKINVEDQLETSSDEEDVI
Sbjct: 601 EETDALGNTIKKRIIEHSDVENENVKDNEELQEIDNVSLDEPKINVEDQLETSSDEEDVI 660

Query: 661 PAPPINYARSFSTVPATPLTYSLRSVIVHYGTHNYGHYIAFRKYRGCWWRISDETVYVVD 720
           PAPPINYARSFSTVPATPLTYSLRSVIVHYGTHNYGHYIAFRKYRGCWWRISDETVYVVD
Sbjct: 661 PAPPINYARSFSTVPATPLTYSLRSVIVHYGTHNYGHYIAFRKYRGCWWRISDETVYVVD 720

Query: 721 EAEVLSTPGVFMLFYEYDFDEETGKMKDDLEAIQSNNXXXXXXXXXXXXXXXXXXXXXXX 780
           EAEVLSTPGVFMLFYEYDFDEETGKMKDDLEAIQSNN                       
Sbjct: 721 EAEVLSTPGVFMLFYEYDFDEETGKMKDDLEAIQSNNEEDDEKEQEQKGVQEPKESQEQG 780

Query: 781 XXXXXXXXXXXMKFERTEDHRDISGKDVN 809
                      MKFERTEDHRDISGKDVN
Sbjct: 781 EGEEQEEGQEQMKFERTEDHRDISGKDVN 809

>Smik_4.115 Chr4 (219167..221539) [2373 bp, 790 aa] {ON} YDL122W
           (REAL)
          Length = 790

 Score = 1252 bits (3240), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 610/758 (80%), Positives = 647/758 (85%), Gaps = 1/758 (0%)

Query: 1   MDLFIESKINSLLQFLFGSRQDFLRNFKTWSXXXXXLSIYLLIFGIVVFFYKKPDHLNYI 60
           MDLFIE KINSLL FLFGSRQDFL++F+ W+     LSIYLLIFG+VVFFYKKPDHLNY+
Sbjct: 1   MDLFIERKINSLLHFLFGSRQDFLKSFEIWNNNNNNLSIYLLIFGVVVFFYKKPDHLNYV 60

Query: 61  VESVSEMTTNFRNNNSLSRWLPRSKFTHLDEEILKRGGFIAGLVNDGNTCFMNSVLQSLA 120
           VES+ EMTTNFRNNNSLSRWLPRSKFTHLDEEILKRGGFIAGLVNDGNTCFMNSVLQSLA
Sbjct: 61  VESIREMTTNFRNNNSLSRWLPRSKFTHLDEEILKRGGFIAGLVNDGNTCFMNSVLQSLA 120

Query: 121 SSRELMEFLDNNVIRTYXXXXXXXXXXXXXXXXSAQDEATHKKNTRXXXXXXXXXXXXLN 180
           SS+ELMEFLDNNVI+TY                  Q E  +KKN+             LN
Sbjct: 121 SSKELMEFLDNNVIKTYEEMEQNEHNKEESEHEPEQGEYNNKKNSNRSGKVYGKHKKKLN 180

Query: 181 RXXXXXXXXXXXXXPDITFSVALRDLLSALNAKYYRDKPYFKTNSLLKAMSKSPRKNILL 240
           R             PDITFS ALRDLL+ALN KYYRDKPYFKTNSLLK+MSKSPRKNILL
Sbjct: 181 RKLSSKEEERENQEPDITFSTALRDLLAALNDKYYRDKPYFKTNSLLKSMSKSPRKNILL 240

Query: 241 GYDQEDAQEFFQNILAELESNVKSLNTEKLDTTPVAKSELPDDALVGQLNLGEVGTVYIP 300
           GYDQEDAQEFFQNILAELESNVKSLNTEKLD+TP+AKS LP+DALVGQ NLGEVGTVYIP
Sbjct: 241 GYDQEDAQEFFQNILAELESNVKSLNTEKLDSTPIAKSNLPEDALVGQQNLGEVGTVYIP 300

Query: 301 TEQIDPNSILHDKSIQNFTPFKLMTPLDGITAERIGCLQCGENGGIRYSVFSGLSLNLPN 360
           TEQIDPNSILHDKSIQN TPF+LMTPLDGITAERIGCLQCGENGGIRYSVFSGLSLNLPN
Sbjct: 301 TEQIDPNSILHDKSIQNLTPFRLMTPLDGITAERIGCLQCGENGGIRYSVFSGLSLNLPN 360

Query: 361 ENIGSTLKLSQLLSDWSKPEIIEGVECNRCALTAAHSHLFGQLKEFEKKPEGSIPEKLIN 420
           ENIGSTLKLSQLLSDWSKPEIIEGVECNRCALTAAHSHL  QL +F+KKPEGSIPEKL+N
Sbjct: 361 ENIGSTLKLSQLLSDWSKPEIIEGVECNRCALTAAHSHLMEQLDQFQKKPEGSIPEKLMN 420

Query: 421 AVKDRVHQIEEVLAKPVIDDEDYKKLHTANMVRKCSKSKQILISRPPPLLSIHINRSVFD 480
           AVKDRV QI+EVLAKPVIDDEDYKKLHTANMVRKCSKSKQILISRPPPLLSIHINRSVFD
Sbjct: 421 AVKDRVQQIQEVLAKPVIDDEDYKKLHTANMVRKCSKSKQILISRPPPLLSIHINRSVFD 480

Query: 481 PRTYMIRKNNSKVLFKSRLNLAPWCCDINEINLDARLPMSKKEKAAQQDSSEDENIGGEY 540
           PRTYMIRKNNSKVLFKSRLNLAPWCCDI+EINLDARLPMSKKEK  QQDSSEDENIGGEY
Sbjct: 481 PRTYMIRKNNSKVLFKSRLNLAPWCCDIDEINLDARLPMSKKEKTVQQDSSEDENIGGEY 540

Query: 541 YTKLHXXXXXXXXXXXXXXXXXXXXGNYASHYNHTKDISNYDPLNGEVDGVTSDDEDEYI 600
           YTKLH                     NY SHY+H+K+ +NYDPLNGE D +TSDDEDE+I
Sbjct: 541 YTKLHERFEQEFEDSEEERDYNDGEENYTSHYSHSKNNNNYDPLNGEADDLTSDDEDEHI 600

Query: 601 EETDALGNTIKKRIIEHSXXXXX-XXXXXXXLQEIDNVSLDEPKINVEDQLETSSDEEDV 659
           EETDALGNTI+KRI E++             L  ID+V++DEPK+NVEDQLETSSDEEDV
Sbjct: 601 EETDALGNTIRKRITENTNDENDYVKDDEKELHNIDSVNIDEPKVNVEDQLETSSDEEDV 660

Query: 660 IPAPPINYARSFSTVPATPLTYSLRSVIVHYGTHNYGHYIAFRKYRGCWWRISDETVYVV 719
           IPAPPINY RSFSTVPATPLTYSLRSVIVHYGTHNYGHYIAFRKYRGCWWRISDETVYVV
Sbjct: 661 IPAPPINYTRSFSTVPATPLTYSLRSVIVHYGTHNYGHYIAFRKYRGCWWRISDETVYVV 720

Query: 720 DEAEVLSTPGVFMLFYEYDFDEETGKMKDDLEAIQSNN 757
           DEAEVLSTPGVFMLFYEYD+DEETG+MKDDLE I SNN
Sbjct: 721 DEAEVLSTPGVFMLFYEYDYDEETGQMKDDLELIPSNN 758

>Skud_4.133 Chr4 (238225..240588) [2364 bp, 787 aa] {ON} YDL122W
           (REAL)
          Length = 787

 Score = 1227 bits (3175), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 600/759 (79%), Positives = 638/759 (84%), Gaps = 2/759 (0%)

Query: 1   MDLFIESKINSLLQFLFGSRQDFLRNFKTWSXXXXXLSIYLLIFGIVVFFYKKPDHLNYI 60
           MDL+IE KINSLLQFLFGSRQDFLRNFK W+      SIYLLIFG+VVFFYKKPDHL YI
Sbjct: 1   MDLYIEGKINSLLQFLFGSRQDFLRNFKIWNSNNNNFSIYLLIFGVVVFFYKKPDHLKYI 60

Query: 61  VESVSEMTTNFRNNNSLSRWLPRSKFTHLDEEILKRGGFIAGLVNDGNTCFMNSVLQSLA 120
           V+ +SEMTTNF+NNNSLSRWLPRSKFTHLDEEILKRGGFIAGLVNDGNTCFMNSVLQSLA
Sbjct: 61  VDGISEMTTNFKNNNSLSRWLPRSKFTHLDEEILKRGGFIAGLVNDGNTCFMNSVLQSLA 120

Query: 121 SSRELMEFLDNNVIRTYXXXXXXXXXXXXXXXXSAQDEATHKKNTRXXXXXXXXXXXXLN 180
           SSRELM+FLDNNVI+TY                  QDE  HK  +             LN
Sbjct: 121 SSRELMDFLDNNVIKTYEDIERSEQNKENNGNEREQDEDNHKTKSSRSGKVYGKHRKKLN 180

Query: 181 RXXXXXXXXXXXXXPDITFSVALRDLLSALNAKYYRDKPYFKTNSLLKAMSKSPRKNILL 240
           R             PDITFSV L+DLL+ALN KYYRDKPYFKTN LLKAMSKSPRKNILL
Sbjct: 181 RKLSSKEEEEENQEPDITFSVTLKDLLAALNDKYYRDKPYFKTNRLLKAMSKSPRKNILL 240

Query: 241 GYDQEDAQEFFQNILAELESNVKSLNTEKLDTTPVAKSELPDDALVGQLNLGEVGTVYIP 300
           GYDQEDAQEFFQNILAELESNVKSLN+E LDTTP AKS+LPDDALVGQ +L  VGTVYIP
Sbjct: 241 GYDQEDAQEFFQNILAELESNVKSLNSETLDTTPTAKSDLPDDALVGQRDLDRVGTVYIP 300

Query: 301 TEQIDPNSILHDKSIQNFTPFKLMTPLDGITAERIGCLQCGENGGIRYSVFSGLSLNLPN 360
           TEQIDPNSILHDKSI+NFTP+KLMTPLDGITAERIGCLQCGENGGIRYSVFSGLSLNLPN
Sbjct: 301 TEQIDPNSILHDKSIKNFTPYKLMTPLDGITAERIGCLQCGENGGIRYSVFSGLSLNLPN 360

Query: 361 ENIGSTLKLSQLLSDWSKPEIIEGVECNRCALTAAHSHLFGQLKEFEKKPEGSIPEKLIN 420
           ENIGSTLKLSQLLSDWSKPEIIEGVECNRCALTAAHSHL GQLK+FEKKP+GSIPEKLIN
Sbjct: 361 ENIGSTLKLSQLLSDWSKPEIIEGVECNRCALTAAHSHLLGQLKQFEKKPDGSIPEKLIN 420

Query: 421 AVKDRVHQIEEVLAKPVIDDEDYKKLHTANMVRKCSKSKQILISRPPPLLSIHINRSVFD 480
           AVK+RVHQIE+VLAKPVIDD+DYKKLHTANMVRKCSKSKQILISRPPPLLSIHINRSVFD
Sbjct: 421 AVKERVHQIEQVLAKPVIDDDDYKKLHTANMVRKCSKSKQILISRPPPLLSIHINRSVFD 480

Query: 481 PRTYMIRKNNSKVLFKSRLNLAPWCCDINEINLDARLPMSKKEKAAQQDSSEDENIGGEY 540
           PRTY IRKNNSKVLFKSRLNL+PWCCDI+EINLDARLPMSKKEK  QQ+SSEDENIGGEY
Sbjct: 481 PRTYTIRKNNSKVLFKSRLNLSPWCCDIDEINLDARLPMSKKEKVVQQESSEDENIGGEY 540

Query: 541 YTKLHXXXXXXXXXXXXXXXXXXXXGNYASHYNHTKDISNYDPLNGEVDGVTSDDEDEYI 600
           YTKLH                     NYASHY   K  SNYDPL  E D +TSDDEDEYI
Sbjct: 541 YTKLHERFEQEFEDSEEEREYNDEKENYASHYASNKGNSNYDPLKDEADDLTSDDEDEYI 600

Query: 601 EETDALGNTIKKRIIEHSXXXXXX--XXXXXXLQEIDNVSLDEPKINVEDQLETSSDEED 658
           EETDALGNTI+KR IEH+              L  I+N++ D+PKI+VEDQLE SSDE+D
Sbjct: 601 EETDALGNTIRKRTIEHADEKNEHVIEDDEEALDSINNINHDKPKIDVEDQLEPSSDEDD 660

Query: 659 VIPAPPINYARSFSTVPATPLTYSLRSVIVHYGTHNYGHYIAFRKYRGCWWRISDETVYV 718
           VIPAPPINYARSFSTVPATPLTYSLRSVIVHYGTHNYGHYIAFRKYRGCWWRISDETVYV
Sbjct: 661 VIPAPPINYARSFSTVPATPLTYSLRSVIVHYGTHNYGHYIAFRKYRGCWWRISDETVYV 720

Query: 719 VDEAEVLSTPGVFMLFYEYDFDEETGKMKDDLEAIQSNN 757
           VDEAEVLSTPGVFMLFYEYD+D+ETG+MKDDLEA+  N+
Sbjct: 721 VDEAEVLSTPGVFMLFYEYDYDKETGEMKDDLEALPPND 759

>Suva_4.125 Chr4 (231011..233392) [2382 bp, 793 aa] {ON} YDL122W
           (REAL)
          Length = 793

 Score = 1209 bits (3127), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 593/760 (78%), Positives = 637/760 (83%), Gaps = 4/760 (0%)

Query: 1   MDLFIESKINSLLQFLFGSRQDFLRNFKTWSXXXXXLSIYLLIFGIVVFFYKKPDHLNYI 60
           MDLFIE KI+SLLQFLF SRQDFL+N + W+       IYLLIFG+VVF YK+PDHLN I
Sbjct: 1   MDLFIERKIDSLLQFLFVSRQDFLKNLRFWNNNSNNFPIYLLIFGVVVFLYKRPDHLNRI 60

Query: 61  VESVSEMTTNFRNNNSLSRWLPRSKFTHLDEEILKRGGFIAGLVNDGNTCFMNSVLQSLA 120
           V+S+SEMTTNFRNNNSLSRWLPRSKFTHLDEE+LKRGGFIAGLVNDGNTCFMNSVLQSLA
Sbjct: 61  VDSISEMTTNFRNNNSLSRWLPRSKFTHLDEEVLKRGGFIAGLVNDGNTCFMNSVLQSLA 120

Query: 121 SSRELMEFLDNNVIRTYXXXXXXXXXXXXXXXXSAQDEATHKKNTRXXXXXXXXXXXXLN 180
           SSRELM+FLDNNVI+TY                   +E  HKK +             LN
Sbjct: 121 SSRELMDFLDNNVIKTYEELEENAENKEENGHEHEDEEDGHKKKSAKNGKVYGKHKKKLN 180

Query: 181 RXXXXXXXXXXXXXPDITFSVALRDLLSALNAKYYRDKPYFKTNSLLKAMSKSPRKNILL 240
           R             PD+TFSV LRDLL+ALN KYYRDKPYFKTN LLKAMSKSPRKN+LL
Sbjct: 181 RKLSSKGEEEENQEPDVTFSVTLRDLLAALNDKYYRDKPYFKTNRLLKAMSKSPRKNMLL 240

Query: 241 GYDQEDAQEFFQNILAELESNVKSLNTEKLDTTPVAKSELPDDALVGQLNLGEVGTVYIP 300
           GYDQEDAQEFFQN+LAELE+N+KSLN+EKLDTTP+AK+ELP DALVGQ NL +VGTVYIP
Sbjct: 241 GYDQEDAQEFFQNLLAELENNIKSLNSEKLDTTPIAKTELPADALVGQNNLEKVGTVYIP 300

Query: 301 TEQIDPNSILHDKSIQNFTPFKLMTPLDGITAERIGCLQCGENGGIRYSVFSGLSLNLPN 360
           TEQIDPNSILHDKSI+NFTP+KL+TPLDGITAERIGCLQCGENGGIRYSVFSGLSLNLPN
Sbjct: 301 TEQIDPNSILHDKSIKNFTPYKLITPLDGITAERIGCLQCGENGGIRYSVFSGLSLNLPN 360

Query: 361 ENIGSTLKLSQLLSDWSKPEIIEGVECNRCALTAAHSHLFGQLKEFEKKPEGSIPEKLIN 420
           ENIG TLKLSQLLSDWSKPEIIEGVECNRCALTAAHSHL GQLKEF KKPEGSIPEKLIN
Sbjct: 361 ENIGCTLKLSQLLSDWSKPEIIEGVECNRCALTAAHSHLLGQLKEFRKKPEGSIPEKLIN 420

Query: 421 AVKDRVHQIEEVLAKPVIDDEDYKKLHTANMVRKCSKSKQILISRPPPLLSIHINRSVFD 480
           AV+DRV QIEEVLAKPVIDDEDY+KLHTANMVRKCSKSKQILISRPPPLLSIHINRSVFD
Sbjct: 421 AVEDRVQQIEEVLAKPVIDDEDYEKLHTANMVRKCSKSKQILISRPPPLLSIHINRSVFD 480

Query: 481 PRTYMIRKNNSKVLFKSRLNLAPWCCDINEINLDARLPMSKKEKAAQQDSSEDENIGGEY 540
           PRTYMIRKNNSKVLFKSRLNLAPWCCDI+EINLDARLPMSKKEKA QQDSSEDENIGGEY
Sbjct: 481 PRTYMIRKNNSKVLFKSRLNLAPWCCDIDEINLDARLPMSKKEKAMQQDSSEDENIGGEY 540

Query: 541 YTKLHXXXXXXXXXXXXXXXXXXXXGNYASHYNHTKDISNYDPLNGEVDGVTSDDEDEYI 600
           Y+KLH                     N ASHYN  +D +NYDPLNGE DG+TSDDEDEYI
Sbjct: 541 YSKLHERFEQEFEDSEEEREYDDGEENQASHYNDNRDTNNYDPLNGEADGLTSDDEDEYI 600

Query: 601 EETDALGNTIKKRIIEHSXXXXXXXXXXX-XLQEID---NVSLDEPKINVEDQLETSSDE 656
           EETDALGNTI+KR IEH+              +E+D   N +  E K+NVED+L++SSDE
Sbjct: 601 EETDALGNTIRKRNIEHANTNEEHEHVVEDNGEEMDNTGNANHSELKVNVEDELDSSSDE 660

Query: 657 EDVIPAPPINYARSFSTVPATPLTYSLRSVIVHYGTHNYGHYIAFRKYRGCWWRISDETV 716
           ED IPAPPINYARSFSTVPATPLTYSLRSVIVHYGTHNYGHYIAFRKYRGCWWRISDETV
Sbjct: 661 EDAIPAPPINYARSFSTVPATPLTYSLRSVIVHYGTHNYGHYIAFRKYRGCWWRISDETV 720

Query: 717 YVVDEAEVLSTPGVFMLFYEYDFDEETGKMKDDLEAIQSN 756
           YVVDEAEVLSTPGVFMLFYEYD+DEETG+MKDDLEAI  N
Sbjct: 721 YVVDEAEVLSTPGVFMLFYEYDYDEETGEMKDDLEAIPIN 760

>Kpol_1003.53 s1003 (121699..124065) [2367 bp, 788 aa] {ON}
           (121699..124065) [2367 nt, 789 aa]
          Length = 788

 Score =  790 bits (2041), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 421/738 (57%), Positives = 503/738 (68%), Gaps = 42/738 (5%)

Query: 38  SIYLLIFGIVVFFYKKPDHLNYIVESVSEMTTNFRNNNSLSRWLPRSKFTHLDEEILKRG 97
           S+ LLI   + F Y K  HL        E  + F NN++  R+LP +  + L+E+IL RG
Sbjct: 34  SLILLILTTIYFIYTKK-HL------FMERLSAFGNNSTFRRFLPGNN-SQLEEKILNRG 85

Query: 98  GFIAGLVNDGNTCFMNSVLQSLASSRELMEFLDNNVIRTYXXXXXXXXXXXXXXX----- 152
           GF+AGLVNDGNTCFMNSVLQSLASS+ L+EFLD+ +I                       
Sbjct: 86  GFVAGLVNDGNTCFMNSVLQSLASSKTLLEFLDSEIILKAEELEEKENNVEVDNEEEKEE 145

Query: 153 --------XSAQDEATHKKNTRXXXXXXXXXXXXLNRXXXXXXXXXXXXXPDITFSVALR 204
                    ++++     K  R                             ++TFS+  +
Sbjct: 146 DDEDKDEESTSEEVEKGTKTARSKTYGKRKKKLARKMDEIALKKDENEQERNVTFSLTFK 205

Query: 205 DLLSALNAKYYRDKPYFKTNSLLKAMSKSPRKNILLGYDQEDAQEFFQNILAELESNVKS 264
           +LL  LN KYYR++ YFKTN LL+ MSK+P KNI+LGYDQEDAQEFFQ+IL ELE NVKS
Sbjct: 206 ELLDKLNFKYYRERHYFKTNKLLRTMSKAPNKNIILGYDQEDAQEFFQSILLELEKNVKS 265

Query: 265 LNTEKLDTTPVAKSELPDDALVGQLNLGEVGTVYIPTEQIDPNSILH-DKSIQNFTPFKL 323
           L  E     PV +SELP++AL+GQ  LGEVGTVYIPT+QIDPNSIL+ D S + +TPFK+
Sbjct: 266 LGDETNKQEPVPESELPENALIGQNKLGEVGTVYIPTDQIDPNSILNSDNSTKFYTPFKM 325

Query: 324 MTPLDGITAERIGCLQCGENGGIRYSVFSGLSLNLPNENIGSTLKLSQLLSDWSKPEIIE 383
           +TPLDGITAERIGCLQCGENGGIRYS+ SG+SLNLP ENIGS LKLSQLL +W KPEIIE
Sbjct: 326 VTPLDGITAERIGCLQCGENGGIRYSISSGISLNLPAENIGSNLKLSQLLKEWIKPEIIE 385

Query: 384 GVECNRCALTAAHSHLFGQLKEFEKKPEGSIPEKLINAVKDRVHQIEEVLAKPVIDDEDY 443
           GVECNRCAL A   HL  QLK+FE K  G+IP+KLI A+ +R+ ++E+ L+KPVIDD+DY
Sbjct: 386 GVECNRCALNAVREHLTDQLKQFEAKESGAIPDKLIKAISERIEKLEQTLSKPVIDDDDY 445

Query: 444 KKLHTANMVRKCSKSKQILISRPPPLLSIHINRSVFDPRTYMIRKNNSKVLFKSRLNLAP 503
           K++HT NMVR+CSKSKQILISRPPPLLSIHINRSVFDPRTYMIRKNNS+VLFKSRLNLAP
Sbjct: 446 KEMHTENMVRRCSKSKQILISRPPPLLSIHINRSVFDPRTYMIRKNNSRVLFKSRLNLAP 505

Query: 504 WCCDINEINLDARLPMSKKEKAAQQDSSEDENIGGEYYTKLHXXXXXXXXXXXXXXXXXX 563
           WCC+I+EINLDARLPMSKK++ A + SSEDEN+GGEYY KLH                  
Sbjct: 506 WCCNIDEINLDARLPMSKKQEFASE-SSEDENVGGEYYAKLHQRFEQEFEDSDEEDEYGE 564

Query: 564 XXGNYASHYNHTKDISNYDPLNGEVD-GVTSDDEDEYIEETDALGNTIKKRIIEHSXXXX 622
               YA      +D+ +YDPLNGE        DE+EYIEE DALGNTI++R +E      
Sbjct: 565 EE--YAD-----RDVKDYDPLNGEFSEDNDDGDEEEYIEEQDALGNTIRRRRVERDTLNE 617

Query: 623 XXXXXXXXLQEIDNVSLDEPKINVED--QLETSSDEEDV---------IPAPPINYARSF 671
                     + ++V  +E K   E+  +L+   ++ DV         I  PP   A S 
Sbjct: 618 DEPLDDEDDDDENDVDYEEEKAVSEEVSELQHGDEKSDVDSEEELDNSISVPPTITAPSA 677

Query: 672 STVPATPLTYSLRSVIVHYGTHNYGHYIAFRKYRGCWWRISDETVYVVDEAEVLSTPGVF 731
           STVP  PLTYSLRSVIVHYGTHNYGHYIAFRKYRGCWWRISDE+V +VDEAEVLSTPGVF
Sbjct: 678 STVPVGPLTYSLRSVIVHYGTHNYGHYIAFRKYRGCWWRISDESVTIVDEAEVLSTPGVF 737

Query: 732 MLFYEYDFDEETGKMKDD 749
           MLFYEYDFDEETG M DD
Sbjct: 738 MLFYEYDFDEETGMMGDD 755

>TDEL0G02370 Chr7 (456393..458636) [2244 bp, 747 aa] {ON} Anc_2.307
           YDL122W
          Length = 747

 Score =  779 bits (2011), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 399/724 (55%), Positives = 496/724 (68%), Gaps = 32/724 (4%)

Query: 37  LSIYLLIFGIVVFFYKKPDHLNYIVESVSEMTTNFRNNNSLSRWLPRSKFTHLDEEILKR 96
           ++  +++     FF K    +   +  + +MT NF   N   RW+PR     +D+  L +
Sbjct: 30  ITTAIILVSTAFFFIKYKSFIMNNLSHIGDMTRNFNPTNGFRRWMPRG--GQVDQHTLDK 87

Query: 97  GGFIAGLVNDGNTCFMNSVLQSLASSRELMEFLDNNVIRTYXXXXXXXXXXXXXXXXSAQ 156
           GG++AGLVNDGNTCFMNSV+QSLASS ELM+FLD+ + +                     
Sbjct: 88  GGYVAGLVNDGNTCFMNSVIQSLASSAELMKFLDDEIAKKEEIDETELLQDEEKPTSVEP 147

Query: 157 DEATHKKNTRXXXXXXXXXXXXLNRXXXXXXXXXXXXXPDITFSVALRDLLSALNAKYYR 216
           D    K   +            L               PD+TFS+ALR++L+ LN KYY+
Sbjct: 148 DTIERKVKGKSYGKAKKHANRKL-----ANGVSDEEKTPDVTFSLALREMLNKLNTKYYK 202

Query: 217 DKPYFKTNSLLKAMSKSPRKNILLGYDQEDAQEFFQNILAELESNVKSLNTEKLDTTPVA 276
           ++P FKTN LLK+M+KSP KNI+LGYDQEDAQEFFQ IL+ELE NVKSL  +  + TP+ 
Sbjct: 203 ERPCFKTNKLLKSMTKSPNKNIILGYDQEDAQEFFQTILSELEKNVKSLEGKPSEATPIP 262

Query: 277 KSELPDDALVGQLNLGEVGTVYIPTEQIDPNSILHDKSIQNFTPFKLMTPLDGITAERIG 336
            +ELP +A++GQ +L +VG VY+P++QIDPN +L ++  Q +TPF+L+TPLDGITAERIG
Sbjct: 263 NAELPKNAVIGQAHLDKVGDVYLPSDQIDPNLVLTNEGKQLYTPFRLVTPLDGITAERIG 322

Query: 337 CLQCGENGGIRYSVFSGLSLNLPNENIGSTLKLSQLLSDWSKPEIIEGVECNRCALTAAH 396
           CLQCGENGGIRYSV S +SLNLP+E+IGSTLKLS LL+ W KPEIIEGV CNRCAL A  
Sbjct: 323 CLQCGENGGIRYSVTSSMSLNLPSEDIGSTLKLSDLLNQWIKPEIIEGVSCNRCALEAVR 382

Query: 397 SHLFGQLKEFEKKPEGSIPEKLINAVKDRVHQIEEVLAKPVIDDEDYKKLHTANMVRKCS 456
            HL  QLK++E K + SIPEKL+ A K RV ++   L+KP++ DEDYK+LHT NM RKCS
Sbjct: 383 DHLLEQLKQYENKGD-SIPEKLLQAFKARVEELNVSLSKPMVSDEDYKRLHTENMTRKCS 441

Query: 457 KSKQILISRPPPLLSIHINRSVFDPRTYMIRKNNSKVLFKSRLNLAPWCCDINEINLDAR 516
           KSKQIL  RPPPLLSIHINRSVFDPRTYMIRKNNS+VLFKSRLNL+PWCCD++EINLDAR
Sbjct: 442 KSKQILFLRPPPLLSIHINRSVFDPRTYMIRKNNSRVLFKSRLNLSPWCCDVDEINLDAR 501

Query: 517 LPMSKKEKAAQQDSSEDENIGGEYYTKLHXXXXXXXXXXXXXXXXXXXXGNYASHYNHTK 576
           LPMSKK++  Q+ SSEDEN+GGEYY KLH                          Y + +
Sbjct: 502 LPMSKKQEQVQE-SSEDENLGGEYYAKLHQTYEKEFEDSDEEVEQD------GDRYVN-R 553

Query: 577 DISNYDPLNGEVDGVT--SDDED------EYIEETDALGNTIKKRIIEHSXXXXXXXXXX 628
           D+S YDPLNGE+D V+  SD+ED      E++EE DALGNT+ K++ +            
Sbjct: 554 DVSEYDPLNGEIDSVSSYSDNEDAHHSSEEFLEEVDALGNTVTKKVAKLQSHFGD----- 608

Query: 629 XXLQEIDNVSLDEPKINVEDQLETSSDEEDVIPAPPINYARSFSTVPATPLTYSLRSVIV 688
              ++   V + E         E+  ++ED I  PP+N A   STVPA PLTY LRSVIV
Sbjct: 609 ---EDGVEVEIKENGAEELSSSESEGEQEDGIMPPPVNTAPIPSTVPAGPLTYVLRSVIV 665

Query: 689 HYGTHNYGHYIAFRKYRGCWWRISDETVYVVDEAEVLSTPGVFMLFYEYDFDEETGKMKD 748
           HYGTHNYGHYIAFRKYRGCWWRISDETVYVV+EAEVLST GVFMLFYEYD+DE TGKM++
Sbjct: 666 HYGTHNYGHYIAFRKYRGCWWRISDETVYVVEEAEVLSTSGVFMLFYEYDYDEATGKMRE 725

Query: 749 DLEA 752
           DLE+
Sbjct: 726 DLES 729

>TPHA0G00850 Chr7 (158945..161293) [2349 bp, 782 aa] {ON} Anc_2.307
           YDL122W
          Length = 782

 Score =  777 bits (2006), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 422/730 (57%), Positives = 510/730 (69%), Gaps = 32/730 (4%)

Query: 38  SIYLLIFGIVVFFYKKPDHLNYIVESVSEMTTNFRNNNSLSRWLPRSKFTHLDEEILKRG 97
           ++  L F  V++      H  YI+ ++S +    RNN++L+R+LP   +  +D+ ILKRG
Sbjct: 31  NVRFLFFTSVIYILYSKRH--YIMNNLSSI----RNNSTLNRFLP--SYNSMDDTILKRG 82

Query: 98  GFIAGLVNDGNTCFMNSVLQSLASSRELMEFLDNNVIRTYXXXXXXXXXXXXXXXXSAQD 157
           G IAGLVNDGNTCFMNSVLQSLASSR L+EFLD  ++ +                   Q 
Sbjct: 83  GHIAGLVNDGNTCFMNSVLQSLASSRTLVEFLDEEIVNSQLKDDETEGENEKEVGEEVQV 142

Query: 158 EATHKKNTRXXXXXXXXXXXXLNRXXXXXXXXXXXXXPDITFSVALRDLLSALNAKYYRD 217
           +   +K  +              +              D+ FS+AL++LL  LN KYYRD
Sbjct: 143 KV--QKLNKNKNGGKRKKKLQKQKDQEDLEKTEESTEKDVAFSIALKELLDKLNFKYYRD 200

Query: 218 KPYFKTNSLLKAMSKSPRKNILLGYDQEDAQEFFQNILAELESNVKSLNTEKLDTTPVAK 277
           KPYFKT+SLLK MSK+P KNI++GYDQEDAQEFFQ+IL+ELE NVKS++  + D  PV +
Sbjct: 201 KPYFKTHSLLKTMSKAPNKNIIMGYDQEDAQEFFQSILSELEKNVKSISPIEKDVKPVPE 260

Query: 278 SELPDDALVGQLNLGEVGTVYIPTEQIDPNSILHDK-SIQNFTPFKLMTPLDGITAERIG 336
           SELPD AL+GQ +LG VGTV+IPTEQIDPNSIL +K S + +TPF+++TPLDGITAERIG
Sbjct: 261 SELPDGALIGQNDLGSVGTVFIPTEQIDPNSILENKDSSKYYTPFRMITPLDGITAERIG 320

Query: 337 CLQCGENGGIRYSVFSGLSLNLPNENIGS-TLKLSQLLSDWSKPEIIEGVECNRCALTAA 395
           CL CGENGGIRYS+ S LSLNLPNENI S  LKLS L+ +W KPEIIEGVECNRCAL A 
Sbjct: 321 CLTCGENGGIRYSISSSLSLNLPNENINSQALKLSNLMQEWIKPEIIEGVECNRCALNAV 380

Query: 396 HSHLFGQLKEFEKKPEGSIPEKLINAVKDRVHQIEEVLAKPVIDDEDYKKLHTANMVRKC 455
             HL  QLK+ ++K  GSIPEKLI+AV++R+  + + L+KPVIDDEDYKK HT NMVRKC
Sbjct: 381 LEHLQDQLKQLQEKSTGSIPEKLISAVEERISILSKTLSKPVIDDEDYKKYHTENMVRKC 440

Query: 456 SKSKQILISRPPPLLSIHINRSVFDPRTYMIRKNNSKVLFKSRLNLAPWCCDINEINLDA 515
           SKSKQILISRPPPLLSIHINRSVFDP TY IRKNNS+VLFKSR NL PWCCDI+EINLDA
Sbjct: 441 SKSKQILISRPPPLLSIHINRSVFDPNTYTIRKNNSRVLFKSRFNLEPWCCDIDEINLDA 500

Query: 516 RLPMSKKEKAAQQDSSEDENIGGEYYTKLHXXXXXXXXXXXXXXXXXXXXGNYASHYNHT 575
           RLPMSKK    Q+ SSEDENIGGEYY KLH                     N +      
Sbjct: 501 RLPMSKKNNLPQE-SSEDENIGGEYYAKLHHKFEQEFEDSDEESYE-----NDSDMQLRG 554

Query: 576 KDISNYDPLNGEVDGVTS-DDEDEYIEETDALGNTIKKRIIEHSXXXXXXXXXXXXLQEI 634
           +D+SNYDPL+GE++   S DD  EYIEETD LGNTI++R+IE               ++ 
Sbjct: 555 RDVSNYDPLHGEIEEDESVDDGAEYIEETDGLGNTIRRRVIEQEQIQKENDIAMESDEDD 614

Query: 635 DNVSLDEPKINVEDQ----------LETSSDEEDVI--PAPPINYAR-SFSTVPATPLTY 681
           ++ + D+ K ++ D            E+S  E D +  PAPP  Y   S STVPA+PLTY
Sbjct: 615 EDYTEDQEKDDIFDNNDPEGEHIVDTESSDVESDRVSLPAPPRQYTSLSSSTVPASPLTY 674

Query: 682 SLRSVIVHYGTHNYGHYIAFRKYRGCWWRISDETVYVVDEAEVLSTPGVFMLFYEYDFDE 741
           SLRSVIVHYGTHNYGHYIAFR+YRGCWWRISDE+VY+V+EAEVLSTPGVFMLFYEYD+D 
Sbjct: 675 SLRSVIVHYGTHNYGHYIAFRRYRGCWWRISDESVYIVEEAEVLSTPGVFMLFYEYDYDV 734

Query: 742 ETGKMKDDLE 751
           ET KM DD+E
Sbjct: 735 ETKKMFDDIE 744

>NCAS0B06130 Chr2 complement(1159264..1161576) [2313 bp, 770 aa]
           {ON} Anc_2.307 YDL122W
          Length = 770

 Score =  771 bits (1990), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 409/711 (57%), Positives = 498/711 (70%), Gaps = 59/711 (8%)

Query: 56  HLNYIVESVSEMTTNFRNNNSLSRWLPRSKFTHLDEEILKRGGFIAGLVNDGNTCFMNSV 115
           +L +I   +S++T  F+NNN   RW+PR+   ++D++ILK+GGF+ GLVNDGNTCFMNSV
Sbjct: 48  NLQFIKYKMSDLTNKFKNNNMFRRWIPRA--GNIDDKILKKGGFVGGLVNDGNTCFMNSV 105

Query: 116 LQSLASSRELMEFLDNNVIRTYXXXXXXXXXXXXXXXXSAQDEATHKKNTRXXXXXXXXX 175
           LQSLASS+EL  FLD+++I+ +                  Q+E    +            
Sbjct: 106 LQSLASSKELNAFLDDSIIKKF----------------QEQEEKIQNEEDPNEKEEEEEK 149

Query: 176 XXXLNRXXXXXXXXXXXXXPDITFSVALRDLLSALNAKYYRDKPYFKTNSLLKAMSKSPR 235
                               D+ FSVA ++LL  LN+KYYRDKPYF+TN LLK MS +P 
Sbjct: 150 DV------------------DVRFSVAFKELLDKLNSKYYRDKPYFRTNKLLKTMSNAPN 191

Query: 236 KNILLGYDQEDAQEFFQNILAELESNVKSLNTEKLDTTPVAKSELPDDALVGQLNLGEVG 295
           KN+LLGYDQEDAQEFFQNIL+ELE NVKSL+ +K D TP+ ++ELPDDA++GQ NLG+VG
Sbjct: 192 KNMLLGYDQEDAQEFFQNILSELEKNVKSLDPKKFDNTPIPENELPDDAIIGQANLGDVG 251

Query: 296 TVYIPTEQIDPNSILH--DKSIQNFTPFKLMTPLDGITAERIGCLQCGENGGIRYSVFSG 353
           TV++PTEQI+PNS+L+  +   + +TPFKL+TPLDGI+AERIGCLQCGENGGIRYSVFSG
Sbjct: 252 TVFLPTEQIEPNSVLNNDENDTKFYTPFKLITPLDGISAERIGCLQCGENGGIRYSVFSG 311

Query: 354 LSLNLPNENIGSTLKLSQLLSDWSKPEIIEGVECNRCALTAAHSHLFGQLKEFEKKPEGS 413
           LSLNLP ENIGSTLKL+ LL +W KPEIIEGVEC RC L A  SHL  QL+++ +   G 
Sbjct: 312 LSLNLPGENIGSTLKLTGLLKEWIKPEIIEGVECYRCGLEAIRSHLLEQLEQYRESNSG- 370

Query: 414 IPEKLINAVKDRVHQIEEVLAKPVIDDEDYKKLHTANMVRKCSKSKQILISRPPPLLSIH 473
           IPEKL+ AV DR+  +E +LAKPVI+DEDYKKLHT NMVRKCSKSKQI+ISRPPPLLSIH
Sbjct: 371 IPEKLLVAVSDRIKVLESILAKPVIEDEDYKKLHTENMVRKCSKSKQIIISRPPPLLSIH 430

Query: 474 INRSVFDPRTYMIRKNNSKVLFKSRLNLAPWCCDINEINLDARLPMSKKEKAAQQDSSED 533
           INRSVFDPRTY IRKNNS+VLFKSRLNL PWCC+ +EINLDARLPMSKKE+ AQ+ SSED
Sbjct: 431 INRSVFDPRTYQIRKNNSRVLFKSRLNLEPWCCNSSEINLDARLPMSKKEQFAQE-SSED 489

Query: 534 ENIGGEYYTKLHXXXXXXXXXXXXXXXXXXXXGNYASHYNHTKDISNYDPLNGEVDGVTS 593
           ENIGGEYY KLH                         +Y+  ++     P   +      
Sbjct: 490 ENIGGEYYAKLHQKFEQEFDDSDEEDEPSSDD--EYDNYSRNREF----PSMEDSSSEDE 543

Query: 594 DDEDEYIEETDALGNTIKKRII--EHSXXXXXXXXXXXXLQEIDNVSLD----------- 640
           ++EDEYIEETDALGNT++KR++  +              L E D  + D           
Sbjct: 544 NEEDEYIEETDALGNTVRKRVVNEQAGMDGTIEERIEGCLNEQDEETQDADIDLRGEKLP 603

Query: 641 EPKINVEDQLETSSDEEDVIPAPPINYARSFSTVPATPLTYSLRSVIVHYGTHNYGHYIA 700
              ++  D+ E   +EE  IP  P++      T PA PLTYSLRSVIVHYGTHNYGHYIA
Sbjct: 604 SSPLSSCDEEENVEEEEPSIPLEPLSTVPPPVTAPAGPLTYSLRSVIVHYGTHNYGHYIA 663

Query: 701 FRKYRGCWWRISDETVYVVDEAEVLSTPGVFMLFYEYDFDEETGKMKDDLE 751
           FRK+RGCWWRISDETVY+VDEAEVLSTPGVFMLFYEYD+DE TGK+KDDL+
Sbjct: 664 FRKFRGCWWRISDETVYIVDEAEVLSTPGVFMLFYEYDYDEATGKLKDDLD 714

>CAGL0H10582g Chr8 complement(1029876..1032248) [2373 bp, 790 aa]
           {ON} similar to uniprot|P25037 Saccharomyces cerevisiae
           YDL122w UBP1 ubiquitin-specific protease
          Length = 790

 Score =  763 bits (1971), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 402/744 (54%), Positives = 501/744 (67%), Gaps = 44/744 (5%)

Query: 40  YLLIFGIVV------FFYKKPDHLNYIVESVSEMTTNFRN--NNSLSRWLPRSK-FTHLD 90
           YL   G+++      F YK  D    I   ++E   N ++  N++L R  P S  F+++D
Sbjct: 28  YLTAIGLIILTYFLLFIYKTGDQ--SIKARMNEFGRNLKDAGNSALRRMAPNSNYFSNID 85

Query: 91  EEILKRGGFIAGLVNDGNTCFMNSVLQSLASSRELMEFLDNNVIRTYXXXXXXXXXXXXX 150
           E+IL+RGG++ GL+NDGN CFMNSV+QSLASS+EL++FLD+ +I  Y             
Sbjct: 86  EQILQRGGYVGGLLNDGNFCFMNSVIQSLASSKELLKFLDDEIIGRYESLEKDLVADEDS 145

Query: 151 XXXSAQDEATHKKNTRXXXXXXXXXXXXLNRXXXXXXXXXXXXXPDITFSVALRDLLSAL 210
              S  +E   KK                NR             PDI F++A ++LL  L
Sbjct: 146 V--SESNEQNGKKQKASNGKVYGKSKKKHNRSVDNGDNDTE---PDIQFTIAFKELLDKL 200

Query: 211 NAKYYRDKPYFKTNSLLKAMSKSPRKNILLGYDQEDAQEFFQNILAELESNVKSLNTEKL 270
           N KYY+++PYFKTNS++  MS SP+K++L+ YDQEDAQEFFQ IL+ELE N+K+L + K 
Sbjct: 201 NYKYYKERPYFKTNSMVNKMSNSPKKSMLMAYDQEDAQEFFQTILSELEKNIKTLESRKD 260

Query: 271 DTTPVAKSELPDDALVGQLNLGEVGTVYIPTEQIDPNSILHDKSIQNFTPFKLMTPLDGI 330
           D TPV    L +D ++GQ +LG +GTVYIP+EQIDPNS     + ++FTPFKL+TPLDGI
Sbjct: 261 DKTPVPAKNLSEDDMIGQAHLGRMGTVYIPSEQIDPNSYTEGSTEKSFTPFKLVTPLDGI 320

Query: 331 TAERIGCLQCGENGGIRYSVFSGLSLNLPNENIGSTLKLSQLLSDWSKPEIIEGVECNRC 390
           TAERIGCLQCGENGGIRYSVFSGLSLNLP+ENIGSTLKLS LL++W KPEIIEGVECNRC
Sbjct: 321 TAERIGCLQCGENGGIRYSVFSGLSLNLPSENIGSTLKLSSLLNEWIKPEIIEGVECNRC 380

Query: 391 ALTAAHSHLFGQLKEFEKKPEGSIPEKLINAVKDRVHQIEEVLAKPVIDDEDYKKLHTAN 450
           AL A   HL  Q+KE +     + P KL++A++ R+ ++EE L KPVIDD+DYKKLHT N
Sbjct: 381 ALEAVREHLLSQMKEIDGS--ANTPAKLVDAMRTRLAELEETLKKPVIDDDDYKKLHTEN 438

Query: 451 MVRKCSKSKQILISRPPPLLSIHINRSVFDPRTYMIRKNNSKVLFKSRLNLAPWCCDINE 510
           MVRKCSKSKQ++ISRPP LLSIHINRSVFDPRTYMIRKNNS+VLFKSR+NL PWCCDI+E
Sbjct: 439 MVRKCSKSKQVVISRPPALLSIHINRSVFDPRTYMIRKNNSRVLFKSRMNLEPWCCDIDE 498

Query: 511 INLDARLPMSKKEKAAQQDSSEDENIGGEYYTKLHXXXXXXXXXXXXXXXXXXXXGNYAS 570
           INLDARLPMSKK+K  +  SSEDENIGG+YY+KLH                         
Sbjct: 499 INLDARLPMSKKQKVVE--SSEDENIGGDYYSKLHQKFEKAFEDEDEEEYDDEDEEYNNG 556

Query: 571 HYNHTKDISNYDPLNGEVDG-VTSDDEDEYIEETDALGNTI--KKRIIEHSXXXXXXXXX 627
            Y  ++++S YDPLNGE+    + +DE    EE DALGNTI  KK +  +          
Sbjct: 557 IY-ESRNVSEYDPLNGELSSDYSEEDEISSDEEVDALGNTIPKKKTVTLNDGSLTEISVA 615

Query: 628 XXXLQEIDNVSLDEPKI----------------NVEDQLETSSDE----EDVIPAPPINY 667
              + + D    +                    + ED     SDE    +D + APPIN 
Sbjct: 616 NGNIVDGDGNEDNSENEDDDDDDDDGDENYTDNDAEDDEAVDSDESNRSQDAVQAPPINL 675

Query: 668 ARSFSTVPATPLTYSLRSVIVHYGTHNYGHYIAFRKYRGCWWRISDETVYVVDEAEVLST 727
           A  +STV  +PLTY+LRSVIVHYGTHNYGHYIA+RK+RG WWRISDE+VYVVDEAEVLST
Sbjct: 676 APRYSTVNPSPLTYALRSVIVHYGTHNYGHYIAYRKFRGVWWRISDESVYVVDEAEVLST 735

Query: 728 PGVFMLFYEYDFDEETGKMKDDLE 751
           PGVFMLFYEYD+DE+TG+MKDD+E
Sbjct: 736 PGVFMLFYEYDYDEKTGRMKDDIE 759

>SAKL0E07106g Chr5 complement(584164..586539) [2376 bp, 791 aa] {ON}
           similar to uniprot|P25037 Saccharomyces cerevisiae
           YDL122W UBP1 Ubiquitin-specific protease that removes
           ubiquitin from ubiquitinated proteins cleaves at the C
           terminus of ubiquitin fusions irrespective of their size
           capable of cleaving polyubiquitin chains
          Length = 791

 Score =  744 bits (1920), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 405/778 (52%), Positives = 513/778 (65%), Gaps = 72/778 (9%)

Query: 27  FKTWSXXXXXLSIYLLIFGIVVFFYKKPDHLNYIVESVS----EMTTNFRNN-----NSL 77
            + +S      ++ +LI   ++ F KK   ++ ++E++S    E+T  FR++     N L
Sbjct: 20  LEKFSDKNKTATVLVLIVSTLLLF-KKKKFVHQLMENLSKAGGELTRGFRSSYYSRANML 78

Query: 78  SRWLPRSKFTHLDEEILKRGGFIAGLVNDGNTCFMNSVLQSLASSRELMEFLDNNVIRTY 137
             W  R   +  +E +LK+GG++ GLVNDGNTCFMNSVLQSLASS++L+EFLD  ++   
Sbjct: 79  GGWGQRR--SEQEERVLKKGGYVGGLVNDGNTCFMNSVLQSLASSQQLLEFLDEEIVERS 136

Query: 138 XXXXXXXXXXXXXXXXSA------------QDEATHKKNTRXXXXXXXXXXXXLNRXXXX 185
                           SA             +E +  K                      
Sbjct: 137 QDDEEPEEFEVEGGRRSADNADGLDGGLEKMEEESKPKVKGKSYGKRKKKQTRDAEARVL 196

Query: 186 XXXXXXXXXPDITFSVALRDLLSALNAKYYRDKPYFKTNSLLKAMSKSPRKNILLGYDQE 245
                     D+ FS+ L++L   LNAK+Y ++PYFKTN LLK MSK+P KNI+LGYDQE
Sbjct: 197 SEKAEEEEEADVQFSITLKELFDKLNAKHYSERPYFKTNRLLKTMSKAPNKNIILGYDQE 256

Query: 246 DAQEFFQNILAELESNVKSLNTEKLDT-TPVAKSELPDDALVGQLNLGEVGTVYIPTEQI 304
           DAQEFFQ IL+ELE NVKS+ T+K ++ TP+ ++ELP DAL+GQ +L ++GTVYIPTEQI
Sbjct: 257 DAQEFFQTILSELEKNVKSIKTKKKESKTPIPETELPADALIGQQHLDKIGTVYIPTEQI 316

Query: 305 DPNSILHDKSIQNFTPFKLMTPLDGITAERIGCLQCGENGGIRYSVFSGLSLNLPNENIG 364
           DPN++L++  ++ +TPF+ +TPLDGITAERIGCL CGENGGIRYSVFSGLSLNLP+ENIG
Sbjct: 317 DPNTVLNNSELKTYTPFQQVTPLDGITAERIGCLNCGENGGIRYSVFSGLSLNLPSENIG 376

Query: 365 STLKLSQLLSDWSKPEIIEGVECNRCALTAAHSHLFGQLKEFEKKPEGSIPEKLINAVKD 424
           STLKLS L+++W+KPEIIEGVECNRCAL A   HL   L  +E+   G+IPEKL+ AV+ 
Sbjct: 377 STLKLSGLMNEWAKPEIIEGVECNRCALNAVRDHLQQSLSSYEQA--GNIPEKLVAAVQK 434

Query: 425 RVHQIEEVLAKPVIDDEDYKKLHTANMVRKCSKSKQILISRPPPLLSIHINRSVFDPRTY 484
           R++ + E+L KPVIDDEDYKKLHT NMVRKCSKSKQILISRPPPLLS+HINRSVFDPRT+
Sbjct: 435 RLNLLNEILNKPVIDDEDYKKLHTVNMVRKCSKSKQILISRPPPLLSVHINRSVFDPRTF 494

Query: 485 MIRKNNSKVLFKSRLNLAPWCCDINEINLDARLPMSKKEKAAQQDSSEDENIGGEYYTKL 544
            IRKNNS+VLFK R NLAPWCC+I+EINLDARLPMSKK++A Q+ SSEDE IGGEY+ KL
Sbjct: 495 SIRKNNSRVLFKPRFNLAPWCCNIDEINLDARLPMSKKQEAPQE-SSEDEAIGGEYFAKL 553

Query: 545 HXXXXXXXXXXXXXXXXXXXXGNYASHYNHTKDISNYDPLNGEVDGVTSD-------DED 597
           H                        ++YN  +D+S+YDPL GE+  +TS        D  
Sbjct: 554 HRKFQEEFEDSDSEDDEGRD-----TYYNK-RDVSDYDPLKGEI--LTSSEDEEELEDGG 605

Query: 598 EYIEETDALGNTI-KKRIIEHSXXXXXXXXXXXXLQEI---------------------- 634
           E + E D+LGN I K++ ++ +            ++EI                      
Sbjct: 606 EDVVEVDSLGNIIPKQKPVQETQEDENGYAVKEEIEEIDEEEGDDDDDDDDDIGEEDYAD 665

Query: 635 DNVSLDEPKINVEDQLETSSDEE-DVIPAPPINYARSFSTVPATPLTYSLRSVIVHYGTH 693
           D     E K     Q++  +DE  DV P  P +Y     TVPA PLTYSLRSVIVHYGTH
Sbjct: 666 DRKHEGEEKEQNGAQIDGDNDERLDVPPPIPSSY-----TVPACPLTYSLRSVIVHYGTH 720

Query: 694 NYGHYIAFRKYRGCWWRISDETVYVVDEAEVLSTPGVFMLFYEYDFDEETGKMKDDLE 751
           NYGHYIAFRK+RG WWRISDETVY+VDEAEVLSTPGVFMLFYEYD+DE+TGK+KDDL+
Sbjct: 721 NYGHYIAFRKHRGFWWRISDETVYIVDEAEVLSTPGVFMLFYEYDYDEQTGKLKDDLQ 778

>KLTH0G10934g Chr7 (919304..921580) [2277 bp, 758 aa] {ON} similar
           to uniprot|P25037 Saccharomyces cerevisiae YDL122W UBP1
           Ubiquitin-specific protease that removes ubiquitin from
           ubiquitinated proteins cleaves at the C terminus of
           ubiquitin fusions irrespective of their size capable of
           cleaving polyubiquitin chains
          Length = 758

 Score =  742 bits (1915), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 408/767 (53%), Positives = 509/767 (66%), Gaps = 55/767 (7%)

Query: 13  LQFLFGSRQDFLRNFKTWSXXXXXLSIYLLIFGIVVFFYKKPDHLNYIVESVS----EMT 68
           L  LF +   F+RN          L + +   GI++  YK       I+E++     ++T
Sbjct: 8   LSALFSTLSIFVRNLSHIDNKSSTLIVLIASTGILL--YKNKRIFRNIMENIGTVGGDLT 65

Query: 69  TNFRNN---NSLSRWLPRSKFTHLDEEILKRGGFIAGLVNDGNTCFMNSVLQSLASSREL 125
            +FRNN   +  ++W   SK    +  +LKRGG++ GLVNDGNTCFMNSVLQSLASS+ L
Sbjct: 66  RSFRNNYKGSMFNKW--GSKDPEQEAAMLKRGGYVGGLVNDGNTCFMNSVLQSLASSKTL 123

Query: 126 MEFLDNNVIRTYXXXXXXXXXXXXXXXXSAQDEATHKKNTRXXXXXXXXXXXXLNRXXXX 185
           ++FLDN VI+ Y                 ++ + +  K T+            L R    
Sbjct: 124 LQFLDNEVIQAYKEAEESEDEHVAEKEFESEKKLSESK-TKPKKKVYGKRKKRLTRNAEK 182

Query: 186 XXXXXXXXXPDITFSVALRDLLSALNAKYYRDKPYFKTNSLLKAMSKSPRKNILLGYDQE 245
                     +I FS  L++LL+ LNAK+YRD+PYFKTN LLK MSK+P K+I+LGYDQE
Sbjct: 183 DALDDDQDA-NIEFSTTLKELLNKLNAKHYRDRPYFKTNKLLKTMSKAPNKSIILGYDQE 241

Query: 246 DAQEFFQNILAELESNVKSL--NTEKLDTTPVAKSELPDDALVGQLNLGEVGTVYIPTEQ 303
           DAQEFFQ IL+ELE NVKSL   + K +  PV   +LP+D++VGQ  LGE+GTVYIPTEQ
Sbjct: 242 DAQEFFQTILSELEKNVKSLYGKSSKDEEAPVQFDQLPEDSMVGQERLGEMGTVYIPTEQ 301

Query: 304 IDPNSILHDKSIQNFTPFKLMTPLDGITAERIGCLQCGENGGIRYSVFSGLSLNLPNENI 363
           IDPN +L  ++   ++PFKL+TPLDG+TAERIGCLQCGENGGIRYSVFSGLSLNLP+EN+
Sbjct: 302 IDPNCVLAHENKSLYSPFKLITPLDGLTAERIGCLQCGENGGIRYSVFSGLSLNLPSENL 361

Query: 364 GSTLKLSQLLSDWSKPEIIEGVECNRCALTAAHSHLFGQLKEFEKKPEGSIPEKLINAVK 423
           GSTLKLS+LL +W KPEIIEGVECNRCAL A   HL   L ++E     S  EKL+ AVK
Sbjct: 362 GSTLKLSELLREWIKPEIIEGVECNRCALNAVLEHLEKTLIQYEGSEHSS--EKLVAAVK 419

Query: 424 DRVHQIEEVLAKPVIDDEDYKKLHTANMVRKCSKSKQILISRPPPLLSIHINRSVFDPRT 483
            RV Q++++LAKP IDD+DYKKLHT NMVRKCSKSKQI+ISRPPPLL IHINRSVFDPRT
Sbjct: 420 ARVEQLKDILAKPAIDDDDYKKLHTENMVRKCSKSKQIIISRPPPLLCIHINRSVFDPRT 479

Query: 484 YMIRKNNSKVLFKSRLNLAPWCCDINEINLDARLPMSKKEKAAQQDSSEDENIGGEYYTK 543
           YMIRKNNS+VLFKS+LNLAPWCC  +EINLDARLPMSKKE+ + + SSEDEN+GGEY+ K
Sbjct: 480 YMIRKNNSRVLFKSKLNLAPWCCAPDEINLDARLPMSKKEQKSLE-SSEDENVGGEYFAK 538

Query: 544 LHXXXXXXXXXXXXXXXXXXXXGNYASHYNHTKDISNYDPLNG----EVDGVTSDDEDEY 599
           LH                    GN+ +     +D+S+YDPL G      D   S  + EY
Sbjct: 539 LH------RHFEEEFEDSEEEEGNFEA---SNRDVSDYDPLRGEIESSSDENESSSDGEY 589

Query: 600 IEETDALGNTIKKRIIEHSXXXXXXXXXXXXLQEIDNVSLD-----------EPK-INVE 647
             E DALGN    R+ + +              + +  SL+           EP+ ++ E
Sbjct: 590 --EVDALGN----RVFKQNGAQTEQELVDGTSADPEVASLEGSDAAERLDGIEPETLDNE 643

Query: 648 DQLETSSDEEDVIPAPP----INYARSFSTVPATPLTYSLRSVIVHYGTHNYGHYIAFRK 703
           D+ ++ SD E  +  PP    +++A S STVP  PLTY+LRSVIVHYGTHNYGHYIAFRK
Sbjct: 644 DEEDSESDHE--VKQPPSLSSLHHAPSSSTVPVGPLTYALRSVIVHYGTHNYGHYIAFRK 701

Query: 704 YRGCWWRISDETVYVVDEAEVLSTPGVFMLFYEYDFDEETGKMKDDL 750
           +RG WWRISDETVYVVDEAEVLSTPG+FMLFYE+D++E    M DDL
Sbjct: 702 FRGLWWRISDETVYVVDEAEVLSTPGIFMLFYEHDYNESLHAMNDDL 748

>ZYRO0A02420g Chr1 (190417..192654) [2238 bp, 745 aa] {ON} similar
           to uniprot|P25037 Saccharomyces cerevisiae YDL122W UBP1
           Ubiquitin-specific protease that removes ubiquitin from
           ubiquitinated proteins cleaves at the C terminus of
           ubiquitin fusions irrespective of their size capable of
           cleaving polyubiquitin chains
          Length = 745

 Score =  734 bits (1896), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 385/736 (52%), Positives = 482/736 (65%), Gaps = 63/736 (8%)

Query: 37  LSIYLLIFGIVVFFYKKPDHLNYIVESVSEMTTNFRNNNSLSRWLPRSKFTHLDEEILKR 96
           +++ ++I      F K   H + + +    MT+     +   RW+PRS    ++ E+LKR
Sbjct: 27  IALGIVILSTAFLFLKSKKHNSNVGDIARGMTSK----SGFRRWMPRS--GQMENEVLKR 80

Query: 97  GGFIAGLVNDGNTCFMNSVLQSLASSRELMEFLDNNVIRTYXXXXXXXXXXXXXXXXSAQ 156
           GG I GLVNDGNTCFMN VLQS+ASS+EL++FLD  +                    S  
Sbjct: 81  GGNIGGLVNDGNTCFMNCVLQSMASSKELLKFLDEEI----------ACKAKLDEDQSNG 130

Query: 157 DEATHKK--NTRXXXXXXXXXXXXLNRXXXXXXXXXXXXXPDITFSVALRDLLSALNAKY 214
           D+  ++K  NT               +             PD+TFS AL++LL  LNAKY
Sbjct: 131 DDVNNEKPHNTSKQ-----------QQKREEEAKSEGETVPDVTFSAALKELLDKLNAKY 179

Query: 215 YRDKPYFKTNSLLKAMSKSPRKNILLGYDQEDAQEFFQNILAELESNVKSLNTEKLDTTP 274
           YRD+PYFK N LLK+MSK+P KNILLGYDQEDAQEFFQ +L+ELE N KSL+   +D   
Sbjct: 180 YRDRPYFKANKLLKSMSKAPNKNILLGYDQEDAQEFFQTMLSELEKNAKSLDNTTIDKHA 239

Query: 275 VAKSELPDDALVGQLNLGEVGTVYIPTEQIDPNSILHDKSIQNFTPFKLMTPLDGITAER 334
           + + +LP+ A++GQ  L  VG VYIPTEQ+ PN I      + FT FKL+TPLDGI AER
Sbjct: 240 ILEKDLPETAVIGQARLDHVGAVYIPTEQVTPNLIPPGSKEKYFTKFKLITPLDGILAER 299

Query: 335 IGCLQCGENGGIRYSVFSGLSLNLPNENIGSTLKLSQLLSDWSKPEIIEGVECNRCALTA 394
           IGCLQCGE GGIRYSV SGLSLNLP++N+GS+LKLS LL D+ KPEIIEGVECNRCAL A
Sbjct: 300 IGCLQCGETGGIRYSVSSGLSLNLPSDNMGSSLKLSDLLKDYIKPEIIEGVECNRCALIA 359

Query: 395 AHSHLFGQLKEFEKKPEGSIPEKLINAVKDRVHQIEEVLAKPVIDDEDYKKLHTANMVRK 454
              HL  QL+++E K   +IP KL  A + R+ ++E+VL+KPVIDDE+YKKLHT NMVRK
Sbjct: 360 VRDHLKEQLQQYEDKKANAIPAKLCQAFQSRIQELEKVLSKPVIDDEEYKKLHTENMVRK 419

Query: 455 CSKSKQILISRPPPLLSIHINRSVFDPRTYMIRKNNSKVLFKSRLNLAPWCCDINEINLD 514
            SKSKQ+LISRPPPLL+IHINRSVFDPRT+MIRKNN++VLFKSRLNL+PWCCDI+EIN+D
Sbjct: 420 SSKSKQVLISRPPPLLAIHINRSVFDPRTFMIRKNNARVLFKSRLNLSPWCCDIDEINMD 479

Query: 515 ARLPMSKKEKAAQQDSSEDENIGGEYYTKLHXXXXXXXXXXXXXXXXXXXXGNYASHYNH 574
           AR+PMS+KE+    DSSEDEN+GGE+YTKLH                     +       
Sbjct: 480 ARMPMSQKEEVI-MDSSEDENVGGEFYTKLHQKYEREFEDSDEDSDQPIGSSD------- 531

Query: 575 TKDISNYDPLNGEVDGVTS------DDEDEYIEETDALGNTIKK-----------RIIEH 617
            K +SNYDPL G+ + ++S       +E +YIE+TDALGNTI++            + E+
Sbjct: 532 DKLVSNYDPLGGDGNSLSSYSDEEESNESDYIEKTDALGNTIREPRARANDKVEVAVREN 591

Query: 618 SXXXXXXXXXXXXL---QEIDNVSLDEPKINVEDQLETSSDEEDVIPAP-PINYARSFST 673
           +                QE+D    DE     ++      DE +    P P  +     +
Sbjct: 592 ASGASSSEEEEEPEDKNQEMDGDDEDERASAPQNTESEGEDEGEATNGPLPSKF-----S 646

Query: 674 VPATPLTYSLRSVIVHYGTHNYGHYIAFRKYRGCWWRISDETVYVVDEAEVLSTPGVFML 733
           VPATPLTYSLRSV+VHYGTHNYGHYIAFR+YRG WWRISDETVY+VDE EVLSTPGVFML
Sbjct: 647 VPATPLTYSLRSVVVHYGTHNYGHYIAFRRYRGYWWRISDETVYIVDETEVLSTPGVFML 706

Query: 734 FYEYDFDEETGKMKDD 749
           FYEYD+DE TG+ K +
Sbjct: 707 FYEYDYDESTGQTKQE 722

>Kwal_27.11444 s27 complement(802766..805039) [2274 bp, 757 aa] {ON}
           YDL122W (UBP1) - Ubiquitin-specific protease [contig 27]
           FULL
          Length = 757

 Score =  711 bits (1836), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 384/736 (52%), Positives = 480/736 (65%), Gaps = 39/736 (5%)

Query: 38  SIYLLIFGIVVFFYKKPDHLNYIVESVS----EMTTNFRNN---NSLSRWLPRSKFTHLD 90
           +  +++    +  YK   ++  I++++     ++T  FRN+   +  ++W  R+     +
Sbjct: 30  TFLVIVASTGLLIYKNRRYIRNIMDALGTVGGDLTRGFRNSYKGSVFNKWGSRNPAQ--E 87

Query: 91  EEILKRGGFIAGLVNDGNTCFMNSVLQSLASSRELMEFLDNNVIRTYXXXXXXXXXXXXX 150
             +LKRGG++ GL+NDGNTCFMNSV+QSLASS+ LM+FLD  ++                
Sbjct: 88  ATMLKRGGYVGGLINDGNTCFMNSVIQSLASSKSLMQFLDEELMEASKELENPNETSSAV 147

Query: 151 XXXSAQDEATHKKNTRXXXXXXXXXXXXLNRXXXXXXXXXXXXXPDITFSVALRDLLSAL 210
                    +  +N              L R              ++ FS AL++LL  L
Sbjct: 148 EEEGNLGSNSELRNRSSSKKTYGKRKKRLTRNAEKDAALEDEGV-NMEFSAALKELLEKL 206

Query: 211 NAKYYRDKPYFKTNSLLKAMSKSPRKNILLGYDQEDAQEFFQNILAELESNVKSLNTEK- 269
           N KY+RDKPYFKTN LLK MSK+P KNI+LGYDQEDAQEFFQ IL+ELE N+KSL  +  
Sbjct: 207 NDKYHRDKPYFKTNKLLKTMSKAPNKNIILGYDQEDAQEFFQTILSELEKNIKSLRGKSD 266

Query: 270 LDTTPVAKSELPDDALVGQLNLGEVGTVYIPTEQIDPNSILHDKSIQNFTPFKLMTPLDG 329
            D  P   +++P +A++GQ  LGE+GTVY+P EQIDPN +L  ++ Q F PF L+TPLDG
Sbjct: 267 KDNEPTELADIPKNAMIGQERLGEMGTVYLPAEQIDPNCVLGHEAKQLFFPFDLVTPLDG 326

Query: 330 ITAERIGCLQCGENGGIRYSVFSGLSLNLPNENIGSTLKLSQLLSDWSKPEIIEGVECNR 389
           ITAERIGCLQCGENGGIRYSVFSGLSLNLP++ +GS LKLSQLL +W KPEIIEGVECNR
Sbjct: 327 ITAERIGCLQCGENGGIRYSVFSGLSLNLPSDTVGSALKLSQLLREWVKPEIIEGVECNR 386

Query: 390 CALTAAHSHLFGQLKEFEKKPEGSIPEKLINAVKDRVHQIEEVLAKPVIDDEDYKKLHTA 449
           CAL A   HL   L ++E   +  + EKL++AV  RV +++ +LAKPV+DD+DYKKLHT 
Sbjct: 387 CALKAVLEHLEKTLTQYEINDK--VSEKLVSAVSSRVEELKAILAKPVVDDDDYKKLHTE 444

Query: 450 NMVRKCSKSKQILISRPPPLLSIHINRSVFDPRTYMIRKNNSKVLFKSRLNLAPWCCDIN 509
           NMVRKCSKSKQILISRPPPLLSIHINRSVFDPRTY IRKNNSKVLFKSRLNLAPW C  +
Sbjct: 445 NMVRKCSKSKQILISRPPPLLSIHINRSVFDPRTYTIRKNNSKVLFKSRLNLAPWSCGPD 504

Query: 510 EINLDARLPMSKKEKAAQQDSSEDENIGGEYYTKLHXXXXXXXXXXXXXXXXXXXXGNYA 569
           EINLDARLPMSKK++ A + SSEDENIGGEY+ KLH                     NY+
Sbjct: 505 EINLDARLPMSKKDQRAME-SSEDENIGGEYFAKLHRRFEEEFEDSDEESD------NYS 557

Query: 570 SHYNHTKDISNYDPLNGEVDGVTSDDEDEYIE---ETDALGNTIKK----------RIIE 616
                  D   YDPL GE+D  +S ++DEY E   E D+LGN + K            +E
Sbjct: 558 EKNRLNSD---YDPLKGELD--SSSEDDEYSEGEYEIDSLGNRVFKCKNIQSDSDVNSVE 612

Query: 617 HSXXXXXXXXXXXXLQEI-DNVSLDEPKINVEDQLETSSDEEDVIPAPPINYARSFSTVP 675
            +             +EI   V  +     VE + E  +   ++ P      A S STVP
Sbjct: 613 EASEEDKPDTNDLENREITGGVGQENSDSEVESEDEVETQPTELNPLSAGQLAPSSSTVP 672

Query: 676 ATPLTYSLRSVIVHYGTHNYGHYIAFRKYRGCWWRISDETVYVVDEAEVLSTPGVFMLFY 735
           + PLTY+LRSVIVHYG+HNYGHYIAFRK+RG WWRISDETVYVVDEAEVLSTPGVFMLFY
Sbjct: 673 SGPLTYALRSVIVHYGSHNYGHYIAFRKFRGLWWRISDETVYVVDEAEVLSTPGVFMLFY 732

Query: 736 EYDFDEETGKMKDDLE 751
           E+D+++   KM DDLE
Sbjct: 733 EHDYNQTLQKMNDDLE 748

>AGR389C Chr7 complement(1444377..1446704) [2328 bp, 775 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDL122W
           (UBP1)
          Length = 775

 Score =  711 bits (1836), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 379/734 (51%), Positives = 472/734 (64%), Gaps = 53/734 (7%)

Query: 51  YKKPDHLNYIVESVSEMTTNFRNN---NSLSRWLPRSKFTHLDEEILKRGGFIAGLVNDG 107
           YK+   +  I++ + ++  NF  +     L RW P+S    L+++  + GG + GLVNDG
Sbjct: 37  YKQRKQVGNIMDGIGQVAGNFTRDFRHRMLGRWAPQS--AELEKQAHQHGGNVGGLVNDG 94

Query: 108 NTCFMNSVLQSLASSRELMEFLDNNVIRTYXXXXXXXXXXXXXXXXSAQD--EATHKKNT 165
           NTCF+NSV+QSLASSREL+ FLD  +I                   SA D       + +
Sbjct: 95  NTCFINSVIQSLASSRELLRFLDEEIIDA----------SQPGTDESADDVQNGDEDEGS 144

Query: 166 RXXXXXXXXXXXXLNRXXXXXXXXXXXXXPDITFSVALRDLLSALNAKYYRDKPYFKTNS 225
                                        P   FS ALR+L+  LN K+YR+KPYF+T+ 
Sbjct: 145 SSAKKKAYGKRKKKQARAADAVALAKADGPRTDFSAALRELIDNLNGKHYRNKPYFRTSG 204

Query: 226 LLKAMSKSPRKNILLGYDQEDAQEFFQNILAELESNVKSLNTE-KLDTTPVAKSELPDDA 284
           LLK MSK+P KNI+LGYDQEDAQEFFQ IL+ELE +V+S+  + + +  PV K ELP DA
Sbjct: 205 LLKTMSKAPNKNIILGYDQEDAQEFFQTILSELEKDVQSIQGKPEKNAKPVPKEELPGDA 264

Query: 285 LVGQLNLGEVGTVYIPTEQIDPNSILHDKSIQNFTPFKLMTPLDGITAERIGCLQCGENG 344
           ++G  ++G +GTVYIPTEQI PNS+L+D   + +TPFKL+TP DGITAER+GCLQCGENG
Sbjct: 265 IIGSEHIGRIGTVYIPTEQIAPNSVLNDPE-RYYTPFKLLTPFDGITAERVGCLQCGENG 323

Query: 345 GIRYSVFSGLSLNLPNENIGSTLKLSQLLSDWSKPEIIEGVECNRCALTAAHSHLFGQLK 404
           GIRY +FS LSLNLPN+N  STLKLS+LL +W KPEIIEGVECNRCAL A H+HL  ++K
Sbjct: 324 GIRYCLFSSLSLNLPNDNTSSTLKLSELLREWVKPEIIEGVECNRCALQAVHAHLAAKVK 383

Query: 405 EFEK-KPEGSIPEKLINAVKDRVHQIEEVLAKPVIDDEDYKKLHTANMVRKCSKSKQILI 463
           E +  + E ++  KLI+ +K R+ Q+E +LAKP IDDEDYKKLHT NMVRKCSKSKQ LI
Sbjct: 384 ELQAAEDEKAMSAKLISLMKARLEQLEGILAKPAIDDEDYKKLHTDNMVRKCSKSKQTLI 443

Query: 464 SRPPPLLSIHINRSVFDPRTYMIRKNNSKVLFKSRLNLAPWCCDINEINLDARLPMSKKE 523
           +RPPPLLSIHINRSVFDPRT+MIRKNNSKVLFKSRLNLAPWCC ++E+NLDARLPMSKK+
Sbjct: 444 TRPPPLLSIHINRSVFDPRTFMIRKNNSKVLFKSRLNLAPWCCGVDEVNLDARLPMSKKD 503

Query: 524 KAAQQDSSEDENIGGEYYTKLHXXXXXXXXXXXXXXXXXXXXGNYASHYNHTKDISNYDP 583
            A  ++SSEDE  G EYY KLH                    G ++S Y    D+ NYDP
Sbjct: 504 AAELEESSEDEPQGTEYYNKLHLRFQAEYEDEDDLDKGPNPSGPHSS-YRAVADVPNYDP 562

Query: 584 LNGEVDGVTSDDEDEYIEETDALGNTIKK---------------------RIIEHSXXXX 622
           L GE    + ++ +    E DALGNTI K                      I+E      
Sbjct: 563 LAGEYSSSSEEEHERESIELDALGNTIPKNGPASLEELSSDEDLATKPRAEILEKPDNDE 622

Query: 623 XXXXXXXXLQEIDNVSLDEPKINVEDQLETSSDEEDVIPAPPINYARSF--STVPATPLT 680
                     +  +     P        ++ S+  D  P  P  +A     S+V A+PLT
Sbjct: 623 DEEPSDDEDADDYDSDSPRPG-------DSGSELRD--PPAPATFATELHGSSVLASPLT 673

Query: 681 YSLRSVIVHYGTHNYGHYIAFRKYRGCWWRISDETVYVVDEAEVLSTPGVFMLFYEYDFD 740
           YSLRSVIVHYGTHNYGHYIAFRK+RG WWRISDET Y+VDEAEVLSTPGVFMLFYEYD+D
Sbjct: 674 YSLRSVIVHYGTHNYGHYIAFRKFRGVWWRISDETAYIVDEAEVLSTPGVFMLFYEYDYD 733

Query: 741 EETGKMKDDLEAIQ 754
           E TG+++DDL  +Q
Sbjct: 734 EATGQLRDDLGCLQ 747

>KNAG0A05450 Chr1 (806796..809090) [2295 bp, 764 aa] {ON} Anc_2.307
           YDL122W
          Length = 764

 Score =  669 bits (1725), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 387/763 (50%), Positives = 474/763 (62%), Gaps = 119/763 (15%)

Query: 38  SIYLLIFGIVVFFYKKPDHLNYIVESVSEMTTNF--RNNNSLSRWLPRSKFTHLDEEILK 95
           SI++L   +V+FF+        +    S   T F  +  N   R         +D+ ILK
Sbjct: 8   SIFILFLSVVLFFF-------LLHTPTSSKITRFVLKMVNQAKRMTSYYSAPSMDDVILK 60

Query: 96  RGGFIAGLVNDGNTCFMNSVLQSLASSRELMEFLDNNVIRTYXXXXXXXXXXXXXXXXSA 155
           RGGF+AGLVNDGNTCFMNSVLQSLASSREL  FLD+ +                      
Sbjct: 61  RGGFVAGLVNDGNTCFMNSVLQSLASSRELAHFLDDII---------------------- 98

Query: 156 QDEATHKKNTRXXXXXXXXXXXXLNRXXXXXXXXXXXXXPDITFSVALRDLLSALNAKYY 215
            +E+   KN                               ++ FSVA + LL  LNAKY 
Sbjct: 99  -EESEPNKN-------------------------------ELNFSVAFKTLLDKLNAKYG 126

Query: 216 RDKPYFKTNSLLKAMSKSPRKNILLGYDQEDAQEFFQNILAELESNVKSLNTE------- 268
           R++ Y++ N+LLK M   P KNILLGYDQEDAQEFFQ I+++LE ++K  +T+       
Sbjct: 127 RNRKYYRPNALLKTMESGPNKNILLGYDQEDAQEFFQQIISQLEKDLKKEDTDGDFKKEE 186

Query: 269 ------KLDTTPVAKSELPDDALVGQLNLGEVGTVYIPTEQIDPNSILHDKSIQNF-TPF 321
                 + D TP+ +S+LP DAL+ Q NL +VGTVYIPTEQ++PN  L     ++F TP+
Sbjct: 187 SVQPSSEDDKTPILESDLPADALLNQENLEKVGTVYIPTEQVEPNFALGKGEHESFYTPY 246

Query: 322 KLMTPLDGITAERIGCLQCGENGGIRYSVFSGLSLNLPNENIGSTLKLSQLLSDWSKPEI 381
           KL+TPLDGI AERIGCL CGENGGIRYSV SGLSLNLPNENIG+TLKLS+LL  W +PEI
Sbjct: 247 KLLTPLDGIIAERIGCLNCGENGGIRYSVSSGLSLNLPNENIGATLKLSELLDKWVEPEI 306

Query: 382 IEGVECNRCALTAAHSHLFGQLKEFEKKPEGSIPEKLINAVKDRVHQIEEVLAKPVIDDE 441
           IEGV+CNRCAL A  SHL  QL+ FEK  E + P KLI+A+K+RV  +EE L KP IDDE
Sbjct: 307 IEGVDCNRCALEAVRSHLLEQLEGFEKN-EKAPPAKLIDAMKERVKVLEETLLKPAIDDE 365

Query: 442 DYKKLHTANMVRKCSKSKQILISRPPPLLSIHINRSVFDPRTYMIRKNNSKVLFKSRLNL 501
           DYKKLHT NMVRKCSKSKQ++ISRPPPLLSIHINRSVFDPRTYMI KN S+VLFKS+LNL
Sbjct: 366 DYKKLHTDNMVRKCSKSKQVVISRPPPLLSIHINRSVFDPRTYMICKNGSRVLFKSKLNL 425

Query: 502 APWCCDINEINLDARLPMSKKEKAAQQDSSEDENIGGEYYTKLHXXXXXXXXXXXXXXXX 561
             WCC   EINLDARLPMSKK+K + +DSSE+E     Y++KLH                
Sbjct: 426 DQWCCSPLEINLDARLPMSKKQKRS-RDSSEEEEEELAYFSKLHQRFQREFEDSSED--- 481

Query: 562 XXXXGNYASHYNHTKDISNYDPLNGE-------VDGVTSDDEDEYIEETDALGNTIKKRI 614
                         K++ +YDPL G+        D  +  +++EYIEETDALGN++++++
Sbjct: 482 -------EEPIRTDKNVKDYDPLGGQYDSDDSSSDFSSQKEDEEYIEETDALGNSVRRKV 534

Query: 615 IEHSXXXXXXXXXXXXLQEIDN--------------VSLDEPKINVEDQLETSSDEEDVI 660
           +               L +  N                 DE     E++ E   +EE V 
Sbjct: 535 VREEDGDGENTVSKNLLLDPGNGRGVSGGNKDFEEEEEDDEAGNEGEEEDEAEKEEEVVE 594

Query: 661 PAPPINYARS----FSTV-----PATPLTYSLRSVIVHYGTHNYGHYIAFRKYRGCWWRI 711
           P P   Y R+    F  V     PATPLTYSLRSVIVHYGTHNYGHYIAFRKYRGCWWRI
Sbjct: 595 PPPIRGYCRNCRNFFPPVPKVSKPATPLTYSLRSVIVHYGTHNYGHYIAFRKYRGCWWRI 654

Query: 712 SDETVYVVDEAEVLSTPGVFMLFYEYDFDEETGKMKDDLEAIQ 754
           SDETV +V EAEVLSTPGVFMLFYEYD+DE TGK++DD++  Q
Sbjct: 655 SDETVGIVTEAEVLSTPGVFMLFYEYDYDEATGKLRDDVDQEQ 697

>NDAI0B03430 Chr2 complement(868578..871148) [2571 bp, 856 aa] {ON}
          Length = 856

 Score =  668 bits (1723), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 358/611 (58%), Positives = 428/611 (70%), Gaps = 57/611 (9%)

Query: 196 DITFSVALRDLLSALNAKYYRDKPYFKTNSLLKAMSKSPRKNILLGYDQEDAQEFFQNIL 255
           DI F+++L +LLS LNAKYY+++PYFKTN LLK M  +P KN+LLGYDQEDAQEFFQNIL
Sbjct: 182 DIGFTLSLNELLSQLNAKYYKERPYFKTNKLLKTMKNAPNKNMLLGYDQEDAQEFFQNIL 241

Query: 256 AELESNVKSLNTEKL---------------DTTPVAKSELPDDALVGQLNLGEVGTVYIP 300
           +ELE N+KS++++                 +   + K +LP DA++GQ  LG+VGTVYIP
Sbjct: 242 SELEKNLKSISSQNNKEEEEEKKEQEKNSNECVKILKKDLPKDAIIGQEQLGKVGTVYIP 301

Query: 301 TEQIDPNS--ILHDKSIQN--FTPFKLMTPLDGITAERIGCLQCGENGGIRYSVFSGLSL 356
           TEQI+PN+   L   + Q   +TPFKL+TPLDGI+AERIGCLQCGENGGIRYSVFSGLSL
Sbjct: 302 TEQIEPNTSTALPSSNPQEKLYTPFKLITPLDGISAERIGCLQCGENGGIRYSVFSGLSL 361

Query: 357 NLPNENIGSTLKLSQLLSDWSKPEIIEGVECNRCALTAAHSHLFGQLKEFEKKPEGSIPE 416
           NLPNENIG TLKLS LL++W KPEII+GVECNRCAL A  SHL  QL+++       IP+
Sbjct: 362 NLPNENIGMTLKLSNLLNEWIKPEIIDGVECNRCALEAIKSHLLDQLEQYHNN-STEIPQ 420

Query: 417 KLINAVKDRVHQIEEVLAKPVIDDEDYKKLHTANMVRKCSKSKQILISRPPPLLSIHINR 476
           KLI+AVKDRV  ++++L+KPVID+EDYKKLHT NMVRKCSKSKQILISRPPPLLSIHINR
Sbjct: 421 KLIDAVKDRVECLQKILSKPVIDEEDYKKLHTENMVRKCSKSKQILISRPPPLLSIHINR 480

Query: 477 SVFDPRTYMIRKNNSKVLFKSRLNLAPWCCDINEINLDARLPMSKKEKAAQQDS-SEDE- 534
           SVFD RTY IRKNNS+VLFKS+LNL PW CDI+EINLDARLPMSKKE +  QD  SED+ 
Sbjct: 481 SVFDVRTYQIRKNNSRVLFKSKLNLEPWTCDIDEINLDARLPMSKKESSLGQDEFSEDDE 540

Query: 535 -NIGGEYYTKLHXXXXXXXXXXXXXXXXXXXXGNYASHYNH---TKDISNYDPLNGEVDG 590
               GEYY +LH                      Y+   N     KD+ NYDPLNGE++ 
Sbjct: 541 ATTNGEYYNRLHQKYQQEFEDSSDEDDDSDDNEIYSMDNNRRRTRKDVRNYDPLNGEIED 600

Query: 591 VTS-----DDEDEY--IEETDALGNTIKKRIIEHSXXXXXXXXXXXXLQEID-------- 635
            +S     D++D +  IEETD+LGNTI+KR+I+               +  +        
Sbjct: 601 SSSVYSSADEKDTHDSIEETDSLGNTIRKRVIKQETFERAEDSIEKENEGAEANHDDDND 660

Query: 636 -NVSLDEPKINVEDQLETSS-------------DEEDVIP--APPINYARSFSTVPATPL 679
            N    E K N +D+L +SS              E  + P  A P    + F + P  PL
Sbjct: 661 DNNDEQEHKGNNDDELPSSSPLAASEEEEDGEVQETSLSPSGAIPQTIRKKFDSTPIGPL 720

Query: 680 TYSLRSVIVHYGTHNYGHYIAFRKYRGCWWRISDETVYVVDEAEVLSTPGVFMLFYEYDF 739
           TYSLRSVIVHYGTHNYGHYIAFRKYRG WWRISDETVY+VDEAEVLSTPGVFMLFYEYD+
Sbjct: 721 TYSLRSVIVHYGTHNYGHYIAFRKYRGVWWRISDETVYIVDEAEVLSTPGVFMLFYEYDY 780

Query: 740 DEETGKMKDDL 750
           DE TGK+KDDL
Sbjct: 781 DEITGKLKDDL 791

 Score = 86.3 bits (212), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 37/57 (64%), Positives = 47/57 (82%), Gaps = 2/57 (3%)

Query: 77  LSRWLPRSKFTHLDEEILKRGGFIAGLVNDGNTCFMNSVLQSLASSRELMEFLDNNV 133
           + RW+PRS  + +D  +L  GG+IAGL+NDGNTCFMNSVLQSLASS+ELM+FLD  +
Sbjct: 106 MRRWMPRS--SQMDSNVLNHGGYIAGLLNDGNTCFMNSVLQSLASSKELMDFLDTTI 160

>KAFR0A06910 Chr1 complement(1393653..1395689) [2037 bp, 678 aa]
           {ON} Anc_2.307 YDL122W
          Length = 678

 Score =  654 bits (1686), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 341/569 (59%), Positives = 414/569 (72%), Gaps = 29/569 (5%)

Query: 196 DITFSVALRDLLSALNAKYYRDKPYFKTNSLLKAMSKSPRKNILLGYDQEDAQEFFQNIL 255
           DI F+  LR+LL  LN KYY++KPYFKTN LLK MS  P KNI+LGYDQEDAQEFFQ IL
Sbjct: 99  DIKFTETLRELLLILNKKYYKEKPYFKTNKLLKTMSNGPNKNIILGYDQEDAQEFFQQIL 158

Query: 256 AELESNVKSLNTEKLDT-TPVAKSELPDDALVGQLNLGEVGTVYIPTEQIDPNSILHDKS 314
           ++LE N+K  +TEK +    + +S+LPDDAL+GQ +L  VGTVYIPTEQI+PNS+L +  
Sbjct: 159 SDLEKNIKKPSTEKKEERNNIKESDLPDDALLGQDDLNNVGTVYIPTEQIEPNSVLENPD 218

Query: 315 IQNFTPFKLMTPLDGITAERIGCLQCGENGGIRYSVFSGLSLNLPNENIG-STLKLSQLL 373
            + ++PFKL+TPLDGITAERIGCL CGENGGIRYSVFSGLSLNLP+E++  STLKLS+LL
Sbjct: 219 QKLYSPFKLITPLDGITAERIGCLTCGENGGIRYSVFSGLSLNLPSESLNQSTLKLSELL 278

Query: 374 SDWSKPEIIEGVECNRCALTAAHSHLFGQLKEFEKKPEGSIPEKLINAVKDRVHQIEEVL 433
           ++W KPEIIEGVECNRC+L A  SHL  Q++        +IPEKL  A+  R++ + E+L
Sbjct: 279 NEWVKPEIIEGVECNRCSLNAVRSHLQDQIQN------DTIPEKLKIAINQRLNLLTEIL 332

Query: 434 AKPVIDDEDYKKLHTANMVRKCSKSKQILISRPPPLLSIHINRSVFDPRTYMIRKNNSKV 493
           +KPVI+++DYKK HT NMVRKCSKSKQILISRPPP LSIHINRSVFDPRTYMIRKNN++V
Sbjct: 333 SKPVIEEDDYKKYHTENMVRKCSKSKQILISRPPPFLSIHINRSVFDPRTYMIRKNNARV 392

Query: 494 LFKSRLNLAPWCCDINEINLDARLPMSKKEKAAQ-QDSSEDENIGGEYYTKLHXXXXXXX 552
           LFK+RLNL  W C+++EINLDARLPMSK E   Q ++SSEDENIGG+YY KLH       
Sbjct: 393 LFKTRLNLQKWACNVDEINLDARLPMSKNEHIVQNEESSEDENIGGDYYAKLHHRFEQEY 452

Query: 553 XXXXXXXXXXXXXGNYASHYNHTKDISNYDPLNGE----VDGVTSDDEDEYIEETDALGN 608
                               +  +D+ NYDPLNGE        +S ++++  EE DALGN
Sbjct: 453 EDSEDEENEIDS--------DDDRDVRNYDPLNGEEMNLSSEFSSSEDEQEEEEVDALGN 504

Query: 609 TIKKRIIEHSXXXXXXXXXXXXLQEIDNVSLDEPKINVEDQLETSSDEE---DVIPAPPI 665
           TI+   +  +              E D     EP  + E + E + D E   D I  PP 
Sbjct: 505 TIRNMPVRLANEVEQPVPMSNSSSEEDQ----EPAQDSESESELNEDVEQKNDEISIPPT 560

Query: 666 NYARSF-STVPATPLTYSLRSVIVHYGTHNYGHYIAFRKYRGCWWRISDETVYVVDEAEV 724
           N + ++ S+VPA PL YSLRSVIVHYGTHNYGHYIAFRKYRG WWRISDETVY+VDE EV
Sbjct: 561 NGSMTYSSSVPAGPLIYSLRSVIVHYGTHNYGHYIAFRKYRGYWWRISDETVYIVDETEV 620

Query: 725 LSTPGVFMLFYEYDFDEETGKMKDDLEAI 753
           LSTPGVFMLFYEYD+D  TG+MKDDLE++
Sbjct: 621 LSTPGVFMLFYEYDYDSVTGRMKDDLESL 649

 Score = 79.7 bits (195), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 39/61 (63%), Positives = 47/61 (77%), Gaps = 2/61 (3%)

Query: 71  FRNNNSLSRWLPRSKFTHLDEEILKRGGFIAGLVNDGNTCFMNSVLQSLASSRELMEFLD 130
           + NNN  SR +  +     D++ +KRGG+IAGLVNDGNTCFMNSVLQSLASS+EL  FLD
Sbjct: 30  YNNNNFFSRKMYNNAIN--DKKFIKRGGYIAGLVNDGNTCFMNSVLQSLASSKELAAFLD 87

Query: 131 N 131
           N
Sbjct: 88  N 88

>TBLA0B06080 Chr2 (1437254..1439728) [2475 bp, 824 aa] {ON}
           Anc_2.307 YDL122W
          Length = 824

 Score =  599 bits (1545), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 301/547 (55%), Positives = 379/547 (69%), Gaps = 23/547 (4%)

Query: 79  RWLPRSKFTHLDEEILKRGGFIAGLVNDGNTCFMNSVLQSLASSRELMEFLDNNVIRTYX 138
           +W+ ++    +   ++KRGGF+ GLVN+GNTCFMNSVLQSLASS E++ FLD  +I+ + 
Sbjct: 14  KWVTKNNL-QIQNTVMKRGGFVGGLVNEGNTCFMNSVLQSLASSHEIVRFLDEEIIKQFK 72

Query: 139 XXXXXXXXXXXXXXXSAQDEATHKKNTRXXXXXXXXXXXXLNRXXXXXXXXXXXXXPDIT 198
                          SA +   H+++ +              R              D++
Sbjct: 73  QKQLQELEELHKKSDSAHNHHNHQQDDKKSKNKSYGK-----RKKKLTKTNDDDMSTDVS 127

Query: 199 FSVALRDLLSALNAKYYRDKPYFKTNSLLKAMSKSPRKNILLGYDQEDAQEFFQNILAEL 258
           FS++L+DLL  LN KYYR++ Y++TN+LLK MSK+P KNI+LGY+QEDAQEFFQ IL EL
Sbjct: 128 FSISLKDLLDKLNDKYYRERKYYRTNNLLKTMSKAPNKNIILGYEQEDAQEFFQTILYEL 187

Query: 259 ESNVKSLNT--EKLDTTPVAKSELPDDALVGQLNLGEVGTVYIPTEQIDPNSIL-HDKSI 315
           E N+K L++  EKLD  P+ +S+LP +AL+GQ NL  VGTVYIPT  +DPNS+L  D S 
Sbjct: 188 EKNIKFLDSDREKLDKKPIPESDLPSNALIGQNNLSHVGTVYIPTAHLDPNSLLDKDPST 247

Query: 316 QNFTPFKLMTPLDGITAERIGCLQCGENGGIRYSVFSGLSLNLPNENIGSTLKLSQLLSD 375
             FTPF+L+TPLDGI AERIGCL CGE GGIRYSV SGLSLNLP+ENIG TLKLSQLL++
Sbjct: 248 NYFTPFRLVTPLDGIVAERIGCLNCGETGGIRYSVSSGLSLNLPSENIGDTLKLSQLLNE 307

Query: 376 WSKPEIIEGVECNRCALTAAHSHLFGQLKEFEKKPEGSIPEKLINAVKDRVHQIEEVLAK 435
           W KPEIIEGV C RC+L A   HL  QLK   +KP+GSIP+KLI+A+K R+  + E L+K
Sbjct: 308 WCKPEIIEGVNCYRCSLNAVLEHLENQLKTMSEKPKGSIPDKLISAIKTRIKALNETLSK 367

Query: 436 PVIDDEDYKKLHTANMVRKCSKSKQILISRPPPLLSIHINRSVFDPRTYMIRKNNSKVLF 495
           PVIDDE+YKK+HT NMVRK SKSKQI+++RPPPLLSIHINRSVFD RT+MI+KNNS++ F
Sbjct: 368 PVIDDEEYKKMHTDNMVRKSSKSKQIILARPPPLLSIHINRSVFDTRTFMIKKNNSRLAF 427

Query: 496 KSRLNLAPWCCDINEINLDARLPMSKKEKAAQQD--SSEDENIGGEYYTKLHXXXXXXXX 553
           K+RLNL PWCCD+N+INLDARLPMSK +K+ +    SSEDE +GGEYY KLH        
Sbjct: 428 KARLNLKPWCCDVNDINLDARLPMSKTQKSEEDGSISSEDETVGGEYYAKLHDKFQKEFE 487

Query: 554 XXXXXXXXXXXXGNYASHYN--HTKDISNYDPLNGEVDG-------VTSDDEDEYIEETD 604
                           S YN    +D+ NYDPLN + +         T+D EDEYIEETD
Sbjct: 488 DSDEEQEDGMSD---YSDYNMRSNRDVDNYDPLNEDTEHDEIRETVSTTDSEDEYIEETD 544

Query: 605 ALGNTIK 611
            LGNTI+
Sbjct: 545 KLGNTIR 551

 Score =  157 bits (396), Expect = 8e-39,   Method: Compositional matrix adjust.
 Identities = 70/84 (83%), Positives = 76/84 (90%), Gaps = 1/84 (1%)

Query: 668 ARSFST-VPATPLTYSLRSVIVHYGTHNYGHYIAFRKYRGCWWRISDETVYVVDEAEVLS 726
           A ++ST VP  PLTY LRSVIVHYGTHNYGHYIAFRKYRG WWRISDETV++VDEAEVLS
Sbjct: 658 APTYSTKVPTGPLTYELRSVIVHYGTHNYGHYIAFRKYRGTWWRISDETVHMVDEAEVLS 717

Query: 727 TPGVFMLFYEYDFDEETGKMKDDL 750
           TP VFMLFYEYDFDE++G MKDDL
Sbjct: 718 TPSVFMLFYEYDFDEKSGMMKDDL 741

>KLLA0E08801g Chr5 (784991..787306) [2316 bp, 771 aa] {ON} similar
           to uniprot|P25037 Saccharomyces cerevisiae YDL122W UBP1
           Ubiquitin-specific protease that removes ubiquitin from
           ubiquitinated proteins cleaves at the C terminus of
           ubiquitin fusions irrespective of their size capable of
           cleaving polyubiquitin chains
          Length = 771

 Score =  563 bits (1451), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 295/561 (52%), Positives = 385/561 (68%), Gaps = 17/561 (3%)

Query: 60  IVESVSEMTTNFRNNNSLSRWLPRSKFTHLDEEILKRGGFIAGLVNDGNTCFMNSVLQSL 119
           +V +  E+T   R+   L RW PR+     +E I++RGG++ GLVNDGNTCFMNSVLQ L
Sbjct: 45  VVSTTKEITQAVRDKIMLGRWAPRN--AEQEETIVRRGGYVGGLVNDGNTCFMNSVLQCL 102

Query: 120 ASSRELMEFLDNNVIRTYXXXXXXXXXXXXXXXXSAQDEATHKKNTRXXXXXXXXXXXXL 179
           ASS+EL +F+D  +I                      +++T +K  +            +
Sbjct: 103 ASSKELHKFMDT-IILDSNDDSQNTIDENGEESDLPNEQSTVEKKPKATKNKTYGKRKKI 161

Query: 180 NRXXXXXXXXXXXXXPDITFSVALRDLLSALNAKYYRDKPYFKTNSLLKAMSKSPRKNIL 239
                          P++ F++AL+DL S LNAK+YR++P+FKTN LLK MSK+P +NI+
Sbjct: 162 AVRQADNELLKNSTEPNMHFTLALQDLFSKLNAKHYRNRPWFKTNKLLKTMSKAPNRNII 221

Query: 240 LGYDQEDAQEFFQNILAELESNVKSL-NTEKLDTTPVAKSELPDDALVGQLNLGEVGTVY 298
           LGYDQEDAQEFFQ IL+ELE NV+S+    + D  PV + +LP+DA+VGQ +LGE+G VY
Sbjct: 222 LGYDQEDAQEFFQTILSELEKNVESIYGKPEKDPKPVPQDDLPEDAIVGQEHLGEIGDVY 281

Query: 299 IPTEQIDPNSILHDKSIQNFTPFKLMTPLDGITAERIGCLQCGENGGIRYSVFSGLSLNL 358
           IPTEQIDPNS+L     + ++P+K++TPLDGITAERIGCLQCGENGGIRYSVFSGLSLNL
Sbjct: 282 IPTEQIDPNSVLASGR-KFYSPYKIVTPLDGITAERIGCLQCGENGGIRYSVFSGLSLNL 340

Query: 359 PNENIGSTLKLSQLLSDWSKPEIIEGVECNRCALTAAHSHLFGQLKEFEKKPEGSIPEKL 418
           P++NIGS +KLSQLL +WSKPEIIEGV+CNRCAL A   HL  QL   + +P+  + +KL
Sbjct: 341 PSDNIGSPIKLSQLLDEWSKPEIIEGVDCNRCALNAVLEHLVEQLNTIQSQPD--VNQKL 398

Query: 419 INAVKDRVHQIEEVLAKPVIDDEDYKKLHTANMVRKCSKSKQILISRPPPLLSIHINRSV 478
           +  ++DR+++++ VL+K  IDD+DYK++HT NMVRK SKSKQILISRPPPLLS+HINRSV
Sbjct: 399 VTLMEDRINEVKSVLSKLAIDDDDYKRMHTENMVRKSSKSKQILISRPPPLLSVHINRSV 458

Query: 479 FDPRTYMIRKNNSKVLFKSRLNLAPWCCDINEINLDARLPMSKKEKAAQQDSSEDENIGG 538
           FDPRTYMIRKNNS+V+FKS+LNL+PWCC+ ++INLDARLPMSKK++   + SSED+N G 
Sbjct: 459 FDPRTYMIRKNNSRVIFKSKLNLSPWCCNYDKINLDARLPMSKKQENWHE-SSEDDNNGT 517

Query: 539 EYYTKLHXXXXXXXXXXXXXXXXXXXXGNYASHYN-HTKDISNYDPLNGE-VDGVTSDDE 596
           EYY KLH                     N    +N  ++ +  +D LNGE      S  E
Sbjct: 518 EYYNKLHRRFEKEFEDSDEEEDGSD---NGQGMFNGSSRMVEEHDVLNGELSSASLSSSE 574

Query: 597 DEYIE----ETDALGNTIKKR 613
           D+  E    E DALGNTI K+
Sbjct: 575 DDIAEVEEVELDALGNTIVKK 595

>TBLA0B07160 Chr2 complement(1696047..1697201) [1155 bp, 384 aa]
           {ON} Anc_2.307 YDL122W
          Length = 384

 Score =  308 bits (789), Expect = 7e-97,   Method: Compositional matrix adjust.
 Identities = 176/328 (53%), Positives = 226/328 (68%), Gaps = 41/328 (12%)

Query: 236 KNILLGYDQEDAQEFFQNILAELESNVKSLN------TEKLDTTPVAKS----ELPDDAL 285
           ++++LGY Q+DAQEFFQ ILA+LE NVK +         K +   + KS    +LP DAL
Sbjct: 7   QDVVLGYAQQDAQEFFQAILAKLEKNVKQIEHIPLKEKNKSNQNNILKSIPFEKLPSDAL 66

Query: 286 VGQLNLGEVGTVYIPTEQIDPNSILHDKSI------QNFTPFKLMTPLDGITAERIGCLQ 339
           +G  +L +VGTV+IPT+QI+PN I +++SI      Q FTPFKL+TPLDGI AERIGCL 
Sbjct: 67  LGHDHLDKVGTVFIPTDQINPNLIKNNESINSSNTNQLFTPFKLITPLDGIIAERIGCLN 126

Query: 340 CGENGGIRYSVFSGLSLNLPNENIGSTLKLSQLLSDWSKPEIIEGVECNRCALTAAHSHL 399
           CGENGGIRYSV S LSLNLPN     ++ L +LLS++++PEIIE V CNRC L + +  +
Sbjct: 127 CGENGGIRYSVSSSLSLNLPNY-TNDSISLYELLSNYTQPEIIEQVNCNRCTLASMYDSI 185

Query: 400 FGQLKEFE-------------KKPEGSIPEKLINAVKD-----------RVHQIEEVLAK 435
             +LKE               ++ E S  EK   A+ D           R++ I  VL+K
Sbjct: 186 NSKLKELTSEDVNINQIDNNTQEDENSTIEKTSMAINDSNNKLKSVLTERLNTISNVLSK 245

Query: 436 PVIDDEDYKKLHTANMVRKCSKSKQILISRPPPLLSIHINRSVFDPRTYMIRKNNSKVLF 495
           PVIDD+ +K L T+NM  + SKSKQ+LISRPPPLLSIHINRSVFDP TY IRKNNS+VLF
Sbjct: 246 PVIDDDSFKTLSTSNMTCQTSKSKQLLISRPPPLLSIHINRSVFDPTTYQIRKNNSRVLF 305

Query: 496 KSRLNLAPWCCDINEINLDARLPMSKKE 523
           +SRLNL  +CC+I+EINLDARLPM+K++
Sbjct: 306 ESRLNLNGFCCNIDEINLDARLPMNKRD 333

>NCAS0G03680 Chr7 complement(682617..684065) [1449 bp, 482 aa] {ON}
           Anc_2.307 YDL122W
          Length = 482

 Score =  128 bits (321), Expect = 1e-30,   Method: Compositional matrix adjust.
 Identities = 119/408 (29%), Positives = 174/408 (42%), Gaps = 81/408 (19%)

Query: 97  GGFIAGLVNDGNTCFMNSVLQSLASSRELMEFLDNNVIRTYXXXXXXXXXXXXXXXXSAQ 156
           G  + GL+N+GN+CFMNSVLQ+LAS   L++FL+                       + Q
Sbjct: 23  GSTLGGLINNGNSCFMNSVLQALASLPSLLKFLE-----------------LILETPATQ 65

Query: 157 DEATHKKNTRXXXXXXXXXXXXLNRXXXXXXXXXXXXXPDITFSVALRDLLSALNAKYYR 216
           +E  H + ++              R               +TF   L  LL  LN K   
Sbjct: 66  EEPKHVEISKKAQKKSKYGRRKKGRKKQVEPQEDEHS---LTFLKLLNGLLKKLNVKC-- 120

Query: 217 DKPYFKTNSLLKAMSKSPRKNILLGYDQEDAQEFFQNILAELESNVKSLNTEKLDTTPVA 276
           +   F  +SLL+A     + ++    DQ+DAQEFFQ+IL E++         K+   P  
Sbjct: 121 NSKSFDCDSLLRASGPQFKLDM---EDQQDAQEFFQHILLEID---------KVSLPP-- 166

Query: 277 KSELPDDALVGQLNLGEVGTVYIPTEQIDPNSILHDKSIQNFTPFKLMTPLDGITAERIG 336
           K +         L     G  Y P           D S +      + +P DGI    I 
Sbjct: 167 KYDEATSTFTNVLECVNYGVCYFP-----------DVSKE----LTIRSPFDGIMKTTIR 211

Query: 337 CLQCGENGGIRYSVFSGLSLNLPNENIGSTLKLSQLLSDWSKPEIIEGVECNRCALTAAH 396
           CLQC E     YS+ S ++LNLP+       KLS L+  W +P I+E V CN+C L    
Sbjct: 212 CLQCNEISNAHYSILSNITLNLPHTK-SDCFKLSTLIHRWIEPCILEDVTCNKCTLLNRT 270

Query: 397 SHLFGQLKEFEKKPEGSIPEKLINAVKDRVHQIEEVL-AKPVIDDEDYKKLHT-ANMVRK 454
           S                           R   +EE+L +   I+DED  KL       +K
Sbjct: 271 S---------------------------RTPDVEELLLSGKYIEDEDMIKLKIIPEEKKK 303

Query: 455 CSKSKQILISRPPPLLSIHINRSVFDPRTYMIRKNNSKVLFKSRLNLA 502
            +K +   + + P ++S HINRS F  +T+ IRK+N +VLFK +L ++
Sbjct: 304 GNKLRNSYMVQLPHVMSFHINRSRFHKKTFKIRKDNRRVLFKLQLTIS 351

 Score =  100 bits (249), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 41/62 (66%), Positives = 51/62 (82%)

Query: 679 LTYSLRSVIVHYGTHNYGHYIAFRKYRGCWWRISDETVYVVDEAEVLSTPGVFMLFYEYD 738
           + Y L++VI+HYGTHNYGHYI++RK+   WWRISDE+V  VDE EVL++PGVFMLFYE  
Sbjct: 420 IIYDLKAVIIHYGTHNYGHYISYRKFMNQWWRISDESVIEVDEMEVLTSPGVFMLFYEIH 479

Query: 739 FD 740
            D
Sbjct: 480 TD 481

>NDAI0G00780 Chr7 (164452..165912) [1461 bp, 486 aa] {ON} 
          Length = 486

 Score =  111 bits (277), Expect = 5e-25,   Method: Compositional matrix adjust.
 Identities = 99/356 (27%), Positives = 151/356 (42%), Gaps = 93/356 (26%)

Query: 199 FSVALRDLLSALNAKYYRDKPY-FKTNSLLKAMSKSPRKNILLGYDQEDAQEFFQNILAE 257
           F + LR LL+ +N +Y   K   F T+  +  +S    + I+   DQ+DAQEF Q +  +
Sbjct: 98  FFIELRKLLTNVNTRYTHKKGLSFSTSKFISTLSS---QTIINATDQQDAQEFLQILFND 154

Query: 258 LESNVKSLNTEKLDTTPVAKSELPDDALVGQLNLGEVGTVYIPTEQIDPNSILHDKSIQN 317
           LE                                     ++  T +I  N  L       
Sbjct: 155 LEK----------------------------------SQIFHTTVKITSNDAL------- 173

Query: 318 FTPFKLMTPLDGITAERIGCLQCGENGGIRYSVFSGLSLNLPNENIGSTLKLSQLLSD-W 376
               ++ TP +GI   R+ CL C E     + +FS L+L+LP  +   T   + +LS  W
Sbjct: 174 ----QIKTPFEGILMARMKCLTCDEISNPNFKLFSNLTLSLPRYSKQET--FNDILSTFW 227

Query: 377 SKPEIIEGVECNRCALTAAHSHLFGQLKEFEKKPEGSIPEKLINAVKDRVHQIEEVLAKP 436
           ++ + +E V CNRC L          LK      E                  + +L K 
Sbjct: 228 NQLDYVENVSCNRCTL----------LKHANSNSE-----------------YQNLLVKD 260

Query: 437 VIDDEDYK---KLHTANMVRKCSKSKQILISRPPPLLSIHINRSVFDPRTYMIRKNNSKV 493
           VI D+D +   K     MV K +K KQI I +PP +LS H NRS+FD + +  +KNN KV
Sbjct: 261 VIKDDDMENILKRDNLEMV-KSNKIKQIKILKPPKILSFHFNRSIFDRKQFKFKKNNCKV 319

Query: 494 LFKSRLNLAPWCCDINEINLDARLPMSKKEKAAQQDSSEDENIGGE----YYTKLH 545
           L   +LN++ +C       +D+ L +   +  A     +++N   E    YY KLH
Sbjct: 320 LLTPKLNISKFCI------VDSDLAVDVADGYAPDFYYKNKNGNSEKDKKYYEKLH 369

 Score = 92.4 bits (228), Expect = 6e-19,   Method: Compositional matrix adjust.
 Identities = 35/59 (59%), Positives = 48/59 (81%)

Query: 680 TYSLRSVIVHYGTHNYGHYIAFRKYRGCWWRISDETVYVVDEAEVLSTPGVFMLFYEYD 738
            YSL+S++VHYG+H+YGHYI++R++   WWRISDE+V  VDE EV S  G+F++FYE D
Sbjct: 427 VYSLKSIVVHYGSHDYGHYISYRRFEDQWWRISDESVLKVDEDEVFSASGIFIVFYEQD 485

 Score = 44.3 bits (103), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 21/33 (63%), Positives = 26/33 (78%), Gaps = 1/33 (3%)

Query: 100 IAGLVND-GNTCFMNSVLQSLASSRELMEFLDN 131
           I GL ND GN+CF+NS+LQS AS   L++FLDN
Sbjct: 5   IGGLNNDDGNSCFINSILQSSASCNYLLQFLDN 37

>SAKL0H10076g Chr8 (863358..865661) [2304 bp, 767 aa] {ON} similar
           to gnl|GLV|KLLA0E23463g Kluyveromyces lactis
           KLLA0E23463g and some similarites with YPL072W
           uniprot|Q02863 Saccharomyces cerevisiae YPL072W UBP16
           Putative ubiquitin-specific protease
          Length = 767

 Score = 57.0 bits (136), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 67/260 (25%), Positives = 112/260 (43%), Gaps = 43/260 (16%)

Query: 279 ELPDDALV--GQLNLGEVGTVYIPT---EQIDPNSILHDKSIQNFTP-FKLMTPLDGITA 332
           EL  DA +  GQ +  E+  V + T   E I     + D+S+    P F    P+ G  A
Sbjct: 268 ELIFDARISTGQNDAHELTQVILETLEKENIKLKKFVKDQSLNVIIPDF----PVRGSLA 323

Query: 333 ERIGCLQCGENGGIRYSVFSGLSLNLPNENIGSTLKLSQLLSDWSKPEIIEGVECNRCAL 392
           + + CL C ++  +    FS   L +P E   ST  L+ ++SD ++ E IEG  C  C +
Sbjct: 324 DHLVCLNCRDSSKVNVHPFSMYPLPVPQE---STAVLADMISD-NQTETIEGYSCLSCKI 379

Query: 393 TAAHSHLFGQLKEFEKKPEGSIPEKLINAVKDRVHQIEEVLAKPVIDDE----------D 442
            A  S+   + + F    E           ++ +  +E++L    I+D+          +
Sbjct: 380 RAILSN--EKQRNFAGTSESE---------RNVLQTLEKILPDIFINDDLSAELTTYIDN 428

Query: 443 YKKLHTANMVRKCSKSKQILISRPPPLLSIHINRSVFDPRTYMIRKNNSKVLFKSRLNLA 502
           Y K      + K +  K+ ++   P LL IH++RSVF+   Y   +N+  V F+  L L 
Sbjct: 429 YNKDGVNTSILKSTIVKKTVVVDSPELLIIHLSRSVFNGMNYT--RNSCNVAFEEDLGLQ 486

Query: 503 PW------CCDINEINLDAR 516
                   C  +N +    R
Sbjct: 487 EQIIEKNKCVGVNNVKYRLR 506

>TBLA0H03600 Chr8 complement(877069..878517) [1449 bp, 482 aa] {ON}
           Anc_8.540 YPL072W
          Length = 482

 Score = 55.5 bits (132), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 51/186 (27%), Positives = 86/186 (46%), Gaps = 32/186 (17%)

Query: 326 PLDGITAERIGCLQCGENGGIRYSVFSGLSLNLPNENIGSTLKLSQLLSDWSKPEIIEGV 385
           P +G     + CL+CG N  ++   F  L+LNLP +    ++ L +L+S  S  ++IEG 
Sbjct: 202 PFEGKYCHELTCLKCGRNSEVKMFDFDILTLNLPAQ---PSISLDELISG-SNSDVIEGF 257

Query: 386 ECNRCALTA----AHSH------LFGQLKEFEKKPEGSIPEKLINAVKDRVHQIEEVLAK 435
            C  C ++A      +H      L   LKE         PE  IN       +++E L  
Sbjct: 258 SCTVCKVSAILGGTGTHNPNTRSLIKSLKEI-------FPELKINT------ELDEPL-N 303

Query: 436 PVIDDEDYKKLHTANMVRKCSKSKQILISRPPPLLSIHINRSVFDPRTYMIRKNNSKVLF 495
             +D   +  + T N+  K +  K+ +    P +L IH+ RS+F+  +Y   +N  K+ +
Sbjct: 304 SFVDSYSHDGVITRNI--KSTIVKKTVFVEVPDILLIHLTRSMFNGMSYT--RNACKIAY 359

Query: 496 KSRLNL 501
             +L L
Sbjct: 360 DEKLLL 365

 Score = 39.7 bits (91), Expect = 0.026,   Method: Compositional matrix adjust.
 Identities = 19/42 (45%), Positives = 27/42 (64%), Gaps = 1/42 (2%)

Query: 94  LKRGGFIAGLVNDGNTCFMNSVLQSLASSRELMEFLDNNVIR 135
           L+   +  GL+N GN CF+NS LQ LA S+    +L N+V+R
Sbjct: 62  LRYDKYTTGLINKGNDCFINSSLQGLAGSQRFNHYL-NSVLR 102

>KLLA0E23387g Chr5 complement(2079405..2081753) [2349 bp, 782 aa]
           {ON} some similarities with uniprot|Q02863 Saccharomyces
           cerevisiae YPL072W UBP16 Putative ubiquitin-specific
           protease
          Length = 782

 Score = 52.4 bits (124), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 49/184 (26%), Positives = 85/184 (46%), Gaps = 27/184 (14%)

Query: 326 PLDGITAERIGCLQCGENGGIRYSVFSGLSLNLPNENIGSTLKLSQLLSDWSKPEIIEGV 385
           P+ G  A+ + CL CGE+  +    F+  SL +P + I +   L+Q++SD ++ + I G 
Sbjct: 312 PVHGSLADSLFCLSCGESSKVNIHEFTMYSLPVP-QLINA--DLAQMISD-NQTDQISGY 367

Query: 386 ECNRCALTAAHSHLFGQLKEFEKKPEGSIPEKLINAVKDRVHQIEEVLAKPVIDDE---- 441
            C  C L A  ++   +  +     E  I           + ++EE+L K  I+D+    
Sbjct: 368 SCLCCKLNAIIANEKNRNYQNNSDEENQI-----------LKELEELLPKAFINDDLARN 416

Query: 442 ------DYKKLHTANMVRKCSKSKQILISRPPPLLSIHINRSVFDPRTYMIRKNNSKVLF 495
                  Y+K        K +  K+ ++   P +L +H++RSVFD   Y  +KN   V F
Sbjct: 417 LSTYINSYEKGGIKTSEIKSTIVKKTVVVDSPDVLILHLSRSVFDGMGY--QKNTCNVSF 474

Query: 496 KSRL 499
           +  L
Sbjct: 475 EEEL 478

 Score = 33.5 bits (75), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 14/33 (42%), Positives = 23/33 (69%)

Query: 99  FIAGLVNDGNTCFMNSVLQSLASSRELMEFLDN 131
           F  GL+N+ N CF NS +Q+L+S   L ++L++
Sbjct: 71  FTTGLINNRNDCFANSSIQALSSLVYLTKYLND 103

 Score = 33.5 bits (75), Expect = 2.8,   Method: Compositional matrix adjust.
 Identities = 12/23 (52%), Positives = 17/23 (73%)

Query: 680 TYSLRSVIVHYGTHNYGHYIAFR 702
           +Y LRS++ H G+H+ GHY  FR
Sbjct: 497 SYKLRSMLRHQGSHSTGHYECFR 519

>Kwal_27.12030 s27 complement(1056215..1058464) [2250 bp, 749 aa]
           {ON} YPL072W (UBP16) - putative deubiquitinating enzyme
           [contig 24] FULL
          Length = 749

 Score = 48.5 bits (114), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 54/225 (24%), Positives = 101/225 (44%), Gaps = 27/225 (12%)

Query: 286 VGQLNLGEVGTVYIPT---EQIDPNSILHDKSIQNFTP-FKLMTPLDGITAERIGCLQCG 341
            GQ +  E+  V + T   E +     + D+S+    P F    P+ G  A+ + CL C 
Sbjct: 271 AGQNDAHELSQVILETLEKENLRLKKFVKDQSLNVIIPDF----PVKGCLADHLICLNCQ 326

Query: 342 ENGGIRYSVFSGLSLNLPNENIGSTLKLSQLLSDWSKPEIIEGVECNRCALTAAHSHLFG 401
            +  +    F+   L +P E+  S   L  +++  ++ E IEG  C  C + A  +    
Sbjct: 327 GSSKVNLHPFTMYPLPVPQEHTAS---LEAMIAG-NQTETIEGYGCLSCKIKAILA---- 378

Query: 402 QLKEFEKKPEGSIPEKLINAVKDRVHQIEEVLAKPVIDDE------DYKKLHTANMVRKC 455
              E ++K EG+ P++  N +      + E+     + D+      +YKK        K 
Sbjct: 379 --TEEQRKYEGN-PDEENNILATLSKIVSEIFINDDLSDDLMNYINNYKKDGCDTSTLKS 435

Query: 456 SKSKQILISRPPPLLSIHINRSVFDPRTYMIRKNNSKVLFKSRLN 500
           +  K+ +++  P +L +H++RSVF+   Y   +N+  V F+  L+
Sbjct: 436 TIVKKTVVTESPDILILHLSRSVFNGMNYT--RNSCYVTFEEELH 478

 Score = 34.3 bits (77), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 11/30 (36%), Positives = 20/30 (66%)

Query: 674 VPATPLTYSLRSVIVHYGTHNYGHYIAFRK 703
           V   P+ Y L++++ H GTH+ GHY  +++
Sbjct: 490 VGVKPIKYKLKAMVKHEGTHSQGHYECYKR 519

>KLTH0E12540g Chr5 complement(1111576..1113834) [2259 bp, 752 aa]
           {ON} some similarities with uniprot|Q02863 Saccharomyces
           cerevisiae YPL072W UBP16 Putative ubiquitin- specific
           protease
          Length = 752

 Score = 48.1 bits (113), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 49/182 (26%), Positives = 85/182 (46%), Gaps = 21/182 (11%)

Query: 326 PLDGITAERIGCLQCGENGGIRYSVFSGLSLNLPNENIGSTLKLSQLLSDWSKPEIIEGV 385
           P+ G  A+ + CL C  +  +    F+  SL +P E   S   LS +++D ++ E I+G 
Sbjct: 309 PVKGSLADHLICLNCQGSSKVNMHPFTMYSLPVPQEPSAS---LSAMIAD-NQTETIDGY 364

Query: 386 ECNRCALTAAHSHLFGQLKEFEKKPEG-SIPEKLINAVKDRVHQIEEVLAKPVIDDE--- 441
            C  C + A  ++      E ++  +G S  E+ I A   R+  I E+     + DE   
Sbjct: 365 SCLSCKIKAILAN------EEQRGSKGNSDEEQNILATLSRI--ISEIFINDDLSDELTN 416

Query: 442 ---DYKKLHTANMVRKCSKSKQILISRPPPLLSIHINRSVFDPRTYMIRKNNSKVLFKSR 498
              +YKK        K    K+ +++  P +L +H++RSVF+   Y   +N+  V F   
Sbjct: 417 YVNNYKKDGCETSSIKSRIVKKTVVTESPEILILHLSRSVFNGTNYT--RNSCYVNFDEE 474

Query: 499 LN 500
           L+
Sbjct: 475 LH 476

 Score = 38.5 bits (88), Expect = 0.066,   Method: Compositional matrix adjust.
 Identities = 14/30 (46%), Positives = 20/30 (66%)

Query: 674 VPATPLTYSLRSVIVHYGTHNYGHYIAFRK 703
           V   P+ Y L+S++ H GTH+ GHY  FR+
Sbjct: 488 VGVKPIKYKLKSMVKHQGTHSQGHYECFRR 517

>YNL186W Chr14 (289498..291876) [2379 bp, 792 aa] {ON}
           UBP10Ubiquitin-specific protease that deubiquitinates
           ubiquitin-protein moieties; may regulate silencing by
           acting on Sir4p; involved in posttranscriptionally
           regulating Gap1p and possibly other transporters;
           primarily located in the nucleus
          Length = 792

 Score = 47.4 bits (111), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 23/60 (38%), Positives = 34/60 (56%), Gaps = 2/60 (3%)

Query: 678 PLTYSLRSVIVHYG-THNYGHYIAF-RKYRGCWWRISDETVYVVDEAEVLSTPGVFMLFY 735
           P+ Y L SV+VH G + + GHYIA  ++  G W    DE + ++ E +VL  P  + L Y
Sbjct: 671 PVKYQLLSVVVHEGRSLSSGHYIAHCKQPDGSWATYDDEYINIISERDVLKEPNAYYLLY 730

>ZYRO0A05962g Chr1 complement(474545..475942) [1398 bp, 465 aa] {ON}
           similar to uniprot|P50102 Saccharomyces cerevisiae
           YMR223W UBP8 Ubiquitin-specific protease that is a
           component of the SAGA (Spt-Ada-Gcn5-Acetyltransferase)
           acetylation complex required for SAGA-mediated
           deubiquitination of histone H2B
          Length = 465

 Score = 46.6 bits (109), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 28/85 (32%), Positives = 43/85 (50%), Gaps = 3/85 (3%)

Query: 653 SSDEEDVIPAPPINYARSFSTVPATP-LTYSLRSVIVHYGTHNYGHYIAFRKY-RGCWWR 710
           S+   D++  P     R++      P + + L  +I H GT N GHYIAF K   G W++
Sbjct: 376 SAKLNDIVEFPLFLNMRNYCDGDDVPDIIFELIGIIAHRGTVNEGHYIAFTKVTTGHWFK 435

Query: 711 ISDETVYVVDEAEVLSTPGVFMLFY 735
            +D  V  + E E+L     ++LFY
Sbjct: 436 FNDSMVSSITEEELLQEQA-YLLFY 459

 Score = 32.7 bits (73), Expect = 4.6,   Method: Compositional matrix adjust.
 Identities = 14/35 (40%), Positives = 23/35 (65%)

Query: 94  LKRGGFIAGLVNDGNTCFMNSVLQSLASSRELMEF 128
           L+R   + GL+N G+TCFM+S++Q L  +    +F
Sbjct: 130 LERRDGLQGLLNMGSTCFMSSIVQCLIHNPYFFQF 164

>Suva_16.240 Chr16 (429066..430637) [1572 bp, 523 aa] {ON} YPL072W
           (REAL)
          Length = 523

 Score = 46.6 bits (109), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 51/184 (27%), Positives = 89/184 (48%), Gaps = 17/184 (9%)

Query: 326 PLDGITAERIGCLQCGENGGIRYSVFSGLSLNLPNENIGSTLKLSQLLSDWSKPEIIEGV 385
           P  G T++ + CLQC       Y       L +P     S+ KL ++L++  + EIIEG 
Sbjct: 224 PFQGQTSKFLSCLQCHRLSKPSYQESFIRELMVPQR---SSEKLMKILAN-DETEIIEGY 279

Query: 386 ECNRCALTAAHSHLFGQLKEFEKKPEGSIPEKLINAVKDRVH--QIEEVLAKPV---IDD 440
            C  C + A  +H   + + F+   +  +  ++++A+K+  +   I E L   V   I  
Sbjct: 280 SCLICQVRAILNH--EKYRTFKNCSQDEL--RILDALKNYANDASINEDLPIKVEQYIKH 335

Query: 441 EDYKKLHTANMVRKCSKSKQILISRPPPLLSIHINRSVFDPRTYMIRKNNSKVLFKSRLN 500
               KL T+N+  K +  K+ +  + P +L IH++RS F+  TY   +N   V F+  + 
Sbjct: 336 YAKDKLRTSNV--KSTVIKKDIAVQLPEVLVIHLSRSTFNGMTYT--RNPCNVEFEETIK 391

Query: 501 LAPW 504
           LA +
Sbjct: 392 LAEY 395

 Score = 37.4 bits (85), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 17/37 (45%), Positives = 25/37 (67%), Gaps = 2/37 (5%)

Query: 101 AGLVNDGNTCFMNSVLQSLASSRELMEFLD--NNVIR 135
            GL+N+GN CF+ S LQSLA     +E+L   N+++R
Sbjct: 68  VGLINNGNDCFITSSLQSLAGIPRFVEYLKEINSILR 104

 Score = 33.9 bits (76), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 11/24 (45%), Positives = 18/24 (75%)

Query: 679 LTYSLRSVIVHYGTHNYGHYIAFR 702
           + Y L+SV+ H G+H+ GHY+ +R
Sbjct: 409 IEYHLKSVVKHTGSHSRGHYVCYR 432

>Kwal_33.14430 s33 (669559..671094) [1536 bp, 511 aa] {ON} YNL186W
           (UBP10) - predicted to encode a ubiquitin-processing
           protease [contig 103] PARTIAL
          Length = 511

 Score = 46.2 bits (108), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 24/65 (36%), Positives = 36/65 (55%), Gaps = 2/65 (3%)

Query: 673 TVPATPLTYSLRSVIVHYG-THNYGHYIAF-RKYRGCWWRISDETVYVVDEAEVLSTPGV 730
           +  A P+ Y L SV+VH G + + GHYIA  ++  G W    DE +  + E ++L  PG 
Sbjct: 387 SATALPVKYQLISVVVHEGRSLSSGHYIAHCKQPDGSWSTYDDEYINKISEKQMLKEPGA 446

Query: 731 FMLFY 735
           + L Y
Sbjct: 447 YYLVY 451

>KAFR0E00930 Chr5 (198914..200410) [1497 bp, 498 aa] {ON} Anc_8.540
           YPL072W
          Length = 498

 Score = 46.2 bits (108), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 45/183 (24%), Positives = 86/183 (46%), Gaps = 20/183 (10%)

Query: 326 PLDGITAERIGCLQCGENGGIRYSVFSGLSLNLPNENIGSTLKLSQLLSDWSKPEIIEGV 385
           P +G+++  + CLQC +     +S F  L + +P      + KL+ L+   S+ EIIEG 
Sbjct: 200 PFEGVSSNYLMCLQCNKYSQTIHSPFLMLEVAVPG---NYSEKLTDLILH-SQDEIIEGY 255

Query: 386 ECNRCA--LTAAHSHLFGQLKEFEKKPEGSIPEKLINAVKDRVHQ--IEEVLAKPV---I 438
            C  C   +   +     QL E+ ++ +      ++N +++++    I + L   V   +
Sbjct: 256 SCLYCKVNMILKNEKYLNQLPEYSQEEQS-----ILNFLRNQILTLYINDDLPADVSFYV 310

Query: 439 DDEDYKKLHTANMVRKCSKSKQILISRPPPLLSIHINRSVFDPRTYMIRKNNSKVLFKSR 498
           D        TAN      K   ++  + P  L +H++RS+F+  T  I ++  +V ++  
Sbjct: 311 DHYSKNGCVTANFKSNIIKKNAVI--KEPASLIVHLSRSIFNGAT--ITRSACRVEYEQS 366

Query: 499 LNL 501
           LNL
Sbjct: 367 LNL 369

 Score = 35.4 bits (80), Expect = 0.61,   Method: Compositional matrix adjust.
 Identities = 13/26 (50%), Positives = 18/26 (69%)

Query: 678 PLTYSLRSVIVHYGTHNYGHYIAFRK 703
           P+ Y L+SV+ H G+H  GHY  +RK
Sbjct: 384 PIKYELKSVVKHTGSHVQGHYQCYRK 409

 Score = 33.5 bits (75), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 17/43 (39%), Positives = 23/43 (53%)

Query: 91  EEILKRGGFIAGLVNDGNTCFMNSVLQSLASSRELMEFLDNNV 133
           EE  +   F  GL+N  N CF+NS LQ+L     L  +L+  V
Sbjct: 65  EESKRLDRFTTGLLNARNDCFLNSSLQALVPIESLTTYLNQFV 107

>TBLA0B09760 Chr2 complement(2316180..2318876) [2697 bp, 898 aa]
           {ON} Anc_2.69 YNL186W
          Length = 898

 Score = 46.2 bits (108), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 24/60 (40%), Positives = 32/60 (53%), Gaps = 2/60 (3%)

Query: 678 PLTYSLRSVIVHYG-THNYGHYIAFRKY-RGCWWRISDETVYVVDEAEVLSTPGVFMLFY 735
           P+ Y L SV+VH G + + GHYIA  K   G W    DE +  + E E+L  P  + L Y
Sbjct: 752 PVKYQLLSVVVHEGRSLSSGHYIAHCKQPDGSWATYDDEYINKISEREMLKEPNAYYLLY 811

>Skud_15.286 Chr15 complement(511346..515182) [3837 bp, 1278 aa] {ON}
            YOR124C (REAL)
          Length = 1278

 Score = 46.2 bits (108), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 23/49 (46%), Positives = 29/49 (59%), Gaps = 3/49 (6%)

Query: 681  YSLRSVIVHYGTHNYGHY---IAFRKYRGCWWRISDETVYVVDEAEVLS 726
            YSL SV +H G  +YGHY   I  R Y G W + +DET+  V E EV +
Sbjct: 1199 YSLFSVFIHRGEASYGHYWIYIKDRNYGGVWRKYNDETISEVQEEEVFN 1247

>SAKL0E13002g Chr5 complement(1070150..1072369) [2220 bp, 739 aa]
           {ON} similar to uniprot|P53874 Saccharomyces cerevisiae
           YNL186W UBP10 Ubiquitin-specific protease that
           deubiquitinates ubiquitin-protein moieties may regulate
           silencing by acting on Sir4p involved in
           posttranscriptionally regulating Gap1p and possibly
           other transporters primarily located in the nucleus
          Length = 739

 Score = 45.8 bits (107), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 23/60 (38%), Positives = 34/60 (56%), Gaps = 2/60 (3%)

Query: 678 PLTYSLRSVIVHYG-THNYGHYIAF-RKYRGCWWRISDETVYVVDEAEVLSTPGVFMLFY 735
           P+ Y L SV+VH G + + GHYIA  ++  G W    DE +  + E ++L  PG + L Y
Sbjct: 624 PVKYQLISVVVHEGRSLSSGHYIAHCKQPDGSWATYDDEYINKITEKQMLKEPGAYYLIY 683

>Smik_13.431 Chr13 (700800..702215) [1416 bp, 471 aa] {ON} YMR223W
           (REAL)
          Length = 471

 Score = 45.4 bits (106), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 23/58 (39%), Positives = 33/58 (56%), Gaps = 2/58 (3%)

Query: 679 LTYSLRSVIVHYGTHNYGHYIAFRKYRGC-WWRISDETVYVVDEAEVLSTPGVFMLFY 735
           + Y L  ++ H GT N GHYIAF K  G  W++ +D  V  + + EVL     ++LFY
Sbjct: 409 IIYELIGIVSHRGTVNEGHYIAFCKISGGQWFKFNDSVVTSIAQGEVLKEQA-YLLFY 465

 Score = 35.8 bits (81), Expect = 0.42,   Method: Compositional matrix adjust.
 Identities = 25/82 (30%), Positives = 42/82 (51%), Gaps = 15/82 (18%)

Query: 43  IFGI-----VVFFYKKPDHLNYIVESVSEMTTNFRNNNSLSRWLPRSKFTHLDEEILKRG 97
           IFGI     ++F +K  D+L  I      +   + ++ S    +P          I++R 
Sbjct: 84  IFGINSNNGLLFCFKCEDYLGNIDLINDAILAKYWDDVSTKTTVP----------IMERR 133

Query: 98  GFIAGLVNDGNTCFMNSVLQSL 119
             ++GL+N G+TCFM+S+LQ L
Sbjct: 134 DGLSGLINMGSTCFMSSILQCL 155

>KLTH0B07150g Chr2 complement(574195..576465) [2271 bp, 756 aa] {ON}
           some similarities with uniprot|P53874 Saccharomyces
           cerevisiae YNL186W UBP10 Ubiquitin-specific protease
           that deubiquitinates ubiquitin-protein moieties may
           regulate silencing by acting on Sir4p involved in
           posttranscriptionally regulating Gap1p and possibly
           other transporters primarily located in the nucleus
          Length = 756

 Score = 45.4 bits (106), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 23/60 (38%), Positives = 33/60 (55%), Gaps = 2/60 (3%)

Query: 678 PLTYSLRSVIVHYG-THNYGHYIAF-RKYRGCWWRISDETVYVVDEAEVLSTPGVFMLFY 735
           P+ Y L SV+VH G +   GHYIA  ++  G W    DE +  + E ++L  PG + L Y
Sbjct: 645 PVKYQLISVVVHEGRSLTSGHYIAHCKQPDGSWSTYDDEYINKISERQMLKEPGAYYLVY 704

>KNAG0F01220 Chr6 (219798..222152) [2355 bp, 784 aa] {ON} Anc_2.69
           YNL186W
          Length = 784

 Score = 45.4 bits (106), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 27/80 (33%), Positives = 43/80 (53%), Gaps = 3/80 (3%)

Query: 678 PLTYSLRSVIVHYG-THNYGHYIAF-RKYRGCWWRISDETVYVVDEAEVLSTPGVFMLFY 735
           P+ Y L SV+VH G + + GHYIA  ++  G W    DE +  + E +VL     + L Y
Sbjct: 642 PVKYQLISVVVHEGRSLSSGHYIAHCKQPDGSWSTYDDEYINKITERDVLRESNAYYLVY 701

Query: 736 EYDFDEETGKMKDDLEAIQS 755
                 +  K++DDL +++S
Sbjct: 702 TR-LTSKAIKLRDDLSSVKS 720

>YMR223W Chr13 (716715..718130) [1416 bp, 471 aa] {ON}
           UBP8Ubiquitin-specific protease that is a component of
           the SAGA (Spt-Ada-Gcn5-Acetyltransferase) acetylation
           complex; required for SAGA-mediated deubiquitination of
           histone H2B
          Length = 471

 Score = 44.7 bits (104), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 23/58 (39%), Positives = 33/58 (56%), Gaps = 2/58 (3%)

Query: 679 LTYSLRSVIVHYGTHNYGHYIAFRKYRGC-WWRISDETVYVVDEAEVLSTPGVFMLFY 735
           + Y L  ++ H GT N GHYIAF K  G  W++ +D  V  + + EVL     ++LFY
Sbjct: 409 IIYELIGIVSHKGTVNEGHYIAFCKISGGQWFKFNDSMVSSISQEEVLKEQA-YLLFY 465

 Score = 33.5 bits (75), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 13/26 (50%), Positives = 21/26 (80%)

Query: 94  LKRGGFIAGLVNDGNTCFMNSVLQSL 119
           ++R   ++GL+N G+TCFM+S+LQ L
Sbjct: 130 MERRDGLSGLINMGSTCFMSSILQCL 155

>Suva_14.156 Chr14 (285613..287979) [2367 bp, 788 aa] {ON} YNL186W
           (REAL)
          Length = 788

 Score = 45.1 bits (105), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 23/60 (38%), Positives = 33/60 (55%), Gaps = 2/60 (3%)

Query: 678 PLTYSLRSVIVHYG-THNYGHYIAF-RKYRGCWWRISDETVYVVDEAEVLSTPGVFMLFY 735
           P+ Y L SV+VH G + + GHYIA  ++  G W    DE +  + E +VL  P  + L Y
Sbjct: 666 PVKYQLLSVVVHEGRSLSSGHYIAHCKQPDGTWATYDDEYINKISERDVLKEPNAYYLLY 725

>TDEL0B03670 Chr2 complement(656511..657902) [1392 bp, 463 aa] {ON}
           Anc_8.742 YMR223W
          Length = 463

 Score = 44.7 bits (104), Expect = 9e-04,   Method: Compositional matrix adjust.
 Identities = 30/84 (35%), Positives = 40/84 (47%), Gaps = 7/84 (8%)

Query: 658 DVIPAPPINYARSF-----STVPATPLTYSLRSVIVHYGTHNYGHYIAFRKYRG-CWWRI 711
           D I  PP    R +     S V    L Y L  V+ H GT N GHY+A  K  G  W++ 
Sbjct: 375 DFIEYPPYLNMRDYCSSGDSDVDVPDLIYELIGVVAHKGTVNEGHYVATTKVAGRQWFKF 434

Query: 712 SDETVYVVDEAEVLSTPGVFMLFY 735
           +D  V  V + E L+    ++LFY
Sbjct: 435 NDSMVSSVTQEEALNEQA-YLLFY 457

 Score = 33.1 bits (74), Expect = 3.0,   Method: Compositional matrix adjust.
 Identities = 24/91 (26%), Positives = 45/91 (49%), Gaps = 15/91 (16%)

Query: 43  IFGI-----VVFFYKKPDHLNYIVESVSEMTTNFRNNNSLSRWLPRSKFTHLDEEILKRG 97
           +FGI     ++F +K  D++      ++ M   + ++ S+   +P          + +R 
Sbjct: 84  VFGINSSNGLLFCFKCSDYIGNNELIIASMLNKYWDDVSIKTVVP---------SVERRD 134

Query: 98  GFIAGLVNDGNTCFMNSVLQSLASSRELMEF 128
           G + GL+N G+TCFM+S+LQ L  +     F
Sbjct: 135 G-LHGLLNLGSTCFMSSILQILIRNPYFFNF 164

>Skud_13.392 Chr13 (690758..692179) [1422 bp, 473 aa] {ON} YMR223W
           (REAL)
          Length = 473

 Score = 44.7 bits (104), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 23/58 (39%), Positives = 33/58 (56%), Gaps = 2/58 (3%)

Query: 679 LTYSLRSVIVHYGTHNYGHYIAFRKYRGC-WWRISDETVYVVDEAEVLSTPGVFMLFY 735
           + Y L  ++ H GT N GHYIAF K  G  W++ +D  V  + + EVL     ++LFY
Sbjct: 411 IIYELIGIVSHKGTVNEGHYIAFCKISGGQWFKFNDSMVSSISQEEVLKEQA-YLLFY 467

 Score = 36.6 bits (83), Expect = 0.29,   Method: Compositional matrix adjust.
 Identities = 26/82 (31%), Positives = 43/82 (52%), Gaps = 15/82 (18%)

Query: 43  IFGI-----VVFFYKKPDHLNYIVESVSEMTTNFRNNNSLSRWLPRSKFTHLDEEILKRG 97
           IFGI     ++F +K  D+L  I         N  N+  L+++        +   + +R 
Sbjct: 84  IFGINSSNGLLFCFKCEDYLGNI---------NLINDAILAKYWDDVSTKTMVPAMERRD 134

Query: 98  GFIAGLVNDGNTCFMNSVLQSL 119
           G ++GL+N G+TCFM+S+LQ L
Sbjct: 135 G-LSGLINMGSTCFMSSILQCL 155

>Kpol_1044.24 s1044 (56564..58738) [2175 bp, 724 aa] {ON}
           (56564..58738) [2175 nt, 725 aa]
          Length = 724

 Score = 44.7 bits (104), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 24/60 (40%), Positives = 32/60 (53%), Gaps = 2/60 (3%)

Query: 678 PLTYSLRSVIVHYG-THNYGHYIAF-RKYRGCWWRISDETVYVVDEAEVLSTPGVFMLFY 735
           P+ Y L SV+VH G + + GHYIA  R+  G W    DE +  + E  VL  P  + L Y
Sbjct: 604 PVKYQLISVVVHEGRSLSSGHYIAHCRQPDGSWAIYDDEYINKISERNVLKEPNAYYLIY 663

>Suva_13.407 Chr13 (697513..698928) [1416 bp, 471 aa] {ON} YMR223W
           (REAL)
          Length = 471

 Score = 44.3 bits (103), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 23/58 (39%), Positives = 33/58 (56%), Gaps = 2/58 (3%)

Query: 679 LTYSLRSVIVHYGTHNYGHYIAFRKYRGC-WWRISDETVYVVDEAEVLSTPGVFMLFY 735
           + Y L  ++ H GT N GHYIAF K  G  W++ +D  V  + + EVL     ++LFY
Sbjct: 409 IIYELIGIVSHKGTVNEGHYIAFCKISGGQWFKFNDSMVSSISQEEVLKEQA-YLLFY 465

 Score = 38.1 bits (87), Expect = 0.096,   Method: Compositional matrix adjust.
 Identities = 26/82 (31%), Positives = 43/82 (52%), Gaps = 15/82 (18%)

Query: 43  IFGI-----VVFFYKKPDHLNYIVESVSEMTTNFRNNNSLSRWLPRSKFTHLDEEILKRG 97
           IFGI     ++F +K  D+L  I      + T + ++ S    +P          I++R 
Sbjct: 84  IFGINSNNGLLFCFKCEDYLGNIELINDAILTKYWDDVSTKTVVP----------IMERR 133

Query: 98  GFIAGLVNDGNTCFMNSVLQSL 119
             ++GL+N G+TCFM+S+LQ L
Sbjct: 134 DGLSGLINMGSTCFMSSILQCL 155

>Smik_15.301 Chr15 complement(515941..519759) [3819 bp, 1272 aa] {ON}
            YOR124C (REAL)
          Length = 1272

 Score = 44.7 bits (104), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 23/49 (46%), Positives = 29/49 (59%), Gaps = 3/49 (6%)

Query: 681  YSLRSVIVHYGTHNYGHY---IAFRKYRGCWWRISDETVYVVDEAEVLS 726
            YSL SV +H G  +YGHY   I  R + G W + +DETV  V E EV +
Sbjct: 1193 YSLFSVFIHRGEASYGHYWIYIKDRNHNGVWRKYNDETVSEVQEDEVFN 1241

>ZYRO0G01606g Chr7 complement(123893..127810) [3918 bp, 1305 aa] {ON}
            similar to uniprot|Q01476 Saccharomyces cerevisiae
            YOR124C UBP2 Ubiquitin-specific protease that removes
            ubiquitin from ubiquitinated proteins cleaves at the C
            terminus of ubiquitin fusions capable of cleaving
            polyubiquitin and possesses isopeptidase activity
          Length = 1305

 Score = 44.7 bits (104), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 28/84 (33%), Positives = 45/84 (53%), Gaps = 11/84 (13%)

Query: 679  LTYSLRSVIVHYGTHNYGHYIAFRKYR---GCWWRISDETVYVVDEAEVL-------STP 728
            + YSL +V +H G  +YGHY  + K R   G W + +DET+  V E+EV        +TP
Sbjct: 1221 IGYSLFAVFIHRGEASYGHYWIYIKDRYKSGIWRKYNDETITEVPESEVFNFSEGNTATP 1280

Query: 729  GVFMLFYEYDFDEETGKMKDDLEA 752
              F+++ +   ++E   +K  LE 
Sbjct: 1281 -YFLVYVKQGHEQEIEPLKRVLEV 1303

>NDAI0F03410 Chr6 complement(820002..822614) [2613 bp, 870 aa] {ON}
           Anc_2.69 YNL186W
          Length = 870

 Score = 44.7 bits (104), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 23/60 (38%), Positives = 33/60 (55%), Gaps = 2/60 (3%)

Query: 678 PLTYSLRSVIVHYG-THNYGHYIAF-RKYRGCWWRISDETVYVVDEAEVLSTPGVFMLFY 735
           P  Y L SV+VH G + + GHYIA  R+  G W    DE +  + E ++L+ P  + L Y
Sbjct: 758 PAKYQLLSVVVHEGRSLSSGHYIAHCRQPDGTWATYDDELINKISELKLLTEPNAYYLVY 817

>NCAS0G01800 Chr7 (319652..322279) [2628 bp, 875 aa] {ON} Anc_2.69
          Length = 875

 Score = 44.7 bits (104), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 25/71 (35%), Positives = 34/71 (47%), Gaps = 2/71 (2%)

Query: 667 YARSFSTVPATPLTYSLRSVIVHYG-THNYGHYIAF-RKYRGCWWRISDETVYVVDEAEV 724
           Y  + S     P+ Y L SV+VH G + + GHYIA  R+  G W    DE +  + E  V
Sbjct: 677 YCETPSGTKQLPVKYELLSVVVHEGRSLSSGHYIAHCRQPDGSWATYDDEYINKISELNV 736

Query: 725 LSTPGVFMLFY 735
           L     + L Y
Sbjct: 737 LKEANAYYLLY 747

>KAFR0L01730 Chr12 (316860..318965) [2106 bp, 701 aa] {ON} Anc_7.390
           YBL067C
          Length = 701

 Score = 44.3 bits (103), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 29/69 (42%), Positives = 35/69 (50%), Gaps = 11/69 (15%)

Query: 681 YSLRSVIVHYGTH-NYGHYIAFRKYRGCWWRI-SDETVYVVDEAEVLSTPG-----VFML 733
           Y L S ++H G    YGHYI+  K     W +  DETV  VDE  VLS  G      ++L
Sbjct: 559 YELASAVIHLGDGPQYGHYISLCKTETFGWLLFDDETVEAVDEQTVLSFTGENSDTAYVL 618

Query: 734 FY----EYD 738
           FY    EYD
Sbjct: 619 FYNEVSEYD 627

>NCAS0C02110 Chr3 (398702..400186) [1485 bp, 494 aa] {ON} Anc_8.540
           YPL072W
          Length = 494

 Score = 44.3 bits (103), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 50/189 (26%), Positives = 85/189 (44%), Gaps = 26/189 (13%)

Query: 323 LMTPLDGITAERIGCLQCGENGGIRYSVFSGLSLNLPNENIGSTLKLSQLLSDWSKPEII 382
           L  P  GI    + CLQCG    +    F    L LP +    ++KLS L+ +  + E I
Sbjct: 187 LTVPFKGIVGNHLVCLQCGRTSHVNEQPFYIYELTLPQQ---GSVKLSDLV-NGEQMETI 242

Query: 383 EGVECNRCALTAAHSHLFGQLKEFEKKPEGSIPEKLINAVKDRVHQIEEVLAKPVIDDED 442
           E   C  C   A  ++      E E+K   S  +  +N +K     ++  L+  +I++E 
Sbjct: 243 ENYSCMYCKTVAMLTN------EREEKSNVSRTDAELNILKF----LKGKLSTLLINEEL 292

Query: 443 YKKL-HTANMVRK--CSKS--KQILISRP-----PPLLSIHINRSVFDPRTYMIRKNNSK 492
            + + H  N   K  C+ S  K +++ +      P +  IH++RSVF+   Y   +N  +
Sbjct: 293 PEHITHYINSYNKGYCNTSEIKSVIVRKSTFAEFPEIFLIHLSRSVFNGMNY--SRNPCQ 350

Query: 493 VLFKSRLNL 501
           V F+  + L
Sbjct: 351 VEFEEEILL 359

 Score = 34.7 bits (78), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 15/32 (46%), Positives = 20/32 (62%)

Query: 99  FIAGLVNDGNTCFMNSVLQSLASSRELMEFLD 130
           F  GLVN GN CF+NS +Q+L    +L  +L 
Sbjct: 74  FTTGLVNPGNDCFINSSIQALVPLDKLTTYLS 105

>ZYRO0D03982g Chr4 (324687..327152) [2466 bp, 821 aa] {ON} weakly
           similar to uniprot|Q02863 Saccharomyces cerevisiae
           YPL072W UBP16 Putative ubiquitin-specific protease
          Length = 821

 Score = 44.3 bits (103), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 58/246 (23%), Positives = 99/246 (40%), Gaps = 33/246 (13%)

Query: 287 GQLNLGEVGTVYIPTEQIDPNSILHDKSIQNFTPFKLMTPLDGITAERIGCLQCGENGGI 346
           GQ +  E+  V + T Q + N I      Q         P  G  A+ + C  C  +  +
Sbjct: 295 GQNDAHELTQVILETLQKENNKIREFAKNQKLPVDIPEIPFRGKVADHLVCTACRNSSKV 354

Query: 347 RYSVFSGLSLNLPNENIGSTLKLSQLLSDWSKPEIIEGVECNRCALTAAHSHLFGQLKEF 406
           R + F+ L L +P      T KL++++SD ++ E IEG  C  C +        G++ E 
Sbjct: 355 RVTQFNMLPLAVPQ---AITAKLAEMVSD-NQVESIEGYSCLTCKV--------GKILEN 402

Query: 407 EKKPEGSIPEKLINAVKDRVHQIEEVLAKPVIDDE----------DYKKLHTANMVRKCS 456
           EK  + S  E      ++ +  +        I+D+           Y +        K +
Sbjct: 403 EKGRDTSSYE---TTEQNTLASLARAFPNLTINDDVSEELMNYINGYNRDGLVTSQLKST 459

Query: 457 KSKQILISRPPPLLSIHINRSVFDPRTYMIRKNNSKVLFKSRLNLAPW------CCDINE 510
             K+ ++   P +L IH++RS+F+   Y   +N   V F   L L         C  IN 
Sbjct: 460 IVKKNVVVDAPQVLLIHLSRSMFNGTNYT--RNPCAVNFDEILQLQEQVIQNDRCVGINS 517

Query: 511 INLDAR 516
           +N + +
Sbjct: 518 VNYELK 523

>Skud_14.148 Chr14 (278827..281157) [2331 bp, 776 aa] {ON} YNL186W
           (REAL)
          Length = 776

 Score = 43.9 bits (102), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 23/60 (38%), Positives = 33/60 (55%), Gaps = 2/60 (3%)

Query: 678 PLTYSLRSVIVHYG-THNYGHYIAF-RKYRGCWWRISDETVYVVDEAEVLSTPGVFMLFY 735
           P+ Y L SV+VH G + + GHYIA  ++  G W    DE +  + E +VL  P  + L Y
Sbjct: 654 PVKYQLLSVVVHEGRSLSSGHYIAHCKQPDGNWATYDDEYINKISERDVLKEPNAYYLLY 713

>Kwal_14.2008 s14 (571638..572912) [1275 bp, 424 aa] {ON} YDR069C
           (DOA4) - ubiquitin isopeptidase [contig 424] PARTIAL
          Length = 424

 Score = 43.5 bits (101), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 21/46 (45%), Positives = 34/46 (73%), Gaps = 2/46 (4%)

Query: 89  LDEEILKRGGFI-AGLVNDGNTCFMNSVLQSLASSRELME-FLDNN 132
           ++  ++KRG  I  GLVN GN+C+MN ++Q L  +REL++ FLD++
Sbjct: 43  MNSSLVKRGLNINVGLVNLGNSCYMNCIIQCLLGTRELVQIFLDDS 88

>KLLA0D08459g Chr4 complement(718046..720298) [2253 bp, 750 aa] {ON}
           some similarities with uniprot|P53874 Saccharomyces
           cerevisiae YNL186W UBP10 Ubiquitin-specific protease
           that deubiquitinates ubiquitin-protein moieties may
           regulate silencing by acting on Sir4p involved in
           posttranscriptionally regulating Gap1p and possibly
           other transporters primarily located in the nucleus
          Length = 750

 Score = 43.9 bits (102), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 22/65 (33%), Positives = 36/65 (55%), Gaps = 2/65 (3%)

Query: 673 TVPATPLTYSLRSVIVHYG-THNYGHYIAF-RKYRGCWWRISDETVYVVDEAEVLSTPGV 730
           ++ + P+ Y L SV+VH G + + GHYIA  ++  G W    DE +  + E ++L  P  
Sbjct: 631 SISSLPVRYQLISVVVHEGRSLSSGHYIAHCKQPDGSWATYDDEYINKISEKQLLKEPNA 690

Query: 731 FMLFY 735
           + L Y
Sbjct: 691 YFLVY 695

>NDAI0E00810 Chr5 complement(163826..165307) [1482 bp, 493 aa] {ON}
           Anc_8.742
          Length = 493

 Score = 43.5 bits (101), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 23/58 (39%), Positives = 31/58 (53%), Gaps = 2/58 (3%)

Query: 679 LTYSLRSVIVHYGTHNYGHYIAFRKYR-GCWWRISDETVYVVDEAEVLSTPGVFMLFY 735
           + Y L S+I H GT N GHYI   K   G W++ +D  V  + E E L     ++LFY
Sbjct: 431 MIYELTSIISHKGTVNEGHYIVVVKVNDGQWFKFNDSMVSAITEEEALKQQA-YLLFY 487

 Score = 39.3 bits (90), Expect = 0.043,   Method: Compositional matrix adjust.
 Identities = 21/40 (52%), Positives = 27/40 (67%), Gaps = 2/40 (5%)

Query: 80  WLPRSKFTHLDEEILKRGGFIAGLVNDGNTCFMNSVLQSL 119
           W   SK TH+  +  K G F  GLVN G+TCFM+S+LQ+L
Sbjct: 118 WDDISKKTHITSQERKDGLF--GLVNMGSTCFMSSILQTL 155

 Score = 32.7 bits (73), Expect = 4.5,   Method: Compositional matrix adjust.
 Identities = 17/44 (38%), Positives = 26/44 (59%), Gaps = 3/44 (6%)

Query: 241 GYDQEDAQEFFQNILAELESNVKSLNTEKL---DTTPVAKSELP 281
           GY Q+DA EF Q IL ++ ++ K  + E +   +TT +A   LP
Sbjct: 225 GYSQQDAHEFLQFILNQIHNDYKLNSMEDVNSGNTTAIAMKTLP 268

>YOR124C Chr15 complement(554824..558642) [3819 bp, 1272 aa] {ON}
            UBP2Ubiquitin-specific protease that removes ubiquitin
            from ubiquitinated proteins; interacts with Rsp5p and is
            required for MVB sorting of membrane proteins; can cleave
            polyubiquitin and has isopeptidase activity
          Length = 1272

 Score = 43.5 bits (101), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 22/49 (44%), Positives = 29/49 (59%), Gaps = 3/49 (6%)

Query: 681  YSLRSVIVHYGTHNYGHYIAFRKYR---GCWWRISDETVYVVDEAEVLS 726
            YSL SV +H G  +YGHY  + K R   G W + +DET+  V E EV +
Sbjct: 1193 YSLFSVFIHRGEASYGHYWIYIKDRNRNGIWRKYNDETISEVQEEEVFN 1241

>TDEL0B03060 Chr2 (545366..547570) [2205 bp, 734 aa] {ON} Anc_8.540
           YPL072W
          Length = 734

 Score = 43.5 bits (101), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 43/180 (23%), Positives = 76/180 (42%), Gaps = 27/180 (15%)

Query: 326 PLDGITAERIGCLQCGENGGIRYSVFSGLSLNLPNENIGSTLKLSQLLSDWSKPEIIEGV 385
           P  G  A+ + C++C  +  +    F    L +P      + KLS ++SD ++ + IEG 
Sbjct: 297 PFGGQLADHLVCMKCTNSSKVNIHPFIIYPLTVPQ---AMSAKLSDMVSD-NQTDTIEGY 352

Query: 386 ECNRCALTAAHSHLFGQLKEFEKKPEGSIPEKLINAVKDRVHQIEEVLAKPVIDDE---- 441
            C  C ++         +  +EK   G    K     K  +  +E+ L    I+DE    
Sbjct: 353 SCLTCKVST--------IVNYEK---GRGYAKCTQEEKRILKTLEDALPDMAINDELSDE 401

Query: 442 ------DYKKLHTANMVRKCSKSKQILISRPPPLLSIHINRSVFDPRTYMIRKNNSKVLF 495
                  Y K        K +  K+ ++   P  L +H++RS+FD  +Y  ++N+  V F
Sbjct: 402 LTSYINSYNKDGIVGADLKSTIVKKTVVVESPKTLVMHLSRSMFDGISY--QRNSCGVAF 459

 Score = 35.4 bits (80), Expect = 0.60,   Method: Compositional matrix adjust.
 Identities = 11/29 (37%), Positives = 20/29 (68%)

Query: 674 VPATPLTYSLRSVIVHYGTHNYGHYIAFR 702
           V   P++Y L++++ H G+H+ GHY  +R
Sbjct: 476 VGINPISYKLKAIVAHSGSHSQGHYECYR 504

>Suva_8.176 Chr8 complement(312595..316407) [3813 bp, 1270 aa] {ON}
            YOR124C (REAL)
          Length = 1270

 Score = 43.1 bits (100), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 22/49 (44%), Positives = 29/49 (59%), Gaps = 3/49 (6%)

Query: 681  YSLRSVIVHYGTHNYGHYIAFRKYR---GCWWRISDETVYVVDEAEVLS 726
            YSL SV +H G  +YGHY  + K R   G W + +DET+  V E EV +
Sbjct: 1191 YSLFSVFIHRGEASYGHYWIYIKDRNQNGVWRKYNDETISEVPEEEVFN 1239

>Kpol_1062.23 s1062 (51365..55165) [3801 bp, 1266 aa] {ON}
            (51365..55165) [3801 nt, 1267 aa]
          Length = 1266

 Score = 43.1 bits (100), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 21/51 (41%), Positives = 30/51 (58%), Gaps = 3/51 (5%)

Query: 679  LTYSLRSVIVHYGTHNYGHYIAFRK---YRGCWWRISDETVYVVDEAEVLS 726
            + YSL +V +H G  +YGHY  + K     G W + +DET+  V EAEV +
Sbjct: 1186 IGYSLFAVFIHRGEASYGHYWVYIKDFTKNGIWRKYNDETITEVPEAEVFN 1236

>NDAI0C05900 Chr3 complement(1350639..1353119) [2481 bp, 826 aa]
           {ON} Anc_8.188 YDR069C
          Length = 826

 Score = 42.7 bits (99), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 22/62 (35%), Positives = 29/62 (46%), Gaps = 4/62 (6%)

Query: 678 PLTYSLRSVIVHYGTHNYGHYIAFRK---YRGCWWRISDETVYVVDEAEVLSTPGVFMLF 734
           P  Y L +V  H G    GHY A+     YRG W+R  D +   V       TP  ++LF
Sbjct: 762 PFKYKLNAVSCHSGNLGSGHYTAYVDKGLYRG-WFRFDDASYRPVKFGTEFLTPDAYLLF 820

Query: 735 YE 736
           Y+
Sbjct: 821 YQ 822

 Score = 33.5 bits (75), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 15/38 (39%), Positives = 21/38 (55%)

Query: 99  FIAGLVNDGNTCFMNSVLQSLASSRELMEFLDNNVIRT 136
           F  GL N  N+C+MN V+Q L S+ +L +    N   T
Sbjct: 456 FTTGLENVKNSCYMNCVIQCLLSTHDLTKLYLTNAFLT 493

>TDEL0D02580 Chr4 (493355..497173) [3819 bp, 1272 aa] {ON} Anc_5.443
            YOR124C
          Length = 1272

 Score = 42.7 bits (99), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 21/51 (41%), Positives = 30/51 (58%), Gaps = 3/51 (5%)

Query: 679  LTYSLRSVIVHYGTHNYGHYIAFRKYR---GCWWRISDETVYVVDEAEVLS 726
            + YSL +V +H G  +YGHY  + K R   G W + +DET+  V E EV +
Sbjct: 1189 IGYSLFAVFIHRGEASYGHYWVYIKDRSKNGTWRKYNDETITEVPETEVFN 1239

>KAFR0A04210 Chr1 (843659..844981) [1323 bp, 440 aa] {ON} Anc_8.742
           YMR223W
          Length = 440

 Score = 42.4 bits (98), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 24/60 (40%), Positives = 32/60 (53%), Gaps = 2/60 (3%)

Query: 677 TPLTYSLRSVIVHYGTHNYGHYIAFRKY-RGCWWRISDETVYVVDEAEVLSTPGVFMLFY 735
           + + Y L  VI H GT N GHYIA  K     W++ +D  V  + E EVL     ++LFY
Sbjct: 376 SSIIYELNGVISHIGTVNEGHYIATLKLDSNNWFKFNDSMVTSISEEEVLKDQA-YLLFY 434

>SAKL0G02728g Chr7 complement(223607..227320) [3714 bp, 1237 aa] {ON}
            similar to uniprot|Q01476 Saccharomyces cerevisiae
            YOR124C UBP2 Ubiquitin-specific protease that removes
            ubiquitin from ubiquitinated proteins cleaves at the C
            terminus of ubiquitin fusions capable of cleaving
            polyubiquitin and possesses isopeptidase activity
          Length = 1237

 Score = 42.4 bits (98), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 25/70 (35%), Positives = 37/70 (52%), Gaps = 5/70 (7%)

Query: 660  IPAPPINYARSFSTVPATPLTYSLRSVIVHYGTHNYGH---YIAFRKYRGCWWRISDETV 716
            I A  +  A  F+    T + YSL +  +H G  +YGH   YI  RK  G W + +DE+V
Sbjct: 1138 ITALEVQIANQFNEF--TKIGYSLFAAFIHRGEASYGHYWIYIKDRKKNGIWRKYNDESV 1195

Query: 717  YVVDEAEVLS 726
              V ++EV +
Sbjct: 1196 TEVPQSEVFN 1205

 Score = 33.9 bits (76), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 17/43 (39%), Positives = 25/43 (58%)

Query: 89  LDEEILKRGGFIAGLVNDGNTCFMNSVLQSLASSRELMEFLDN 131
           +D   L  G +  GL N GNTC++NS+LQ   S   L +++ N
Sbjct: 689 VDVSCLPAGNWPTGLNNIGNTCYLNSLLQYYFSISPLRDYVLN 731

>NDAI0E04180 Chr5 complement(941527..944010) [2484 bp, 827 aa] {ON}
           Anc_7.390 YBL067C
          Length = 827

 Score = 42.4 bits (98), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 26/70 (37%), Positives = 36/70 (51%), Gaps = 9/70 (12%)

Query: 681 YSLRSVIVHYGTH-NYGHYIAFRKY-RGCWWRISDETVYVVDEAEVLSTPG-------VF 731
           Y L+ ++VH G+    GHY+A  K  +  W    DET   ++E EVLS  G        +
Sbjct: 672 YKLQGIVVHMGSSPQQGHYVAICKTDKYGWLLFDDETASWINEEEVLSFIGDEKSQNTAY 731

Query: 732 MLFYEYDFDE 741
           +LFYE   DE
Sbjct: 732 VLFYEEVKDE 741

>AEL242W Chr5 (182610..184451) [1842 bp, 613 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YPL072W (UBP16)
          Length = 613

 Score = 42.0 bits (97), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 43/174 (24%), Positives = 77/174 (44%), Gaps = 7/174 (4%)

Query: 326 PLDGITAERIGCLQCGENGGIRYSVFSGLSLNLPNENIGSTLKLSQLLSDWSKPEIIEGV 385
           P+ G  A+ + CL+CG +  +    FS  +L +PN    ++  L  +L D ++ E I+  
Sbjct: 252 PIRGSLADNLVCLRCGGSSKVNVHQFSMHTLPVPN---ATSADLRDMLFD-NQTETIDDY 307

Query: 386 ECNRCALTAAHSHLFGQLKEFEKKPEGSIPEKLINAVKDRVHQIEEVLAKPVIDDEDYKK 445
            C  C + A  +    + ++     E +I E+L   +   +   E++          Y K
Sbjct: 308 TCVSCQIRAILATEKNRGRQGVDSTELAIIEELAR-LAPSISINEDMPPHLAAYVSAYNK 366

Query: 446 LHTANMVRKCSKSKQILISRPPPLLSIHINRSVFDPRTYMIRKNNSKVLFKSRL 499
            H      K +  K+ +    P +L +H++RSVF+  +Y   KN   V F   L
Sbjct: 367 DHCITAALKSTIVKRTVSVDSPRVLILHLSRSVFNGVSYA--KNTCNVTFPEEL 418

 Score = 32.0 bits (71), Expect = 7.0,   Method: Compositional matrix adjust.
 Identities = 12/22 (54%), Positives = 15/22 (68%)

Query: 681 YSLRSVIVHYGTHNYGHYIAFR 702
           Y L ++I H GTH+ GHY  FR
Sbjct: 438 YKLCAMIKHIGTHSQGHYACFR 459

>KNAG0G02930 Chr7 (644555..645934) [1380 bp, 459 aa] {ON} Anc_8.742
           YMR223W
          Length = 459

 Score = 42.0 bits (97), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 21/61 (34%), Positives = 31/61 (50%), Gaps = 1/61 (1%)

Query: 675 PATPLTYSLRSVIVHYGTHNYGHYIAFRKY-RGCWWRISDETVYVVDEAEVLSTPGVFML 733
           P T + Y L  V+ H GT N GHY A  +   G W++ +D  + VV   +VL      +L
Sbjct: 390 PTTSIVYRLSGVVSHSGTVNEGHYTAVLQLNSGEWFKFNDSMISVVSAEDVLREQAYLLL 449

Query: 734 F 734
           +
Sbjct: 450 Y 450

 Score = 34.3 bits (77), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 16/26 (61%), Positives = 22/26 (84%), Gaps = 1/26 (3%)

Query: 94  LKRGGFIAGLVNDGNTCFMNSVLQSL 119
           L+R G + GL+N G+TCFM+S+LQSL
Sbjct: 131 LRRDG-LYGLLNLGSTCFMSSILQSL 155

>ZYRO0C09812g Chr3 complement(743861..745969) [2109 bp, 702 aa] {ON}
           some similarities with uniprot|P53874 Saccharomyces
           cerevisiae YNL186W UBP10 Ubiquitin-specific protease
           that deubiquitinates ubiquitin-protein moieties may
           regulate silencing by acting on Sir4p involved in
           posttranscriptionally regulating Gap1p and possibly
           other transporters primarily located in the nucleus
          Length = 702

 Score = 42.0 bits (97), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 22/60 (36%), Positives = 33/60 (55%), Gaps = 2/60 (3%)

Query: 678 PLTYSLRSVIVHYG-THNYGHYIAF-RKYRGCWWRISDETVYVVDEAEVLSTPGVFMLFY 735
           PL Y L +V+VH G + + GHYI   ++  G W    DE +  ++E +VL  P  + L Y
Sbjct: 584 PLKYQLITVVVHEGRSLSSGHYIVHCKQPEGHWATYDDEYINNINEKDVLREPNAYYLVY 643

>Ecym_4514 Chr4 complement(1025172..1028912) [3741 bp, 1246 aa] {ON}
            similar to Ashbya gossypii ACL164C
          Length = 1246

 Score = 42.4 bits (98), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 21/52 (40%), Positives = 30/52 (57%), Gaps = 3/52 (5%)

Query: 677  TPLTYSLRSVIVHYGTHNYGHYIAF---RKYRGCWWRISDETVYVVDEAEVL 725
            T   Y+L +V +H G  +YGHY  +   RK  G W + +DE+V  V E+EV 
Sbjct: 1164 TNFGYNLFAVFIHRGEASYGHYWVYIKDRKNSGIWRKYNDESVTEVPESEVF 1215

 Score = 35.0 bits (79), Expect = 0.93,   Method: Compositional matrix adjust.
 Identities = 16/43 (37%), Positives = 25/43 (58%)

Query: 89  LDEEILKRGGFIAGLVNDGNTCFMNSVLQSLASSRELMEFLDN 131
           +D   L  G +  GL N GNTC++NS+LQ   +   L +++ N
Sbjct: 684 IDTNYLTSGNWPTGLNNIGNTCYLNSLLQYYFTISPLRDYIQN 726

>CAGL0J11352g Chr10 complement(1103473..1105788) [2316 bp, 771 aa]
           {ON} similar to uniprot|P53874 Saccharomyces cerevisiae
           YNL186w UBP10
          Length = 771

 Score = 42.0 bits (97), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 22/60 (36%), Positives = 32/60 (53%), Gaps = 2/60 (3%)

Query: 678 PLTYSLRSVIVHYG-THNYGHYIAF-RKYRGCWWRISDETVYVVDEAEVLSTPGVFMLFY 735
           P+ Y L SV+VH G + + GHYIA  ++  G W    DE +  + E EVL     + + Y
Sbjct: 659 PVKYELLSVVVHEGRSLSSGHYIAHCKQPDGSWATYDDEYINKITEREVLKERNAYYVLY 718

>TBLA0A06470 Chr1 (1588461..1592423) [3963 bp, 1320 aa] {ON} Anc_5.443
            YOR124C
          Length = 1320

 Score = 42.0 bits (97), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 21/51 (41%), Positives = 29/51 (56%), Gaps = 3/51 (5%)

Query: 679  LTYSLRSVIVHYGTHNYGHYIAFRK---YRGCWWRISDETVYVVDEAEVLS 726
            L YSL +V +H G  +YGHY  + K     G W + +DE+V  V E EV +
Sbjct: 1235 LAYSLFAVFIHRGEASYGHYWVYIKDHSKNGIWRKYNDESVTEVPEQEVFN 1285

 Score = 34.7 bits (78), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 15/29 (51%), Positives = 21/29 (72%)

Query: 101 AGLVNDGNTCFMNSVLQSLASSRELMEFL 129
           AGL N GNTC++NS+LQ   S + L +F+
Sbjct: 762 AGLNNIGNTCYLNSLLQYYFSIKPLRDFI 790

>NCAS0H02100 Chr8 complement(406897..410706) [3810 bp, 1269 aa] {ON}
            Anc_5.443 YOR124C
          Length = 1269

 Score = 41.6 bits (96), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 21/49 (42%), Positives = 29/49 (59%), Gaps = 3/49 (6%)

Query: 679  LTYSLRSVIVHYGTHNYGHYIAFRKYR---GCWWRISDETVYVVDEAEV 724
            + YS+ +V +H G  +YGHY  + K R   G W + +DETV  V E EV
Sbjct: 1184 IGYSIFAVFIHRGEASYGHYWIYIKDRSQNGIWRKYNDETVSEVPEEEV 1232

 Score = 33.1 bits (74), Expect = 3.7,   Method: Compositional matrix adjust.
 Identities = 18/46 (39%), Positives = 28/46 (60%), Gaps = 3/46 (6%)

Query: 72  RNNNSLSRWLPRSKFTHLDEEILKRGGFIAGLVNDGNTCFMNSVLQ 117
           RN++ +S +L   K   +D   L    + AG+ N GNTC++NS+LQ
Sbjct: 687 RNSSLISNFLQTGK---IDPNCLPIKDWPAGINNIGNTCYLNSLLQ 729

>TPHA0O01640 Chr15 complement(325844..328084) [2241 bp, 746 aa] {ON}
           Anc_2.69 YNL186W
          Length = 746

 Score = 41.6 bits (96), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 23/59 (38%), Positives = 30/59 (50%), Gaps = 2/59 (3%)

Query: 679 LTYSLRSVIVHYG-THNYGHYIAFRKY-RGCWWRISDETVYVVDEAEVLSTPGVFMLFY 735
           + Y L SV+VH G + + GHYIA  K   G W    DE   ++ E  VL  P  + L Y
Sbjct: 614 VMYQLISVVVHEGRSLSSGHYIAHCKQPDGTWATYDDEYTNIISERNVLKEPNAYYLVY 672

>Kwal_26.9151 s26 complement(1095026..1096390) [1365 bp, 454 aa]
           {ON} YMR223W (UBP8) - putative deubiquitinating enzyme
           [contig 70] FULL
          Length = 454

 Score = 41.2 bits (95), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 22/62 (35%), Positives = 32/62 (51%), Gaps = 2/62 (3%)

Query: 675 PATPLTYSLRSVIVHYGTHNYGHYIAFRKYRGC-WWRISDETVYVVDEAEVLSTPGVFML 733
           P   + Y L +VI H G+ N GHY +  K  G  W+R +D  +  + E E L     ++L
Sbjct: 388 PVPDMMYELVAVISHEGSVNQGHYTSMCKIPGGQWFRFNDSMIVSISEEEALRQQA-YLL 446

Query: 734 FY 735
           FY
Sbjct: 447 FY 448

 Score = 33.9 bits (76), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 14/34 (41%), Positives = 24/34 (70%)

Query: 100 IAGLVNDGNTCFMNSVLQSLASSRELMEFLDNNV 133
           + GLVN G+TCFM+S++Q+L  +  +++   N V
Sbjct: 135 LCGLVNMGSTCFMSSIIQTLVHNPYVLKTCMNQV 168

>TDEL0A01100 Chr1 (186399..188384) [1986 bp, 661 aa] {ON} Anc_2.69
           YNL186W
          Length = 661

 Score = 41.2 bits (95), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 21/60 (35%), Positives = 32/60 (53%), Gaps = 2/60 (3%)

Query: 678 PLTYSLRSVIVHYG-THNYGHYIAF-RKYRGCWWRISDETVYVVDEAEVLSTPGVFMLFY 735
           P+ Y L +V+VH G + + GHYI   ++  G W    DE +  + E +VL  P  + L Y
Sbjct: 546 PVKYQLTTVVVHEGRSLSSGHYIVHCKQPDGTWATYDDEYINKITERDVLKEPNAYYLLY 605

>Smik_14.144 Chr14 (268784..271075) [2292 bp, 763 aa] {ON} YNL186W
           (REAL)
          Length = 763

 Score = 41.2 bits (95), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 22/60 (36%), Positives = 32/60 (53%), Gaps = 2/60 (3%)

Query: 678 PLTYSLRSVIVHYG-THNYGHYIAF-RKYRGCWWRISDETVYVVDEAEVLSTPGVFMLFY 735
           P+ Y L SV+VH G + + GHYIA  ++  G W    DE +  + E +VL     + L Y
Sbjct: 641 PVKYQLLSVVVHEGRSLSSGHYIAHCKQPDGSWATYDDEYINKISERDVLKETNAYYLLY 700

>Ecym_1166 Chr1 (339106..341196) [2091 bp, 696 aa] {ON} similar to
           Ashbya gossypii AEL242W
          Length = 696

 Score = 41.2 bits (95), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 48/188 (25%), Positives = 85/188 (45%), Gaps = 31/188 (16%)

Query: 326 PLDGITAERIGCLQCGENGGIRYSVFSGLSLNLPNENIGSTLKLSQLLSDWSKPEIIEGV 385
           P  G  A  + CL+C  +  +    F+  SL +P     S+  L  ++ D ++ E IEG 
Sbjct: 268 PFQGSLATNLICLRCNNSSKVNVHRFTMHSLPVPQM---SSASLKDMMFD-NQTETIEGY 323

Query: 386 ECNRCALTAAHSHLFGQLKEFEKKPEGSIPEKLINAVKDRVHQIEEVLAKPVIDDE---- 441
            C  C L A        L    ++   ++ ++     + ++  + ++L +  I+D+    
Sbjct: 324 SCISCRLRAI-------LNNERQRDYHNVSQE----ERAKLDDLAKLLPRICINDDLPEP 372

Query: 442 ------DYKK--LHTANMVRKCSKSKQILISRPPPLLSIHINRSVFDPRTYMIRKNNSKV 493
                  Y K   H  ++  +  K + +++S P  LL +H++RSVFD  TY   KN+  V
Sbjct: 373 LELYVKSYHKDGCHIPSLKSRILK-RTVVVSSPKVLL-LHLSRSVFDGVTYT--KNSCNV 428

Query: 494 LFKSRLNL 501
           LF   L L
Sbjct: 429 LFPEDLIL 436

 Score = 35.0 bits (79), Expect = 0.89,   Method: Compositional matrix adjust.
 Identities = 17/40 (42%), Positives = 24/40 (60%), Gaps = 2/40 (5%)

Query: 99  FIAGLVNDGNTCFMNSVLQSLASSRELMEFLD--NNVIRT 136
           +  GL N  N CF NS +Q+LAS   L E+L+    V+R+
Sbjct: 82  YTTGLTNSRNDCFANSSIQALASLPALAEYLNGVTEVVRS 121

>Smik_5.309 Chr5 complement(462971..465388) [2418 bp, 805 aa] {ON}
           YER144C (REAL)
          Length = 805

 Score = 41.2 bits (95), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 18/37 (48%), Positives = 24/37 (64%), Gaps = 1/37 (2%)

Query: 99  FIAGLVNDGNTCFMNSVLQSLASSRELME-FLDNNVI 134
           FI GL N GN C+MN +LQ L  + +L+  FLDN  +
Sbjct: 444 FIVGLENTGNCCYMNCILQCLVGTHDLVRMFLDNTYL 480

 Score = 35.0 bits (79), Expect = 0.95,   Method: Compositional matrix adjust.
 Identities = 20/65 (30%), Positives = 29/65 (44%), Gaps = 4/65 (6%)

Query: 678 PLTYSLRSVIVHYGTHNYGHYIAFRKYRG---CWWRISDETVYVVDEAEVLSTPGVFMLF 734
           P  Y L  V  H G+   GHY ++  Y+G    W+   D     +   +   TP  ++LF
Sbjct: 742 PFRYRLYGVACHSGSLYGGHYTSY-VYKGPKKGWYFFDDSIYRPIRFNDEFITPNAYVLF 800

Query: 735 YEYDF 739
           YE  F
Sbjct: 801 YERIF 805

>KNAG0A01970 Chr1 (157670..159085) [1416 bp, 471 aa] {ON} Anc_8.540
           YPL072W
          Length = 471

 Score = 40.8 bits (94), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 37/162 (22%), Positives = 75/162 (46%), Gaps = 12/162 (7%)

Query: 326 PLDGITAERIGCLQCGENGGIRYSVFSGLSLNLPNENIGSTLKLSQLLSDWSKPEIIEGV 385
           P +G T     CL+C +   +    F    L +P +   S   L  +L+D    E+IE  
Sbjct: 193 PFEGETTSFSVCLKCKQYSEVSAQKFLIHELVVPKK---SDAHLEDILTDGDS-ELIEDY 248

Query: 386 ECNRCALTAAHSHLFGQLKEFEKKPEGSIPEKLINAVKDRVH--QIEEVLAKPVID-DED 442
            C  C +TA  ++     +    KP      +++ +++  +   +I   L   ++D  + 
Sbjct: 249 SCLYCQITAILTN-----ESNTTKPPTGFEAEMVGSLQSLLPDLKINTALPDTLLDYVKS 303

Query: 443 YKKLHTANMVRKCSKSKQILISRPPPLLSIHINRSVFDPRTY 484
           Y+K +    + K +  ++  IS  P +LS+H++RS+F+  ++
Sbjct: 304 YRKGNCNTSILKTAIIRRTAISNAPSILSLHLSRSMFNGASF 345

 Score = 33.5 bits (75), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 14/27 (51%), Positives = 18/27 (66%)

Query: 676 ATPLTYSLRSVIVHYGTHNYGHYIAFR 702
           A  +TY LRS+I H GTH  GHY  ++
Sbjct: 370 AERITYRLRSMIKHTGTHYSGHYQCYK 396

 Score = 32.0 bits (71), Expect = 6.5,   Method: Compositional matrix adjust.
 Identities = 18/51 (35%), Positives = 29/51 (56%), Gaps = 1/51 (1%)

Query: 84  SKFTHLDEEILKRGGFIAGLVNDGNTCFMNSVLQSLASSRELMEFLDNNVI 134
           +KFT  D +  +   +  GL N  N CF+NS LQ+L+S   L  +L + ++
Sbjct: 49  AKFTE-DSDNKRMDKYTPGLSNPANECFINSSLQALSSLDYLTAYLHDALL 98

>KNAG0B04190 Chr2 (795803..799591) [3789 bp, 1262 aa] {ON} Anc_5.443
            YOR124C
          Length = 1262

 Score = 40.8 bits (94), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 21/48 (43%), Positives = 27/48 (56%), Gaps = 3/48 (6%)

Query: 681  YSLRSVIVHYGTHNYGHYIAFR---KYRGCWWRISDETVYVVDEAEVL 725
            YSL +V +H G  +YGHY  +    K  G W + +DETV  V E EV 
Sbjct: 1179 YSLFAVFIHRGEASYGHYWVYVKDFKNSGIWRKYNDETVSEVPEEEVF 1226

>CAGL0M11198g Chr13 (1102767..1104152) [1386 bp, 461 aa] {ON}
           similar to uniprot|P50102 Saccharomyces cerevisiae
           YMR223w UBP8
          Length = 461

 Score = 40.4 bits (93), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 22/58 (37%), Positives = 33/58 (56%), Gaps = 2/58 (3%)

Query: 679 LTYSLRSVIVHYGTHNYGHYIAFRKYR-GCWWRISDETVYVVDEAEVLSTPGVFMLFY 735
           + Y L  +I H G+ N GHY+AF K   G W++ +D  V  + E +VL     ++LFY
Sbjct: 399 ILYELIGIISHTGSVNEGHYVAFCKIENGEWFKFNDSMVTKILEKDVLKEQA-YLLFY 455

 Score = 33.1 bits (74), Expect = 3.3,   Method: Compositional matrix adjust.
 Identities = 17/59 (28%), Positives = 34/59 (57%), Gaps = 2/59 (3%)

Query: 71  FRNNNSLSRWLPRSKFTHLDEEILKRGGFIAGLVNDGNTCFMNSVLQSLASSRELMEFL 129
           FR+    +RW    ++T++       G  +AGLVN G+TC+M+S++Q +  +  ++ + 
Sbjct: 109 FRDAALANRWDYYEEYTNVPTVDQIDG--MAGLVNMGSTCYMSSIMQCIIHNPYMIRYF 165

>CAGL0A04477g Chr1 (442089..444401) [2313 bp, 770 aa] {ON} similar
           to uniprot|P38187 Saccharomyces cerevisiae YBL067c UBP13
           or uniprot|P39967 Saccharomyces cerevisiae YER098w UBP9
           ubiquitin carboxyl-terminal hydrolase
          Length = 770

 Score = 40.4 bits (93), Expect = 0.021,   Method: Compositional matrix adjust.
 Identities = 25/82 (30%), Positives = 38/82 (46%), Gaps = 9/82 (10%)

Query: 664 PINYARSFSTVPATPLTYSLRSVIVHYGTH-NYGHYIAFRKYRGCWWRI-SDETVYVVDE 721
           P++   S +  P+    Y L  ++VH G    +GHYI+  K     W +  DETV  + E
Sbjct: 596 PLDLKVSSTFNPSISKNYELSGIVVHMGGGPQHGHYISLCKNEKFGWLLFDDETVEAISE 655

Query: 722 AEVLSTPG-------VFMLFYE 736
             VL   G        ++LFY+
Sbjct: 656 QAVLQYTGDKDTMTTAYVLFYQ 677

>Suva_5.272 Chr5 complement(429119..431485) [2367 bp, 788 aa] {ON}
           YER144C (REAL)
          Length = 788

 Score = 40.0 bits (92), Expect = 0.025,   Method: Compositional matrix adjust.
 Identities = 18/37 (48%), Positives = 23/37 (62%), Gaps = 1/37 (2%)

Query: 99  FIAGLVNDGNTCFMNSVLQSLASSRELME-FLDNNVI 134
           FI GL N GN C+MN +LQ L  + +L   FLDN  +
Sbjct: 427 FIVGLENMGNCCYMNCILQCLVGTHDLTRMFLDNTYL 463

 Score = 36.2 bits (82), Expect = 0.35,   Method: Compositional matrix adjust.
 Identities = 22/65 (33%), Positives = 32/65 (49%), Gaps = 4/65 (6%)

Query: 678 PLTYSLRSVIVHYGTHNYGHYIAFRKYRGCW--WRISDETVY-VVDEAEVLSTPGVFMLF 734
           P  Y L  V  H G+   GHY ++  Y+G    W   D+T+Y ++       TP  ++LF
Sbjct: 725 PFRYRLYGVACHSGSLYGGHYTSY-VYKGPQKGWYFFDDTIYRLIRFNNEFITPNAYVLF 783

Query: 735 YEYDF 739
           YE  F
Sbjct: 784 YERIF 788

>Skud_5.281 Chr5 complement(448432..450903) [2472 bp, 823 aa] {ON}
           YER144C (REAL)
          Length = 823

 Score = 40.0 bits (92), Expect = 0.026,   Method: Compositional matrix adjust.
 Identities = 18/37 (48%), Positives = 23/37 (62%), Gaps = 1/37 (2%)

Query: 99  FIAGLVNDGNTCFMNSVLQSLASSRELME-FLDNNVI 134
           FI GL N GN C+MN +LQ L  + +L   FLDN  +
Sbjct: 462 FIVGLENMGNCCYMNCILQCLVGTHDLTRMFLDNTYL 498

 Score = 36.2 bits (82), Expect = 0.38,   Method: Compositional matrix adjust.
 Identities = 22/65 (33%), Positives = 32/65 (49%), Gaps = 4/65 (6%)

Query: 678 PLTYSLRSVIVHYGTHNYGHYIAFRKYRGCW--WRISDETVYV-VDEAEVLSTPGVFMLF 734
           P  Y L  V  H G+   GHY ++  Y+G    W   D++VY  +   +   TP  ++LF
Sbjct: 760 PFRYRLYGVACHSGSLYGGHYTSY-VYKGPQKGWYFFDDSVYCPIRFNDEFITPNAYVLF 818

Query: 735 YEYDF 739
           YE  F
Sbjct: 819 YERIF 823

>NDAI0C01550 Chr3 (327953..331840) [3888 bp, 1295 aa] {ON} Anc_5.443
            YOR124C
          Length = 1295

 Score = 40.0 bits (92), Expect = 0.031,   Method: Compositional matrix adjust.
 Identities = 20/49 (40%), Positives = 28/49 (57%), Gaps = 3/49 (6%)

Query: 681  YSLRSVIVHYGTHNYGHYIAFRK---YRGCWWRISDETVYVVDEAEVLS 726
            YSL +V +H G  +YGHY  + K     G W + +DETV  V + EV +
Sbjct: 1214 YSLFAVFIHRGEASYGHYWVYIKDYNQNGIWRKYNDETVSEVPDEEVFN 1262

>KAFR0A07580 Chr1 complement(1528362..1530770) [2409 bp, 802 aa]
           {ON} Anc_2.69 YNL186W
          Length = 802

 Score = 39.7 bits (91), Expect = 0.032,   Method: Compositional matrix adjust.
 Identities = 21/60 (35%), Positives = 32/60 (53%), Gaps = 2/60 (3%)

Query: 678 PLTYSLRSVIVHYG-THNYGHYIAF-RKYRGCWWRISDETVYVVDEAEVLSTPGVFMLFY 735
           P+ Y L SV+VH G + + GHY+A  ++  G W    DE +  + + EVL     + L Y
Sbjct: 670 PVKYQLISVVVHEGRSLSSGHYVAHCKQPDGLWATYDDEYINKISDKEVLRETNAYYLVY 729

>NCAS0B00580 Chr2 (86690..88090) [1401 bp, 466 aa] {ON} Anc_8.742
          Length = 466

 Score = 39.7 bits (91), Expect = 0.032,   Method: Compositional matrix adjust.
 Identities = 21/61 (34%), Positives = 33/61 (54%), Gaps = 3/61 (4%)

Query: 677 TP-LTYSLRSVIVHYGTHNYGHYIAFRKYR-GCWWRISDETVYVVDEAEVLSTPGVFMLF 734
           TP + Y L  ++ H G+ N GHY+   K   G W++ +D  + V+ E E L     ++LF
Sbjct: 401 TPDIIYELTGILSHIGSINEGHYVVVLKINDGRWFKFNDSMISVIKEDEALKQQA-YLLF 459

Query: 735 Y 735
           Y
Sbjct: 460 Y 460

 Score = 35.4 bits (80), Expect = 0.55,   Method: Compositional matrix adjust.
 Identities = 24/82 (29%), Positives = 42/82 (51%), Gaps = 15/82 (18%)

Query: 43  IFGI-----VVFFYKKPDHLNYIVESVSEMTTNFRNNNSLSRWLPRSKFTHLDEEILKRG 97
           +FGI     ++F +K  D++ ++      M   + ++ S    +P  +         +R 
Sbjct: 85  VFGINSSNGLLFCFKCMDYIGHLETINYSMLNKYWDDISTKTTIPSQE---------RRD 135

Query: 98  GFIAGLVNDGNTCFMNSVLQSL 119
           G   GLVN G+TCFM+S+LQ+L
Sbjct: 136 GLF-GLVNMGSTCFMSSILQAL 156

>CAGL0H05335g Chr8 complement(512683..514134) [1452 bp, 483 aa] {ON}
           weakly similar to uniprot|Q02863 Saccharomyces
           cerevisiae YPL072w UBP16
          Length = 483

 Score = 39.3 bits (90), Expect = 0.033,   Method: Compositional matrix adjust.
 Identities = 50/187 (26%), Positives = 76/187 (40%), Gaps = 31/187 (16%)

Query: 326 PLDGITAERIGCLQCGENGGIRYSVFSGLSLNLPNENIGSTLKLSQLLSDWSKPEIIEGV 385
           P  G   E   CLQC      + S F+     LP +     + L+ +L   S  EII+  
Sbjct: 199 PFAGTIIESYKCLQCQHETAPKKSTFNIFEAPLPQK---YEIDLNDVLMRNSN-EIIDDY 254

Query: 386 ECNRC----ALTAAHSHLF--------GQLKEFEKKPEGSIPEKLINAVKDRVHQIEEVL 433
           +C  C     +T   +H F        G+L   EKK    +P+  IN   D   +++  L
Sbjct: 255 KCMVCLIRSVITLERAHGFSGTAESIKGKLLALEKK----LPDITINEEFDI--ELQNYL 308

Query: 434 AKPVIDDEDYKKLHTANMVRKCSKSKQILISRPPPLLSIHINRSVFDPRTYMIRKNNSKV 493
                  + Y K    N V + S  KQ      P +  IH++RS ++  T+   +N  KV
Sbjct: 309 -------DTYCKYGFKNNVARRSILKQCKFVNAPDIFVIHLSRSTYNGMTFT--RNGCKV 359

Query: 494 LFKSRLN 500
            F   L+
Sbjct: 360 HFGETLD 366

 Score = 35.8 bits (81), Expect = 0.51,   Method: Compositional matrix adjust.
 Identities = 15/36 (41%), Positives = 24/36 (66%)

Query: 99  FIAGLVNDGNTCFMNSVLQSLASSRELMEFLDNNVI 134
           +  GLVN GN C+ NSV+Q+L+S     ++++  VI
Sbjct: 70  YTTGLVNKGNYCYANSVIQALSSIDYFSDYINKFVI 105

>TBLA0D01070 Chr4 complement(275843..277294) [1452 bp, 483 aa] {ON}
           Anc_8.742 YMR223W
          Length = 483

 Score = 39.3 bits (90), Expect = 0.035,   Method: Compositional matrix adjust.
 Identities = 26/100 (26%), Positives = 42/100 (42%), Gaps = 17/100 (17%)

Query: 658 DVIPAPPINYARSFSTVP---------------ATP-LTYSLRSVIVHYGTHNYGHYIAF 701
           D +  P     +SF T P               +TP + Y L  ++ H GT N GHYI +
Sbjct: 384 DFVEFPLHLNMKSFCTAPTPDTDPTNLNEKTNKSTPDMIYELTGIVTHRGTVNEGHYITY 443

Query: 702 RKYR-GCWWRISDETVYVVDEAEVLSTPGVFMLFYEYDFD 740
            K   G W++ +D  V  V   ++L      +++    F+
Sbjct: 444 TKTADGVWYQFNDSVVMKVPLEQMLKEQAYLLIYTIRQFN 483

>SAKL0H04994g Chr8 complement(445232..446596) [1365 bp, 454 aa] {ON}
           similar to uniprot|P50102 Saccharomyces cerevisiae
           YMR223W UBP8 Ubiquitin-specific protease that is a
           component of the SAGA (Spt-Ada-Gcn5-Acetyltransferase)
           acetylation complex required for SAGA-mediated
           deubiquitination of histone H2B
          Length = 454

 Score = 39.3 bits (90), Expect = 0.036,   Method: Compositional matrix adjust.
 Identities = 24/64 (37%), Positives = 34/64 (53%), Gaps = 3/64 (4%)

Query: 674 VPATP-LTYSLRSVIVHYGTHNYGHYIAFRKYRGC-WWRISDETVYVVDEAEVLSTPGVF 731
           V  TP + Y L  +I H G+ N GHY +  K  G  W++ +D  V  V E +VL     +
Sbjct: 386 VGETPAIVYELIGLISHQGSVNQGHYTSICKIPGGQWFKFNDSMVTAVAEIDVLKEQA-Y 444

Query: 732 MLFY 735
           +LFY
Sbjct: 445 LLFY 448

 Score = 35.8 bits (81), Expect = 0.42,   Method: Compositional matrix adjust.
 Identities = 16/25 (64%), Positives = 22/25 (88%), Gaps = 1/25 (4%)

Query: 95  KRGGFIAGLVNDGNTCFMNSVLQSL 119
           KR G +AGLVN G+TCFM+S++Q+L
Sbjct: 131 KRNG-LAGLVNMGSTCFMSSIIQTL 154

>Kwal_55.21393 s55 (816177..819878) [3702 bp, 1233 aa] {ON} YOR124C
            (UBP2) - Ubiquitin-specific protease [contig 130] FULL
          Length = 1233

 Score = 39.7 bits (91), Expect = 0.038,   Method: Compositional matrix adjust.
 Identities = 21/51 (41%), Positives = 28/51 (54%), Gaps = 3/51 (5%)

Query: 679  LTYSLRSVIVHYGTHNYGHYIAFRK---YRGCWWRISDETVYVVDEAEVLS 726
            L YSL +V +H G  +YGHY  + K     G W + +DETV    E EV +
Sbjct: 1148 LGYSLFAVFIHRGEASYGHYWLYIKDHNRNGIWRKYNDETVTEAPENEVFN 1198

>ACL164C Chr3 complement(67792..71961) [4170 bp, 1389 aa] {ON}
            Syntenic homolog of Saccharomyces cerevisiae YOR124C
            (UBP2)
          Length = 1389

 Score = 39.3 bits (90), Expect = 0.042,   Method: Compositional matrix adjust.
 Identities = 24/65 (36%), Positives = 33/65 (50%), Gaps = 15/65 (23%)

Query: 681  YSLRSVIVHYGTHNYGHYIAFRK---YRGCWWRISDETVYVVDEAEVLSTPGVFMLFYEY 737
            YSL +V +H G  +YGHY  + K     G W + +DE+V  V E+EV            +
Sbjct: 1310 YSLGAVFIHRGEASYGHYWVYIKDCQNGGIWRKYNDESVTEVPESEV------------F 1357

Query: 738  DFDEE 742
            DF EE
Sbjct: 1358 DFSEE 1362

 Score = 32.3 bits (72), Expect = 6.0,   Method: Compositional matrix adjust.
 Identities = 15/41 (36%), Positives = 24/41 (58%)

Query: 89  LDEEILKRGGFIAGLVNDGNTCFMNSVLQSLASSRELMEFL 129
           +D   L  G +  G+ N GNTC++NS+LQ   +   L E++
Sbjct: 665 VDINYLPAGNWPTGINNIGNTCYLNSLLQYYFTISPLREYI 705

>Kpol_513.25 s513 (71125..74697) [3573 bp, 1190 aa] {ON}
           (71125..74697) [3573 nt, 1191 aa]
          Length = 1190

 Score = 39.3 bits (90), Expect = 0.043,   Method: Compositional matrix adjust.
 Identities = 20/50 (40%), Positives = 26/50 (52%), Gaps = 2/50 (4%)

Query: 678 PLTYSLRSVIVHYGTHNYGHYIAFRK--YRGCWWRISDETVYVVDEAEVL 725
           P  Y L  V+VH G  + GHY A  K      W+R  DE V+ VD+ +V 
Sbjct: 438 PKNYKLHGVLVHTGDISTGHYYAMIKPTLEDQWYRFDDEKVWKVDKKQVF 487

>Ecym_6248 Chr6 (468203..469603) [1401 bp, 466 aa] {ON} similar to
           Ashbya gossypii AFR551W
          Length = 466

 Score = 38.9 bits (89), Expect = 0.044,   Method: Compositional matrix adjust.
 Identities = 19/62 (30%), Positives = 33/62 (53%), Gaps = 2/62 (3%)

Query: 675 PATPLTYSLRSVIVHYGTHNYGHYIAFRKYRG-CWWRISDETVYVVDEAEVLSTPGVFML 733
           P   + Y L ++I H+GT + GHY    +  G  W + +D  V V+ E ++L     ++L
Sbjct: 403 PVPNMMYKLSAIISHHGTVHQGHYTTICRINGDIWAKFNDSMVTVISEEDMLKEQA-YLL 461

Query: 734 FY 735
           +Y
Sbjct: 462 YY 463

 Score = 32.7 bits (73), Expect = 3.8,   Method: Compositional matrix adjust.
 Identities = 13/28 (46%), Positives = 21/28 (75%)

Query: 100 IAGLVNDGNTCFMNSVLQSLASSRELME 127
           + GLVN G+TCFM+SV+Q+L     +++
Sbjct: 135 LLGLVNMGSTCFMSSVIQTLVHIPHVLQ 162

>TPHA0G00560 Chr7 complement(105403..106794) [1392 bp, 463 aa] {ON}
           Anc_8.742 YMR223W
          Length = 463

 Score = 38.9 bits (89), Expect = 0.044,   Method: Compositional matrix adjust.
 Identities = 27/94 (28%), Positives = 41/94 (43%), Gaps = 14/94 (14%)

Query: 642 PKINVEDQLETSSDEEDVIPAPPINYARSFSTVPATPLTYSLRSVIVHYGTHNYGHYIAF 701
           P + + D  +TSS+E   I +P             + + Y L  VI H GT N GHYI  
Sbjct: 377 PYLRMNDYCQTSSNE--TIDSPD-----------DSDIIYELIGVICHTGTVNEGHYICS 423

Query: 702 RKYRGCWW-RISDETVYVVDEAEVLSTPGVFMLF 734
            K     W + +D  + +VD   VL      +++
Sbjct: 424 CKLANNQWVKFNDSMITIVDNETVLKEQAYLLIY 457

>Smik_16.163 Chr16 (301703..303208) [1506 bp, 501 aa] {ON} YPL072W
           (REAL)
          Length = 501

 Score = 38.9 bits (89), Expect = 0.045,   Method: Compositional matrix adjust.
 Identities = 51/186 (27%), Positives = 87/186 (46%), Gaps = 21/186 (11%)

Query: 326 PLDGITAERIGCLQCGENGGIRYSVFSGLSLNLPNENIGSTLKLSQLLSDWSKPEIIEGV 385
           P +G T++ + CLQC       Y       L++P +   ++ KL  +L++  + EIIE  
Sbjct: 204 PFEGETSKFLVCLQCKGLSKPSYQQTFIRELSVPQQ---TSEKLLTILAN-DETEIIEDY 259

Query: 386 ECNRCALTAAHSHLFGQLKEFEKKPEGSIPEKL--INAVKDRVHQ--IEEVLAKPV---I 438
            C+ C + A  +H      E  +  +   PE+L  I A+K+   +  I E L   +   I
Sbjct: 260 SCSICQIRAILNH------ERYRNFKDCTPEELLMIEALKNYATKASINEDLPPELEQYI 313

Query: 439 DDEDYKKLHTANMVRKCSKSKQILISRPPPLLSIHINRSVFDPRTYMIRKNNSKVLFKSR 498
                 KLH + +  K  K K + + + P +L +H++RS F+  TY   +N   V F  R
Sbjct: 314 KRYSKDKLHISKVKGKIIK-KDVAV-QLPDILVVHLSRSTFNGITYC--RNPCNVEFGER 369

Query: 499 LNLAPW 504
           + L  +
Sbjct: 370 VKLPEY 375

 Score = 36.2 bits (82), Expect = 0.36,   Method: Compositional matrix adjust.
 Identities = 12/25 (48%), Positives = 20/25 (80%)

Query: 679 LTYSLRSVIVHYGTHNYGHYIAFRK 703
           + Y+L+SV+ H G+H+ GHYI +R+
Sbjct: 389 VKYNLKSVVKHTGSHSRGHYICYRR 413

 Score = 34.3 bits (77), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 14/29 (48%), Positives = 18/29 (62%)

Query: 101 AGLVNDGNTCFMNSVLQSLASSRELMEFL 129
            GL+N GN CF+ S LQ LA     +E+L
Sbjct: 53  VGLINRGNDCFITSSLQGLAGMPRFVEYL 81

>Kpol_1032.28 s1032 complement(57514..60162) [2649 bp, 882 aa] {ON}
           complement(57514..60162) [2649 nt, 883 aa]
          Length = 882

 Score = 39.3 bits (90), Expect = 0.045,   Method: Compositional matrix adjust.
 Identities = 16/34 (47%), Positives = 22/34 (64%)

Query: 99  FIAGLVNDGNTCFMNSVLQSLASSRELMEFLDNN 132
           F  GL N GN+C+MN ++Q L S+ EL +   NN
Sbjct: 517 FTVGLENMGNSCYMNCIIQCLLSTHELSQIFLNN 550

 Score = 37.0 bits (84), Expect = 0.26,   Method: Compositional matrix adjust.
 Identities = 23/63 (36%), Positives = 32/63 (50%), Gaps = 8/63 (12%)

Query: 678 PLTYSLRSVIVHYGTHNYGHYIAFRKY---RGCWWRISDETVY--VVDEAEVLSTPGVFM 732
           P  Y L +V  H G+   GHY A+      RG  W   D+T Y  + +E E + TP  ++
Sbjct: 817 PFRYKLNAVASHVGSLYGGHYTAYVNKGINRG--WHYFDDTSYRPIKNETECI-TPNAYV 873

Query: 733 LFY 735
           LFY
Sbjct: 874 LFY 876

>NCAS0B04280 Chr2 (777104..779872) [2769 bp, 922 aa] {ON} Anc_8.188
          Length = 922

 Score = 39.3 bits (90), Expect = 0.050,   Method: Compositional matrix adjust.
 Identities = 18/52 (34%), Positives = 30/52 (57%), Gaps = 1/52 (1%)

Query: 81  LPRSKFTHLDEEILKRGGFIAGLVNDGNTCFMNSVLQSLASSRELMEFLDNN 132
           +P     H ++++L    FI GL N GN+C++N ++Q L  + EL +   NN
Sbjct: 540 IPNKSALHTNDKMLDLD-FIVGLQNIGNSCYLNCIIQCLLGTHELTKIFLNN 590

>TDEL0B02080 Chr2 (369534..372611) [3078 bp, 1025 aa] {ON} Anc_5.712
           YIL156W
          Length = 1025

 Score = 38.9 bits (89), Expect = 0.053,   Method: Compositional matrix adjust.
 Identities = 65/291 (22%), Positives = 112/291 (38%), Gaps = 60/291 (20%)

Query: 235 RKNILLGYDQEDAQEFFQNILAELESNVKSLNTEKLDTTPVAKSELPDDALVGQLNLGEV 294
           R ++ +  DQ+D QEF    L  L         ++L       +E PD  L  +      
Sbjct: 687 RPDLRIPDDQQDTQEFLMVTLDRLH--------DELSNQAAVANEYPDLLLYDE------ 732

Query: 295 GTVYIPTEQIDPNSILHDKSIQNFTPFKLMTPLDGITAERIG----CLQCGENGGIRYSV 350
                   Q+D N   + K  +       + P+D I   +I     C +CG N    YS 
Sbjct: 733 -------HQMDVNGKEYKKWFEESVIGNGLAPIDHIFQGQIENILECQRCG-NSSFSYST 784

Query: 351 FSGLSLNLPNENIGS-----TLKLSQLLSDWSKPEIIEG---VECNRCA----------L 392
           F  LSL +P  +  +      +KL   ++ ++  EI+ G    +C +C           L
Sbjct: 785 FYVLSLAIPKPSTSTFSRAKRVKLEDCINMFTNDEILSGENAWDCPKCGSAVTDMGPNHL 844

Query: 393 TAAHSHLFGQLKEFEKKPEGSIPEKLINAVKDRVHQIEEVLA--KPVIDDEDYKKLHTAN 450
             +      +L E  +   G      I++   R      +L   K  +  ED+K      
Sbjct: 845 KKSKKKKKSELGEERRSKSGFF---RIHSKSKRSKSPFRMLGSTKFPLAMEDWKS----- 896

Query: 451 MVRKCSKSKQILISRPPPLLSIHINRSVFDPRTYMIRKNNSKVLFKSRLNL 501
             ++ S  K +     PP+L IH++R  +D    + +KN++ V +   LN+
Sbjct: 897 --KELSTKKTLNFIFLPPVLIIHLSRFYYD----LTKKNDTIVTYPLVLNI 941

>Kpol_1064.48 s1064 (88495..89895) [1401 bp, 466 aa] {ON}
           (88495..89895) [1401 nt, 467 aa]
          Length = 466

 Score = 38.9 bits (89), Expect = 0.056,   Method: Compositional matrix adjust.
 Identities = 19/57 (33%), Positives = 28/57 (49%), Gaps = 1/57 (1%)

Query: 679 LTYSLRSVIVHYGTHNYGHYIAFRKY-RGCWWRISDETVYVVDEAEVLSTPGVFMLF 734
           L Y L  +I H GT N GHY A  K   G W + +D  V ++ E  +L      +++
Sbjct: 404 LIYELIGIICHTGTVNEGHYTAICKIPEGQWIKFNDSMVTIISEETMLKEQAYLLIY 460

 Score = 35.8 bits (81), Expect = 0.50,   Method: Compositional matrix adjust.
 Identities = 29/84 (34%), Positives = 41/84 (48%), Gaps = 4/84 (4%)

Query: 195 PDITFSVALRDLLSALNAKYYRDKPYFKTNS--LLKAMSKSPRKNI-LLGYDQEDAQEFF 251
           P    S AL  +++        D    KTN+  L+  ++ S + N  L GY Q+DA EF+
Sbjct: 179 PTTCISCALDSIVTDFYGISDLDDDVKKTNNDGLIDLLTCSWKINQNLAGYSQQDAHEFW 238

Query: 252 QNILAELESNVKSLNTEKLDTTPV 275
           Q +L  L S  KS N    DT P+
Sbjct: 239 QFLLNRLHSEYKS-NIGPTDTAPL 261

>TPHA0L01670 Chr12 complement(351116..352690) [1575 bp, 524 aa] {ON}
           Anc_8.540 YPL072W
          Length = 524

 Score = 38.9 bits (89), Expect = 0.057,   Method: Compositional matrix adjust.
 Identities = 43/190 (22%), Positives = 86/190 (45%), Gaps = 30/190 (15%)

Query: 326 PLDGITAERIGCLQCGENGGIRYSVFSGLSLNLPNENIGSTLKLSQLLSDWSKPEI--IE 383
           P  G   + + CL C     +R   F  L+L+LP       ++   LL+  +K ++  I 
Sbjct: 216 PFLGCQTDSLICLTCNRTSNVREHEFIILTLHLPR------IQSDTLLNTINKNQVEEIT 269

Query: 384 GVECNRCALTAAHSHLFGQLKEFEKKPEGSIPEKLINAVKDR-VHQIEEVLAKPVIDDE- 441
              C  C + +  ++     +E+ K+       K INA + R +  + +++ K  I++E 
Sbjct: 270 DYACLVCQINSILAN-----EEYLKRNNNG---KTINAEESRYIDTLRQLVPKICINEEL 321

Query: 442 -----DYKKLHTANMVRKCSK-----SKQILISRPPPLLSIHINRSVFDPRTYMIRKNNS 491
                 Y K +  N +  C K      K+ +I++ P  L +H++RS ++    +  +N+ 
Sbjct: 322 PDDVIYYIKSYNKNGLNVCQKIRSKIIKKTVITKAPLALILHLSRSSYNGMISV--RNSC 379

Query: 492 KVLFKSRLNL 501
            + + S+L L
Sbjct: 380 NIAYDSKLEL 389

 Score = 35.0 bits (79), Expect = 0.90,   Method: Compositional matrix adjust.
 Identities = 16/34 (47%), Positives = 21/34 (61%)

Query: 681 YSLRSVIVHYGTHNYGHYIAFRKYRGCWWRISDE 714
           YSL++++ H GTH  GHY  +RK      RIS E
Sbjct: 407 YSLQAMVKHTGTHMEGHYQCYRKKPNLVKRISYE 440

 Score = 32.3 bits (72), Expect = 4.8,   Method: Compositional matrix adjust.
 Identities = 15/48 (31%), Positives = 27/48 (56%)

Query: 90  DEEILKRGGFIAGLVNDGNTCFMNSVLQSLASSRELMEFLDNNVIRTY 137
           ++E  +   +  GL+N    CF+NS LQ+L+S  +   +L+  +  TY
Sbjct: 56  NQESKREDKYTTGLINSSTYCFINSSLQALSSLPKFTIYLNETLKITY 103

>CAGL0G05247g Chr7 complement(491024..493867) [2844 bp, 947 aa] {ON}
           similar to uniprot|P32571 Saccharomyces cerevisiae
           YDR069c DOA4 ubiquitin-specific protease
          Length = 947

 Score = 38.9 bits (89), Expect = 0.059,   Method: Compositional matrix adjust.
 Identities = 24/87 (27%), Positives = 39/87 (44%), Gaps = 8/87 (9%)

Query: 54  PDHLNYIVESVSEMTTNFRN--NNSLSRWLPRSKFTHLDEEILKRG------GFIAGLVN 105
           P  L ++ + VS+  T  R+  N ++   L        +  +L          F  GL N
Sbjct: 528 PSSLTFVGDDVSKSPTGLRSSSNATIKEVLSSPTGRKFNHSVLPNTKKDYDLNFTVGLEN 587

Query: 106 DGNTCFMNSVLQSLASSRELMEFLDNN 132
            GN+C+MN +LQ +  + EL +   NN
Sbjct: 588 MGNSCYMNCILQCIMGTNELSQIFLNN 614

 Score = 35.8 bits (81), Expect = 0.54,   Method: Compositional matrix adjust.
 Identities = 24/90 (26%), Positives = 42/90 (46%), Gaps = 13/90 (14%)

Query: 653 SSDEEDVIPAPPINYARSFSTVPAT----PLTYSLRSVIVHYGTHNYGHYIAFRK---YR 705
           ++D++D +P        S   +PA     P  YSL +V  H+G+   GHY ++      R
Sbjct: 858 ANDKDDRLPP-----GVSIDELPARGQIPPFKYSLYAVANHFGSLYGGHYTSYVNKGLSR 912

Query: 706 GCWWRISDETVYVVDEAEVLSTPGVFMLFY 735
           G W+   D+   +V +   +     ++LFY
Sbjct: 913 G-WYYFDDQNYRLVKKTSEVVNSNAYVLFY 941

>Smik_2.49 Chr2 complement(87575..89812) [2238 bp, 745 aa] {ON}
           YBL067C (REAL)
          Length = 745

 Score = 38.9 bits (89), Expect = 0.065,   Method: Compositional matrix adjust.
 Identities = 22/65 (33%), Positives = 33/65 (50%), Gaps = 9/65 (13%)

Query: 681 YSLRSVIVHYGTH-NYGHYIAFRKYRGCWWRI-SDETVYVVDEAEVLSTPG-------VF 731
           Y L  ++VH G    +GHY++  K++   W +  DETV  V E  VL   G        +
Sbjct: 602 YELAGIVVHMGGGPQHGHYVSLCKHQKFGWLLFDDETVEAVKEETVLEFTGESANMATAY 661

Query: 732 MLFYE 736
           +LFY+
Sbjct: 662 VLFYK 666

>KLLA0C06974g Chr3 complement(604344..605684) [1341 bp, 446 aa] {ON}
           similar to uniprot|P50102 Saccharomyces cerevisiae
           YMR223W UBP8 Ubiquitin-specific protease that is a
           component of the SAGA (Spt-Ada-Gcn5-Acetyltransferase)
           acetylation complex required for SAGA-mediated
           deubiquitination of histone H2B
          Length = 446

 Score = 38.5 bits (88), Expect = 0.068,   Method: Compositional matrix adjust.
 Identities = 21/58 (36%), Positives = 31/58 (53%), Gaps = 2/58 (3%)

Query: 679 LTYSLRSVIVHYGTHNYGHYIAFRKYR-GCWWRISDETVYVVDEAEVLSTPGVFMLFY 735
           + Y L +V+ H GT + GHY    K   G W++ +D  V  V E +VL     ++LFY
Sbjct: 387 IAYDLLNVVSHQGTVDQGHYTTVSKTEDGQWFKFNDSVVTSVTEEQVLEQQA-YLLFY 443

 Score = 34.3 bits (77), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 25/90 (27%), Positives = 47/90 (52%), Gaps = 18/90 (20%)

Query: 43  IFGI-----VVFFYKKPDHLNYIVESVSEMTTNFRNNNSLSRWLPRSKFTHLDEEILKRG 97
           IFG+     +VF ++  D   ++ + V+E+          S+W    + T L   + + G
Sbjct: 83  IFGVNSSNGLVFCFRCGD---FMADLVAEIPA--------SQWDTVMEKTELPASLHRDG 131

Query: 98  GFIAGLVNDGNTCFMNSVLQSLASSRELME 127
             + GLVN G+TCFM+S++Q++  +   +E
Sbjct: 132 --LQGLVNMGSTCFMSSIIQTIIHNPYFVE 159

>TBLA0D00620 Chr4 complement(159706..163221) [3516 bp, 1171 aa] {ON}
            Anc_7.390 YBL067C
          Length = 1171

 Score = 38.9 bits (89), Expect = 0.069,   Method: Compositional matrix adjust.
 Identities = 22/65 (33%), Positives = 32/65 (49%), Gaps = 9/65 (13%)

Query: 681  YSLRSVIVHYGTH-NYGHYIAFRKY-RGCWWRISDETVYVVDEAEVLSTPG-------VF 731
            Y L  ++VH G    +GHY+A  K  +  W  + DETV  + E  VL   G        +
Sbjct: 1006 YELNGIVVHMGGGPQHGHYVAICKNDKFGWLLMDDETVETISEETVLRCKGDSKDLTTAY 1065

Query: 732  MLFYE 736
            +LFY+
Sbjct: 1066 VLFYK 1070

>Kpol_1018.93 s1018 (248094..250361) [2268 bp, 755 aa] {ON}
           (248094..250361) [2268 nt, 756 aa]
          Length = 755

 Score = 38.5 bits (88), Expect = 0.069,   Method: Compositional matrix adjust.
 Identities = 23/65 (35%), Positives = 32/65 (49%), Gaps = 9/65 (13%)

Query: 681 YSLRSVIVHYGTH-NYGHYIAFRKYRGCWWRI-SDETVYVVDEAEVLSTPG-------VF 731
           Y L  +I+H G    +GHY+A  K     W +  DETV  V E +VL   G        +
Sbjct: 596 YELSGIIIHLGAGPQHGHYVAMCKTEKFGWLLYDDETVEAVLEKDVLRHVGDSNDLATAY 655

Query: 732 MLFYE 736
           +LFY+
Sbjct: 656 ILFYK 660

>NDAI0E02820 Chr5 (598119..599606) [1488 bp, 495 aa] {ON} Anc_8.540
           YPL072W
          Length = 495

 Score = 38.5 bits (88), Expect = 0.075,   Method: Compositional matrix adjust.
 Identities = 47/191 (24%), Positives = 87/191 (45%), Gaps = 31/191 (16%)

Query: 325 TPLDGITAERIGCLQCGENGGIRYSVFSGLSLNLPNENIGSTLKLSQLLSDWSKPEIIEG 384
            P+ G+    + C++CG    I+  +FS   LN+P     S+ KL+ ++ + ++ E IEG
Sbjct: 189 VPMKGVVGNHLICIRCGHISQIKEEMFSIYELNVPQ---CSSSKLTDIIHN-NQLEKIEG 244

Query: 385 VECNRCALTAA-------HSHLFGQLKEFEKKPEGSIPEKLINAVK-------DRVHQIE 430
             C  C +          +S  F    E EK+    + E  +N +        D +H I+
Sbjct: 245 YSCLYCEINMILKNENYRNSDGFTGDDE-EKRKLRYLKEVFLNNLMINQELPDDIMHYIK 303

Query: 431 EVLAKPVIDDEDYKKLHTANMVRKCSKSKQILISRPPPLLSIHINRSVFDPRTYMIRKNN 490
                      D  K+  +++ RK    +++L  + P +L IH++RS+++   Y   +N 
Sbjct: 304 SYKRGYC----DISKMEKSDIFRK----RRLL--QCPKVLLIHLSRSMYNGMAYT--RNP 351

Query: 491 SKVLFKSRLNL 501
             V F++ L L
Sbjct: 352 CNVEFENILEL 362

>KLTH0H07678g Chr8 (677217..679802) [2586 bp, 861 aa] {ON} similar
           to uniprot|P32571 Saccharomyces cerevisiae YDR069C DOA4
           Ubiquitin hydrolase required for recycling ubiquitin
           from proteasome-bound ubiquitinated intermediates acts
           at the late endosome/prevacuolar compartment to recover
           ubiquitin from ubiquitinated membrane proteins en route
           to the vacuole
          Length = 861

 Score = 38.5 bits (88), Expect = 0.080,   Method: Compositional matrix adjust.
 Identities = 16/35 (45%), Positives = 24/35 (68%), Gaps = 1/35 (2%)

Query: 99  FIAGLVNDGNTCFMNSVLQSLASSRELME-FLDNN 132
           F  GL N GN+C+MN ++Q L  + EL + FLD++
Sbjct: 493 FTVGLTNLGNSCYMNCIIQCLLGTHELTQIFLDDS 527

>ABL145W Chr2 (124839..127088) [2250 bp, 749 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YNL186W (UBP10)
          Length = 749

 Score = 38.5 bits (88), Expect = 0.085,   Method: Compositional matrix adjust.
 Identities = 22/60 (36%), Positives = 31/60 (51%), Gaps = 2/60 (3%)

Query: 678 PLTYSLRSVIVHYG-THNYGHYIAF-RKYRGCWWRISDETVYVVDEAEVLSTPGVFMLFY 735
           P+ Y L SV+VH G + + GHYIA  ++  G W    DE +  + E  VL     + L Y
Sbjct: 635 PVKYQLISVVVHEGRSLSSGHYIAHCKQPDGTWATYDDEYINKITERNVLKEVNAYYLVY 694

>KLTH0F15862g Chr6 (1288742..1292467) [3726 bp, 1241 aa] {ON} similar
            to uniprot|Q01476 Saccharomyces cerevisiae YOR124C UBP2
            Ubiquitin-specific protease that removes ubiquitin from
            ubiquitinated proteins cleaves at the C terminus of
            ubiquitin fusions capable of cleaving polyubiquitin and
            possesses isopeptidase activity
          Length = 1241

 Score = 38.5 bits (88), Expect = 0.087,   Method: Compositional matrix adjust.
 Identities = 19/48 (39%), Positives = 27/48 (56%), Gaps = 3/48 (6%)

Query: 681  YSLRSVIVHYGTHNYGHYIAFRK---YRGCWWRISDETVYVVDEAEVL 725
            YSL +V +H G  +YGHY  + K     G W + +DE+V    E+EV 
Sbjct: 1158 YSLFAVFIHRGEASYGHYWIYIKDSGKNGIWRKYNDESVTEAPESEVF 1205

 Score = 33.5 bits (75), Expect = 2.8,   Method: Compositional matrix adjust.
 Identities = 18/46 (39%), Positives = 27/46 (58%), Gaps = 3/46 (6%)

Query: 72  RNNNSLSRWLPRSKFTHLDEEILKRGGFIAGLVNDGNTCFMNSVLQ 117
           RN+  ++R+L       +D   L  G +  GL N GNTC++NS+LQ
Sbjct: 677 RNSLLINRYLETGI---IDVSCLPAGNWPTGLNNIGNTCYLNSLLQ 719

>KNAG0B02370 Chr2 complement(463599..465860) [2262 bp, 753 aa] {ON}
           Anc_7.390 YBL067C
          Length = 753

 Score = 38.1 bits (87), Expect = 0.087,   Method: Compositional matrix adjust.
 Identities = 26/82 (31%), Positives = 41/82 (50%), Gaps = 11/82 (13%)

Query: 675 PATPLTYSLRSVIVHYGTH-NYGHYIAFRKYRG-CWWRISDETVYVVDEAEVLS------ 726
           P+    Y L  V++H G    +GHY++  K     W    DETV  +DE +VL+      
Sbjct: 589 PSVSKKYELTGVVLHMGGGPQHGHYVSVCKTDNFGWLFFDDETVETLDEPQVLNFTGDTT 648

Query: 727 -TPGVFMLFYEY--DFDEETGK 745
            +   ++LFY+   + D+E GK
Sbjct: 649 TSTTAYVLFYKETDEGDDEFGK 670

>Smik_11.362 Chr11 complement(623098..625263) [2166 bp, 721 aa] {ON}
           YKR098C (REAL)
          Length = 721

 Score = 38.1 bits (87), Expect = 0.096,   Method: Compositional matrix adjust.
 Identities = 72/296 (24%), Positives = 118/296 (39%), Gaps = 57/296 (19%)

Query: 224 NSLLKAMSKSPRKNILLGYDQEDAQEFFQNILAELESNVKSLNTEKLDTTPVAKSELPD- 282
           N  LK M K  R ++ +  DQ+D QEF   ILA L         E+L    V +   PD 
Sbjct: 373 NGFLK-MCKKLRPDLNIPDDQQDTQEFLLIILARLH--------EELSNGTVTEY-YPDL 422

Query: 283 ---DALVGQLNLGEVGTVYIPTEQIDPNSILHDKSIQNFTPFKLMTPLD----GITAERI 335
              DA   Q+N  +    Y         S+L D           ++P+D    G     +
Sbjct: 423 VSYDANAFQVNPSKYQKWY-------EGSVLTDG----------LSPIDYIFRGQMENIL 465

Query: 336 GCLQCGENGGIRYSVFSGLSLNLPNENIGS------TLKLSQLLSDWSKPEIIEG---VE 386
            C +CG N    YS F  LSL +P  ++ S       +KL   ++ ++  E + G    +
Sbjct: 466 KCQRCG-NSSHSYSTFYVLSLAIPKISLYSFTSKSKKIKLEDCINLFTSDEELSGDNSWD 524

Query: 387 CNRCALTAAHSHLFGQLKEFEKKPEGSIPEKLINAVKDRVHQIEEVLAKPVIDD-EDYKK 445
           C  C  T     L  ++ E   + + S      +  + +             D+ E + K
Sbjct: 525 CPNCGTT----DLKTKINESTSQKKKSTFFSFHSRSRSKSPHHHHHHHHHSHDNTEKHSK 580

Query: 446 LHTANMVRKCSKSKQILISRPPPLLSIHINRSVFDPRTYMIRKNNSKVLFKSRLNL 501
              +  +     S  I++   PP+L IH++R  +D    + RKNN+ + +   LN+
Sbjct: 581 KWNSRKLTTVKSSDFIVL---PPILVIHLSRFYYD----LTRKNNTVITYPLILNV 629

>Kpol_2001.78 s2001 complement(213762..214973) [1212 bp, 403 aa]
           {ON} complement(213762..214973) [1212 nt, 404 aa]
          Length = 403

 Score = 37.7 bits (86), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 59/277 (21%), Positives = 114/277 (41%), Gaps = 48/277 (17%)

Query: 243 DQEDAQEFFQNILAELESNVKSLNTEKLDTTPVAKSELPDDALVGQLNLGEVGTVYIPTE 302
           DQ+D QEF   +L  L   + +  T  +D         PD  L               T 
Sbjct: 74  DQQDTQEFLMLMLDRLHDELSNQETVGID--------YPDLVLYD-------------TR 112

Query: 303 QIDPNSILHDKSIQNFTPFKLMTPLDGITAERI-GCLQCGENGGI--RYSVFSGLSLNLP 359
           ++  N+  + K          ++P+D I   +I   L C   G +   YS F  LSL +P
Sbjct: 113 KLRVNNKEYSKWFDKTIFANGLSPIDHIFQGQIENTLTCQRCGFVSYNYSTFYVLSLAIP 172

Query: 360 NENIGS-----TLKLSQLLSDWSKPEIIEG---VECNRCALTAAHSHLFGQLKEFEKKPE 411
             + G+      +KL   ++ ++  E++ G    +C+ C  ++ H+     +++ + K  
Sbjct: 173 KPSSGTFSRSKRVKLEDCINMFTNDEVLSGENAWDCSNCGSSSVHN-----VEQRKDKTT 227

Query: 412 GSIPEKLINAVKDRVHQIEEVLAKPVIDDEDYKKLHTANMVRKCSKSKQILISRP----- 466
           G+  EK   + K R+  +  +  +       ++K  +     +  K K+++  +      
Sbjct: 228 GNGEEKK-RSRKSRLFLLPNINGRSSRSISPFRKSASPRPPHEKLKHKKLVTIKSMNFIS 286

Query: 467 -PPLLSIHINRSVFDPRTYMIRKNNSKVLFKSRLNLA 502
            PP L IH++R  +D    + +KN + V +   LN+ 
Sbjct: 287 LPPTLVIHLSRFYYD----LSKKNETIVTYPLILNIV 319

>YER144C Chr5 complement(457806..460223) [2418 bp, 805 aa] {ON}
           UBP5Putative ubiquitin-specific protease, closest
           paralog of Doa4p but has no functional overlap;
           concentrates at the bud neck
          Length = 805

 Score = 38.1 bits (87), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 17/37 (45%), Positives = 23/37 (62%), Gaps = 1/37 (2%)

Query: 99  FIAGLVNDGNTCFMNSVLQSLASSRELME-FLDNNVI 134
            I GL N GN C+MN +LQ L  + +L+  FLDN  +
Sbjct: 444 LIVGLENIGNCCYMNCILQCLVGTHDLVRMFLDNTYL 480

 Score = 35.8 bits (81), Expect = 0.58,   Method: Compositional matrix adjust.
 Identities = 20/65 (30%), Positives = 29/65 (44%), Gaps = 4/65 (6%)

Query: 678 PLTYSLRSVIVHYGTHNYGHYIAFRKYRG---CWWRISDETVYVVDEAEVLSTPGVFMLF 734
           P  Y L  V  H G+   GHY ++  Y+G    W+   D     +  +    TP  ++LF
Sbjct: 742 PFRYRLYGVACHSGSLYGGHYTSY-VYKGPKKGWYFFDDSLYRPITFSTEFITPSAYVLF 800

Query: 735 YEYDF 739
           YE  F
Sbjct: 801 YERIF 805

>YBL067C Chr2 complement(93639..95882) [2244 bp, 747 aa] {ON}
           UBP13Putative ubiquitin carboxyl-terminal hydrolase,
           ubiquitin-specific protease that cleaves
           ubiquitin-protein fusions
          Length = 747

 Score = 38.1 bits (87), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 22/65 (33%), Positives = 32/65 (49%), Gaps = 9/65 (13%)

Query: 681 YSLRSVIVHYGTH-NYGHYIAFRKYRGCWWRI-SDETVYVVDEAEVLSTPG-------VF 731
           Y L  ++VH G    +GHY++  K+    W +  DETV  V E  VL   G        +
Sbjct: 602 YELAGIVVHMGGGPQHGHYVSLCKHEKFGWLLFDDETVEAVKEETVLEFTGESPNMATAY 661

Query: 732 MLFYE 736
           +LFY+
Sbjct: 662 VLFYK 666

>Skud_10.22 Chr10 (38735..42502) [3768 bp, 1255 aa] {ON} YJL197W
           (REAL)
          Length = 1255

 Score = 38.1 bits (87), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 17/36 (47%), Positives = 22/36 (61%)

Query: 94  LKRGGFIAGLVNDGNTCFMNSVLQSLASSRELMEFL 129
           L+ G    GLVN GNTC+MNS LQ L    +L ++ 
Sbjct: 357 LEPGSGTTGLVNLGNTCYMNSALQCLVHIPQLRDYF 392

>AFR007W Chr6 (448632..451178) [2547 bp, 848 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YDR069C (DOA4) and
           YER144C (UBP5)
          Length = 848

 Score = 38.1 bits (87), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 15/34 (44%), Positives = 22/34 (64%)

Query: 99  FIAGLVNDGNTCFMNSVLQSLASSRELMEFLDNN 132
           F  GLVN GN+C+M+ ++Q L  ++EL     NN
Sbjct: 486 FSVGLVNCGNSCYMSCIIQCLLGTQELCTMFLNN 519

>Suva_2.50 Chr2 complement(90700..92952) [2253 bp, 750 aa] {ON}
           YBL067C (REAL)
          Length = 750

 Score = 37.7 bits (86), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 22/65 (33%), Positives = 32/65 (49%), Gaps = 9/65 (13%)

Query: 681 YSLRSVIVHYGTH-NYGHYIAFRKYRGCWWRI-SDETVYVVDEAEVLSTPG-------VF 731
           Y L  ++VH G    +GHY++  K+    W +  DETV  V E  VL   G        +
Sbjct: 605 YQLAGIVVHMGGGPQHGHYVSLCKHEKFGWLLFDDETVEAVKEETVLEFTGESPNMATAY 664

Query: 732 MLFYE 736
           +LFY+
Sbjct: 665 VLFYK 669

>CAGL0I05522g Chr9 complement(521749..523923) [2175 bp, 724 aa] {ON}
           some similarities with uniprot|P39967 Saccharomyces
           cerevisiae YER098w UBP9 or uniprot|P38187 Saccharomyces
           cerevisiae YBL067c UBP13
          Length = 724

 Score = 37.7 bits (86), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 23/80 (28%), Positives = 38/80 (47%), Gaps = 9/80 (11%)

Query: 680 TYSLRSVIVHYGTH-NYGHYIAFRKY-RGCWWRISDETVYVVDEAEVLSTPG-------V 730
           TY L  V++H G    +GHY++  K+ +  W    DET+  + E  V S  G        
Sbjct: 582 TYELTGVVLHVGASPTHGHYVSICKHEKYGWLMYDDETIESIPEEAVTSHVGEPNNPITA 641

Query: 731 FMLFYEYDFDEETGKMKDDL 750
           ++LFY      +  ++ D+L
Sbjct: 642 YVLFYSEKIQNKKTQLSDEL 661

>SAKL0H18986g Chr8 (1683752..1686433) [2682 bp, 893 aa] {ON} similar
           to uniprot|P32571 Saccharomyces cerevisiae YDR069C DOA4
           Ubiquitin hydrolase required for recycling ubiquitin
           from proteasome-bound ubiquitinated intermediates acts
           at the late endosome/prevacuolar compartment to recover
           ubiquitin from ubiquitinated membrane proteins en route
           to the vacuole
          Length = 893

 Score = 37.7 bits (86), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 15/39 (38%), Positives = 24/39 (61%)

Query: 99  FIAGLVNDGNTCFMNSVLQSLASSRELMEFLDNNVIRTY 137
           F  GLVN GN+C+MN ++Q L  + EL +   N+  + +
Sbjct: 521 FSVGLVNLGNSCYMNCIIQCLLGTHELSQMFLNDSYKNH 559

>KNAG0D01930 Chr4 (324705..327665) [2961 bp, 986 aa] {ON} Anc_8.188
           YDR069C
          Length = 986

 Score = 37.7 bits (86), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 16/35 (45%), Positives = 26/35 (74%), Gaps = 1/35 (2%)

Query: 99  FIAGLVNDGNTCFMNSVLQSLASSRELME-FLDNN 132
           F+ GL N GN+C++N ++Q L  + EL++ FLDN+
Sbjct: 618 FMVGLENMGNSCYLNCIIQCLLGNNELIKIFLDNS 652

 Score = 36.2 bits (82), Expect = 0.42,   Method: Compositional matrix adjust.
 Identities = 18/75 (24%), Positives = 33/75 (44%), Gaps = 2/75 (2%)

Query: 664 PINYARSFSTVPATPLTYSLRSVIVHYGTHNYGHYIAF--RKYRGCWWRISDETVYVVDE 721
           P+N +   +     P  Y L  V  H+G+   GHY A+  +  +  W+   D +   +  
Sbjct: 905 PLNVSELPTRGQKPPFNYKLYGVACHFGSLYGGHYTAYVDKGIKNGWYYFDDTSCRPIKN 964

Query: 722 AEVLSTPGVFMLFYE 736
           +    T   ++LFY+
Sbjct: 965 SMEPITSSAYVLFYK 979

>TPHA0P00680 Chr16 (139640..141823) [2184 bp, 727 aa] {ON} Anc_7.390
           YBL067C
          Length = 727

 Score = 37.7 bits (86), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 23/66 (34%), Positives = 35/66 (53%), Gaps = 11/66 (16%)

Query: 681 YSLRSVIVHYG-THNYGHYIAFRKYRGCWWRI-SDETVYVVDEAEVLS--------TPGV 730
           Y L S++VH G +   GHY+   K++   W I  DETV  V + E++S        +   
Sbjct: 587 YELNSIVVHIGESPQLGHYVTLCKHKSYGWLIYDDETVQAVSD-ELVSRILNNEQRSATA 645

Query: 731 FMLFYE 736
           ++LFYE
Sbjct: 646 YLLFYE 651

>NDAI0I02530 Chr9 (584472..588065) [3594 bp, 1197 aa] {ON} Anc_5.18
           YMR304W
          Length = 1197

 Score = 37.7 bits (86), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 19/50 (38%), Positives = 26/50 (52%), Gaps = 2/50 (4%)

Query: 678 PLTYSLRSVIVHYGTHNYGHYIAFRK--YRGCWWRISDETVYVVDEAEVL 725
           P  Y+L  V+VH G  + GHY A  K      W+R  DE V+ V + +V 
Sbjct: 435 PCIYNLHGVLVHTGDISTGHYYAMIKPDLEDQWYRFDDEKVWKVTKKQVF 484

>NCAS0A14370 Chr1 (2830136..2832325) [2190 bp, 729 aa] {ON}
           Anc_7.390
          Length = 729

 Score = 37.4 bits (85), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 26/77 (33%), Positives = 38/77 (49%), Gaps = 10/77 (12%)

Query: 681 YSLRSVIVHYG-THNYGHYIAFRKY-RGCWWRISDETVYVVDEAEVLSTPG-------VF 731
           Y L  V++H G +  +GHY++  K  +  W    DETV  V E  VL   G        +
Sbjct: 588 YELTGVVIHMGGSPQHGHYVSLCKNDKFGWLLFDDETVESVTEKTVLEFTGDSSNQATAY 647

Query: 732 MLFYEYDFDEETGKMKD 748
           +LFY+ + DE+  K  D
Sbjct: 648 VLFYK-ELDEKDTKPVD 663

>KLLA0E02377g Chr5 complement(218647..222309) [3663 bp, 1220 aa] {ON}
            uniprot|O42726 Kluyveromyces lactis UBP2 Ubiquitin
            carboxyl-terminal hydrolase 2
          Length = 1220

 Score = 37.7 bits (86), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 18/51 (35%), Positives = 30/51 (58%), Gaps = 3/51 (5%)

Query: 679  LTYSLRSVIVHYGTHNYGHYIAFRK---YRGCWWRISDETVYVVDEAEVLS 726
            + YSL +V +H G  +YGHY  + K     G W + +D++V  V ++EV +
Sbjct: 1135 IGYSLFAVFIHRGEASYGHYWVYIKDHTKNGIWRKYNDDSVTEVPQSEVFN 1185

 Score = 34.3 bits (77), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 16/43 (37%), Positives = 26/43 (60%)

Query: 89  LDEEILKRGGFIAGLVNDGNTCFMNSVLQSLASSRELMEFLDN 131
           +D   L    + AG+ N GNTC++NS+LQ   + + L +F+ N
Sbjct: 686 VDVSCLPVATWPAGINNVGNTCYLNSLLQFFFTIKPLRDFILN 728

>Ecym_6184 Chr6 (341652..344207) [2556 bp, 851 aa] {ON} similar to
           Ashbya gossypii AFR007W
          Length = 851

 Score = 37.7 bits (86), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 15/34 (44%), Positives = 22/34 (64%)

Query: 99  FIAGLVNDGNTCFMNSVLQSLASSRELMEFLDNN 132
           F  GLVN GN+C+M+ ++Q L  ++EL     NN
Sbjct: 484 FSVGLVNCGNSCYMSCIIQCLLGTQELCTMFLNN 517

>KAFR0C02590 Chr3 complement(503330..506266) [2937 bp, 978 aa] {ON}
           Anc_8.188 YDR069C
          Length = 978

 Score = 37.7 bits (86), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 14/34 (41%), Positives = 23/34 (67%)

Query: 99  FIAGLVNDGNTCFMNSVLQSLASSRELMEFLDNN 132
           FI GL N GN+C+MN ++Q +  + +L++   NN
Sbjct: 603 FIVGLENMGNSCYMNCIIQCILGTHDLIKIFLNN 636

 Score = 35.0 bits (79), Expect = 0.82,   Method: Compositional matrix adjust.
 Identities = 21/61 (34%), Positives = 32/61 (52%), Gaps = 4/61 (6%)

Query: 678 PLTYSLRSVIVHYGTHNYGHYIAF-RKYRGCWWRISDETVY--VVDEAEVLSTPGVFMLF 734
           P  Y L  V  H+G+   GHY A+  K  G  W   D+T Y  + ++ E +S+   ++LF
Sbjct: 912 PFNYRLYGVACHFGSLYGGHYTAYVDKGIGNGWYYFDDTTYRPLKNDKEPISS-SAYVLF 970

Query: 735 Y 735
           Y
Sbjct: 971 Y 971

>AFR296C Chr6 complement(972519..976028) [3510 bp, 1169 aa] {ON}
            Syntenic homolog of Saccharomyces cerevisiae YIL156W
            (UBP7) and YKR098C (UBP11)
          Length = 1169

 Score = 37.7 bits (86), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 54/232 (23%), Positives = 95/232 (40%), Gaps = 41/232 (17%)

Query: 306  PNSILHDKSI-------------QNFTPFKLMTPLDGITAERI----GCLQCGENGGIRY 348
            P  +LH+ S+             QNF    L +P+D I   +I     C +C +     Y
Sbjct: 861  PQLLLHESSVLKVNDKEYTTWFDQNFEKNGL-SPIDSIFQGQIEHQLSCQRC-DFSSYSY 918

Query: 349  SVFSGLSLNLPNENI-----GSTLKLSQLLSDWSKPEIIEGV---ECNRCALTAAHSHLF 400
            S F  LSL LPN           L+L   ++ ++  E++ G    +C +C + ++     
Sbjct: 919  STFYVLSLALPNPGSKAFGKAKKLRLEDCINFFTCDEVLTGQNPWDCPKCGVNSSGDRQM 978

Query: 401  GQLKEFEKKP--EGSIPEKLINAVKDRVHQIEEV-------LAKPVIDD-EDYKKLHTAN 450
               K   K     GS      N+ +D + ++ ++        + P I   +   K H   
Sbjct: 979  NSEKSKRKNKFFMGSENANSANSNRDHLPRLFKIGSKSRSRSSSPFISGPKSSGKTHEKR 1038

Query: 451  MVRKCSKSKQILISRPPPLLSIHINRSVFDPRTYMIRKNNSKVLFKSRLNLA 502
              +K +  K +     P +L IH++R V+D    + +KNN+ V +   LN+ 
Sbjct: 1039 YNKKLATIKSLNFITLPRILIIHLSRFVYD----LTKKNNTVVTYPLILNIV 1086

 Score = 33.9 bits (76), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 18/37 (48%), Positives = 22/37 (59%), Gaps = 1/37 (2%)

Query: 100 IAGLVNDGNTCFMNSVLQSLASSRELME-FLDNNVIR 135
           I GL N  NTC++NS+LQ L S+ E    FL N   R
Sbjct: 745 ITGLRNMSNTCYINSMLQCLFSTTEFRNLFLSNKYSR 781

>KAFR0I02600 Chr9 (525365..529006) [3642 bp, 1213 aa] {ON} Anc_5.18
           YMR304W
          Length = 1213

 Score = 37.4 bits (85), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 19/50 (38%), Positives = 25/50 (50%), Gaps = 2/50 (4%)

Query: 678 PLTYSLRSVIVHYGTHNYGHYIAFRK--YRGCWWRISDETVYVVDEAEVL 725
           P  Y L  V+VH G  + GHY A  K      W+R  DE V+ V + +V 
Sbjct: 428 PCIYKLHGVLVHAGDISTGHYYAMIKPSTEDQWYRFDDEKVWKVTKTQVF 477

>AFR551W Chr6 (1427498..1428907) [1410 bp, 469 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YMR223W (UBP8)
          Length = 469

 Score = 37.0 bits (84), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 19/62 (30%), Positives = 33/62 (53%), Gaps = 2/62 (3%)

Query: 675 PATPLTYSLRSVIVHYGTHNYGHYIAFRKYRG-CWWRISDETVYVVDEAEVLSTPGVFML 733
           P   LT+ L ++I H GT + GHY    +  G  W + +D  V ++ E ++L     ++L
Sbjct: 406 PVPNLTFKLSAIIPHQGTVDKGHYTTICRINGDVWAKFNDSMVTLISEEDMLKEQA-YLL 464

Query: 734 FY 735
           +Y
Sbjct: 465 YY 466

 Score = 36.6 bits (83), Expect = 0.24,   Method: Compositional matrix adjust.
 Identities = 26/92 (28%), Positives = 48/92 (52%), Gaps = 19/92 (20%)

Query: 52  KKPDHLNYIVESVSEMTTNFRNNNSLSRWLPRSKFTHLD------EEILKR--------G 97
           KK  H+ + V + + +   FR  + +S     ++F H+D       E+L+R        G
Sbjct: 79  KKVGHI-FGVNATNGLLFCFRCRDYISD----NEFVHMDIMPKHWNEVLRRSSIPAPHRG 133

Query: 98  GFIAGLVNDGNTCFMNSVLQSLASSRELMEFL 129
             + GLVN G+TCFM+SV+Q+      +++++
Sbjct: 134 EGLLGLVNMGSTCFMSSVIQTFLHLPHVLQYM 165

>NDAI0C05950 Chr3 complement(1361343..1364585) [3243 bp, 1080 aa]
           {ON} Anc_8.202 YER151C
          Length = 1080

 Score = 37.4 bits (85), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 26/82 (31%), Positives = 39/82 (47%), Gaps = 19/82 (23%)

Query: 54  PDHLNYIVESVSEMTTNFRNNNSLSRWLPRSKFTHLDEEILKRGGFIAGLVNDGNTCFMN 113
           PD  NY +E+ S       NNN+    +P        + I+ RG     +VN  N CFM+
Sbjct: 538 PDFTNYALETTS-------NNNTKDHKVPI-------KSIVSRG-----IVNVANICFMS 578

Query: 114 SVLQSLASSRELMEFLDNNVIR 135
           S+LQ L S +  ++ L+    R
Sbjct: 579 SILQMLLSCKPFIDVLNVTSTR 600

>Skud_2.38 Chr2 complement(77293..79539) [2247 bp, 748 aa] {ON}
           YBL067C (REAL)
          Length = 748

 Score = 37.0 bits (84), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 22/68 (32%), Positives = 33/68 (48%), Gaps = 9/68 (13%)

Query: 681 YSLRSVIVHYGTH-NYGHYIAFRKYRGCWWRI-SDETVYVVDEAEVLSTPG-------VF 731
           Y L  ++VH G    +GHY++  K+    W +  DETV  V E  VL   G        +
Sbjct: 604 YELSGIVVHMGGGPQHGHYVSLCKHEIFGWLLFDDETVEAVKEEAVLEFTGESPNMATAY 663

Query: 732 MLFYEYDF 739
           +LFY+  +
Sbjct: 664 VLFYKTKY 671

>KNAG0C03580 Chr3 complement(699604..701934) [2331 bp, 776 aa] {ON}
           Anc_7.390 YBL067C
          Length = 776

 Score = 37.0 bits (84), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 24/70 (34%), Positives = 34/70 (48%), Gaps = 19/70 (27%)

Query: 680 TYSLRSVIVHYGTH-NYGHYIAFRKYRGC------WWRISDETVYVVDEAEVLSTPG--- 729
           +Y L+ V+VH G   ++GHY++      C      W    DETV  VDE+ VL   G   
Sbjct: 610 SYRLQGVVVHMGNGPHHGHYVSL-----CHTELFGWLLFDDETVESVDESYVLDFVGSHE 664

Query: 730 ----VFMLFY 735
                ++LFY
Sbjct: 665 SPTTAYVLFY 674

>Skud_16.209 Chr16 (389855..391366) [1512 bp, 503 aa] {ON} YPL072W
           (REAL)
          Length = 503

 Score = 36.6 bits (83), Expect = 0.23,   Method: Compositional matrix adjust.
 Identities = 49/186 (26%), Positives = 85/186 (45%), Gaps = 21/186 (11%)

Query: 326 PLDGITAERIGCLQCGENGGIRYSVFSGLSLNLPNENIGSTLKLSQLLSDWSKPEIIEGV 385
           P +G T++ + C+QC     I +       L++P +   S+  L  +LS+  + EIIE  
Sbjct: 212 PFEGETSKFLVCVQCNGLSKISHQKTFIRELSVPQK---SSENLLDILSN-DETEIIEDY 267

Query: 386 ECNRCALTAAHSHLFGQLKEFEKKPEGSIPEKLI--NAVKDRVHQ--IEEVLAKPV---I 438
            C  C   A  +H   Q + F+       P++L+  +A+KD   +  I E L   +   I
Sbjct: 268 SCLICRARAILAH--EQYRNFK----DCAPDELLILDALKDYATEASINEDLPLEIDQYI 321

Query: 439 DDEDYKKLHTANMVRKCSKSKQILISRPPPLLSIHINRSVFDPRTYMIRKNNSKVLFKSR 498
           +     K   +N+  K  K    +  + P +L IH++RS F+  TY   +N   V F+  
Sbjct: 322 NHYTKDKFCISNVKGKVIKRD--IAVKLPKVLVIHLSRSTFNGVTY--SRNPCNVKFQEE 377

Query: 499 LNLAPW 504
           + L  +
Sbjct: 378 IKLTEY 383

 Score = 35.4 bits (80), Expect = 0.54,   Method: Compositional matrix adjust.
 Identities = 14/30 (46%), Positives = 20/30 (66%)

Query: 101 AGLVNDGNTCFMNSVLQSLASSRELMEFLD 130
            GL+N GN CF+ S LQ+LA     +E+L+
Sbjct: 58  VGLINRGNDCFITSALQALAGIPRFVEYLN 87

 Score = 35.0 bits (79), Expect = 0.77,   Method: Compositional matrix adjust.
 Identities = 15/48 (31%), Positives = 29/48 (60%), Gaps = 2/48 (4%)

Query: 679 LTYSLRSVIVHYGTHNYGHYIAFRKYRGCWWRISDETVYVVDEAEVLS 726
           + Y+L+SV+ H G+H+ GHY+ +R+     +   DE+   VD   +++
Sbjct: 397 IVYNLKSVVKHTGSHSRGHYMCYRRKGDILFDKEDES--FVDSRSIIT 442

>KLLA0C03476g Chr3 (314815..318573) [3759 bp, 1252 aa] {ON} similar
           to uniprot|P39538 Saccharomyces cerevisiae YJL197W UBP12
           Ubiquitin-specific protease present in the nucleus and
           cytoplasm that cleaves ubiquitin from ubiquitinated
           proteins
          Length = 1252

 Score = 37.0 bits (84), Expect = 0.23,   Method: Compositional matrix adjust.
 Identities = 21/46 (45%), Positives = 25/46 (54%), Gaps = 2/46 (4%)

Query: 84  SKFTHLDEEILKRGGFIAGLVNDGNTCFMNSVLQSLASSRELMEFL 129
           S F H ++  L     I GL N GNTC+MNS LQ L    EL E+ 
Sbjct: 324 SNFFHYNK--LNAPSGIMGLSNLGNTCYMNSALQCLLHIPELNEYF 367

>TPHA0E01710 Chr5 (343977..347828) [3852 bp, 1283 aa] {ON} Anc_5.443
            YOR124C
          Length = 1283

 Score = 37.0 bits (84), Expect = 0.24,   Method: Compositional matrix adjust.
 Identities = 17/51 (33%), Positives = 29/51 (56%), Gaps = 3/51 (5%)

Query: 679  LTYSLRSVIVHYGTHNYGHYIAFRK---YRGCWWRISDETVYVVDEAEVLS 726
            + Y+L +V +H G  +YGHY  + K       W + +DET+  V ++EV +
Sbjct: 1199 IKYNLFAVFIHRGEASYGHYWTYIKDFQQNSIWRKYNDETITEVPDSEVFN 1249

>TDEL0C05640 Chr3 complement(1005536..1009072) [3537 bp, 1178 aa]
           {ON} Anc_1.137 YJL197W
          Length = 1178

 Score = 37.0 bits (84), Expect = 0.25,   Method: Compositional matrix adjust.
 Identities = 16/30 (53%), Positives = 19/30 (63%)

Query: 100 IAGLVNDGNTCFMNSVLQSLASSRELMEFL 129
           I GL N GNTC+MNS LQ L    EL ++ 
Sbjct: 301 ITGLTNLGNTCYMNSALQCLVHIPELRDYF 330

>NCAS0A03910 Chr1 (791578..793965) [2388 bp, 795 aa] {ON} Anc_8.188
          Length = 795

 Score = 37.0 bits (84), Expect = 0.25,   Method: Compositional matrix adjust.
 Identities = 20/61 (32%), Positives = 28/61 (45%), Gaps = 4/61 (6%)

Query: 678 PLTYSLRSVIVHYGTHNYGHYIAFRKYRG---CWWRISDETVYVVDEAEVLSTPGVFMLF 734
           P  Y L +V  H GT   GHY A+   +G    W+   D +  +V  A     P  ++LF
Sbjct: 731 PFKYQLNAVACHMGTLGSGHYTAYVN-KGPDVGWYYFDDSSHRIVKIATEYMNPDAYLLF 789

Query: 735 Y 735
           Y
Sbjct: 790 Y 790

 Score = 34.7 bits (78), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 15/33 (45%), Positives = 21/33 (63%)

Query: 100 IAGLVNDGNTCFMNSVLQSLASSRELMEFLDNN 132
           I GL N  N+C+MN ++Q L S  EL++   NN
Sbjct: 428 IIGLENMSNSCYMNCIIQCLLSVPELIQICLNN 460

>KLTH0D12760g Chr4 (1045108..1046469) [1362 bp, 453 aa] {ON} similar
           to uniprot|P50102 Saccharomyces cerevisiae YMR223W UBP8
           Ubiquitin-specific protease that is a component of the
           SAGA (Spt-Ada-Gcn5- Acetyltransferase) acetylation
           complex required for SAGA- mediated deubiquitination of
           histone H2B
          Length = 453

 Score = 36.6 bits (83), Expect = 0.25,   Method: Compositional matrix adjust.
 Identities = 23/74 (31%), Positives = 35/74 (47%), Gaps = 4/74 (5%)

Query: 663 PPINYARSFSTVPATPLTYSLRSVIVHYGTHNYGHYIAFRKYRGC-WWRISDETVYVVDE 721
            P  +     +VP   + Y L +VI   G+ N GHY    K  G  W+R +D  +  + E
Sbjct: 377 APFCHHSEARSVP--DMVYELVAVISQEGSVNQGHYTCMCKVPGGQWFRFNDTMIVSITE 434

Query: 722 AEVLSTPGVFMLFY 735
            +VL     ++LFY
Sbjct: 435 EDVLRQQA-YLLFY 447

 Score = 34.3 bits (77), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 24/83 (28%), Positives = 43/83 (51%), Gaps = 15/83 (18%)

Query: 43  IFGI-----VVFFYKKPDHLNYIVESVSEMTTNFRNNNSLSRWLPRSKFTHLDEEILKRG 97
           IFG+     ++F +K  D++      ++     + ++ S+   LP +K          R 
Sbjct: 83  IFGVNSSNGLLFCFKCGDYVGGNETLINSTLVKYWDDISVKSSLPVAK---------GRD 133

Query: 98  GFIAGLVNDGNTCFMNSVLQSLA 120
           G + GLVN G+TCFM+S++Q+L 
Sbjct: 134 G-LCGLVNMGSTCFMSSIIQTLV 155

>KNAG0G01670 Chr7 complement(366899..369592) [2694 bp, 897 aa] {ON}
           Anc_8.202 YER151C
          Length = 897

 Score = 36.6 bits (83), Expect = 0.27,   Method: Compositional matrix adjust.
 Identities = 25/83 (30%), Positives = 37/83 (44%), Gaps = 24/83 (28%)

Query: 54  PDHLNYIVESVSEMTTNFRNNNSLSRWLPRSKFTHLDEEILKRGGFIAGLVNDGNTCFMN 113
           PD++NY +    +M TN      +   +PR                  G+VN  N CFM+
Sbjct: 420 PDYVNYFLSKSIDMRTNL----PVKSIIPR------------------GIVNTANICFMS 457

Query: 114 SVLQSLASSRELMEFLDNNVIRT 136
           SVLQ L   +  ++ L  NV+ T
Sbjct: 458 SVLQVLLHCKPFVDIL--NVLST 478

>CAGL0I06600g Chr9 (639096..641546) [2451 bp, 816 aa] {ON} similar
           to uniprot|Q01477 Saccharomyces cerevisiae YER151c UBP3
           ubiquitin-specific proteinase
          Length = 816

 Score = 36.6 bits (83), Expect = 0.27,   Method: Compositional matrix adjust.
 Identities = 19/49 (38%), Positives = 28/49 (57%), Gaps = 3/49 (6%)

Query: 680 TYSLRSVIVHYG-THNYGHYIA--FRKYRGCWWRISDETVYVVDEAEVL 725
           TY L  VI H+G + + GHY A  F K    W+RI D  +  +++ +VL
Sbjct: 746 TYELSGVIYHHGMSPDGGHYTADVFHKQTKTWYRIDDVNITKLEDDDVL 794

>ZYRO0C17908g Chr3 complement(1393864..1397478) [3615 bp, 1204 aa]
           {ON} similar to uniprot|P39538 Saccharomyces cerevisiae
           YJL197W UBP12 Ubiquitin-specific protease present in the
           nucleus and cytoplasm that cleaves ubiquitin from
           ubiquitinated proteins
          Length = 1204

 Score = 36.6 bits (83), Expect = 0.29,   Method: Compositional matrix adjust.
 Identities = 16/30 (53%), Positives = 19/30 (63%)

Query: 100 IAGLVNDGNTCFMNSVLQSLASSRELMEFL 129
           I GL N GNTC+MNS LQ L    EL ++ 
Sbjct: 292 ITGLYNLGNTCYMNSALQCLVHIPELRDYF 321

>SAKL0E15136g Chr5 complement(1258870..1261983) [3114 bp, 1037 aa]
           {ON} uniprot|Q875P1 Saccharomyces kluyveri UBP7
          Length = 1037

 Score = 36.6 bits (83), Expect = 0.31,   Method: Compositional matrix adjust.
 Identities = 49/185 (26%), Positives = 76/185 (41%), Gaps = 33/185 (17%)

Query: 224 NSLLKAMSKSPRKNILLGYDQEDAQEFFQNILAELESNVKSLNTEKLDTTPVAKSELPDD 283
           +  LKA + S R +  +  DQ+D QEF   +L +L   +        D   VA ++ P  
Sbjct: 682 SGFLKACN-SMRPDFKIPNDQQDTQEFLLFLLDQLHDELS-------DPEQVA-NDYPQL 732

Query: 284 ALVGQLNLGEVGTVYIPTEQIDPNSILHDKSIQNFTPFKLMTPLDGITAERI-GCLQCGE 342
            L    NL   G  Y             DK  ++      ++P+D I   ++  CLQC  
Sbjct: 733 LLHDDDNLQVDGKEY-------------DKWFEDSISKNGLSPIDSIFQGQMENCLQCQR 779

Query: 343 NG--GIRYSVFSGLSLNLP---NENIGSTLK--LSQLLSDWSKPEIIEG---VECNRCAL 392
            G     YS F  LSL +P       G T K  L   ++ ++  E++ G    +C RC  
Sbjct: 780 CGHSSYNYSTFYVLSLAIPTPGTSTFGKTKKVLLEDCINLFTSDEVLSGENAWDCPRCGT 839

Query: 393 TAAHS 397
           + + S
Sbjct: 840 SMSGS 844

>CAGL0G02563g Chr7 complement(235498..237393) [1896 bp, 631 aa] {ON}
           weakly similar to uniprot|P36026 Saccharomyces
           cerevisiae YKR098c UBP11 ubiquitin C-terminal hydrolase
          Length = 631

 Score = 36.2 bits (82), Expect = 0.33,   Method: Compositional matrix adjust.
 Identities = 48/200 (24%), Positives = 85/200 (42%), Gaps = 31/200 (15%)

Query: 314 SIQNFTPFKLMTPLDGITAERIGCLQCGENGGIRYSVFSGLSLNLPNENIG-----STLK 368
           S  N +P  L+    G    ++ C  C E+    +S F  LSLN+P E         T++
Sbjct: 356 SRNNLSPIDLL--FRGDVESKLICKHCNESAST-FSSFYILSLNIPKEKSSLFFKSKTIR 412

Query: 369 LSQLLSDWSKPEIIEG---VECNRCALTAAHSHLFGQLKEFEKK-----PEGSIPEKL-- 418
           L   ++ +++ EI+ G     C  C  T A  ++    K +++K          P     
Sbjct: 413 LEDCINLFTRKEILTGENSWACPSCE-TKARYNVIDNDKTYQQKHTNIGKHSKFPRFFSH 471

Query: 419 INAVKDRVHQIEEVLAKPVIDDEDYKKLHTANMVRKCSKSKQIL---ISRPPPLLSIHIN 475
           I A K   +      ++   D+ + ++ H     R+  KS+ IL       PP+L IH++
Sbjct: 472 IEAGKTERNSGANKFSQLKYDNLENEQRH-----RQQKKSETILSVSFVSLPPILVIHLS 526

Query: 476 RSVFDPRTYMIRKNNSKVLF 495
           R  +D    + +KN S + +
Sbjct: 527 RFCYD----ISKKNTSNISY 542

 Score = 32.7 bits (73), Expect = 4.0,   Method: Compositional matrix adjust.
 Identities = 13/30 (43%), Positives = 19/30 (63%)

Query: 100 IAGLVNDGNTCFMNSVLQSLASSRELMEFL 129
           + G+ N GNTC+MNS+LQ L  S +  +  
Sbjct: 212 VFGIRNMGNTCYMNSMLQCLFGSTQFRDLF 241

>Kpol_1055.31 s1055 complement(78247..80715) [2469 bp, 822 aa] {ON}
           complement(78247..80715) [2469 nt, 823 aa]
          Length = 822

 Score = 36.2 bits (82), Expect = 0.35,   Method: Compositional matrix adjust.
 Identities = 19/42 (45%), Positives = 24/42 (57%), Gaps = 1/42 (2%)

Query: 90  DEEILKRGGFIA-GLVNDGNTCFMNSVLQSLASSRELMEFLD 130
           +E IL  G  I  G+VN  N CFM+SVLQ L   R  +  L+
Sbjct: 365 NESILPIGSIIPRGIVNRANICFMSSVLQVLLYCRPFISVLN 406

>Kpol_1045.41 s1045 complement(95233..97371) [2139 bp, 712 aa] {ON}
           complement(95235..97373) [2139 nt, 713 aa]
          Length = 712

 Score = 36.2 bits (82), Expect = 0.38,   Method: Compositional matrix adjust.
 Identities = 23/65 (35%), Positives = 32/65 (49%), Gaps = 9/65 (13%)

Query: 681 YSLRSVIVHYGTH-NYGHYIAFRKYRGCWWRI-SDETVYVVDEAEVLSTPG-------VF 731
           Y L  ++VH G    +GHYI+  K     W +  DETV  + E  VLS  G        +
Sbjct: 574 YELGGLVVHIGIGPQHGHYISVCKTSDYGWLLFDDETVECISEDTVLSFVGDSNSAGTAY 633

Query: 732 MLFYE 736
           +LFY+
Sbjct: 634 VLFYK 638

 Score = 32.0 bits (71), Expect = 8.1,   Method: Compositional matrix adjust.
 Identities = 14/28 (50%), Positives = 18/28 (64%)

Query: 100 IAGLVNDGNTCFMNSVLQSLASSRELME 127
           + GL N GNTC+ NS+LQ L +  E  E
Sbjct: 130 VYGLENFGNTCYCNSILQCLYNMNEFRE 157

>NCAS0D02390 Chr4 complement(451930..455565) [3636 bp, 1211 aa] {ON}
           Anc_5.18
          Length = 1211

 Score = 36.2 bits (82), Expect = 0.39,   Method: Compositional matrix adjust.
 Identities = 18/47 (38%), Positives = 26/47 (55%), Gaps = 2/47 (4%)

Query: 681 YSLRSVIVHYGTHNYGHYIAFRK--YRGCWWRISDETVYVVDEAEVL 725
           Y+L  V+VH G  + GHY A  K   +  W+R  DE V+ V + +V 
Sbjct: 444 YTLHGVLVHTGDISTGHYYAMIKPDLQDQWYRFDDEKVWKVTKKQVF 490

>Skud_11.338 Chr11 complement(614651..616789) [2139 bp, 712 aa] {ON}
           YKR098C (REAL)
          Length = 712

 Score = 36.2 bits (82), Expect = 0.40,   Method: Compositional matrix adjust.
 Identities = 64/311 (20%), Positives = 112/311 (36%), Gaps = 47/311 (15%)

Query: 204 RDLLSALNAKYYRDKPYFKTNSLLKAMSKSPRKNILLGYDQEDAQEFFQNILAELESNVK 263
           R + S     Y         N  LK M K  R ++ +  DQ+D QEF   ILA +   + 
Sbjct: 342 RSIYSLFKKMYANGGSAIVPNGFLK-MCKKLRPDLNIPDDQQDTQEFLLIILARIHEELS 400

Query: 264 SLNTEKLDTTPVAKSELPDDALVGQLNLGEVGTVYIPTEQIDPNSILHDKSIQNFTPFKL 323
           + N  K                           V   T  +  N I + K  +       
Sbjct: 401 NENVTKY----------------------YCDLVSYDTNALQVNPIKYQKWYEETILADG 438

Query: 324 MTPLDGITAER----IGCLQCGENGGIRYSVFSGLSLNLPNENIGS------TLKLSQLL 373
           ++P+D I   +    + C +CG N    YS F  LSL +P  ++ S       +KL   +
Sbjct: 439 LSPIDHIFRGQMENILKCQRCG-NSSFSYSTFYVLSLAIPKNSVHSFTSKSKKIKLEDCI 497

Query: 374 SDWSKPEIIEG---VECNRCALTAAHSHLFGQLKEFEKKPEGSIPEKLINAVKDRVHQIE 430
           + ++  E + G    +C  C +  +      +LK  E   +           + R     
Sbjct: 498 NLFTSDEELTGDNAWDCPECRIDDS------KLKTGENSSQKKRSPLFSFHSRSRSKSPH 551

Query: 431 EVLAKPVIDDEDYKKLHTANMVRKCSKSKQILISRPPPLLSIHINRSVFDPRTYMIRKNN 490
                     ++  K       ++ +  K +     PP+L IH++R  +D    + +KNN
Sbjct: 552 HHHHYHHHGSDNTTKNSNKWKSKRLTTIKSLDFIFLPPILVIHLSRFYYD----LTKKNN 607

Query: 491 SKVLFKSRLNL 501
           + + +   LN+
Sbjct: 608 AVITYPLILNI 618

>Suva_13.495 Chr13 (857778..861470) [3693 bp, 1230 aa] {ON} YMR304W
           (REAL)
          Length = 1230

 Score = 36.2 bits (82), Expect = 0.41,   Method: Compositional matrix adjust.
 Identities = 18/52 (34%), Positives = 25/52 (48%), Gaps = 2/52 (3%)

Query: 676 ATPLTYSLRSVIVHYGTHNYGHYIAFRK--YRGCWWRISDETVYVVDEAEVL 725
             P  Y+L  V+VH G  + GHY    K      W+R  DE V+ V + +V 
Sbjct: 443 GNPYIYNLHGVLVHSGDISTGHYYTLIKPGVEDQWYRFDDERVWRVTKKQVF 494

>Smik_13.521 Chr13 (857682..861377) [3696 bp, 1231 aa] {ON} YMR304W
           (REAL)
          Length = 1231

 Score = 36.2 bits (82), Expect = 0.41,   Method: Compositional matrix adjust.
 Identities = 18/50 (36%), Positives = 25/50 (50%), Gaps = 2/50 (4%)

Query: 678 PLTYSLRSVIVHYGTHNYGHYIAFRK--YRGCWWRISDETVYVVDEAEVL 725
           P  Y+L  V+VH G  + GHY    K      W+R  DE V+ V + +V 
Sbjct: 446 PYVYNLHGVLVHSGDISTGHYYTLIKPGVEDQWYRFDDERVWRVTKKQVF 495

>AGL357W Chr7 (33383..36883) [3501 bp, 1166 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YMR304W (UBP15)
          Length = 1166

 Score = 36.2 bits (82), Expect = 0.43,   Method: Compositional matrix adjust.
 Identities = 21/61 (34%), Positives = 29/61 (47%), Gaps = 2/61 (3%)

Query: 681 YSLRSVIVHYGTHNYGHYIAFRK--YRGCWWRISDETVYVVDEAEVLSTPGVFMLFYEYD 738
           Y+L  V+VH G  + GHY A  K      W+R  D+ V+ V + +V      F    EYD
Sbjct: 427 YNLHGVLVHTGDISTGHYYAMIKPGLEDAWYRFDDDKVWRVTKKQVFEQNFGFDKLSEYD 486

Query: 739 F 739
            
Sbjct: 487 L 487

>YMR304W Chr13 (874987..878679) [3693 bp, 1230 aa] {ON}
           UBP15Ubiquitin-specific protease involved in protein
           deubiquitination; catalytic activity regulated by an
           N-terminal TRAF-like domain and and C-terminal
           sequences; physically interacts with anaphase-promoting
           complex/cyclosome (APC/C) activator, Cdh1p
          Length = 1230

 Score = 36.2 bits (82), Expect = 0.43,   Method: Compositional matrix adjust.
 Identities = 18/50 (36%), Positives = 25/50 (50%), Gaps = 2/50 (4%)

Query: 678 PLTYSLRSVIVHYGTHNYGHYIAFRK--YRGCWWRISDETVYVVDEAEVL 725
           P  Y+L  V+VH G  + GHY    K      W+R  DE V+ V + +V 
Sbjct: 446 PYVYNLHGVLVHSGDISTGHYYTLIKPGVEDQWYRFDDERVWRVTKKQVF 495

>KAFR0C00410 Chr3 complement(85302..87611) [2310 bp, 769 aa] {ON}
           Anc_3.270 YBR058C
          Length = 769

 Score = 36.2 bits (82), Expect = 0.44,   Method: Compositional matrix adjust.
 Identities = 13/23 (56%), Positives = 19/23 (82%)

Query: 97  GGFIAGLVNDGNTCFMNSVLQSL 119
           G F  GL+N GN+C++NS+LQ+L
Sbjct: 315 GNFGCGLINLGNSCYLNSILQAL 337

>CAGL0H06721g Chr8 complement(667816..671061) [3246 bp, 1081 aa]
           {ON} similar to uniprot|P40453 Saccharomyces cerevisiae
           YIL156w UBP7
          Length = 1081

 Score = 35.8 bits (81), Expect = 0.47,   Method: Compositional matrix adjust.
 Identities = 16/38 (42%), Positives = 23/38 (60%)

Query: 100 IAGLVNDGNTCFMNSVLQSLASSRELMEFLDNNVIRTY 137
           + GL N GNTC++N +LQSL ++ EL     +   R Y
Sbjct: 647 VTGLRNLGNTCYINCMLQSLFATNELKNLFISGKYREY 684

>Skud_13.478 Chr13 (848446..852141) [3696 bp, 1231 aa] {ON} YMR304W
           (REAL)
          Length = 1231

 Score = 35.8 bits (81), Expect = 0.48,   Method: Compositional matrix adjust.
 Identities = 18/50 (36%), Positives = 25/50 (50%), Gaps = 2/50 (4%)

Query: 678 PLTYSLRSVIVHYGTHNYGHYIAFRK--YRGCWWRISDETVYVVDEAEVL 725
           P  Y+L  V+VH G  + GHY    K      W+R  DE V+ V + +V 
Sbjct: 446 PYIYNLHGVLVHSGDISTGHYYTLIKPGVEDQWYRFDDERVWRVTKKQVF 495

>NDAI0A03680 Chr1 (837931..841281) [3351 bp, 1116 aa] {ON} 
          Length = 1116

 Score = 35.8 bits (81), Expect = 0.49,   Method: Compositional matrix adjust.
 Identities = 15/39 (38%), Positives = 22/39 (56%)

Query: 99  FIAGLVNDGNTCFMNSVLQSLASSRELMEFLDNNVIRTY 137
           FI GL N GN+C++N ++Q L  + EL +   N     Y
Sbjct: 745 FIIGLQNMGNSCYLNCIIQCLLGTHELTKIFLNYSFERY 783

>YJL197W Chr10 (63805..67569) [3765 bp, 1254 aa] {ON}
           UBP12Ubiquitin carboxyl-terminal hydrolase,
           ubiquitin-specific protease present in the nucleus and
           cytoplasm that cleaves ubiquitin from ubiquitinated
           proteins
          Length = 1254

 Score = 35.8 bits (81), Expect = 0.51,   Method: Compositional matrix adjust.
 Identities = 16/36 (44%), Positives = 21/36 (58%)

Query: 94  LKRGGFIAGLVNDGNTCFMNSVLQSLASSRELMEFL 129
           L+      GLVN GNTC+MNS LQ L    +L ++ 
Sbjct: 357 LEPASGTTGLVNLGNTCYMNSALQCLVHIPQLRDYF 392

>Kpol_1024.44 s1024 (118060..119550) [1491 bp, 496 aa] {ON}
           (118060..119550) [1491 nt, 497 aa]
          Length = 496

 Score = 35.8 bits (81), Expect = 0.51,   Method: Compositional matrix adjust.
 Identities = 13/23 (56%), Positives = 17/23 (73%)

Query: 681 YSLRSVIVHYGTHNYGHYIAFRK 703
           Y L+S+I H GTHN GHY  +R+
Sbjct: 395 YQLQSIIKHTGTHNSGHYQCYRR 417

 Score = 32.7 bits (73), Expect = 4.3,   Method: Compositional matrix adjust.
 Identities = 45/200 (22%), Positives = 81/200 (40%), Gaps = 23/200 (11%)

Query: 326 PLDGITAERIGCLQCGENGGIRYSVFSGLSLNLPNENIGSTLKLSQLLSDWSKPEIIEGV 385
           P +G  A  + CL CG+      S F+ L +  P E    + +L +++   ++ + I   
Sbjct: 208 PFEGKLASYLSCLNCGQTSIPNISTFNILPIQTPQE---YSAELEEIIYG-NQIDQITDY 263

Query: 386 ECNRCALTA--------AHSHLFGQLKEFEKKPEGSIPEKLINAVKDRVHQIEEVLAKPV 437
            C  C   A         H        E  K  E  +P   IN         EE+ +K +
Sbjct: 264 SCLVCQTNAILKNEKTNGHKGNTTDEHEIVKYLEDVLPVLRIN---------EELDSKTL 314

Query: 438 IDDEDYKKLHTANMVRKCSKSKQILISRPPPLLSIHINRSVFDPRTYMIRKNNSKVLFKS 497
              + Y K    +   K +  K+  I   P +L IH++RS+++    +  +N+ +V F+ 
Sbjct: 315 NYIKYYNKYGMKSGNIKSTIIKKNSIIETPKILMIHLSRSIYNGMVAV--RNSCRVRFEE 372

Query: 498 RLNLAPWCCDINEINLDARL 517
           ++++     D    NL   L
Sbjct: 373 KMSIERQTTDEKNENLKIEL 392

>Skud_4.323 Chr4 complement(560596..563376) [2781 bp, 926 aa] {ON}
           YDR069C (REAL)
          Length = 926

 Score = 35.8 bits (81), Expect = 0.52,   Method: Compositional matrix adjust.
 Identities = 19/61 (31%), Positives = 25/61 (40%), Gaps = 2/61 (3%)

Query: 678 PLTYSLRSVIVHYGTHNYGHYIAFRK--YRGCWWRISDETVYVVDEAEVLSTPGVFMLFY 735
           P  Y L  V  H+GT   GHY A+ K   R  W    D     V     ++    ++LFY
Sbjct: 861 PFKYELYGVACHFGTLYGGHYTAYVKKGLRKGWLYFDDTKFKPVKNKTDVTNSNAYVLFY 920

Query: 736 E 736
            
Sbjct: 921 H 921

 Score = 35.8 bits (81), Expect = 0.53,   Method: Compositional matrix adjust.
 Identities = 15/38 (39%), Positives = 25/38 (65%), Gaps = 1/38 (2%)

Query: 99  FIAGLVNDGNTCFMNSVLQSLASSRELME-FLDNNVIR 135
           F  GL N GN+C+MN ++Q +  + EL + FLD++  +
Sbjct: 560 FAVGLENLGNSCYMNCIIQCILGTHELTQIFLDDSYAK 597

>Suva_2.228 Chr2 complement(385322..388105) [2784 bp, 927 aa] {ON}
           YDR069C (REAL)
          Length = 927

 Score = 35.8 bits (81), Expect = 0.54,   Method: Compositional matrix adjust.
 Identities = 15/38 (39%), Positives = 25/38 (65%), Gaps = 1/38 (2%)

Query: 99  FIAGLVNDGNTCFMNSVLQSLASSRELME-FLDNNVIR 135
           F  GL N GN+C+MN ++Q +  + EL + FLD++  +
Sbjct: 561 FAVGLENLGNSCYMNCIIQCILGTHELTQIFLDDSYAK 598

>TBLA0C01200 Chr3 complement(258492..259981,260188..260209) [1512
           bp, 503 aa] {ON} Anc_1.369 YFR010W
          Length = 503

 Score = 35.4 bits (80), Expect = 0.55,   Method: Compositional matrix adjust.
 Identities = 17/54 (31%), Positives = 31/54 (57%), Gaps = 4/54 (7%)

Query: 680 TYSLRSVIVHYGTHN-YGHYIAF---RKYRGCWWRISDETVYVVDEAEVLSTPG 729
            Y+L  +I H G ++  GHY AF   R+    W++ +D+ V +VD+ ++ +  G
Sbjct: 433 VYNLIGIITHQGANSESGHYQAFIRDREDEEIWYKFNDDKVTIVDKEKIETLAG 486

>KLLA0E10275g Chr5 (906675..909065) [2391 bp, 796 aa] {ON} similar
           to uniprot|P39944 Saccharomyces cerevisiae YER144C UBP5
           Putative ubiquitin-specific protease that does not
           associate with the proteasome
          Length = 796

 Score = 35.8 bits (81), Expect = 0.57,   Method: Compositional matrix adjust.
 Identities = 20/59 (33%), Positives = 27/59 (45%), Gaps = 1/59 (1%)

Query: 678 PLTYSLRSVIVHYGTHNYGHYIAF-RKYRGCWWRISDETVYVVDEAEVLSTPGVFMLFY 735
           P  Y L +V  H GT   GHY +F  K R  W    D +   +   +   TP  ++LFY
Sbjct: 733 PFNYRLFAVASHSGTLYGGHYTSFVDKGRVGWCSFDDVSWRKIRRKDEYITPNAYVLFY 791

 Score = 35.0 bits (79), Expect = 0.80,   Method: Compositional matrix adjust.
 Identities = 15/39 (38%), Positives = 21/39 (53%)

Query: 99  FIAGLVNDGNTCFMNSVLQSLASSRELMEFLDNNVIRTY 137
           F  GLVN GN+C++N ++Q L    EL      N  R +
Sbjct: 430 FAIGLVNLGNSCYLNCIIQCLLGCHELSYIFLTNSYRKH 468

>Smik_10.37 Chr10 (61787..65530) [3744 bp, 1247 aa] {ON} YJL197W
           (REAL)
          Length = 1247

 Score = 35.8 bits (81), Expect = 0.57,   Method: Compositional matrix adjust.
 Identities = 16/36 (44%), Positives = 21/36 (58%)

Query: 94  LKRGGFIAGLVNDGNTCFMNSVLQSLASSRELMEFL 129
           L+      GLVN GNTC+MNS LQ L    +L ++ 
Sbjct: 357 LEPASGTTGLVNLGNTCYMNSALQCLVHIPQLRDYF 392

>AGR139C Chr7 complement(1010460..1012829) [2370 bp, 789 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YER151C
           (UBP3)
          Length = 789

 Score = 35.8 bits (81), Expect = 0.58,   Method: Compositional matrix adjust.
 Identities = 17/39 (43%), Positives = 22/39 (56%)

Query: 98  GFIAGLVNDGNTCFMNSVLQSLASSRELMEFLDNNVIRT 136
           G   G++N GN CFM+SVLQ L      +E L+    RT
Sbjct: 346 GIPRGIMNKGNICFMSSVLQVLLFCEPFIEMLNVVHART 384

 Score = 32.3 bits (72), Expect = 5.4,   Method: Compositional matrix adjust.
 Identities = 20/74 (27%), Positives = 35/74 (47%), Gaps = 3/74 (4%)

Query: 655 DEEDVIPAPPINYARSFSTVPATPLTYSLRSVIVHYG-THNYGHYIA--FRKYRGCWWRI 711
           D+E  IP   ++   +   +     TY L  V+ H+G + + GHY A    + +  W+RI
Sbjct: 697 DQELTIPKEALSSVNAKFYLSGKDTTYRLTGVVYHHGLSPSGGHYTADVLHQTQDKWYRI 756

Query: 712 SDETVYVVDEAEVL 725
            D  V  + + +V 
Sbjct: 757 DDNNVTEIRQEDVF 770

>YDR069C Chr4 complement(584939..587719) [2781 bp, 926 aa] {ON}
           DOA4Ubiquitin isopeptidase, required for recycling
           ubiquitin from proteasome-bound ubiquitinated
           intermediates, acts at the late endosome/prevacuolar
           compartment to recover ubiquitin from ubiquitinated
           membrane proteins en route to the vacuole
          Length = 926

 Score = 35.8 bits (81), Expect = 0.59,   Method: Compositional matrix adjust.
 Identities = 15/38 (39%), Positives = 25/38 (65%), Gaps = 1/38 (2%)

Query: 99  FIAGLVNDGNTCFMNSVLQSLASSRELME-FLDNNVIR 135
           F  GL N GN+C+MN ++Q +  + EL + FLD++  +
Sbjct: 560 FAVGLENLGNSCYMNCIIQCILGTHELTQIFLDDSYAK 597

 Score = 35.0 bits (79), Expect = 0.97,   Method: Compositional matrix adjust.
 Identities = 21/62 (33%), Positives = 33/62 (53%), Gaps = 4/62 (6%)

Query: 678 PLTYSLRSVIVHYGTHNYGHYIAF-RKYRGCWWRISDETVY--VVDEAEVLSTPGVFMLF 734
           P  Y L  V  H+GT   GHY A+ +K     W   D+T Y  V ++A+ +++   ++LF
Sbjct: 861 PFKYELYGVACHFGTLYGGHYTAYVKKGLKKGWLYFDDTKYKPVKNKADAINS-NAYVLF 919

Query: 735 YE 736
           Y 
Sbjct: 920 YH 921

>Ecym_4685 Chr4 complement(1332993..1335329) [2337 bp, 778 aa] {ON}
           similar to Ashbya gossypii AGR370W
          Length = 778

 Score = 35.4 bits (80), Expect = 0.60,   Method: Compositional matrix adjust.
 Identities = 20/65 (30%), Positives = 32/65 (49%), Gaps = 9/65 (13%)

Query: 681 YSLRSVIVHYGTH-NYGHYIAFRKYRGCWWRI-SDETVYVVDEAEVLSTPG-------VF 731
           Y L  +++H G    +GHY+A  K+    W +  DETV  +DE  V    G        +
Sbjct: 637 YELNGIVIHMGGGPQHGHYVAICKHDMFGWLLYDDETVESIDEETVFKFVGDEKDMTTAY 696

Query: 732 MLFYE 736
           +LF++
Sbjct: 697 VLFFK 701

 Score = 31.6 bits (70), Expect = 9.2,   Method: Compositional matrix adjust.
 Identities = 15/26 (57%), Positives = 18/26 (69%)

Query: 100 IAGLVNDGNTCFMNSVLQSLASSREL 125
           + GL N GNTC+ NSVLQ L +  EL
Sbjct: 132 VFGLENFGNTCYCNSVLQCLFNLSEL 157

>Suva_6.276 Chr6 complement(481843..485613) [3771 bp, 1256 aa] {ON}
           YJL197W (REAL)
          Length = 1256

 Score = 35.8 bits (81), Expect = 0.62,   Method: Compositional matrix adjust.
 Identities = 16/36 (44%), Positives = 21/36 (58%)

Query: 94  LKRGGFIAGLVNDGNTCFMNSVLQSLASSRELMEFL 129
           L+      GLVN GNTC+MNS LQ L    +L ++ 
Sbjct: 354 LEPASGTTGLVNLGNTCYMNSALQCLVHLPQLRDYF 389

>KNAG0G01590 Chr7 complement(354369..356384) [2016 bp, 671 aa] {ON}
           Anc_8.188 YDR069C
          Length = 671

 Score = 35.4 bits (80), Expect = 0.62,   Method: Compositional matrix adjust.
 Identities = 16/38 (42%), Positives = 23/38 (60%), Gaps = 1/38 (2%)

Query: 100 IAGLVNDGNTCFMNSVLQSLASSRELM-EFLDNNVIRT 136
           I G+ N+GN C+MN ++Q L    E   +FLDN  + T
Sbjct: 343 IKGIQNEGNCCYMNCIIQCLLCFPEFTNKFLDNAYLGT 380

 Score = 33.5 bits (75), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 19/58 (32%), Positives = 26/58 (44%), Gaps = 3/58 (5%)

Query: 681 YSLRSVIVHYGTHNYGHYIA--FRKYRGCWWRISDETVYVVDEAEVLSTPGVFMLFYE 736
           Y L +V  H GT   GHY A  F+     W+   D     V   E +S    ++LFY+
Sbjct: 612 YKLVAVACHTGTLFSGHYTAYCFKNSENGWYHFDDTQCKPVSNGECISQ-SAYLLFYQ 668

>Smik_4.307 Chr4 complement(551719..554508) [2790 bp, 929 aa] {ON}
           YDR069C (REAL)
          Length = 929

 Score = 35.4 bits (80), Expect = 0.62,   Method: Compositional matrix adjust.
 Identities = 15/38 (39%), Positives = 25/38 (65%), Gaps = 1/38 (2%)

Query: 99  FIAGLVNDGNTCFMNSVLQSLASSRELME-FLDNNVIR 135
           F  GL N GN+C+MN ++Q +  + EL + FLD++  +
Sbjct: 563 FAVGLENLGNSCYMNCIIQCILGTHELTQIFLDDSYAK 600

 Score = 33.9 bits (76), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 20/62 (32%), Positives = 32/62 (51%), Gaps = 4/62 (6%)

Query: 678 PLTYSLRSVIVHYGTHNYGHYIAF-RKYRGCWWRISDETVY--VVDEAEVLSTPGVFMLF 734
           P  Y L  V  H+GT   GHY A+ +K     W   D+T Y  V ++ + +++   ++LF
Sbjct: 864 PFKYELYGVACHFGTLYGGHYTAYVKKGLKKGWLYFDDTKYKPVKNQTDAINS-NAYVLF 922

Query: 735 YE 736
           Y 
Sbjct: 923 YH 924

>KLTH0H13354g Chr8 complement(1165485..1166953,1167017..1167035)
           [1488 bp, 495 aa] {ON} similar to uniprot|P43593
           Saccharomyces cerevisiae YFR010W UBP6 Ubiquitin-specific
           protease situated in the base subcomplex of the 26S
           proteasome releases free ubiquitin from branched
           polyubiquitin chains deletion causes hypersensitivity to
           cycloheximide and other toxic compounds
          Length = 495

 Score = 35.4 bits (80), Expect = 0.64,   Method: Compositional matrix adjust.
 Identities = 17/31 (54%), Positives = 20/31 (64%)

Query: 101 AGLVNDGNTCFMNSVLQSLASSRELMEFLDN 131
            GL N GNTC+MNS LQ+L   R L E + N
Sbjct: 106 VGLKNLGNTCYMNSTLQALYQIRPLREEILN 136

>Kwal_55.19645 s55 (62575..65487) [2913 bp, 970 aa] {ON} YIL156W
           (UBP7) - Ubiquitin-specific protease [contig 159] FULL
          Length = 970

 Score = 35.4 bits (80), Expect = 0.66,   Method: Compositional matrix adjust.
 Identities = 14/30 (46%), Positives = 21/30 (70%)

Query: 100 IAGLVNDGNTCFMNSVLQSLASSRELMEFL 129
           I GL N GNTC++NS+LQ L ++R+  +  
Sbjct: 555 ITGLRNMGNTCYINSMLQCLFATRKFRDLF 584

>TPHA0C02770 Chr3 (604690..607602) [2913 bp, 970 aa] {ON} Anc_8.188
           YDR069C
          Length = 970

 Score = 35.4 bits (80), Expect = 0.67,   Method: Compositional matrix adjust.
 Identities = 15/34 (44%), Positives = 20/34 (58%)

Query: 99  FIAGLVNDGNTCFMNSVLQSLASSRELMEFLDNN 132
           F  GL N GN+C++N ++Q L SS E      NN
Sbjct: 606 FSIGLENMGNSCYLNCIIQCLLSSHEFTRIFLNN 639

 Score = 35.0 bits (79), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 17/59 (28%), Positives = 28/59 (47%), Gaps = 1/59 (1%)

Query: 678 PLTYSLRSVIVHYGTHNYGHYIAFRKYRGCWWRISDET-VYVVDEAEVLSTPGVFMLFY 735
           P  Y L +V  H+G+   GHY ++       WR  D+T +  +  +    T   ++LFY
Sbjct: 906 PFNYKLNAVAAHFGSLYGGHYTSYVDKGKFGWRYFDDTKIRPLKNSYECITSNAYVLFY 964

>NCAS0A03840 Chr1 (780031..782784) [2754 bp, 917 aa] {ON} Anc_8.202
           YER151C
          Length = 917

 Score = 35.4 bits (80), Expect = 0.69,   Method: Compositional matrix adjust.
 Identities = 26/83 (31%), Positives = 42/83 (50%), Gaps = 22/83 (26%)

Query: 54  PDHLNYIVESVSEMTTNFRNNNSLSRWLPRSKFTHLDEEILKRGGFIAGLVNDGNTCFMN 113
           PD +NY +++        + N+++ R +P        + I+ RG     +VN  N CFM+
Sbjct: 403 PDFINYTLKT--------KQNSNVDRTIPI-------KSIIPRG-----IVNMANICFMS 442

Query: 114 SVLQSLASSRELMEFLDNNVIRT 136
           SVLQ L   +  ++ L  NVI T
Sbjct: 443 SVLQVLLYCKPFIDIL--NVIST 463

>Klac_YGOB_Anc_5.18b Chr3 (1201452..1202573,1202576..1204954) [3501
           bp, 1166 aa] {ON} ANNOTATED BY YGOB -
          Length = 1166

 Score = 35.4 bits (80), Expect = 0.70,   Method: Compositional matrix adjust.
 Identities = 18/51 (35%), Positives = 25/51 (49%), Gaps = 2/51 (3%)

Query: 677 TPLTYSLRSVIVHYGTHNYGHYIAFRK--YRGCWWRISDETVYVVDEAEVL 725
           TP  Y L  V+VH G  + GHY A  +    G W+R  D+ V    + +V 
Sbjct: 427 TPADYILHGVLVHSGDISTGHYYAMIQPDAHGSWYRFDDDRVIKATDKQVF 477

>Kpol_2001.54 s2001 complement(144924..148595) [3672 bp, 1223 aa]
           {ON} complement(144924..148595) [3672 nt, 1224 aa]
          Length = 1223

 Score = 35.4 bits (80), Expect = 0.74,   Method: Compositional matrix adjust.
 Identities = 20/51 (39%), Positives = 26/51 (50%), Gaps = 4/51 (7%)

Query: 79  RWLPRSKFTHLDEEILKRGGFIAGLVNDGNTCFMNSVLQSLASSRELMEFL 129
            WL  S + H +     RG    GL N GNTC+MNS LQ L    +L ++ 
Sbjct: 324 HWL--SNYFHYNALTPSRGNI--GLNNLGNTCYMNSALQCLVHIPQLRDYF 370

>AGR370W Chr7 (1416579..1418801) [2223 bp, 740 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YER098W (UBP9) and
           YBL067C (UBP13)
          Length = 740

 Score = 35.4 bits (80), Expect = 0.74,   Method: Compositional matrix adjust.
 Identities = 22/65 (33%), Positives = 32/65 (49%), Gaps = 9/65 (13%)

Query: 681 YSLRSVIVHYGTH-NYGHYIAFRKYRGCWWRI-SDETVYVVDEAEVLSTPG-------VF 731
           Y L  +++H G    +GHY+A  K+    W +  DETV  V E  VL   G        +
Sbjct: 592 YELNGIVIHMGGGPQHGHYVAICKHELFGWLLYDDETVESVGEDAVLRFIGDVNDMTTAY 651

Query: 732 MLFYE 736
           +LFY+
Sbjct: 652 VLFYK 656

 Score = 33.1 bits (74), Expect = 3.9,   Method: Compositional matrix adjust.
 Identities = 15/26 (57%), Positives = 19/26 (73%)

Query: 100 IAGLVNDGNTCFMNSVLQSLASSREL 125
           + GL N GNTC+ NSVLQ L + +EL
Sbjct: 98  VFGLENYGNTCYCNSVLQCLYNLKEL 123

>KAFR0H00150 Chr8 (14149..16119) [1971 bp, 656 aa] {ON} Anc_5.712
           YIL156W possible pseudogene; NNN added to avoid internal
           stop codon
          Length = 656

 Score = 35.0 bits (79), Expect = 0.75,   Method: Compositional matrix adjust.
 Identities = 70/303 (23%), Positives = 120/303 (39%), Gaps = 89/303 (29%)

Query: 235 RKNILLGYDQEDAQEFFQNILAELESNVKSLNTEKLDTTPVAKSELPDDALVGQLNLGEV 294
           R ++ +  DQ+D QEF   +L  L   +  + T+ L    ++ + + DD     +NLG+ 
Sbjct: 316 RPDLNIPKDQQDTQEFLVILLDILHDEL--VYTDDL----ISNNYVSDD-----INLGKE 364

Query: 295 GTVYIPTEQIDPNSILHDKSIQNFTPFKLMTPLDGITAERI-GCLQCGENGGI--RYSVF 351
              Y+P              +QN       +P+D I   +I  CLQC   G     YS+F
Sbjct: 365 ---YMPW-------------LQNNLKANGKSPIDLIFQGQIENCLQCQRCGNTSYNYSMF 408

Query: 352 SGLSLNLPN---ENIGSTLKLSQLLSDWSKPEIIEG---VECNRCALTAAHSHLFGQLKE 405
             LSL +P    EN  + +KL   ++ ++  EI+ G     C +C  T   ++       
Sbjct: 409 YMLSLAIPKIAKENSKNRVKLEDCINFFTSDEILTGENAWNCPKCCPTTIETY------- 461

Query: 406 FEKKPEGSIPEKLINAVKDRVHQIEEVLAKPVIDDEDYKKLHTA-----------NMVRK 454
                E   P  + N VK++            I+  ++ KLH             +    
Sbjct: 462 ----DEADSPATVENRVKNKS-----------INPLNFFKLHKVLSPSSGNHHRHHHHHH 506

Query: 455 CSKS----------------KQILISRPPPLLSIHINRSVFDPRTYMIRKNNSKVLFKSR 498
             KS                KQ+   + PP+L IH++R  ++      +KNN+ + +   
Sbjct: 507 HHKSDGKNKNKYKNEKLITLKQLNFIKLPPILVIHLSRFYYNS----TKKNNAVITYPLI 562

Query: 499 LNL 501
           LN+
Sbjct: 563 LNI 565

>NCAS0G00170 Chr7 (22237..25329) [3093 bp, 1030 aa] {ON} Anc_5.712
          Length = 1030

 Score = 35.4 bits (80), Expect = 0.77,   Method: Compositional matrix adjust.
 Identities = 14/30 (46%), Positives = 20/30 (66%)

Query: 100 IAGLVNDGNTCFMNSVLQSLASSRELMEFL 129
           I GL N GNTC++NS+LQ L ++R   +  
Sbjct: 607 ITGLRNLGNTCYINSMLQCLFATRRFRDLF 636

>TBLA0C07020 Chr3 (1694706..1698449) [3744 bp, 1247 aa] {ON}
           Anc_5.18 YMR304W
          Length = 1247

 Score = 35.4 bits (80), Expect = 0.78,   Method: Compositional matrix adjust.
 Identities = 19/50 (38%), Positives = 26/50 (52%), Gaps = 2/50 (4%)

Query: 678 PLTYSLRSVIVHYGTHNYGHYIAFRK--YRGCWWRISDETVYVVDEAEVL 725
           P  Y+L  V+VH G  + GHY A  K      W+R  DE V+ V + +V 
Sbjct: 493 PNNYNLHGVLVHTGDISTGHYYAMIKPTTDDKWYRFDDEKVWRVTKKQVF 542

>SAKL0D03322g Chr4 (270137..272434) [2298 bp, 765 aa] {ON} similar
           to uniprot|P38237 YBR058C Saccharomyces cerevisiae UBP14
           Ubiquitin-specific protease that specifically
           disassembles unanchored ubiquitin chains
          Length = 765

 Score = 35.0 bits (79), Expect = 0.78,   Method: Compositional matrix adjust.
 Identities = 25/75 (33%), Positives = 35/75 (46%), Gaps = 8/75 (10%)

Query: 668 ARSFSTVPATPLTYSLRSVIVHYGTH-NYGHYIAFRKY----RGCWWRISDETVYVVDE- 721
           AR +    A+   Y+LR+VI H G     GHY+AF K     +  W   +DE + V D+ 
Sbjct: 689 ARKYGDPDASLAQYTLRAVICHKGNSVQSGHYVAFIKKNVDGQVKWALYNDEKIVVADDI 748

Query: 722 --AEVLSTPGVFMLF 734
              E +   G   LF
Sbjct: 749 ANIEEIKKNGYVYLF 763

>NCAS0I03140 Chr9 complement(576993..580598) [3606 bp, 1201 aa] {ON}
           Anc_1.137 YJL197W
          Length = 1201

 Score = 35.0 bits (79), Expect = 0.87,   Method: Compositional matrix adjust.
 Identities = 15/30 (50%), Positives = 18/30 (60%)

Query: 100 IAGLVNDGNTCFMNSVLQSLASSRELMEFL 129
           I GLVN GNTC+MNS LQ +       E+ 
Sbjct: 320 ITGLVNLGNTCYMNSALQCITHIPVFREYF 349

>YPL072W Chr16 (418512..420011) [1500 bp, 499 aa] {ON}
           UBP16Deubiquitinating enzyme anchored to the outer
           mitochondrial membrane, probably not important for
           general mitochondrial functioning, but may perform a
           more specialized function at mitochondria
          Length = 499

 Score = 35.0 bits (79), Expect = 0.88,   Method: Compositional matrix adjust.
 Identities = 13/39 (33%), Positives = 25/39 (64%)

Query: 679 LTYSLRSVIVHYGTHNYGHYIAFRKYRGCWWRISDETVY 717
           + Y+L+SV+ H G+H+ GHY+ +R+     +   DE+ +
Sbjct: 389 VKYNLKSVVKHTGSHSSGHYMCYRRKTEIRFGKEDESSF 427

 Score = 34.3 bits (77), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 17/36 (47%), Positives = 21/36 (58%), Gaps = 2/36 (5%)

Query: 101 AGLVNDGNTCFMNSVLQSLASSRELMEFLDNNVIRT 136
            GL+N GN CF+ S LQ LA     +E+L    IRT
Sbjct: 53  VGLINRGNDCFITSSLQGLAGIPRFVEYLKR--IRT 86

 Score = 32.3 bits (72), Expect = 6.0,   Method: Compositional matrix adjust.
 Identities = 45/188 (23%), Positives = 85/188 (45%), Gaps = 25/188 (13%)

Query: 326 PLDGITAERIGCLQCGENGGIRYSVFSGLSLNLPNENIGSTLKLSQLLSDWSKPEIIEGV 385
           P +G T++ + CL+C       Y       L++P +   ++  LS +L+   + EII+  
Sbjct: 204 PFEGETSKFLVCLKCKGLSEPSYKQTFIRELSVPQQ---TSENLSNILAH-DETEIIDDY 259

Query: 386 ECNRCALTAAHSHLFGQLKEFEKKPEGSIPEKLINAVKDRVHQ------IEEVLAKPVID 439
            C  C + A  +H      E  +  +   P++++  + DR+        I E L  P   
Sbjct: 260 SCLICQIRAILNH------EEYRNFKDCTPDEIL--MLDRLKNYATKAPINENL--PFEV 309

Query: 440 DEDYKKLHTANMVRKCSKSKQI---LISRPPPLLSIHINRSVFDPRTYMIRKNNSKVLFK 496
           ++  K+    N+     K K I   ++ + P +L +H++RS F+  TY   +N   V F 
Sbjct: 310 EQYVKRYSKGNLQVSNIKGKVIKKDVVVQLPDILIVHLSRSTFNGITY--SRNPCNVKFG 367

Query: 497 SRLNLAPW 504
            R+ L+ +
Sbjct: 368 ERITLSEY 375

>ZYRO0D07062g Chr4 complement(609322..612903) [3582 bp, 1193 aa]
           {ON} similar to uniprot|P50101 Saccharomyces cerevisiae
           YMR304W UBP15 Ubiquitin-specific protease that may play
           a role in ubiquitin precursor processing
          Length = 1193

 Score = 35.0 bits (79), Expect = 0.90,   Method: Compositional matrix adjust.
 Identities = 18/50 (36%), Positives = 24/50 (48%), Gaps = 2/50 (4%)

Query: 678 PLTYSLRSVIVHYGTHNYGHYIAFRK--YRGCWWRISDETVYVVDEAEVL 725
           P  Y L  V+VH G  + GHY A  K      W+R  DE V+ V + +  
Sbjct: 437 PRWYGLHGVLVHTGDISTGHYYALIKPGLEDQWYRFDDERVWKVSKKQAF 486

>ZYRO0G06798g Chr7 (544095..546728) [2634 bp, 877 aa] {ON} some
           similarities with uniprot|P32571 Saccharomyces
           cerevisiae YDR069C DOA4 Ubiquitin hydrolase required for
           recycling ubiquitin from proteasome-bound ubiquitinated
           intermediates acts at the late endosome/prevacuolar
           compartment to recover ubiquitin from ubiquitinated
           membrane proteins en route to the vacuole
          Length = 877

 Score = 35.0 bits (79), Expect = 0.92,   Method: Compositional matrix adjust.
 Identities = 14/34 (41%), Positives = 20/34 (58%)

Query: 99  FIAGLVNDGNTCFMNSVLQSLASSRELMEFLDNN 132
           F  GL N GN+C++N ++Q L  + EL     NN
Sbjct: 513 FTVGLENMGNSCYINCIIQCLLGTHELTNIFLNN 546

>TPHA0L02290 Chr12 (479360..482941) [3582 bp, 1193 aa] {ON} Anc_5.18
           YMR304W
          Length = 1193

 Score = 35.0 bits (79), Expect = 0.94,   Method: Compositional matrix adjust.
 Identities = 18/47 (38%), Positives = 23/47 (48%), Gaps = 2/47 (4%)

Query: 681 YSLRSVIVHYGTHNYGHYIAFRK--YRGCWWRISDETVYVVDEAEVL 725
           Y L  V+VH G  + GHY    K      W+R  DE V+ VD  +V 
Sbjct: 448 YKLHGVLVHTGDISTGHYYTMIKPDLGDQWYRFDDERVWKVDRKQVF 494

>YKR098C Chr11 complement(633026..635179) [2154 bp, 717 aa] {ON}
           UBP11Ubiquitin-specific protease that cleaves ubiquitin
           from ubiquitinated proteins
          Length = 717

 Score = 34.7 bits (78), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 66/294 (22%), Positives = 116/294 (39%), Gaps = 54/294 (18%)

Query: 224 NSLLKAMSKSPRKNILLGYDQEDAQEFFQNILAELESNVKSLNTEKLDTTPVAKSELPDD 283
           N  LK M K  R ++ +  DQ+D QEF   +LA +   + + N  K     V+      D
Sbjct: 368 NRFLK-MCKKLRPDLNIPDDQQDTQEFLLIVLARIHEELSNENVVKYYPDLVSY-----D 421

Query: 284 ALVGQLNLGEVGTVY---IPTEQIDPNSILHDKSIQNFTPFKLMTPLDGITAERIGCLQC 340
           A   Q+N  +    Y   + T+ + P   ++   ++N                 + C +C
Sbjct: 422 ANALQVNPSKYEKWYERNVITDGLSPIDHIYRGQLENI----------------LKCQRC 465

Query: 341 GENGGIRYSVFSGLSLNLPNENIGS------TLKLSQLLSDWSKPEIIEG---VECNRCA 391
           G N    YS F  LSL +P  ++ S       +KL   ++ ++  E + G    +C  C 
Sbjct: 466 G-NSSYSYSTFYVLSLAIPKLSLYSFTSKSRKIKLEDCINLFTGDEELSGDNAWDCPNCR 524

Query: 392 LTAAHSHLFGQLKEFEKKPEGSIPEKLINAV----KDRVHQIEEVLAKPVIDDEDYKKLH 447
           +T + S          KK E +  +K         + R              D+  K   
Sbjct: 525 ITDSKS----------KKEEITSQKKKSTIFGFHSRSRSKSPHHHHHHHHSSDDSTKNAK 574

Query: 448 TANMVRKCSKSKQILISRPPPLLSIHINRSVFDPRTYMIRKNNSKVLFKSRLNL 501
             N  +K +  K +     PP+L IH++R  +D    + +KN++ + +   LN+
Sbjct: 575 KRNS-KKLTTIKSLDFIVLPPILVIHLSRFYYD----LTKKNSTVITYPLILNI 623

>Kwal_33.13628 s33 (324581..328063) [3483 bp, 1160 aa] {ON} YJL197W
           (UBP12) - ubiquitin carboxyl-terminal hydrolase [contig
           114] FULL
          Length = 1160

 Score = 35.0 bits (79), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 15/30 (50%), Positives = 19/30 (63%)

Query: 100 IAGLVNDGNTCFMNSVLQSLASSRELMEFL 129
           I GL N GN+C+MNS LQ L    EL ++ 
Sbjct: 297 IVGLSNLGNSCYMNSALQCLVHIPELRDYF 326

>SAKL0H18656g Chr8 (1658629..1660947) [2319 bp, 772 aa] {ON} some
           similarities with uniprot|Q01477 Saccharomyces
           cerevisiae YER151C UBP3 Ubiquitin-specific protease that
           interacts with Bre5p to co-regulate anterograde and
           retrograde transport between endoplasmic reticulum and
           Golgi compartments inhibitor of gene silencing cleaves
           ubiquitin fusions but not polyubiquitin
          Length = 772

 Score = 34.7 bits (78), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 16/35 (45%), Positives = 21/35 (60%)

Query: 102 GLVNDGNTCFMNSVLQSLASSRELMEFLDNNVIRT 136
           G+VN GN CFM+SVLQ L   +  +  L+    RT
Sbjct: 334 GIVNTGNICFMSSVLQVLLYCKPFISILNVISYRT 368

>NDAI0F00200 Chr6 (35966..39283) [3318 bp, 1105 aa] {ON} Anc_5.712
          Length = 1105

 Score = 34.7 bits (78), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 14/24 (58%), Positives = 19/24 (79%)

Query: 100 IAGLVNDGNTCFMNSVLQSLASSR 123
           I GL N GNTC++NS+LQ L ++R
Sbjct: 677 ITGLRNLGNTCYINSMLQCLFATR 700

 Score = 33.9 bits (76), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 40/169 (23%), Positives = 70/169 (41%), Gaps = 34/169 (20%)

Query: 235 RKNILLGYDQEDAQEFFQNILAELESNVKSLNTEKLDTTPVAKSELPDDALVGQLNLGEV 294
           R ++ +  DQ+D QEF   IL  L         ++L       +E P+  L  + NL   
Sbjct: 758 RPDLRIPDDQQDTQEFLMIILDRLH--------DELSNQQEVVNEYPNLLLYDENNLKVQ 809

Query: 295 GTVYIPTEQIDPNSILHDKSIQNFTPFKLMTPLDGITAER----IGCLQCGENGGIRYSV 350
              Y      D N I +            ++P+D I + +    + C +CG N    YS 
Sbjct: 810 NKEY--KHWFDKNVIGNG-----------LSPIDHIFSGQMENSLQCQRCG-NSSYNYST 855

Query: 351 FSGLSLNLPNENIGS-----TLKLSQLLSDWSKPEIIEG---VECNRCA 391
           F  LSL +P  +  +      +KL + ++ ++  E++ G    +C +C 
Sbjct: 856 FYVLSLAIPKPSSTTFSRSKRVKLEECINMFTSDEVLSGENAWDCPKCG 904

>TBLA0F03610 Chr6 (890140..893574) [3435 bp, 1144 aa] {ON} Anc_8.188
           YDR069C
          Length = 1144

 Score = 34.7 bits (78), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 14/34 (41%), Positives = 22/34 (64%)

Query: 99  FIAGLVNDGNTCFMNSVLQSLASSRELMEFLDNN 132
           F  GL N GN+C++N ++Q L ++ EL +   NN
Sbjct: 733 FKVGLENMGNSCYLNCIIQCLLNNHELTKMFLNN 766

>Skud_2.177 Chr2 complement(322000..324348) [2349 bp, 782 aa] {ON}
           YBR058C (REAL)
          Length = 782

 Score = 34.7 bits (78), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 14/27 (51%), Positives = 20/27 (74%)

Query: 93  ILKRGGFIAGLVNDGNTCFMNSVLQSL 119
           +L    +  GL+N GN+C++NSVLQSL
Sbjct: 315 LLPNKDYGCGLINLGNSCYLNSVLQSL 341

>TPHA0A02540 Chr1 (543606..547466) [3861 bp, 1286 aa] {ON} Anc_1.137
           YJL197W
          Length = 1286

 Score = 34.7 bits (78), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 20/55 (36%), Positives = 30/55 (54%), Gaps = 4/55 (7%)

Query: 66  EMTTNFRNNNSLSRWLPRSKFTHLDEEILKRGGFIAGLVNDGNTCFMNSVLQSLA 120
           ++    +++N    WL  S + H +   ++ G    GL N GNTC+MNS LQ LA
Sbjct: 367 DIVIEIKHSNCNYHWL--SNYFHYNP--IQNGVGNVGLNNLGNTCYMNSALQCLA 417

>Ecym_5544 Chr5 (1102256..1104760) [2505 bp, 834 aa] {ON} similar to
           Ashbya gossypii AGR139C
          Length = 834

 Score = 34.3 bits (77), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 15/35 (42%), Positives = 21/35 (60%)

Query: 102 GLVNDGNTCFMNSVLQSLASSRELMEFLDNNVIRT 136
           G++N GN CFM+SVLQ L   +  +  L+    RT
Sbjct: 390 GILNKGNICFMSSVLQVLLFCKPFISMLNAVCTRT 424

>Kpol_534.23 s534 (53632..53653,53786..55254) [1491 bp, 496 aa] {ON}
           (53632..53653,53786..55254) [1491 nt, 497 aa]
          Length = 496

 Score = 33.9 bits (76), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 13/18 (72%), Positives = 16/18 (88%)

Query: 102 GLVNDGNTCFMNSVLQSL 119
           GL+N GNTC+MNS LQ+L
Sbjct: 110 GLLNMGNTCYMNSTLQAL 127

>TBLA0J00600 Chr10 (129182..133570) [4389 bp, 1462 aa] {ON}
           Anc_1.137 YJL197W
          Length = 1462

 Score = 34.3 bits (77), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 15/28 (53%), Positives = 18/28 (64%)

Query: 102 GLVNDGNTCFMNSVLQSLASSRELMEFL 129
           GLVN GNTC+MNS LQ L    +  E+ 
Sbjct: 415 GLVNLGNTCYMNSALQCLIHLPKFNEYF 442

>KLTH0B09944g Chr2 complement(826050..829619) [3570 bp, 1189 aa]
           {ON} similar to uniprot|P50101 Saccharomyces cerevisiae
           YMR304W UBP15 Ubiquitin-specific protease that may play
           a role in ubiquitin precursor processing
          Length = 1189

 Score = 33.9 bits (76), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 17/50 (34%), Positives = 25/50 (50%), Gaps = 2/50 (4%)

Query: 678 PLTYSLRSVIVHYGTHNYGHYIAFRK--YRGCWWRISDETVYVVDEAEVL 725
           P  Y+L  V+VH G  + GHY A  K      W+R  D+ V+ V + +  
Sbjct: 436 PCVYNLHGVLVHSGEISVGHYYAMIKPDVGDQWFRFDDDKVWRVTKEQAF 485

>KNAG0J00800 Chr10 complement(134836..137133) [2298 bp, 765 aa] {ON}
           Anc_3.270 YBR058C
          Length = 765

 Score = 33.9 bits (76), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 23/81 (28%), Positives = 36/81 (44%), Gaps = 4/81 (4%)

Query: 656 EEDVIPAPPINYARSFSTVPATPLTYSLRSVIVHYG-THNYGHYIAFRKYR-GCWWRISD 713
           E +  P    N AR F   P   + Y L  ++ H G +   GHY+A+ + R G W   +D
Sbjct: 684 ETETAPQDTANAARKFGH-PGGSI-YKLYGIVCHKGNSTQSGHYVAYIRQRDGQWTLYND 741

Query: 714 ETVYVVDEAEVLSTPGVFMLF 734
           E +  V+  +     G   L+
Sbjct: 742 EKIVCVESLDEALRNGYIFLY 762

>KAFR0D05070 Chr4 complement(996195..999878) [3684 bp, 1227 aa] {ON}
           Anc_5.443 YOR124C
          Length = 1227

 Score = 33.9 bits (76), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 17/43 (39%), Positives = 26/43 (60%)

Query: 89  LDEEILKRGGFIAGLVNDGNTCFMNSVLQSLASSRELMEFLDN 131
           +D  +L+   +  GL N GNTC++NS+LQ   S   L E++ N
Sbjct: 698 IDANLLQPENWPIGLNNIGNTCYLNSLLQYYFSIAPLREYILN 740

>KAFR0D02160 Chr4 (432966..435506) [2541 bp, 846 aa] {ON} Anc_5.712
           YIL156W
          Length = 846

 Score = 33.9 bits (76), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 15/38 (39%), Positives = 23/38 (60%)

Query: 100 IAGLVNDGNTCFMNSVLQSLASSRELMEFLDNNVIRTY 137
           I+GL N GNTC++NS+LQ L ++        +N  + Y
Sbjct: 445 ISGLRNLGNTCYINSMLQCLFATTAFRNLFLSNRYKEY 482

>KNAG0C02180 Chr3 (429789..433484) [3696 bp, 1231 aa] {ON} Anc_1.137
           YJL197W
          Length = 1231

 Score = 33.9 bits (76), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 21/70 (30%), Positives = 34/70 (48%), Gaps = 4/70 (5%)

Query: 60  IVESVSEMTTNFRNNNSLSRWLPRSKFTHLDEEILKRGGFIAGLVNDGNTCFMNSVLQSL 119
           I+  +  + T  R+  +   W   S + H ++  L R     GL N GNTC+MNS LQ L
Sbjct: 284 ILNGIFIIETKRRSRKTKQHW--ASNYFHYNK--LNRSTGTIGLSNLGNTCYMNSGLQCL 339

Query: 120 ASSRELMEFL 129
               ++ ++ 
Sbjct: 340 VHIPQIRDYF 349

>YBR058C Chr2 complement(353672..356017) [2346 bp, 781 aa] {ON}
           UBP14Ubiquitin-specific protease that specifically
           disassembles unanchored ubiquitin chains; involved in
           fructose-1,6-bisphosphatase (Fbp1p) degradation; similar
           to human isopeptidase T
          Length = 781

 Score = 33.5 bits (75), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 13/31 (41%), Positives = 22/31 (70%)

Query: 91  EEILKRGGFIAGLVNDGNTCFMNSVLQSLAS 121
           E++     +  GL+N GN+C++NSV+QSL +
Sbjct: 313 EKLSASKNYGCGLINLGNSCYLNSVIQSLVN 343

>CAGL0I02244g Chr9 complement(195217..195726) [510 bp, 169 aa] {ON}
           no similarity
          Length = 169

 Score = 32.3 bits (72), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 23/108 (21%), Positives = 46/108 (42%), Gaps = 17/108 (15%)

Query: 339 QCGENGGIRYSVFSGLSLNLPNENIGSTLKLSQLLSDWSKPEIIEGVECNRCALTAAHSH 398
           +C         VF+ L L +P E             +++K       ECN  +LT  H  
Sbjct: 59  KCYVKKSFLLQVFAELGLQVPTE------------EEYNKI-----TECNESSLTNVHGL 101

Query: 399 LFGQLKEFEKKPEGSIPEKLINAVKDRVHQIEEVLAKPVIDDEDYKKL 446
           +    ++  K P  ++ +KL+ +++  + ++E       +D++  KKL
Sbjct: 102 MKDDEQDQAKLPNSNLTDKLVRSIQHDIEELERNYLAAAVDEQTKKKL 149

>CAGL0K10494g Chr11 (1023698..1025185) [1488 bp, 495 aa] {ON} highly
           similar to uniprot|P43593 Saccharomyces cerevisiae
           YFR010w UBP6 ubiquitin-specific protease
          Length = 495

 Score = 33.5 bits (75), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 14/40 (35%), Positives = 25/40 (62%)

Query: 90  DEEILKRGGFIAGLVNDGNTCFMNSVLQSLASSRELMEFL 129
           D+++ +      GL N GNTC++N+ LQ+L  + EL + +
Sbjct: 98  DQQVQQFNSTPLGLQNMGNTCYLNATLQALFRADELKDLI 137

>TDEL0A01620 Chr1 (291670..294057) [2388 bp, 795 aa] {ON} Anc_8.202
           YER151C
          Length = 795

 Score = 33.5 bits (75), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 19/48 (39%), Positives = 26/48 (54%), Gaps = 3/48 (6%)

Query: 681 YSLRSVIVHYG-THNYGHYIA--FRKYRGCWWRISDETVYVVDEAEVL 725
           YSL  VI H+G + + GHY A  + K    W+RI D  +  V +  VL
Sbjct: 728 YSLSGVIYHHGLSSDGGHYTADVYHKETDKWYRIDDINITEVQKDSVL 775

>TBLA0E01760 Chr5 complement(430209..433847) [3639 bp, 1212 aa] {ON}
           Anc_5.712 YIL156W
          Length = 1212

 Score = 33.5 bits (75), Expect = 2.8,   Method: Compositional matrix adjust.
 Identities = 42/169 (24%), Positives = 69/169 (40%), Gaps = 28/169 (16%)

Query: 235 RKNILLGYDQEDAQEFFQNILAELESNVKSLNTEKLDTTPVAKSELPDDALVGQLNLGEV 294
           R ++ +  DQ+D QEF   IL  L   + + +  KLD   +   ++ D     ++  G+ 
Sbjct: 832 RPDLRIPDDQQDTQEFLMLILDRLHDELSNQHEVKLDYPDLVDYDVDD----MEVQPGQY 887

Query: 295 GTVYIPTEQIDPNSILH-DKSIQNFTPFKLMTPLDGITAERIGCLQCGENGGIRYSVFSG 353
              Y   E +  N +   D   Q  T        DG+  +R GC          YS F  
Sbjct: 888 IKWY--NESVKSNGLSPIDHVFQGQTE-------DGLVCQRCGC------SSFTYSTFYI 932

Query: 354 LSLNLPNENIGSTLKLSQL-LSD----WSKPEIIE---GVECNRCALTA 394
           LSL +P  +  +  K+ ++ L D    ++  EI+      +C RC   A
Sbjct: 933 LSLAIPKASTNAFGKIKRVNLEDCIKMFTNDEILSDENAWDCPRCGSAA 981

>CAGL0L01639g Chr12 (178104..181547) [3444 bp, 1147 aa] {ON} similar
           to uniprot|P39538 Saccharomyces cerevisiae YJL197w UBP12
           ubiquitin C-terminal hydrolase
          Length = 1147

 Score = 33.5 bits (75), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 15/30 (50%), Positives = 19/30 (63%)

Query: 100 IAGLVNDGNTCFMNSVLQSLASSRELMEFL 129
           I GL N GNTC+MNS LQ L    +L ++ 
Sbjct: 288 IVGLSNLGNTCYMNSGLQCLVHIPKLRDYF 317

>KNAG0C01940 Chr3 complement(375973..377472) [1500 bp, 499 aa] {ON}
           Anc_1.369 YFR010W
          Length = 499

 Score = 33.1 bits (74), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 15/42 (35%), Positives = 24/42 (57%)

Query: 90  DEEILKRGGFIAGLVNDGNTCFMNSVLQSLASSRELMEFLDN 131
           D+++ +      G  N GNTC++N+ LQSL    +L E + N
Sbjct: 97  DQQVSRFNELPIGFKNMGNTCYLNATLQSLFRMDQLRELILN 138

>Ecym_5671 Chr5 complement(1362706..1366236) [3531 bp, 1176 aa] {ON}
           similar to Ashbya gossypii AGL357W
          Length = 1176

 Score = 33.5 bits (75), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 20/63 (31%), Positives = 30/63 (47%), Gaps = 2/63 (3%)

Query: 679 LTYSLRSVIVHYGTHNYGHYIAFRK--YRGCWWRISDETVYVVDEAEVLSTPGVFMLFYE 736
           + Y+L  V+VH G  + GHY A  K      W+R  D+ V+ V + +V      F    E
Sbjct: 434 MMYNLHGVLVHTGDISTGHYYAMIKPGLDDKWYRFDDDKVWQVTKKQVFEQNFGFDRLPE 493

Query: 737 YDF 739
           Y+ 
Sbjct: 494 YEL 496

>TPHA0D04660 Chr4 complement(1017401..1020538) [3138 bp, 1045 aa]
           {ON} Anc_5.712 YIL156W
          Length = 1045

 Score = 33.5 bits (75), Expect = 3.0,   Method: Compositional matrix adjust.
 Identities = 38/169 (22%), Positives = 69/169 (40%), Gaps = 34/169 (20%)

Query: 235 RKNILLGYDQEDAQEFFQNILAELESNVKSLNTEKLDTTPVAKSELPDDALVGQLNLGEV 294
           R ++ +  DQ+D QEF   +L  L   +   +T   D                 L L + 
Sbjct: 704 RPDLKIPDDQQDTQEFLMLVLDRLHDELSKEDTVLND--------------YSNLLLYDA 749

Query: 295 GTVYIPTEQIDPNSILHDKSIQNFTPFKLMTPLD----GITAERIGCLQCGENGGIRYSV 350
             +++  +Q       + K  +N      ++P+D    G     I C +CG      YS 
Sbjct: 750 ERMHVKVDQ-------YKKWFENSNLSGGVSPIDDIFQGQIENSINCQRCGY-SSFNYSS 801

Query: 351 FSGLSLNLPNENIGS-----TLKLSQLLSDWSKPEIIEG---VECNRCA 391
           F  LSL +P  ++ S      +KL   ++ +++ E++ G    +C+RC 
Sbjct: 802 FYVLSLAIPKISVMSFSRTNRVKLEDCINMFTRDEVLSGENAWDCSRCG 850

>TPHA0A02510 Chr1 (536076..536097,536233..537728) [1518 bp, 505 aa]
           {ON} Anc_1.369 YFR010W
          Length = 505

 Score = 33.1 bits (74), Expect = 3.0,   Method: Compositional matrix adjust.
 Identities = 14/30 (46%), Positives = 19/30 (63%)

Query: 90  DEEILKRGGFIAGLVNDGNTCFMNSVLQSL 119
           D+++ K      G  N GNTC+MNS LQ+L
Sbjct: 98  DQQMQKLNDLPIGFQNMGNTCYMNSTLQAL 127

>CAGL0M13783g Chr13 (1354198..1357788) [3591 bp, 1196 aa] {ON}
           similar to uniprot|P50101 Saccharomyces cerevisiae
           YMR304w UBP15
          Length = 1196

 Score = 33.1 bits (74), Expect = 3.4,   Method: Compositional matrix adjust.
 Identities = 17/48 (35%), Positives = 24/48 (50%), Gaps = 2/48 (4%)

Query: 680 TYSLRSVIVHYGTHNYGHYIAFRK--YRGCWWRISDETVYVVDEAEVL 725
            Y+L  V+VH G  + GHY    K      W+R  DE V+ V + +V 
Sbjct: 438 VYNLHGVLVHAGDISTGHYYTLIKPGLEDQWYRFDDERVWKVTKNQVF 485

>KAFR0F01560 Chr6 (310936..314451) [3516 bp, 1171 aa] {ON} Anc_1.137
           YJL197W
          Length = 1171

 Score = 33.1 bits (74), Expect = 3.6,   Method: Compositional matrix adjust.
 Identities = 14/28 (50%), Positives = 18/28 (64%)

Query: 102 GLVNDGNTCFMNSVLQSLASSRELMEFL 129
           GL N GNTC+MNS LQ L    +L ++ 
Sbjct: 324 GLSNLGNTCYMNSALQCLVHIPQLRDYF 351

>Suva_11.335 Chr11 complement(617850..620024) [2175 bp, 724 aa] {ON}
           YKR098C (REAL)
          Length = 724

 Score = 33.1 bits (74), Expect = 3.6,   Method: Compositional matrix adjust.
 Identities = 70/299 (23%), Positives = 128/299 (42%), Gaps = 55/299 (18%)

Query: 224 NSLLKAMSKSPRKNILLGYDQEDAQEFFQNILAELESNVKSLNTEKLDTTPVAKSELPDD 283
           N  LK + K  R ++ +  DQ+D QEF   ILA +   + + N  K  +  +      +D
Sbjct: 366 NGFLK-VCKKLRPDLNIPDDQQDTQEFLMIILARIHEELSNNNVTKYYSDLIL-----ND 419

Query: 284 ALVGQLNLGEVGTVYIPTEQIDPNSILHDKSIQNFTPFKLMTPLDGITAER----IGCLQ 339
           A   Q+N  +        ++    ++L D           ++P+D I   +    + C +
Sbjct: 420 ATALQVNPSKY-------QKWCEETVLSDG----------LSPIDHIFQGQMENILKCQR 462

Query: 340 CGENGGIRYSVFSGLSLNLPNENIGS------TLKLSQLLSDWSKPEIIE---GVECNRC 390
           CG N    YS F  LSL +P  ++ S       +KL   ++ ++  E +      +C +C
Sbjct: 463 CG-NSSYSYSTFYVLSLAIPKASLYSFTSKSKKIKLEDCINFFTSDEELSDDNAWDCPKC 521

Query: 391 ALTAAHSHLFGQLKEFE--KKPEGSIPEKLINAVKDRVHQIEEVLAKPVIDDEDYKKLHT 448
             TA +     +LK+ E   + + SI   L +  + +  +           ++D KK   
Sbjct: 522 R-TAEY-----KLKKDENLSQKKRSILFNLHSRPRSKSPRHRHHHHHHRHKNDDAKKNDD 575

Query: 449 ANMVRKCSKSKQILISRP------PPLLSIHINRSVFDPRTYMIRKNNSKVLFKSRLNL 501
           A    K  KSK++   +       PP+L IH++R  +D    + +KNN+ + +   LN+
Sbjct: 576 ATKNSKKWKSKKLTTIKSLDFIVLPPILVIHLSRFYYD----LTKKNNTVITYPLILNI 630

>Kwal_14.1957 s14 (549510..550844) [1335 bp, 444 aa] {ON} YER151C
           (UBP3) - Ubiquitin-specific protease [contig 231]
           PARTIAL
          Length = 444

 Score = 32.7 bits (73), Expect = 3.7,   Method: Compositional matrix adjust.
 Identities = 14/35 (40%), Positives = 21/35 (60%)

Query: 102 GLVNDGNTCFMNSVLQSLASSRELMEFLDNNVIRT 136
           G+VN GN CFM+S+LQ L      +  ++   I+T
Sbjct: 10  GIVNSGNICFMSSILQVLLFCEPFVSLMNLISIKT 44

>NDAI0H03550 Chr8 complement(865851..867359) [1509 bp, 502 aa] {ON}
           Anc_1.369 YFR010W
          Length = 502

 Score = 32.7 bits (73), Expect = 3.7,   Method: Compositional matrix adjust.
 Identities = 13/40 (32%), Positives = 24/40 (60%)

Query: 90  DEEILKRGGFIAGLVNDGNTCFMNSVLQSLASSRELMEFL 129
           D+++ K      G  N GNTC+MN+ LQ+L  + ++ + +
Sbjct: 100 DQQLQKMDSTPIGFQNMGNTCYMNATLQALYRTDDIRQMI 139

>Suva_4.295 Chr4 complement(520439..522787) [2349 bp, 782 aa] {ON}
           YBR058C (REAL)
          Length = 782

 Score = 33.1 bits (74), Expect = 3.8,   Method: Compositional matrix adjust.
 Identities = 12/21 (57%), Positives = 18/21 (85%)

Query: 99  FIAGLVNDGNTCFMNSVLQSL 119
           +  GL+N GN+C++NSV+QSL
Sbjct: 321 YGCGLINLGNSCYLNSVMQSL 341

>Smik_2.189 Chr2 complement(335612..337960) [2349 bp, 782 aa] {ON}
           YBR058C (REAL)
          Length = 782

 Score = 33.1 bits (74), Expect = 3.8,   Method: Compositional matrix adjust.
 Identities = 12/19 (63%), Positives = 17/19 (89%)

Query: 101 AGLVNDGNTCFMNSVLQSL 119
            GL+N GN+C++NSV+QSL
Sbjct: 323 CGLINLGNSCYLNSVMQSL 341

>Kwal_34.16268 s34 (268814..270163) [1350 bp, 449 aa] {ON} YFR010W
           (UBP6) - (putative) ubiquitin-specific protease [contig
           710] FULL
          Length = 449

 Score = 32.7 bits (73), Expect = 4.0,   Method: Compositional matrix adjust.
 Identities = 13/19 (68%), Positives = 15/19 (78%)

Query: 101 AGLVNDGNTCFMNSVLQSL 119
            GL N GNTC+MNS LQ+L
Sbjct: 60  VGLKNLGNTCYMNSTLQAL 78

>Kpol_251.7 s251 (12280..13719) [1440 bp, 480 aa] {ON}
           (12280..13719) [1440 nt, 480 aa]
          Length = 480

 Score = 32.7 bits (73), Expect = 4.1,   Method: Compositional matrix adjust.
 Identities = 13/19 (68%), Positives = 16/19 (84%)

Query: 101 AGLVNDGNTCFMNSVLQSL 119
            GL+N GN+C+MNSVLQ L
Sbjct: 322 CGLINLGNSCYMNSVLQLL 340

>KLTH0E00814g Chr5 (80059..82983) [2925 bp, 974 aa] {ON} similar to
           uniprot|P40453 Saccharomyces cerevisiae YIL156W UBP7
           Ubiquitin-specific protease that cleaves
           ubiquitin-protein fusions
          Length = 974

 Score = 32.7 bits (73), Expect = 4.2,   Method: Compositional matrix adjust.
 Identities = 56/282 (19%), Positives = 115/282 (40%), Gaps = 56/282 (19%)

Query: 235 RKNILLGYDQEDAQEFFQNILAELESNVKSLNTEKLDTTPVAKSELPDDALVGQLNLGEV 294
           R +  + +DQ+D QEF   +L++L   +   N    D   +    L DD           
Sbjct: 635 RPDFRIPHDQQDTQEFLLFLLSQLHDELSESNRVANDYPGLL---LHDD----------- 680

Query: 295 GTVYIPTEQIDPNSILHDKSIQNFTPFKLMTPLDGITAERIG----CLQCGENGGIRYSV 350
                  +++D +   +D   +       ++P+D I   ++     C +CG +    YSV
Sbjct: 681 -------KKLDVDQKEYDTWFEKHISENGISPIDNIFQGQMENGLFCQRCG-HSSFNYSV 732

Query: 351 FSGLSLNLPNENIGST----LKLSQLLSDWSKPEII---EGVECNRCALTAAHSHLFGQL 403
           F  LSL +P+     +    ++L   ++ ++  E +      +C +C  +A+     G  
Sbjct: 733 FYVLSLAIPSSTSTFSQRKKVRLEDCINLFTSDEQLTNENAWDCPKCGTSAS-----GTG 787

Query: 404 KEFEKKPEGSI--PEKLINAVKDRVHQIEEV--------LAKPVIDDEDYKKLHTANMVR 453
            E EKK +  +  P+   +  + R  ++             K     ++ +KL +    +
Sbjct: 788 PEEEKKKKRFLLNPDTRASGNRSRFFKLRSKSRSRSVSPFRKQSSQQQNLEKLKS----K 843

Query: 454 KCSKSKQILISRPPPLLSIHINRSVFDPRTYMIRKNNSKVLF 495
           K +  K +     P +L+IH++R  +D    + +KNN  + +
Sbjct: 844 KLTTIKTLNFISLPTVLTIHLSRFFYD----LTKKNNKVITY 881

>ZYRO0G01188g Chr7 (95655..95676,95759..97239) [1503 bp, 500 aa]
           {ON} highly similar to uniprot|P43593 Saccharomyces
           cerevisiae YFR010W UBP6 Ubiquitin-specific protease
           situated in the base subcomplex of the 26S proteasome
           releases free ubiquitin from branched polyubiquitin
           chains deletion causes hypersensitivity to cycloheximide
           and other toxic compounds
          Length = 500

 Score = 32.7 bits (73), Expect = 4.2,   Method: Compositional matrix adjust.
 Identities = 14/40 (35%), Positives = 23/40 (57%)

Query: 90  DEEILKRGGFIAGLVNDGNTCFMNSVLQSLASSRELMEFL 129
           +E++ +      G  N GNTC++NS LQ+L   + L E +
Sbjct: 97  EEQLQRSSDLPIGFQNMGNTCYLNSTLQALYRIKPLRELI 136

 Score = 32.0 bits (71), Expect = 6.9,   Method: Compositional matrix adjust.
 Identities = 18/53 (33%), Positives = 29/53 (54%), Gaps = 4/53 (7%)

Query: 681 YSLRSVIVHYGTHN-YGHYIAFRKY---RGCWWRISDETVYVVDEAEVLSTPG 729
           Y L  VI H G ++  GHY +F +       W++ +D+ V VVD+ ++ S  G
Sbjct: 431 YELVGVITHQGANSESGHYQSFIRDDYDEDKWYKFNDDKVSVVDKEKIESLSG 483

>TPHA0J02620 Chr10 complement(580898..584575) [3678 bp, 1225 aa]
           {ON} Anc_5.443 YOR124C
          Length = 1225

 Score = 32.7 bits (73), Expect = 4.5,   Method: Compositional matrix adjust.
 Identities = 14/31 (45%), Positives = 20/31 (64%)

Query: 101 AGLVNDGNTCFMNSVLQSLASSRELMEFLDN 131
            G+ N GNTC++NS+LQ   S     EF++N
Sbjct: 758 TGINNIGNTCYLNSLLQYYFSITLFREFIEN 788

>Kpol_1016.1 s1016 (585..4340) [3756 bp, 1251 aa] {ON} (585..4340)
            [3756 nt, 1252 aa]
          Length = 1251

 Score = 32.7 bits (73), Expect = 5.4,   Method: Compositional matrix adjust.
 Identities = 27/86 (31%), Positives = 41/86 (47%), Gaps = 13/86 (15%)

Query: 681  YSLRSVIVHYGTHNYGHYIAF---RKYRGCWWRISDETVYVVDEAEVL-------STPGV 730
            YSL +V +H G   +GHY  +    K  G W + +D  V  +   EV        STP  
Sbjct: 1165 YSLFAVFIHRGQATFGHYWIYIKDFKNHGTWRKYNDHEVTEILPIEVFNFSEGNSSTP-Y 1223

Query: 731  FMLFYE--YDFDEETGKMKDDLEAIQ 754
            F+++ +   +FD E  K +D  +A Q
Sbjct: 1224 FLVYIKNGSEFDVEPLKREDMNKAQQ 1249

 Score = 32.3 bits (72), Expect = 6.3,   Method: Compositional matrix adjust.
 Identities = 15/31 (48%), Positives = 20/31 (64%)

Query: 101 AGLVNDGNTCFMNSVLQSLASSRELMEFLDN 131
            GL N GNTC++NS+LQ   +   L E+L N
Sbjct: 762 VGLNNIGNTCYLNSLLQYYFAISPLREYLIN 792

>SAKL0D10120g Chr4 complement(845029..846491,846566..846581) [1479
           bp, 492 aa] {ON} highly similar to uniprot|P43593
           Saccharomyces cerevisiae YFR010W UBP6 Ubiquitin-specific
           protease situated in the base subcomplex of the 26S
           proteasome releases free ubiquitin from branched
           polyubiquitin chains deletion causes hypersensitivity to
           cycloheximide and other toxic compounds
          Length = 492

 Score = 32.0 bits (71), Expect = 6.2,   Method: Compositional matrix adjust.
 Identities = 15/30 (50%), Positives = 19/30 (63%)

Query: 102 GLVNDGNTCFMNSVLQSLASSRELMEFLDN 131
           GL N GNTC+MN+ LQ+L     L E + N
Sbjct: 105 GLKNMGNTCYMNATLQALYQITPLREAILN 134

>KLLA0E01013g Chr5 (104991..107315) [2325 bp, 774 aa] {ON} some
           similarities with uniprot|Q01477 Saccharomyces
           cerevisiae YER151C UBP3 Ubiquitin-specific protease that
           interacts with Bre5p to co-regulate anterograde and
           retrograde transport between endoplasmic reticulum and
           Golgi compartments inhibitor of gene silencing cleaves
           ubiquitin fusions but not polyubiquitin
          Length = 774

 Score = 32.0 bits (71), Expect = 7.6,   Method: Compositional matrix adjust.
 Identities = 28/85 (32%), Positives = 39/85 (45%), Gaps = 13/85 (15%)

Query: 52  KKPDHLNYIVESVSEMTTNFRNNNSLSRWLPRSKFTHLDEEILKRGGFIAGLVNDGNTCF 111
           K P+ L  +   V     NF N+      L  +K   L  E++ RG     + N G+ CF
Sbjct: 299 KSPEPLGSVALRVC-FDKNFTNHT-----LQSTKAKKLITELVPRG-----IYNKGSICF 347

Query: 112 MNSVLQSLASSRELMEFLDNNVIRT 136
           ++SVLQ L   R  +  L  NVI T
Sbjct: 348 ISSVLQLLIHCRSFVNLL--NVIHT 370

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.316    0.134    0.389 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 79,690,835
Number of extensions: 3439857
Number of successful extensions: 12853
Number of sequences better than 10.0: 244
Number of HSP's gapped: 12944
Number of HSP's successfully gapped: 353
Length of query: 809
Length of database: 53,481,399
Length adjustment: 118
Effective length of query: 691
Effective length of database: 39,950,811
Effective search space: 27606010401
Effective search space used: 27606010401
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 70 (31.6 bits)