Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
YDL030W (PRP9)3.160ON53053024780.0
Smik_4.2053.160ON53153119300.0
Skud_4.2213.160ON53153118790.0
Suva_4.2193.160ON53153118160.0
NCAS0C035403.160ON51853311201e-148
NDAI0G028903.160ON53654310661e-139
TDEL0D046203.160ON51653910501e-137
ZYRO0B04950g3.160ON50653610421e-136
Kpol_479.263.160ON51753310191e-132
TPHA0A009103.160ON5275349701e-125
KAFR0C010503.160ON5065319641e-124
SAKL0C08800g3.160ON6015469241e-117
KLTH0C08888g3.160ON5065348601e-109
Kwal_56.227993.160ON5315368561e-108
Ecym_35493.160ON5325398461e-106
CAGL0K01573g3.160ON5165448121e-101
KNAG0K011203.160ON5275447852e-97
AEL085W3.160ON5275437747e-96
KLLA0F24662g3.160ON5305305995e-70
TBLA0B016003.160ON4861971991e-15
SAKL0B00704g8.11ON16938890.010
Kwal_14.10648.11ON16238850.030
CAGL0K12804g8.11ON17238840.042
YLR074C (BUD20)8.11ON16653830.055
ABR234C8.11ON17538830.062
Ecym_15318.11ON17138820.078
Skud_12.1398.11ON16453810.11
NDAI0C065808.11ON16953780.26
Suva_10.1588.11ON16958780.32
KLTH0G19096g8.11ON15938770.36
Kpol_1023.128.11ON16338750.64
Smik_12.1348.11ON16658750.68
TBLA0D023508.11ON15154740.72
KLLA0D05621g8.11ON16738731.2
ZYRO0B15994g5.660ON44782741.6
KNAG0L001708.11ON15538711.7
TDEL0C003408.11ON16153721.7
TPHA0D002008.11ON16638712.0
KAFR0D008608.11ON16553712.4
YDL223C (HBT1)2.54ON104642732.6
TBLA0G001702.15ON65951723.6
NCAS0J002608.11ON17038694.3
Ecym_62318.725ON44935705.9
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= YDL030W
         (530 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

YDL030W Chr4 (397537..399129) [1593 bp, 530 aa] {ON}  PRP9Subuni...   959   0.0  
Smik_4.205 Chr4 (377655..379250) [1596 bp, 531 aa] {ON} YDL030W ...   748   0.0  
Skud_4.221 Chr4 (392347..393942) [1596 bp, 531 aa] {ON} YDL030W ...   728   0.0  
Suva_4.219 Chr4 (387976..389571) [1596 bp, 531 aa] {ON} YDL030W ...   704   0.0  
NCAS0C03540 Chr3 (707075..708631) [1557 bp, 518 aa] {ON} Anc_3.1...   436   e-148
NDAI0G02890 Chr7 (669498..671108) [1611 bp, 536 aa] {ON} Anc_3.1...   415   e-139
TDEL0D04620 Chr4 complement(847509..849059) [1551 bp, 516 aa] {O...   409   e-137
ZYRO0B04950g Chr2 complement(399973..401493) [1521 bp, 506 aa] {...   405   e-136
Kpol_479.26 s479 complement(50993..52546) [1554 bp, 517 aa] {ON}...   397   e-132
TPHA0A00910 Chr1 (179145..180728) [1584 bp, 527 aa] {ON} Anc_3.1...   378   e-125
KAFR0C01050 Chr3 complement(214128..215648) [1521 bp, 506 aa] {O...   375   e-124
SAKL0C08800g Chr3 (807712..809517) [1806 bp, 601 aa] {ON} simila...   360   e-117
KLTH0C08888g Chr3 (745663..747183) [1521 bp, 506 aa] {ON} simila...   335   e-109
Kwal_56.22799 s56 complement(284859..286454) [1596 bp, 531 aa] {...   334   e-108
Ecym_3549 Chr3 complement(1038111..1039709) [1599 bp, 532 aa] {O...   330   e-106
CAGL0K01573g Chr11 (139809..141359) [1551 bp, 516 aa] {ON} simil...   317   e-101
KNAG0K01120 Chr11 (218749..220332) [1584 bp, 527 aa] {ON} Anc_3....   306   2e-97
AEL085W Chr5 (467583..469166) [1584 bp, 527 aa] {ON} Syntenic ho...   302   7e-96
KLLA0F24662g Chr6 complement(2292807..2294399) [1593 bp, 530 aa]...   235   5e-70
TBLA0B01600 Chr2 (352382..353842) [1461 bp, 486 aa] {ON} Anc_3.1...    81   1e-15
SAKL0B00704g Chr2 (65060..65569) [510 bp, 169 aa] {ON} highly si...    39   0.010
Kwal_14.1064 s14 (178979..179467) [489 bp, 162 aa] {ON} YLR074C ...    37   0.030
CAGL0K12804g Chr11 complement(1269506..1270024) [519 bp, 172 aa]...    37   0.042
YLR074C Chr12 complement(281956..282456) [501 bp, 166 aa] {ON}  ...    37   0.055
ABR234C Chr2 complement(841361..841888) [528 bp, 175 aa] {ON} Sy...    37   0.062
Ecym_1531 Chr1 complement(1094489..1095004) [516 bp, 171 aa] {ON...    36   0.078
Skud_12.139 Chr12 complement(266691..267185) [495 bp, 164 aa] {O...    36   0.11 
NDAI0C06580 Chr3 complement(1519086..1519595) [510 bp, 169 aa] {...    35   0.26 
Suva_10.158 Chr10 complement(283475..283984) [510 bp, 169 aa] {O...    35   0.32 
KLTH0G19096g Chr7 complement(1649335..1649814) [480 bp, 159 aa] ...    34   0.36 
Kpol_1023.12 s1023 (24892..25383) [492 bp, 163 aa] {ON} (24892.....    33   0.64 
Smik_12.134 Chr12 complement(261773..262273) [501 bp, 166 aa] {O...    33   0.68 
TBLA0D02350 Chr4 (594084..594539) [456 bp, 151 aa] {ON} Anc_8.11...    33   0.72 
KLLA0D05621g Chr4 complement(486879..487382) [504 bp, 167 aa] {O...    33   1.2  
ZYRO0B15994g Chr2 complement(1297942..1299285) [1344 bp, 447 aa]...    33   1.6  
KNAG0L00170 Chr12 (16874..17341) [468 bp, 155 aa] {ON} Anc_8.11 ...    32   1.7  
TDEL0C00340 Chr3 (45150..45635) [486 bp, 161 aa] {ON} Anc_8.11 Y...    32   1.7  
TPHA0D00200 Chr4 (25129..25629) [501 bp, 166 aa] {ON} Anc_8.11 Y...    32   2.0  
KAFR0D00860 Chr4 (182173..182670) [498 bp, 165 aa] {ON} Anc_8.11...    32   2.4  
YDL223C Chr4 complement(57265..60405) [3141 bp, 1046 aa] {ON}  H...    33   2.6  
TBLA0G00170 Chr7 complement(26304..28283) [1980 bp, 659 aa] {ON}...    32   3.6  
NCAS0J00260 Chr10 (35339..35851) [513 bp, 170 aa] {ON} Anc_8.11 ...    31   4.3  
Ecym_6231 Chr6 (431597..432946) [1350 bp, 449 aa] {ON} similar t...    32   5.9  

>YDL030W Chr4 (397537..399129) [1593 bp, 530 aa] {ON}  PRP9Subunit
           of the SF3a splicing factor complex, required for
           spliceosome assembly; acts after the formation of the U1
           snRNP-pre-mRNA complex
          Length = 530

 Score =  959 bits (2478), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 472/530 (89%), Positives = 472/530 (89%)

Query: 1   MNLLETRRSLLXXXXXXXXXXXXXXQRNPELYYHYIQESSKVFPDTKLPRSSLIAENXXX 60
           MNLLETRRSLL              QRNPELYYHYIQESSKVFPDTKLPRSSLIAEN   
Sbjct: 1   MNLLETRRSLLEEMEIIENAIAERIQRNPELYYHYIQESSKVFPDTKLPRSSLIAENKIY 60

Query: 61  XXXXXXXXXXXXXXXXHEINIFLRDYQEKQQTFNKINRPEETQEDDKDLPNFERKLQQLE 120
                           HEINIFLRDYQEKQQTFNKINRPEETQEDDKDLPNFERKLQQLE
Sbjct: 61  KFKKVKRKRKQIILQQHEINIFLRDYQEKQQTFNKINRPEETQEDDKDLPNFERKLQQLE 120

Query: 121 KELKNEDENFELDINSKKDKYALFSSSSDPSRRTNILSDRARDLDLNEIFTRDEQYGEYM 180
           KELKNEDENFELDINSKKDKYALFSSSSDPSRRTNILSDRARDLDLNEIFTRDEQYGEYM
Sbjct: 121 KELKNEDENFELDINSKKDKYALFSSSSDPSRRTNILSDRARDLDLNEIFTRDEQYGEYM 180

Query: 181 ELEQFHSLWLNVIKRGDCSXXXXXXXXXXXXXXXKYLLTPPMDRKNDRYMAFLLKLSKYV 240
           ELEQFHSLWLNVIKRGDCS               KYLLTPPMDRKNDRYMAFLLKLSKYV
Sbjct: 181 ELEQFHSLWLNVIKRGDCSLLQFLDILELFLDDEKYLLTPPMDRKNDRYMAFLLKLSKYV 240

Query: 241 ETFFFKSYALLDAAAVENLIKSDFEHSYCRGSLRSEAKGIYCPFCSRWFKTSSVFESHLV 300
           ETFFFKSYALLDAAAVENLIKSDFEHSYCRGSLRSEAKGIYCPFCSRWFKTSSVFESHLV
Sbjct: 241 ETFFFKSYALLDAAAVENLIKSDFEHSYCRGSLRSEAKGIYCPFCSRWFKTSSVFESHLV 300

Query: 301 GKIHKKNESKRRNFVYSEYKLHRYLKYLNDEFSRTRSFVERKLAFTANERMAEMDILTQK 360
           GKIHKKNESKRRNFVYSEYKLHRYLKYLNDEFSRTRSFVERKLAFTANERMAEMDILTQK
Sbjct: 301 GKIHKKNESKRRNFVYSEYKLHRYLKYLNDEFSRTRSFVERKLAFTANERMAEMDILTQK 360

Query: 361 YEAPAYDSTEKEGAEQVDGEQRDGQLQEEHLSGKSFDMPLGPDGLPMPYWLYKLHGLDRE 420
           YEAPAYDSTEKEGAEQVDGEQRDGQLQEEHLSGKSFDMPLGPDGLPMPYWLYKLHGLDRE
Sbjct: 361 YEAPAYDSTEKEGAEQVDGEQRDGQLQEEHLSGKSFDMPLGPDGLPMPYWLYKLHGLDRE 420

Query: 421 YRCEICSNKVYNGRRTFERHFNEERHIYHLRCLGIEPSSVFKGITKIKEAQELWKNMQGQ 480
           YRCEICSNKVYNGRRTFERHFNEERHIYHLRCLGIEPSSVFKGITKIKEAQELWKNMQGQ
Sbjct: 421 YRCEICSNKVYNGRRTFERHFNEERHIYHLRCLGIEPSSVFKGITKIKEAQELWKNMQGQ 480

Query: 481 SQLTSIAAVPPKPNPSQLKVPTXXXXXXXXXXGNVMSKKVYDELKKQGLV 530
           SQLTSIAAVPPKPNPSQLKVPT          GNVMSKKVYDELKKQGLV
Sbjct: 481 SQLTSIAAVPPKPNPSQLKVPTELELEEEDEEGNVMSKKVYDELKKQGLV 530

>Smik_4.205 Chr4 (377655..379250) [1596 bp, 531 aa] {ON} YDL030W
           (REAL)
          Length = 531

 Score =  748 bits (1930), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 369/531 (69%), Positives = 416/531 (78%), Gaps = 1/531 (0%)

Query: 1   MNLLETRRSLLXXXXXXXXXXXXXXQRNPELYYHYIQESSKVFPDTKLPRSSLIAENXXX 60
           M+ LETRRSLL              +RNPELYYHYIQESSKVFPD KLP+SSLIAEN   
Sbjct: 1   MSFLETRRSLLEDMEIIENAIVERIRRNPELYYHYIQESSKVFPDVKLPKSSLIAENKLF 60

Query: 61  XXXXXXXXXXXXXXXXHEINIFLRDYQEKQQTFNKINRPEETQEDDKDLPNFERKLQQLE 120
                           HEI++FLRDY EKQ++FN IN    +QEDDKDL +F+ +L+QLE
Sbjct: 61  KIKKVKRNRKQVILQQHEISLFLRDYLEKQKSFNNINSQNYSQEDDKDLCSFDEELRQLE 120

Query: 121 KELKNEDENFELDINSKKDKYALFSSSSDPSRRTNILSDRARDLDLNEIFTRDEQYGEYM 180
            ELK+E+ENF+LDINSK++KYALFSSS D S+RTNILS+RARDLDLN+IFTRDEQYGEYM
Sbjct: 121 DELKSEEENFQLDINSKRNKYALFSSSIDSSKRTNILSERARDLDLNKIFTRDEQYGEYM 180

Query: 181 ELEQFHSLWLNVIKRGDCSXXXXXXXXXXXXXXXKYLLTPPMDRKNDRYMAFLLKLSKYV 240
           ELEQFHSLWLNV KR DCS               KYLLTPPMDRKNDRYMAFL+KL KY+
Sbjct: 181 ELEQFHSLWLNVFKRSDCSLLQFFDVVELFVDDKKYLLTPPMDRKNDRYMAFLIKLCKYL 240

Query: 241 ETFFFKSYALLDAAAVENLIKSDFEHSYCRGSLRSEAKGIYCPFCSRWFKTSSVFESHLV 300
           ETFFFKSYAL D   +E+ I+ DFE SYC+GSLRSEAKGI+CPFC +WFKTS VFE+HL 
Sbjct: 241 ETFFFKSYALFDKEVIESSIRFDFEQSYCKGSLRSEAKGIHCPFCYKWFKTSPVFENHLT 300

Query: 301 GKIHKKNESKRRNFVYSEYKLHRYLKYLNDEFSRTRSFVERKLAFTANERMAEMDILTQK 360
           GKIHKKNE KR++ VYSEYKLHRYLKYL DEFS T+SFVERKL FTANER+AEMD LTQK
Sbjct: 301 GKIHKKNEFKRKDTVYSEYKLHRYLKYLKDEFSHTKSFVERKLVFTANERIAEMDALTQK 360

Query: 361 YEAPAYDSTEKEGAEQVDGEQRDGQLQEEHLSGKSFDMPLGPDGLPMPYWLYKLHGLDRE 420
           YEAPAYD T+K+G +Q   +QRD QLQE+H  GKSFDMPLGPDGLPMP+WLYKLHGLDRE
Sbjct: 361 YEAPAYDPTDKDGDQQKGSDQRDDQLQEKHFFGKSFDMPLGPDGLPMPHWLYKLHGLDRE 420

Query: 421 YRCEICSNKVYNGRRTFERHFNEERHIYHLRCLGIEPSSVFKGITKIKEAQELWKNMQGQ 480
           Y CEIC+NKVYNGRRTFERHFNE  H+YHLRCLGIEPS  FKGITKI EAQ+LW+NMQ Q
Sbjct: 421 YHCEICANKVYNGRRTFERHFNEGPHLYHLRCLGIEPSLAFKGITKITEAQKLWENMQKQ 480

Query: 481 SQ-LTSIAAVPPKPNPSQLKVPTXXXXXXXXXXGNVMSKKVYDELKKQGLV 530
            Q  TSIA+   K   S+ K+PT          GNVMSKKV+DELKKQGLV
Sbjct: 481 PQSATSIASSLTKLKHSRSKLPTELELEEEDEEGNVMSKKVFDELKKQGLV 531

>Skud_4.221 Chr4 (392347..393942) [1596 bp, 531 aa] {ON} YDL030W
           (REAL)
          Length = 531

 Score =  728 bits (1879), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 360/531 (67%), Positives = 407/531 (76%), Gaps = 1/531 (0%)

Query: 1   MNLLETRRSLLXXXXXXXXXXXXXXQRNPELYYHYIQESSKVFPDTKLPRSSLIAENXXX 60
           MN+LETRRSLL              QRNPELYYHYIQES KVFPD KLP+ SLIAEN   
Sbjct: 1   MNVLETRRSLLEDLEIIENAIAIRIQRNPELYYHYIQESCKVFPDVKLPKPSLIAENKIY 60

Query: 61  XXXXXXXXXXXXXXXXHEINIFLRDYQEKQQTFNKINRPEETQEDDKDLPNFERKLQQLE 120
                           HEI++FLRDY EKQ+ FN+ N  E  +EDDK++  FE+ LQ+LE
Sbjct: 61  KLKKVKRNRKQVILQQHEIDLFLRDYHEKQKAFNESNNLEGVEEDDKEVDRFEQNLQELE 120

Query: 121 KELKNEDENFELDINSKKDKYALFSSSSDPSRRTNILSDRARDLDLNEIFTRDEQYGEYM 180
           + LKNED+NF+LDIN  + KYALFSSS+DPS+RTNILS+RARDLDLN+IFTRDEQYGEYM
Sbjct: 121 ERLKNEDDNFQLDINLTRSKYALFSSSADPSKRTNILSERARDLDLNKIFTRDEQYGEYM 180

Query: 181 ELEQFHSLWLNVIKRGDCSXXXXXXXXXXXXXXXKYLLTPPMDRKNDRYMAFLLKLSKYV 240
           EL+QFH LWLNVI+R DCS               K+LLTPPMDRKNDRYM FL++LSKY+
Sbjct: 181 ELDQFHYLWLNVIRRSDCSLLQFFNILELFVDDKKFLLTPPMDRKNDRYMDFLMRLSKYL 240

Query: 241 ETFFFKSYALLDAAAVENLIKSDFEHSYCRGSLRSEAKGIYCPFCSRWFKTSSVFESHLV 300
           ETFFFKSY L D   VEN I+SDFE+SYC+G +RSEAKGIYCPFCS+WFKT  VFE+HL 
Sbjct: 241 ETFFFKSYVLFDKEMVENSIESDFENSYCKGLVRSEAKGIYCPFCSKWFKTFPVFENHLS 300

Query: 301 GKIHKKNESKRRNFVYSEYKLHRYLKYLNDEFSRTRSFVERKLAFTANERMAEMDILTQK 360
           GK HKKNE+KR+N VYSEYKLHRYLKYL DEF  TRSF+ERKLAFTANERMAEMD LT+K
Sbjct: 301 GKNHKKNEAKRKNTVYSEYKLHRYLKYLKDEFFHTRSFIERKLAFTANERMAEMDSLTEK 360

Query: 361 YEAPAYDSTEKEGAEQVDGEQRDGQLQEEHLSGKSFDMPLGPDGLPMPYWLYKLHGLDRE 420
           YEAPAYD TE EG  Q D  ++   LQE+   GKSFDMPLGPDGLPMPYWLYKLHGLDRE
Sbjct: 361 YEAPAYDHTEGEGDGQCDAGRKGDLLQEKQPFGKSFDMPLGPDGLPMPYWLYKLHGLDRE 420

Query: 421 YRCEICSNKVYNGRRTFERHFNEERHIYHLRCLGIEPSSVFKGITKIKEAQELWKNMQGQ 480
           Y CEIC+N+VYNGRRTFERHFNEE H+YHLRCLGIEPS  FKGITKI E Q+LWK++Q Q
Sbjct: 421 YPCEICANRVYNGRRTFERHFNEEAHLYHLRCLGIEPSPAFKGITKIAEVQKLWKDIQNQ 480

Query: 481 SQLTSIAAVP-PKPNPSQLKVPTXXXXXXXXXXGNVMSKKVYDELKKQGLV 530
            +  S  AV   K +PSQ K+PT          GNVMSKKVYDELKKQGLV
Sbjct: 481 HRSGSSTAVALTKKSPSQPKLPTGLELEEEDEEGNVMSKKVYDELKKQGLV 531

>Suva_4.219 Chr4 (387976..389571) [1596 bp, 531 aa] {ON} YDL030W
           (REAL)
          Length = 531

 Score =  704 bits (1816), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 355/531 (66%), Positives = 415/531 (78%), Gaps = 1/531 (0%)

Query: 1   MNLLETRRSLLXXXXXXXXXXXXXXQRNPELYYHYIQESSKVFPDTKLPRSSLIAENXXX 60
           M+ LET+RSLL              QRNPELYY YI E+ K+FPD K PR SL++EN   
Sbjct: 1   MDFLETKRSLLEDLEIIENAITERIQRNPELYYRYILEAGKLFPDIKQPRPSLVSENKIY 60

Query: 61  XXXXXXXXXXXXXXXXHEINIFLRDYQEKQQTFNKINRPEETQEDDKDLPNFERKLQQLE 120
                           HEI++FLRDY+EKQ+  N+IN P++ QED+KDL +FE+KLQ+LE
Sbjct: 61  KLKKNKRNRKQVILQQHEIDLFLRDYKEKQRLINEINIPQDVQEDEKDLRSFEQKLQELE 120

Query: 121 KELKNEDENFELDINSKKDKYALFSSSSDPSRRTNILSDRARDLDLNEIFTRDEQYGEYM 180
           +ELKNE EN++LDIN K+ +YALFSSS++PS+RTNILS+RARD+DLN +FTRDEQYGEYM
Sbjct: 121 EELKNEQENYQLDINLKRGRYALFSSSAEPSKRTNILSERARDIDLNRLFTRDEQYGEYM 180

Query: 181 ELEQFHSLWLNVIKRGDCSXXXXXXXXXXXXXXXKYLLTPPMDRKNDRYMAFLLKLSKYV 240
           ELEQFHSLWLNVIKRGDCS               KYLL PPMDRKNDRYM+FL+KLS+YV
Sbjct: 181 ELEQFHSLWLNVIKRGDCSLLQFFDTVELFVDDKKYLLAPPMDRKNDRYMSFLMKLSEYV 240

Query: 241 ETFFFKSYALLDAAAVENLIKSDFEHSYCRGSLRSEAKGIYCPFCSRWFKTSSVFESHLV 300
           E+FF+KSYAL +   VE LIKSDF++SYCRG L+SE+KGIYCP C +WFKT +VFE+H+ 
Sbjct: 241 ESFFYKSYALFEKEVVEGLIKSDFDNSYCRGILKSESKGIYCPLCYKWFKTQAVFENHIP 300

Query: 301 GKIHKKNESKRRNFVYSEYKLHRYLKYLNDEFSRTRSFVERKLAFTANERMAEMDILTQK 360
           GK HKKNE+KR+  VYSEYKLHRYL+ L DE   T+SFVERKLAFTANERM EMD LTQK
Sbjct: 301 GKNHKKNEAKRKRIVYSEYKLHRYLRLLKDELFHTKSFVERKLAFTANERMVEMDSLTQK 360

Query: 361 YEAPAYDSTEKEGAEQVDGEQRDGQLQEEHLSGKSFDMPLGPDGLPMPYWLYKLHGLDRE 420
           YEAPAYD+TE+E   +  GEQ+D +LQE+HL GKSFDMPLGPDGLPMPYWLYKLHGLDRE
Sbjct: 361 YEAPAYDATEREDDGKGGGEQKDDKLQEKHLFGKSFDMPLGPDGLPMPYWLYKLHGLDRE 420

Query: 421 YRCEICSNKVYNGRRTFERHFNEERHIYHLRCLGIEPSSVFKGITKIKEAQELWKNMQGQ 480
           Y CEIC+N++YNGRRTFERHFNEE H+YHLRCLGIEPSSVFKGITKI EAQ LWKN Q Q
Sbjct: 421 YPCEICANRIYNGRRTFERHFNEETHLYHLRCLGIEPSSVFKGITKIAEAQRLWKNTQSQ 480

Query: 481 SQ-LTSIAAVPPKPNPSQLKVPTXXXXXXXXXXGNVMSKKVYDELKKQGLV 530
            Q ++SIAAVP +   SQ K+P           GNVMSKKVYDELKKQGLV
Sbjct: 481 PQFVSSIAAVPAEKKLSQTKLPAGMELEEEDEQGNVMSKKVYDELKKQGLV 531

>NCAS0C03540 Chr3 (707075..708631) [1557 bp, 518 aa] {ON} Anc_3.160
           YDL030W
          Length = 518

 Score =  436 bits (1120), Expect = e-148,   Method: Compositional matrix adjust.
 Identities = 242/533 (45%), Positives = 318/533 (59%), Gaps = 25/533 (4%)

Query: 3   LLETRRSLLXXXXXXXXXXXXXXQRNPELYYHYIQESSKVFPDTKL--PRSSLIAENXXX 60
           LLE +R+LL              QRNPELYY  I + S +  +  +  P  S  + N   
Sbjct: 4   LLEKKRNLLEDLEVIEDAIAKRFQRNPELYYDNITKLS-ILTNLSIDTPAESNKSNNKIY 62

Query: 61  XXXXXXXXXXXXXXXXHEINIFLRDYQEKQQTFNKINRPEETQEDDKDLPNFERKLQQLE 120
                            EINIFL+D++E+++    + + E  ++D+  L  F+  +Q + 
Sbjct: 63  KRKKLKRSRKQFVLQQQEINIFLKDFEERRRVLLDLGK-ETVKDDNITLETFKTMIQDIN 121

Query: 121 KELKNEDENFELDINSKKDKYALFSSSSDPSRRTNILSDRARDLDLNEIFTRDEQYGEYM 180
            +  + +    L IN K  +YA+FS+S   S+  NILS R   LD+N+ F+R+EQYG+YM
Sbjct: 122 AKKSSSEV---LPINQKITRYAMFSASISESKPNNILSQRCAGLDINKYFSREEQYGQYM 178

Query: 181 ELEQFHSLWLNVIKRGDCSXXXXXXXXXXXXXXXKYLLTPPMDRKNDRYMAFLLKLSKYV 240
           + E F+  WLNV+K GD +               KYL  PPMDRKN+RYM FL  L  YV
Sbjct: 179 DFENFYLEWLNVVKTGDVTLLQFLNLLRVFMDEEKYLTHPPMDRKNNRYMKFLESLCSYV 238

Query: 241 ETFFFKSYALLDAAAVENLIKSDFEHSYCRGSLRSEAKGIYCPFCSRWFKTSSVFESHLV 300
           E+FFF+ YAL++ +A+ + I+S F   Y +       KG YC  C++WFKT SVF +H+ 
Sbjct: 239 ESFFFRKYALINKSAITSQIESQFTE-YIKEPTEHSVKGQYCKACAKWFKTESVFVNHIP 297

Query: 301 GKIHKKNESKRRNFVYSEYKLHRYLKYLNDEFSRTRSFVERKLAFTANERMAEMDILTQK 360
           GK H KNE +R+N + SEYKLHR+   L +EF  T  F+E K+A TA+ERM EM  LT+ 
Sbjct: 298 GKNHIKNEKQRKNALLSEYKLHRFFFLLQEEFKETYEFIEMKMALTADERMEEMKRLTEN 357

Query: 361 YEAPAYDSTEKEG----AEQVDGEQRDGQLQEEHLSGKSFDMPLGPDGLPMPYWLYKLHG 416
           YE PAY S EKEG    A+    EQR G+ Q   L   SFDMPLGPDGLPMP+WLYKL G
Sbjct: 358 YEKPAYSSDEKEGDENNADLEHDEQRSGKGQ--GLLEGSFDMPLGPDGLPMPFWLYKLQG 415

Query: 417 LDREYRCEICSNKVYNGRRTFERHFNEERHIYHLRCLGIEPSSVFKGITKIKEAQELWKN 476
           LD EY CEICSN+++ GRR FE+HF    H YHLRCLGIEPSS+FKGITKIKEAQ+LW +
Sbjct: 416 LDVEYPCEICSNQIFKGRRAFEKHFTAPTHQYHLRCLGIEPSSMFKGITKIKEAQKLWVD 475

Query: 477 MQGQSQLTSIAAVPPKPNPSQLKVPTXXXXXXXXXXGNVMSKKVYDELKKQGL 529
           +  Q   +       KP  S +++            GNVMSKK+YDELKKQGL
Sbjct: 476 INSQKNSS-------KPMVSSIELQV----EVEDSVGNVMSKKLYDELKKQGL 517

>NDAI0G02890 Chr7 (669498..671108) [1611 bp, 536 aa] {ON} Anc_3.160
           YDL030W
          Length = 536

 Score =  415 bits (1066), Expect = e-139,   Method: Compositional matrix adjust.
 Identities = 229/543 (42%), Positives = 319/543 (58%), Gaps = 28/543 (5%)

Query: 4   LETRRSLLXXXXXXXXXXXXXXQRNPELYYHYIQESSKVFPDTK---LPRSSLIAENXXX 60
           LE RRSLL              QRNPELYY  +++ S++FP  +   LP  S++  N   
Sbjct: 6   LEKRRSLLEDLEIIENAISTRFQRNPELYYSNLKKVSELFPSKQVEELPTHSIMTNNKIY 65

Query: 61  XXXXXXXXXXXXXXXXHEINIFLRDYQEKQQTFNKINR----PEETQEDDKDLP--NFER 114
                           HEI++F++D+  KQ+    + R      +  +++  LP   F+ 
Sbjct: 66  KTKKLKRNRKQIALQQHEISLFIKDFFSKQKELETLTREANFKAKKNKEEILLPVEEFKD 125

Query: 115 KLQQLEKELKNEDENF-ELDINSKKDKYALFSSSSDPSRRTNILSDRARDLDLNEIFTRD 173
            L ++ +   NE+ N  EL+IN K +KY++FS+S + S  + ILS RA DLD+N IF+ +
Sbjct: 126 ILSEINEADGNENGNRRELEINDKINKYSMFSNSLNKSHPSTILSSRASDLDINSIFSLE 185

Query: 174 EQYGEYMELEQFHSLWLNVIKRGDCSXXXXXXXXXXXXXXXKYLLTPPMDRKNDRYMAFL 233
           EQYGEY+ L  +++ WLNV+K+ D +               +Y++ PPMDRKN+ YM +L
Sbjct: 186 EQYGEYLALNPYYTEWLNVVKKEDLTFLQFLNMLKIFQDDKRYIVQPPMDRKNEPYMKYL 245

Query: 234 LKLSKYVETFFFKSYALLDAAAVENLIKSDFEHSYCRGSLRSEAKGIYCPFCSRWFKTSS 293
            +   Y+E+FF + Y L+D+      +K +F  S  +  L +E KG +C  C +WFKT +
Sbjct: 246 QRYCSYLESFFERKYPLIDSRYTSRELKKEFNKSIIK-PLENEKKGFFCKTCCKWFKTLT 304

Query: 294 VFESHLVGKIHKKNESKRRNFVYSEYKLHRYLKYLNDEFSRTRSFVERKLAFTANERMAE 353
           VFESHL G+ H K+ +KR   +Y+EYK HRY   L +E   T  FVERK+AFT  ER+ E
Sbjct: 305 VFESHLNGQKHIKSYNKRVQGLYAEYKTHRYSMLLKEEHQSTCEFVERKMAFTVEERITE 364

Query: 354 MDILTQKYEAPAYDSTEKEGAEQ------VDGEQRDGQLQEEHLSGKSFDMPLGPDGLPM 407
           M  L +  +APAYD  EKEG E        D  + DG      LSG S +MPLGPDGLPM
Sbjct: 365 MKRLAEICKAPAYDVNEKEGDENNTELNVKDNLKNDGA--SAMLSG-SINMPLGPDGLPM 421

Query: 408 PYWLYKLHGLDREYRCEICSNKVYNGRRTFERHFNEERHIYHLRCLGIEPSSVFKGITKI 467
           P+WLYKL GLD  Y CEICSN+++ GRRTF++HF E  HIYHLRCLGIEP+  FKG+TKI
Sbjct: 422 PFWLYKLQGLDVSYPCEICSNQIFKGRRTFDKHFTEATHIYHLRCLGIEPTPAFKGVTKI 481

Query: 468 KEAQELWKNMQGQSQLTSIAAVPPKPNPSQLKVPTXXXXXXXXXXGNVMSKKVYDELKKQ 527
           +EAQ LW NM+  + +     +   P+   ++V            GN+M++KVYDELKKQ
Sbjct: 482 EEAQRLWNNMKNDTIMGDKKFIETIPDKMAIEV--------EDKEGNIMTQKVYDELKKQ 533

Query: 528 GLV 530
           GL 
Sbjct: 534 GLA 536

>TDEL0D04620 Chr4 complement(847509..849059) [1551 bp, 516 aa] {ON}
           Anc_3.160 YDL030W
          Length = 516

 Score =  409 bits (1050), Expect = e-137,   Method: Compositional matrix adjust.
 Identities = 229/539 (42%), Positives = 311/539 (57%), Gaps = 32/539 (5%)

Query: 1   MNLLETRRSLLXXXXXXXXXXXXXXQRNPELYYHYIQESSKVFPDTKLPRSSLIAE---- 56
           MN LE+RRS L              +RNP LYY Y+Q+ + +     +P SS I      
Sbjct: 1   MNTLESRRSHLEDLEVIEQSIASRFERNPGLYYGYLQKRALI---DDIPLSSSITNAYNA 57

Query: 57  NXXXXXXXXXXXXXXXXXXXHEINIFLRDYQEKQQTFNKINRPEET---QEDDKDLPNFE 113
           N                   HEI++FL++   K +    +  P  T   ++++     F+
Sbjct: 58  NRIYKAKRSKRNRKQFVLQQHEIDLFLQESMRKLRDLGSLKGPVNTHSLRDEEATFEIFK 117

Query: 114 RKLQQLEKELKN--EDENFELDINSKKDKYALFSSSSDPSRRTNILSDRARDLDLNEIFT 171
           + L++++ + K+   D  F  D+N +  K+A+FS+ +  S+   ILS  A++L LN++F+
Sbjct: 118 QNLEEIKDKYKDLGSDSLFS-DVNEEISKHAMFSALTTDSKPVTILSRSAKNLRLNDVFS 176

Query: 172 RDEQYGEYMELEQFHSLWLNVIKRGDCSXXXXXXXXXXXXXXXKYLLTPPMDRKNDRYMA 231
           R+EQYGEY++L++FHS WLNVI+  +C+               +Y+L PPMDRKN RY  
Sbjct: 177 REEQYGEYLDLDRFHSSWLNVIRSTECTLLQFYSILEKFLDDRQYILAPPMDRKNGRYAE 236

Query: 232 FLLKLSKYVETFFFKSYALLDAAAVENLIKSDFEHSYCRGSLRSEAKGIYCPFCSRWFKT 291
           FL+++S Y+E FF K+  LL+   +E  I+S+F  S     L +  KG YC  C +WFK 
Sbjct: 237 FLVEISNYLEKFFQKANVLLNHTKLERRIQSEFSRSLA-TPLHTGGKGFYCIACCKWFKV 295

Query: 292 SSVFESHLVGKIHKKNESKRRNFVYSEYKLHRYLKYLNDEFSRTRSFVERKLAFTANERM 351
            +VF+SHL GK HK N SKR   + +EYKLHRYL  L++EF RTR F ERK+AFTA ERM
Sbjct: 296 PTVFDSHLTGKHHKNNLSKRSKHLQAEYKLHRYLTLLSEEFRRTREFTERKVAFTAEERM 355

Query: 352 AEMDILTQKYEAPAYDSTEKEGAEQVDGEQRDGQLQEEHLSGKSFDMPLGPDGLPMPYWL 411
            EM  L   Y AP Y   EKE   Q D +    +L +    G SFD+PLG DGLP+PYWL
Sbjct: 356 QEMARLNHDYHAPDYGPDEKE---QEDPDSNKAELDKNSALGGSFDLPLGADGLPIPYWL 412

Query: 412 YKLHGLDREYRCEICSNKVYNGRRTFERHFNEERHIYHLRCLGIEPSSVFKGITKIKEAQ 471
           YKL GLD EY CEIC+N+ Y GRR FE+HF E  H +HL+CLGIEPS  FKGIT I+EAQ
Sbjct: 413 YKLQGLDVEYSCEICTNQTYKGRRAFEKHFLEPTHTFHLKCLGIEPSITFKGITGIQEAQ 472

Query: 472 ELWKNMQGQSQLTSIAAVPPKPNPSQLKVPTXXXXXXXXXXGNVMSKKVYDELKKQGLV 530
           +LW+        TS    P       L+V            GNV+++KVY ELKKQGLV
Sbjct: 473 DLWRQ-------TSSRNRPQTQKKIDLEV--------EDQEGNVLTQKVYQELKKQGLV 516

>ZYRO0B04950g Chr2 complement(399973..401493) [1521 bp, 506 aa] {ON}
           similar to uniprot|P19736 Saccharomyces cerevisiae
           YDL030W PRP9 Subunit of the SF3a splicing factor complex
           required for spliceosome assembly
          Length = 506

 Score =  405 bits (1042), Expect = e-136,   Method: Compositional matrix adjust.
 Identities = 225/536 (41%), Positives = 303/536 (56%), Gaps = 36/536 (6%)

Query: 1   MNLLETRRSLLXXXXXXXXXXXXXXQRNPELYYHYIQESSKVFPDTKLPRSSLIAENXXX 60
           M  LETRR LL               RNPELYY  I +   +    +LP ++ +A N   
Sbjct: 1   MTTLETRRQLLEGLEIIEDAISQRFGRNPELYYSNITKQVLIDGGIELPSTTAMAVNRIY 60

Query: 61  XXXXXXXXXXXXXXXXHEINIFLRDYQEKQQTFNKINRP---EETQEDDKDLPNFERKLQ 117
                           HEIN+FL    +KQ+  + +N     E+ ++++ +   F   + 
Sbjct: 61  KSKRTKRSRKQLVTQQHEINLFLSQALDKQKELSGVNGTVDVEDYRDEEINFDKFREAVD 120

Query: 118 QLEKELKNEDENFELDINSKKDKYALFSSSSDPSRRTNILSDRARDLDLNEIFTRDEQYG 177
           Q+  + +++ E   LDIN     + +FS++   S    ILS+ ARDLDLN+IFTRDEQYG
Sbjct: 121 QINSKYEDQ-EGLALDINENIVNHEMFSATFSKS---TILSESARDLDLNQIFTRDEQYG 176

Query: 178 EYMELEQFHSLWLNVIKRGDCSXXXXXXXXXXXXXXXKYLLTPPMDRKNDRYMAFLLKLS 237
           + ++LE+FHS WLNVIKR DCS               +YLL+PPMDRKN+RY  FL++L 
Sbjct: 177 DLLDLEKFHSQWLNVIKRADCSYLQFFDVLQKFLDPSEYLLSPPMDRKNERYGQFLIELF 236

Query: 238 KYVETFFFKSYALLDAAAVENLIKSDFEHSYCRGSLRSEAKGIYCPFCSRWFKTSSVFES 297
           +YVE FF K Y L+++  +   ++SDFE  Y R  +     G+YC  C +WFKT +VF+S
Sbjct: 237 QYVEQFFAKVYVLVNSTILSQRMESDFEE-YLRMPIYKSNHGLYCVACGKWFKTPTVFQS 295

Query: 298 HLVGKIHKKNESKRRNFVYSEYKLHRYLKYLNDEFSRTRSFVERKLAFTANERMAEMDIL 357
           HL GK H+ N  KR   + +EYKLHRYLK L  +  RTR FVERK+AFT  ERM EM  L
Sbjct: 296 HLTGKHHRNNRDKRFTKLQAEYKLHRYLKILQGQLERTRGFVERKMAFTTEERMEEMSRL 355

Query: 358 TQKYEAPAY---DSTEKEGAEQVDGEQRDGQLQEEHLSGKSFDMPLGPDGLPMPYWLYKL 414
            + YE P Y   +   +E  + VD         E+ ++G   ++PLG DGLP+P WLYKL
Sbjct: 356 ARIYEGPDYAPDEKEIEEKEDSVDTP------SEKKMNG-GIELPLGLDGLPIPLWLYKL 408

Query: 415 HGLDREYRCEICSNKVYNGRRTFERHFNEERHIYHLRCLGIEPSSVFKGITKIKEAQELW 474
            GLD  Y CEIC N+ Y GRR FERHF E  H++HL+CLGIE S  F+ IT I+EAQ LW
Sbjct: 409 QGLDVTYSCEICGNQTYRGRRMFERHFTEPTHLFHLKCLGIEASDAFRSITSIEEAQNLW 468

Query: 475 KNMQGQSQLTSIAAVPPKPNPSQLKVPTXXXXXXXXXXGNVMSKKVYDELKKQGLV 530
           K + G +  +S                           GNVM+++VY+ELKKQGLV
Sbjct: 469 KRISGNNTTSS------------------RDIEVEDEEGNVMTQQVYEELKKQGLV 506

>Kpol_479.26 s479 complement(50993..52546) [1554 bp, 517 aa] {ON}
           complement(50993..52546) [1554 nt, 518 aa]
          Length = 517

 Score =  397 bits (1019), Expect = e-132,   Method: Compositional matrix adjust.
 Identities = 216/533 (40%), Positives = 317/533 (59%), Gaps = 19/533 (3%)

Query: 1   MNLLETRRSLLXXXXXXXXXXXXXXQRNPELYYHYIQESSKVFPDTKLPRSSLI--AENX 58
           M+ +E  RSLL              QRNPE+YY+Y Q+ + +    +  ++ +   + N 
Sbjct: 1   MSYIENVRSLLEDIEVIEDAISKRFQRNPEVYYYYSQQLNDINGGGEETKTVVSNRSSNR 60

Query: 59  XXXXXXXXXXXXXXXXXXHEINIFLRDYQEKQQTFNKINRPEETQEDDKDLPNFERKLQQ 118
                             +E N F++D + K     +IN  +E+  +   L  +   +  
Sbjct: 61  IYKSRKHKRDRKQVILQQYETNEFIKDIRSKLNEIREINVTKES--NGIKLDRYVELMGS 118

Query: 119 LEKELKNE-DENFELDINSKKDKYALFSSSSDPSRRTNILSDRARDLDLNEIFTRDEQYG 177
           ++ + ++   +N +L IN    +Y++F+SS+  ++  NILSD+ + L++N+ FTRDEQYG
Sbjct: 119 IDTKYEDSVSDNQQLPINKTIFQYSMFTSSNSKNKPNNILSDKCKYLEINDYFTRDEQYG 178

Query: 178 EYMELEQFHSLWLNVIKRGDCSXXXXXXXXXXXXXXXKYLLTPPMDRKNDRYMAFLLKLS 237
           EY+ELE+F++ WLNVIK  +CS               +Y+L PPMDRKN+RY+ FL  + 
Sbjct: 179 EYLELERFYNNWLNVIKSANCSILQYMSIIEKFLDSAQYILQPPMDRKNERYLKFLEIIE 238

Query: 238 KYVETFFFKSYALLDAAAVENLIKSDFEHSYCRGSLRSEAKGIYCPFCSRWFKTSSVFES 297
            Y+ +F  K+Y L+D      ++K D+E   C  SL  + KG +C  C +WFKT SVFE+
Sbjct: 239 TYLTSFIKKTYVLIDWEEEAEVLKYDYEIE-CTKSLMKQGKGNFCRLCGKWFKTESVFEN 297

Query: 298 HLVGKIHKKNESKRRNFVYSEYKLHRYLKYLNDEFSRTRSFVERKLAFTANERMAEMDIL 357
           HL GK H KN  K  +  + E+K+HR L +L+ EF  T+ F+ERKLAFT++ER+ E+D +
Sbjct: 298 HLPGKNHVKNYKKYYDEYFIEFKIHRILNWLSKEFEETKLFLERKLAFTSDERIKEIDRM 357

Query: 358 TQKYEAPAYDSTEKEGAEQVDGEQRDGQLQEEHLSGKSFDMPLGPDGLPMPYWLYKLHGL 417
           T+ YE PAY   E E  +  +   +    + + ++G SFDMPLGPDGLPMPYWLYKL GL
Sbjct: 358 TEVYERPAYSVGEPEEGKPNENSSKTSSNKNDIING-SFDMPLGPDGLPMPYWLYKLQGL 416

Query: 418 DREYRCEICSNKVYNGRRTFERHFNEERHIYHLRCLGIEPSSVFKGITKIKEAQELWKNM 477
           D  Y+CEIC+N +Y GRRTFE+HF+E  H YHLRCLGIEPSS FKGI  IKEA +LW  M
Sbjct: 417 DMTYKCEICANTIYKGRRTFEKHFSETTHNYHLRCLGIEPSSAFKGIVSIKEATDLWGTM 476

Query: 478 QGQSQLTSIAAVPPKPNPSQLKVPTXXXXXXXXXXGNVMSKKVYDELKKQGLV 530
             + + +  A    + N  +++V            GNV+SK++Y+ELKKQGL+
Sbjct: 477 NVKDKSSKHA----ESNNYEIEV--------EDKEGNVLSKEIYEELKKQGLL 517

>TPHA0A00910 Chr1 (179145..180728) [1584 bp, 527 aa] {ON} Anc_3.160
           YDL030W
          Length = 527

 Score =  378 bits (970), Expect = e-125,   Method: Compositional matrix adjust.
 Identities = 223/534 (41%), Positives = 298/534 (55%), Gaps = 11/534 (2%)

Query: 1   MNLLETRRSLLXXXXXXXXXXXXXXQRNPELYYHYIQESSKVF-PDTKLPRSSLIAENXX 59
           M+ +E RRSLL              QRNPELYY Y +   KV  PD  LP  ++   N  
Sbjct: 1   MSNIEERRSLLEDLEVIESSITKRFQRNPELYYKYQEGLKKVVDPDIDLPSKTVRNTNKI 60

Query: 60  XXXXXXXXXXXXXXXXXHEINIFLRDYQEKQQTFNKINRP-EETQEDDKDLPNFERKLQQ 118
                            +EIN FL DY+ K++   K      E ++   D   FE  L+ 
Sbjct: 61  YKTRKHKRKRKQILLQQYEINEFLDDYRRKEKQLMKQKLDISEFRDKGADFVKFEELLES 120

Query: 119 LEKELKNEDENF--ELDINSKKDKYALFSSSSDPSRRTNILSDRARDLDLNEIFTRDEQY 176
           +  E  N++E     L +  KKDKYA+FSSS + +   NILS R++ LDLN  F+++EQY
Sbjct: 121 INNEYNNQNEETPTNLKLLDKKDKYAMFSSSININSPNNILSKRSQLLDLNNYFSKEEQY 180

Query: 177 GEYMELEQFHSLWLNVIKRGDCSXXXXXXXXXXXXXXXKYLLTPPMDRKNDRYMAFLLKL 236
           GE + LEQF+S WLNV+K  DCS               +++L  PMDRKN RY+ F+  L
Sbjct: 181 GEILNLEQFYSSWLNVVKTADCSILKYILMLNVFLDKDEFILNSPMDRKNLRYVDFIRIL 240

Query: 237 SKYVETFFFKSYALLDAAAVENLIKSDFEHSYCRGSLRSEAKGIYCPFCSRWFKTSSVFE 296
           SKY E++  K Y L +    +  +K  FE  Y    +  E KG  C  C +WFK S+V++
Sbjct: 241 SKYFESYLEKRYILNNWINFKTELKKSFE-KYSIKPIVKEKKGYLCISCGKWFKNSNVYD 299

Query: 297 SHLVGKIHKKNESKRRNFVYSEYKLHRYLKYLNDEFSRTRSFVERKLAFTANERMAEMDI 356
            HL GK H+K+ S R+ F+Y+EYKLHR + YL  EF  +++++ERKLAFT  ER  E+ +
Sbjct: 300 GHLKGKQHEKHYSNRKMFLYNEYKLHRIINYLKYEFDESKAYMERKLAFTNTERNNELKL 359

Query: 357 LTQKYEAPAYDSTEKEGAEQVDGEQRDGQLQEEHLSGKSFDMPLGPDGLPMPYWLYKLHG 416
           LT+KYE PAY+  E E  ++ + E  +          KSF+MPLGPDG+P+P WLYKL G
Sbjct: 360 LTKKYEEPAYNKDEPENTDKYE-EDDNSMSNAAEDRNKSFNMPLGPDGMPIPLWLYKLQG 418

Query: 417 LDREYRCEICSNKVYNGRRTFERHFNEERHIYHLRCLGIEPSSVFKGITKIKEAQELWKN 476
           LD +Y CEIC NK Y GR+ +E HF+E  H  HL  LGI+ S  FKGIT I EA+ LW +
Sbjct: 419 LDIKYNCEICGNKEYQGRKAYENHFSELTHTSHLYFLGIQYSKAFKGITSIAEAKSLWSS 478

Query: 477 MQGQSQLTSIAAVPPKPNPSQLKVPTXXXXXXXXXXGNVMSKKVYDELKKQGLV 530
           M       S  +     N +  K+            GNVMSKK+YDELKKQ LV
Sbjct: 479 MHA-----SNGSAASFSNQNNTKLAMTEDIEVEDSEGNVMSKKIYDELKKQNLV 527

>KAFR0C01050 Chr3 complement(214128..215648) [1521 bp, 506 aa] {ON}
           Anc_3.160 YDL030W
          Length = 506

 Score =  375 bits (964), Expect = e-124,   Method: Compositional matrix adjust.
 Identities = 217/531 (40%), Positives = 301/531 (56%), Gaps = 26/531 (4%)

Query: 1   MNLLETRRSLLXXXXXXXXXXXXXXQRNPELYYHYIQESSKVFPDT-KLPRSSLIAENXX 59
           M  LE +R L               QRNPELYY+Y+++ S     + ++P S  I  N  
Sbjct: 1   MANLEEKRDLCEDLEVIEDAIAKRLQRNPELYYNYLEKLSSFEKHSLEVPSSIDIKNNRV 60

Query: 60  XXXXXXXXXXXXXXXXXHEINIFLRDYQEKQQTFNKINRPEETQEDDKDLPNFERKLQQL 119
                            HEI +F+ DY  KQ+  N + + ++T +   D+ +F   + + 
Sbjct: 61  YKSKKAKRSKKQIVAQQHEIRLFIEDYTNKQKGLNMLMKRKDTTQISSDIGDFITSITEN 120

Query: 120 EKELKNEDENFELDINSKKDKYALFSSSSDPSRRTNILSDRARDLDLNEIFTRDEQYGEY 179
           +  +K+        +  K D Y++FS+S+    + +ILS RA DLD+N+ FTRDEQ+GE 
Sbjct: 121 KSHVKSS-------LKDKIDYYSMFSAST---TQKSILSKRAADLDINQTFTRDEQFGEC 170

Query: 180 MELEQFHSLWLNVIKRGDCSXXXXXXXXXXXXXXXKYLLTPPMDRKNDRYMAFLLKLSKY 239
           M+LE+FH++WL+V+K    S                YL +P MDRKN RY  F+  +S Y
Sbjct: 171 MDLERFHNVWLSVVKDDSYSLLDFFRVIESFLDTKSYLKSPHMDRKNQRYQEFIKTISGY 230

Query: 240 VETFFFKSYALLDAAAVENLIKSDFEHSYCRGSLRSEAKGIYCPFCSRWFKTSSVFESHL 299
           VE+FFFK + L+D   V   ++ DF   Y    L ++  G +C  C++ FKT SVF++HL
Sbjct: 231 VESFFFKKFCLIDKEYVNARLQQDF-ILYLDNPLNNQ-NGFFCVACNKSFKTKSVFDNHL 288

Query: 300 VGKIHKKNESKRRNFVYSEYKLHRYLKYLNDEFSRTRSFVERKLAFTANERMAEMDILTQ 359
            GK HK+N  KRRN + SEYKL+R+L  L  EF+ T+ F ERK++FTANER  E++ L  
Sbjct: 289 PGKQHKRNVDKRRNSLISEYKLYRFLNLLRTEFNNTKEFTERKISFTANERREELERLNN 348

Query: 360 KYEAPAYDSTEKEGAEQVDGEQRDGQLQEEHLSGKSFDMPLGPDGLPMPYWLYKLHGLDR 419
           +Y AP Y S E+E  ++   E          L G  F+MPLGPDG+PMP+WLYKL GLD 
Sbjct: 349 EYNAPVYGSEEQEEGDEEHDEYASKNGNRSILDG-LFNMPLGPDGVPMPFWLYKLQGLDV 407

Query: 420 EYRCEICSNKVYNGRRTFERHFNEERHIYHLRCLGIEPSSVFKGITKIKEAQELWKNMQG 479
            Y CEICSN+ + GRR FERHFNE+ H YHLRCLGI PS  F GIT I EAQ LW ++Q 
Sbjct: 408 SYYCEICSNREFKGRRAFERHFNEKTHQYHLRCLGITPSPTFVGITAITEAQTLWDHIQS 467

Query: 480 QSQLTSIAAVPPKPNPSQLKVPTXXXXXXXXXXGNVMSKKVYDELKKQGLV 530
               T     P       ++V            GNV+++KVYD+LK+QGL+
Sbjct: 468 ----TQKKKAPSGKIDMDIEV--------EDADGNVLTRKVYDDLKRQGLL 506

>SAKL0C08800g Chr3 (807712..809517) [1806 bp, 601 aa] {ON} similar
           to uniprot|P19736 Saccharomyces cerevisiae YDL030W PRP9
           Subunit of the SF3a splicing factor complex required for
           spliceosome assembly
          Length = 601

 Score =  360 bits (924), Expect = e-117,   Method: Compositional matrix adjust.
 Identities = 213/546 (39%), Positives = 302/546 (55%), Gaps = 34/546 (6%)

Query: 1   MNLLETRRSLLXXXXXXXXXXXXXXQRNPELYYHYIQESSKVFPDTK--LPR--SSLIAE 56
           M +LE +RS+L              +RNPELYY Y +E   V  +    LP   +S I+ 
Sbjct: 74  MEILEAKRSVLERLEVIENAISERIRRNPELYYSYYEEQRLVDKENHGLLPPVPASDISA 133

Query: 57  NXXXXXXXXXXXXXXXXXXXHEINIFLRDYQEKQQTFNKINRPEETQEDDKDLPNFERKL 116
           N                   HEI+ FL +YQ +    + I   ++  E     P+FE   
Sbjct: 134 NRIHSVKKSRRSRKQIVLQQHEIDRFLEEYQREVARLHGIKLDKDDSESAA--PDFE--- 188

Query: 117 QQLEKELKNE-----DENFEL-DINSKKDKYALFSSSSDPSRRTNILSDRARDLDLNEIF 170
            QLEK +K+      DE+  L  ++ +  ++++FSSS+  S   +ILS R RDLD+N +F
Sbjct: 189 -QLEKAVKDAKSRYADESRTLAGVDVESVEHSMFSSST--STHKDILSTRGRDLDMNRLF 245

Query: 171 TRDEQYGEYMELEQFHSLWLNVIKRGDCSXXXXXXXXXXXXXXXKYLLTPPMDRKNDRYM 230
            RDE YGE++ LE FH  WLN++K G  +                YL+ P ++R + +Y 
Sbjct: 246 ARDEHYGEFLLLEPFHHEWLNIVKDGSVTALQFMNVVEMFVSDA-YLVAPAVNRGSKKYQ 304

Query: 231 AFLLKLSKYVETFFFKSYALLDAAAVENLIKSDFEHSYCRGSLRSEAKGIYCPFCSRWFK 290
            F+  L  Y+  FF K+Y L++ + +   + + F+  Y R  +  E KG++C  C RWFK
Sbjct: 305 DFVGSLLGYMSEFFRKTYPLVNHSTLGRRLAALFD-EYLRAPVADETKGLFCIPCGRWFK 363

Query: 291 TSSVFESHLVGKIHKKNESKRRNFVYSEYKLHRYLKYLNDEFSRTRSFVERKLAFTANER 350
             +V++SHL GK H KN +K    + +EYKLH+Y   L    + TR+FVER  A TA+ER
Sbjct: 364 LETVYKSHLSGKKHSKNLAKGDGHLLAEYKLHKYCGLLVQTIANTRAFVERNRALTADER 423

Query: 351 MAEMDILTQKYEAPAYDSTEKEGAEQVDGEQRDGQLQEEHLSGKSFDMPLGPDGLPMPYW 410
             E++ L ++YEAPAY   E E A +   ++R+ +  E    G  F++PLGPDG P+PYW
Sbjct: 424 AQELERLAKEYEAPAYSQHETEDAAREKQQKREPETDE---GGNPFNLPLGPDGYPIPYW 480

Query: 411 LYKLHGLDREYRCEICSNKVYNGRRTFERHFNEERHIYHLRCLGIEPSSVFKGITKIKEA 470
           LYKL GLD EY CEICSN  Y GRR FE+HF+E RHI+ LRCLGIEPS+ FKGITKI+EA
Sbjct: 481 LYKLQGLDIEYSCEICSNHTYKGRRYFEKHFSEARHIFGLRCLGIEPSATFKGITKIQEA 540

Query: 471 QELWKNMQGQSQLTSIAA------VPPKPNPSQLKVPTXXXXXXXXXXGNVMSKKVYDEL 524
           ++LW  +Q     TS+A       +      +                GNVMS+K+Y EL
Sbjct: 541 KDLWARIQ-----TSVATGVGAGAIASAATAAATPSTAKLEIEVEDEEGNVMSEKLYHEL 595

Query: 525 KKQGLV 530
           K+QGL+
Sbjct: 596 KRQGLL 601

>KLTH0C08888g Chr3 (745663..747183) [1521 bp, 506 aa] {ON} similar
           to uniprot|P19736 Saccharomyces cerevisiae YDL030W PRP9
           Subunit of the SF3a splicing factor complex required for
           spliceosome assembly
          Length = 506

 Score =  335 bits (860), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 202/534 (37%), Positives = 295/534 (55%), Gaps = 32/534 (5%)

Query: 1   MNLLETRRSLLXXXXXXXXXXXXXXQRNPELYYHYIQESSKVFPDTKLPR--SSLIAENX 58
           M   E  R+ L              +RNPE++Y  I E   V    +     SS  + N 
Sbjct: 1   MKTYEDARATLEELELIENAVTSRLRRNPEIFYRNIDEVDLVEHSGRFDHIPSSQKSANK 60

Query: 59  XXXXXXXXXXXXXXXXXXHEINIFLRDYQEKQQTFNKINRPEETQEDDKDLPNFERKLQQ 118
                             HEI  FL  Y +  Q+  ++    +  E   D  +  + L+ 
Sbjct: 61  VYTVKKSRRSRKQILAQEHEIKSFLSQYLKDCQSLGRVEF--DMSEYRVDNGSVNKLLEH 118

Query: 119 LE--KELKNEDENFELDINSKKDKYALFSSSSDPSRRTNILSDRARDLDLNEIFTRDEQY 176
           +E  KE+  +D+ F        D+YA+FSSS+ PS + NI+S +A++LD+N  FTRDEQY
Sbjct: 119 IERIKEIHPKDDEF-------GDQYAMFSSST-PSNK-NIISRKAQNLDINSYFTRDEQY 169

Query: 177 GEYMELEQFHSLWLNVIKRGDCSXXXXXXXXXXXXXXXKYLLTPPMDRKNDRYMAFLLKL 236
           GEY++LE FH  WL+V+K GD +               +YLL P ++R + RY  F+  L
Sbjct: 170 GEYLDLEPFHQKWLSVVKNGDVTLLQFLSEVEKFTDQ-RYLLQPAVNRNSSRYREFVASL 228

Query: 237 SKYVETFFFKSYALLDAAAVENLIKSDFEHSYCRGSLRSEAKGIYCPFCSRWFKTSSVFE 296
             Y+  +  ++Y LL    + +    +  H+     + S   G++C  C + FKT +V+ 
Sbjct: 229 HHYLSDYAARAYPLLSWDLI-HAKAQELYHTNVAKPIPSGESGVFCIPCDKRFKTDTVYN 287

Query: 297 SHLVGKIHKKNESKRRNFVYSEYKLHRYLKYLNDEFSRTRSFVERKLAFTANERMAEMDI 356
           +HL GK H  N  K  +F+  E+ LH + +YL+ E +RTR FVERKLAFT  ER  E++ 
Sbjct: 288 AHLPGKRHVGNLHKNSSFLTQEHSLHIFCRYLSRELARTREFVERKLAFTTEERTQELER 347

Query: 357 LTQKYEAPAYDSTEKEGAEQVDGEQRDGQLQEEHLSGKSFDMPLGPDGLPMPYWLYKLHG 416
           LT  Y++P Y   E+E A++   E ++ + +E+ +   S ++PLGPDG P+PYWLYKL G
Sbjct: 348 LTDIYDSPVYGRQEQEDAQE--DENKETEDKEDSVLDSSMNLPLGPDGFPIPYWLYKLQG 405

Query: 417 LDREYRCEICSNKVYNGRRTFERHFNEERHIYHLRCLGIEPSSVFKGITKIKEAQELWKN 476
           LD EY CE+C N VYNGRR F++HF E+RH++ LR LGIEPS+ FKG+TKI +A++LW +
Sbjct: 406 LDIEYPCELCGNFVYNGRRQFDKHFGEQRHVFGLRRLGIEPSASFKGVTKIDDAKQLWSH 465

Query: 477 MQGQSQLTSIAAVPPKPNPSQLKVPTXXXXXXXXXXGNVMSKKVYDELKKQGLV 530
           ++     TS   V  +    +L+V            GNVMSKKVYDELKKQGL+
Sbjct: 466 LRS----TSSGRVSSE---GKLEVEV------EDEDGNVMSKKVYDELKKQGLL 506

>Kwal_56.22799 s56 complement(284859..286454) [1596 bp, 531 aa] {ON}
           YDL030W (PRP9) - RNA splicing factor [contig 184] FULL
          Length = 531

 Score =  334 bits (856), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 195/536 (36%), Positives = 286/536 (53%), Gaps = 35/536 (6%)

Query: 1   MNLLETRRSLLXXXXXXXXXXXXXXQRNPELYYHYIQESSKVFPDTKLPRSSLIAENXXX 60
           M   E+ RS L              +RNPE++Y  + E   +  D K+   + I +N   
Sbjct: 25  MVTYESSRSTLEELELIEGAIAARLRRNPEIFYRNVDELKLITGDAKVDDYAEIEKNSNK 84

Query: 61  --XXXXXXXXXXXXXXXXHEINIFLRDYQEKQQTFNKIN-RPEETQEDDKDLPNFERKLQ 117
                             HEI +FL +Y++K ++   +       Q  D  +  F   ++
Sbjct: 85  IYSVRKTKRTRKQILAQEHEIQLFLEEYRKKSESLRNVEFDLRRYQVTDGSVDGFLEHIE 144

Query: 118 QLEKELKNEDENFELDINSKKDKYALFSSSSDPSRRTNILSDRARDLDLNEIFTRDEQYG 177
            +  E+ +       DI+   + Y +FS+S+  + R +ILS +AR LD+N  FTR+EQYG
Sbjct: 145 TINSEVPD-------DIDDSMENYTMFSNST--AARRDILSKKARALDINAKFTREEQYG 195

Query: 178 EYMELEQFHSLWLNVIKRGDCSXXXXXXXXXXXXXXXKYLLTPPMDRKNDRYMAFLLKLS 237
           E+++LE FH  WL+V+K G  S               ++LLTP ++R + RY  F+  L 
Sbjct: 196 EFLDLEPFHQQWLSVVKDGSVSLLQFLGEIEKFTTK-RFLLTPAVNRGSARYQDFVKALL 254

Query: 238 KYVETFFFKSYALLDAAAVENLIKSDFEHSYCRGSLRSEA---KGIYCPFCSRWFKTSSV 294
            Y++ +  ++Y L D     + I ++ + +YC      E     G++C  C + FK  +V
Sbjct: 255 CYLQDYLMRAYPLQDW----DKIHAEIQATYCDYKSHPEEAGDSGLFCIPCDKTFKAETV 310

Query: 295 FESHLVGKIHKKNESKRRNFVYSEYKLHRYLKYLNDEFSRTRSFVERKLAFTANERMAEM 354
           + +HL GK H  N +K+  F+  EYKLH    YL  E  RTR FVERKLAFT  ER  EM
Sbjct: 311 YLAHLTGKKHINNMNKKDEFLAQEYKLHMLCCYLVQELVRTREFVERKLAFTPEERRQEM 370

Query: 355 DILTQKYEAPAYDSTEKEGAEQVDGEQRDGQLQEEHLSGKSFDMPLGPDGLPMPYWLYKL 414
           + LT  YE+P Y   E+E   + D  Q+    QE+     SFD+PLGPDG P+PYWLYKL
Sbjct: 371 ERLTTVYESPVYGEQEQEDIAEAD--QKPTTNQEDSTPEPSFDLPLGPDGFPIPYWLYKL 428

Query: 415 HGLDREYRCEICSNKVYNGRRTFERHFNEERHIYHLRCLGIEPSSVFKGITKIKEAQELW 474
            GLD EY CE+C N +Y GRR F++HF E+RHI+ L+ LG++PS  FKG+T I + ++LW
Sbjct: 429 QGLDIEYPCEVCGNLIYKGRRQFDKHFTEQRHIFGLKRLGVDPSPSFKGVTSIDDVKQLW 488

Query: 475 KNMQGQSQLTSIAAVPPKPNPSQLKVPTXXXXXXXXXXGNVMSKKVYDELKKQGLV 530
            +++  S+ ++ A   PK                    GNVMSKKVY+ELKKQGL+
Sbjct: 489 AHLRSSSKASNAAG--PK-----------FEEEIEDEEGNVMSKKVYEELKKQGLI 531

>Ecym_3549 Chr3 complement(1038111..1039709) [1599 bp, 532 aa] {ON}
           similar to Ashbya gossypii AEL085W
          Length = 532

 Score =  330 bits (846), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 194/539 (35%), Positives = 288/539 (53%), Gaps = 16/539 (2%)

Query: 1   MNLLETRRSLLXXXXXXXXXXXXXXQRNPELYYHYIQESSKVFPDTK----LPRSSLIAE 56
           M+LLE +R++L               RNPE++Y YI E S V  D K    +P   + A 
Sbjct: 1   MSLLEEKRAILEELELIEDAISDRIARNPEVFYSYIHELSIVNSDEKVLSNIPNVDITA- 59

Query: 57  NXXXXXXXXXXXXXXXXXXXHEINIFLRDYQEKQQTFN--KINRPEETQEDDKDLPNFER 114
           N                   HEI+ FL  Y +  +  N  K +  +E ++ +++   F  
Sbjct: 60  NRVYMIKKSKRSRKQILLQQHEISKFLSYYLKNVKKLNGYKNDNVDEFKDHNQNFELFRD 119

Query: 115 KLQQLEKELKNED--ENFELDINSKKDKYALFSSSSDPSRRTNILSDRARDLDLNEIFTR 172
           ++Q+++++   E   E F+  + ++K +Y +FS+S+   ++ +ILS   + +D+N+ F+ 
Sbjct: 120 QIQRIKEKYAEESNSEAFDASLEARKYQYTMFSNSN--HQKKDILSLEGQSIDINKKFSW 177

Query: 173 DEQYGEYMELEQFHSLWLNVIKRGDCSXXXXXXXXXXXXXXXKYLLTPPMDRKNDRYMAF 232
           +E YGEY+ L+Q+H  +LN++K  + S                +L  PP+DR +  Y  F
Sbjct: 178 EEHYGEYLHLDQYHQEYLNIVKNANVSLLQFIGFLQTFCDH-GHLKNPPVDRNSKIYHGF 236

Query: 233 LLKLSKYVETFFFKSYALLDAAAVENLIKSDFEHSYCRGSLRSEAKGIYCPFCSRWFKTS 292
           L +L KYV +FF  ++ L++    +  IK+ F   Y    +   ++G  C  C +WFK  
Sbjct: 237 LERLLKYVNSFFESAFPLINHVQFQKRIKNSFV-EYTSTPIEDSSRGCLCVACGKWFKAI 295

Query: 293 SVFESHLVGKIHKKNESKRRNFVYSEYKLHRYLKYLNDEFSRTRSFVERKLAFTANERMA 352
           +V+ SHL G+ H  N   RR  +  EY L      LN E   T+SFVERK AFT  ER+ 
Sbjct: 296 TVYTSHLQGRKHLNNLKCRRRSLMVEYTLQNLFTCLNKELVSTKSFVERKYAFTVEERIQ 355

Query: 353 EMDILTQKYEAPAYDSTEKEGAEQVDGEQRDGQLQEEHLSGKSFDMPLGPDGLPMPYWLY 412
           E+  L   Y A AY   E+E +++        +   +       ++PLGPDG P+PYWLY
Sbjct: 356 ELAKLRDAYNANAYGDHEREDSQEDLSVSSSKETPPD--DNNPLNLPLGPDGYPIPYWLY 413

Query: 413 KLHGLDREYRCEICSNKVYNGRRTFERHFNEERHIYHLRCLGIEPSSVFKGITKIKEAQE 472
           KL GLD EY CEIC N +Y GRR FERHF+E+RH Y LRCLGIEP+S FKGI+KI +AQ 
Sbjct: 414 KLQGLDIEYTCEICGNHLYKGRRVFERHFHEQRHTYGLRCLGIEPTSTFKGISKISDAQI 473

Query: 473 LWKNMQGQSQLTSIAAVPPKPNPSQLKVPTXXXXXXXX-XXGNVMSKKVYDELKKQGLV 530
           LW  ++  S L S +A  P    S+  V             GNVMS +VY++LKKQGL+
Sbjct: 474 LWSRLKNNSHLNSASATYPDATSSRAVVTNNKLEIEMEDEDGNVMSHRVYEDLKKQGLL 532

>CAGL0K01573g Chr11 (139809..141359) [1551 bp, 516 aa] {ON} similar
           to uniprot|P19736 Saccharomyces cerevisiae YDL030w
           Pre-mRNA splicing factor PRP9
          Length = 516

 Score =  317 bits (812), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 193/544 (35%), Positives = 278/544 (51%), Gaps = 47/544 (8%)

Query: 4   LETRRSLLXXXXXXXXXXXXXXQRNPELYYHYIQESSKVFPDTKLPRSSLIAE---NXXX 60
           L+T RSLL              QRNPELYY Y      +  D  +P+  L  +   N   
Sbjct: 3   LDTVRSLLEDIEVIEDAISSRFQRNPELYYDYRIHLEGIRDD--IPKLGLDDDRMVNKIY 60

Query: 61  XXXXXXXXXXXXXXXXHEINIFLRDYQEKQQTFNKINRPEETQEDDKDLPNFERKLQQLE 120
                           +EIN FL D  +K +   K+    + + D     + E K + L+
Sbjct: 61  KARKHKRTLKQKRTQQYEINTFLDDIFKKNKYILKVRN--QLKSDGLKYKDSECKFELLK 118

Query: 121 K--------------ELKNEDENFELDINSKKDKYALFSSSSDPSRRTNILSDRARDLDL 166
           K               +   + +  LDI+   ++Y +   +        ++S+R   LD+
Sbjct: 119 KLLGDEPTEDEDEDDSISKSNSSRLLDIDETINRYNMNLGNG------KLVSERCSLLDI 172

Query: 167 NEIFTRDEQYGEYMELEQFHSLWLNVIKRGDCSXXXXXXXXXXXXXXXKYLLTPPMDRKN 226
           N IF +DEQ G  ++ E  +  WLN++K G  +               KYLL P MDRK 
Sbjct: 173 NTIFQKDEQDGFIIDFEPLYRRWLNIVKDGTLTYPKFISNLEKFIDDKKYLLDPVMDRKT 232

Query: 227 DRYMAFLLKLSKYVETFFFKSYALLDAAAVENLIKSDFEHSYCRGSLRSEAKGIYCPFCS 286
             Y  F+++   +VET +FK   LL+   ++  +  DFE+   +  + +E+   YC +C 
Sbjct: 233 KGYCEFVVEACDFVETQYFKRNILLNEEQIKGKLHRDFENHVTKAII-TESGIYYCLYCD 291

Query: 287 RWFKTSSVFESHLVGKIHKKNESKRRNFVYSEYKLHRYLKYLNDEFSRTRSFVERKLAFT 346
           + F ++ +++SH  GK H K+ S   +   +E+KLH Y+  + +EF  T+ +V+RK+AFT
Sbjct: 292 KMFNSAHIYDSHRTGKAHSKSVSNYHDSFRAEFKLHVYVSCMREEFENTKEYVDRKMAFT 351

Query: 347 ANERMAEMDILTQKYEAPAYDSTEKEGAEQVDGEQRDGQLQEEHLSGKSFDMPLGPDGLP 406
             ER+ EM+ LTQ+Y  P YD TEKEG  + D  +   + + + + G   DMPLGPDGLP
Sbjct: 352 NKERLEEMEKLTQEYHRPVYDPTEKEGDVEEDNSKSKTKDELKEMLGLGEDMPLGPDGLP 411

Query: 407 MPYWLYKLHGLDREYRCEICSNKVYNGRRTFERHFNEERHIYHLRCLGIEPSSVFKGITK 466
           +PYWLYKL GLD    CEIC N+VY G + F++HF+   H YHL+CLGIEPSS F+GITK
Sbjct: 412 IPYWLYKLQGLDVGQECEICGNQVYKGHKNFDKHFSGPTHTYHLKCLGIEPSSAFQGITK 471

Query: 467 IKEAQELWKNMQGQSQLTSIAAVPPKPNPSQLKVPTXXXXXXXXXXGNVMSKKVYDELKK 526
           IKEAQ LWK MQ  +       V  K                    GNVMSK +Y+ELKK
Sbjct: 472 IKEAQALWKQMQRNTTQELAEEVEDK-------------------EGNVMSKDIYEELKK 512

Query: 527 QGLV 530
           QGLV
Sbjct: 513 QGLV 516

>KNAG0K01120 Chr11 (218749..220332) [1584 bp, 527 aa] {ON} Anc_3.160
           YDL030W
          Length = 527

 Score =  306 bits (785), Expect = 2e-97,   Method: Compositional matrix adjust.
 Identities = 186/544 (34%), Positives = 284/544 (52%), Gaps = 36/544 (6%)

Query: 4   LETRRSLLXXXXXXXXXXXXXXQRNPELYYHYIQESSKVFPDTK---LPRSSLIAENXXX 60
           L+ R SL+              QRNP LYY+ +    K+    +    P    + +N   
Sbjct: 3   LDERVSLIRQLEILEDAIAARFQRNPALYYNSVPMLKKLTMQAEPKVCPPQDHVTKNKVY 62

Query: 61  XXXXXXXXXXXXXXXXHEINIFLRDYQEKQQTFNKINRPEETQEDD---KDLPNFERKLQ 117
                           HEI +FL+D   +    NK++R +E+   +   K+L  F+  + 
Sbjct: 63  RVEKSARKVKQVATQQHEIKLFLQD---RTDILNKLSRAQESGPGESQYKNLDEFKTAIN 119

Query: 118 QL-EKELKNEDENFELDINSKKDKYALFSSSSDPSRRTNILSDRARDLDLNEIFTRDEQY 176
            L E  +          + S+KD+YA+FSSS +    TNILS RA +LD+N IF R+EQY
Sbjct: 120 GLTESNIPKRS-----GLQSEKDQYAMFSSSIEKPP-TNILSARALELDINAIFNREEQY 173

Query: 177 GEYMELEQFHSLWLNVIKRGDCSXXXXXXXXX----XXXXXXKYLLTPPMDRKNDRYMAF 232
           G Y++LE +H +WL ++K    +                    YL +PP+DR N +Y+ F
Sbjct: 174 GTYIQLENYHPMWLELMKEPSVTVLQYLESLERMFLNADDKTSYLTSPPIDRDNKQYLRF 233

Query: 233 LLKLSKYVETFFFKSYALLDAAAVENLIKSDFEHSYCRGSLRSEAKGIYCPFCSRWFKTS 292
           L +L  Y++T+  K + L+D   VE+ +   F++ Y    + ++    +CP C + ++  
Sbjct: 234 LERLGLYLKTYIAKKFPLIDQHLVEDYLLDHFKNRYVNKPVSTDQNTQFCPVCDKRYEGM 293

Query: 293 SVFESHLVGKIHKKNESKRRNFVYSEYKLHRYLKYLNDEFSRTRSFVERKLAFTANERMA 352
            +F  HL+ K H +   KR   + +E+++  YL  L+ EF  +++F+ERKLAFT  ER  
Sbjct: 294 QLFNDHLLNKFHAQQRGKRLPLLQAEFRVSVYLTALSKEFKDSKNFMERKLAFTYAERQE 353

Query: 353 EMDILTQKYEAPAYD-STEKEGAEQVDGEQRDGQLQEEH-----LSGKSFDMPLGPDGLP 406
           E+  LT +YEAP Y+ + E E       + ++G+   E+     L     +MPLGPDG+P
Sbjct: 354 ELQRLTTEYEAPNYNPALEHEDNPAETDKNKNGKTHSENKQTAELESMFTNMPLGPDGMP 413

Query: 407 MPYWLYKLHGLDREYRCEICSNKVYNGRRTFERHFNEERHIYHLRCLGIEPSSVFKGITK 466
           +P WLYKL GLD +Y CEIC N  + GRR +++HF+E  H Y L+CLGI  S  F GI  
Sbjct: 414 IPLWLYKLQGLDVKYTCEICGNAEFKGRRAYQKHFHEPLHEYRLKCLGITRSKAFDGIAL 473

Query: 467 IKEAQELWKNMQGQSQLTSIAAVPPKPNPSQLKVPTXXXXXXXXXXGNVMSKKVYDELKK 526
           I+EAQELW  + G+S  TS  A        +++V            GNVMS+ VY +LK+
Sbjct: 474 IEEAQELWAKISGKS--TSARAGSDDSLKLEIEV--------EDEDGNVMSQTVYQDLKR 523

Query: 527 QGLV 530
           QGL+
Sbjct: 524 QGLL 527

>AEL085W Chr5 (467583..469166) [1584 bp, 527 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YDL030W (PRP9)
          Length = 527

 Score =  302 bits (774), Expect = 7e-96,   Method: Compositional matrix adjust.
 Identities = 190/543 (34%), Positives = 282/543 (51%), Gaps = 29/543 (5%)

Query: 1   MNLLETRRSLLXXXXXXXXXXXXXXQRNPELYYHYIQESSKVFPDTKL---PRSSLIAEN 57
           M+ LE +R++L              +RNPE+YY Y++E   V PD K+        I  N
Sbjct: 1   MSSLEEKRAILEELEVIEGAISARIERNPEIYYSYLKELQLVNPDEKVLDNISKDDINSN 60

Query: 58  XXXXXXXXXXXXXXXXXXXHEINIFLRDYQEKQQTFN--KINRPEETQEDDKDLPNFERK 115
                              HEI  FL+ Y ++ +  N  K +  E  ++ + +   FE  
Sbjct: 61  RIYVNKKARRSRKQLILQQHEIARFLQRYWKQVKRLNAFKSDDIESLRDPNMNFETFEAD 120

Query: 116 LQQLEKELKNEDENFELDINS---KKDKYALFSSSSDPSRRTNILSDRARDLDLNEIFTR 172
           +++L+ E + E  + E  I+S   K+ +Y++FS+SS   +   ILS+  + +D+N++F  
Sbjct: 121 IKELQ-ERQAEGADSESAISSLERKRREYSMFSASSGADQ--TILSNVGQFIDVNKLFMW 177

Query: 173 DEQYGEYMELEQFHSLWLNVIKRGDCSXXXXXXXXXXXXXXXKYLLTPPMDRKNDRYMAF 232
           +E YGEY+ LE+ H  WLNV+K G  +                YL  PP+DR + RY  F
Sbjct: 178 EEHYGEYLFLERLHQDWLNVVKDGSVTLLQFIAFLESFAGT-GYLTAPPVDRNSKRYQVF 236

Query: 233 LLKLSKYVETFFFKSYALLDAAAVENLIKSDFEHSYCRGSLRSEAKGIYCPFCSRWFKTS 292
           + KL  Y+E  F  +Y LL+   +EN I   FE SY    +    +G+ C  C + FK  
Sbjct: 237 IQKLVTYLEGAFRNTYPLLNHRLLENRISQSFE-SYIANPVEDPPRGLLCIACGKHFKVG 295

Query: 293 SVFESHLVGKIHKKNESKRRNFVYSEYKLHRYLKYLNDEFSRTRSFVERKLAFTANERMA 352
           +VF  HL+GK H ++ + +   + +E+ LH  + YL      TR+ VERK AFT+ ER  
Sbjct: 296 TVFAGHLLGKKHAQSVTTKVATLRAEHTLHYLVIYLATSIENTRALVERKYAFTSGERNR 355

Query: 353 EMDILTQKYEAPAYDSTEKEGAEQVDGEQRDGQLQEEHLSGKSFDMPLGPDGLPMPYWLY 412
           EM  +   Y+APAY S E E   +   +Q++    + +      ++PLGP G P+PYWLY
Sbjct: 356 EMATIRDAYDAPAYSSGEPEDVIETPQQQQNAHPDDVN----PLNLPLGPMGYPIPYWLY 411

Query: 413 KLHGLDREYRCEICSNKVYNGRRTFERHFNEERHIYHLRCLGIEPSSVFKGITKIKEAQE 472
           KL GLD EY CEIC+N VY GRR     F      Y LRCLGIEPS  FK I  I EAQ+
Sbjct: 412 KLQGLDIEYACEICANHVYKGRRISNAIFRTA-PCYGLRCLGIEPSPAFKDIYNIAEAQQ 470

Query: 473 LWKNMQGQSQLTSIA-----AVPPKPNPSQLKVPTXXXXXXXXXXGNVMSKKVYDELKKQ 527
           L++++Q  +    +A     A+    N  +L+V            GNVM+ +VY++LKKQ
Sbjct: 471 LFQSLQSSTGPAGLATRRAGAISSSANTRKLEVEV------EDEDGNVMTHQVYEDLKKQ 524

Query: 528 GLV 530
           GL+
Sbjct: 525 GLL 527

>KLLA0F24662g Chr6 complement(2292807..2294399) [1593 bp, 530 aa]
           {ON} similar to uniprot|P19736 Saccharomyces cerevisiae
           YDL030W PRP9 Subunit of the SF3a splicing factor complex
           required for spliceosome assembly
          Length = 530

 Score =  235 bits (599), Expect = 5e-70,   Method: Compositional matrix adjust.
 Identities = 167/530 (31%), Positives = 249/530 (46%), Gaps = 11/530 (2%)

Query: 4   LETRRSLLXXXXXXXXXXXXXXQRNPELYYHYIQESSKVFPDTKLPRSSLIAENXXXXXX 63
            E RR +L              +RNPE++Y + +    +  +        ++ N      
Sbjct: 9   FEERRKILEELEVIEDAISSRLRRNPEIFYRFNEALHNLGVEAWAVPKLDVSANRIYRSK 68

Query: 64  XXXXXXXXXXXXXHEINIFLRDYQEKQQTFNKINRPEETQEDDKDLPNFERKLQQLEKEL 123
                        +EI +FL  Y+   ++  K    EE  E  +D      + + +  E+
Sbjct: 69  KSKRSRKQIKAQEYEIALFLGRYRRLLKSLQKHKLSEEHLEYFRDTNASFEQFETVTTEV 128

Query: 124 KNEDENFELDINSKKDKYALFSSSSDPSRRTNILSDRARDLDLNEIFTRDEQYGEYMELE 183
                N    +  K D Y +FS     S+  NI+S   + +DL+  F RDE +G Y++L 
Sbjct: 129 LEGQVNSRSLVEVKSD-YEMFSGPQAASK--NIISPIGQIIDLSRNFARDENFGTYLDLS 185

Query: 184 QFHSLWLNVIKRGDCSXXXXXXXXXXXXXXXKYLLTPPMDRKNDRYMAFLLKLSKYVETF 243
           +    WLN+IKR D +                YLL P +DR    Y   + +L KY + +
Sbjct: 186 EQFKKWLNIIKRADLTILSFLKMLESFETY-DYLLNPSLDRDTKEYNQLVTELLKYYKAY 244

Query: 244 FFKSYALLDAAAVENLIKSDFEHSYCRGSLRS---EAKGIYCPFCSRWFKTSSVFESHLV 300
           + K+Y L+D   +   I + F+     G   S   E+  +Y    +RWF + S F +H+ 
Sbjct: 245 YSKAYPLVDKEILSKTIHNGFDKYVRTGITESPSKESGKMYSVVFNRWFDSQSEFNTHVQ 304

Query: 301 GKIHKKNESKRRNFVYSEYKLHRYLKYLNDEFSRTRSFVERKLAFTANERMAEMDILTQK 360
            +      S+ R  +  EY  H + K+L+     T SF ERKLAFT  E   E++ L ++
Sbjct: 305 TEQFNIALSRNRKRLMKEYTFHCFSKFLSKVLQNTISFTERKLAFTDEEFTEELEKLQEQ 364

Query: 361 YEAPAYDSTEKEGAEQVDGEQRDGQLQEEHLSGKSFDMPLGPDGLPMPYWLYKLHGLDRE 420
           YE+P Y   E E          D   +E       +++PLGPDG P+P WL K+ GLD +
Sbjct: 365 YESPIYAKDESEDKPSYIDNAEDTAQKESMDPTNPYNLPLGPDGFPIPRWLIKVQGLDVK 424

Query: 421 YRCEICSNKVYNGRRTFERHFNEERHIYHLRCLGIEPSSVFKGITKIKEAQELWKNMQGQ 480
           Y CEIC N++Y+GRR FE+HF  ++H   L+ LGI PS  FK +T I E  ELWK +Q +
Sbjct: 425 YVCEICGNQIYHGRREFEKHFPLKKHSEGLKSLGITPSLAFKDVTTIVEVTELWKALQAK 484

Query: 481 SQLTSIAAVPPKPNPSQLKVPTXXXXXXXXXXGNVMSKKVYDELKKQGLV 530
           S L S     P    S +K P           GNVMS +VY+ELKKQGL+
Sbjct: 485 STLKS---GEPFSKISTVKEP-EMVLETEDNEGNVMSVQVYEELKKQGLL 530

>TBLA0B01600 Chr2 (352382..353842) [1461 bp, 486 aa] {ON} Anc_3.160
           YDL030W
          Length = 486

 Score = 81.3 bits (199), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 55/197 (27%), Positives = 82/197 (41%), Gaps = 8/197 (4%)

Query: 280 IYCPFCS-RWFKTSSVFESHLVGKIHKKNESKRRNFVYSEYKLHRYLKYLNDEFSRTRSF 338
           + C  C  + F T  VF  HL    H K E+ R   +     +   L+ L  E +   + 
Sbjct: 237 LTCIVCGPKKFATEQVFHHHLNSNRHLKREASRLPIMIPIQSVREKLQTLAAELASGAAR 296

Query: 339 VERKLAFTANERMAEMDILTQKYEAPAYDSTEKEGAEQVDGEQRDGQLQEEHLSGKSFDM 398
           VER+L  T  ER AE     Q+           +                   S  + ++
Sbjct: 297 VERQLNMTPQERFAE-HAAQQRIRTAVQGRGGGDTTATPSATPSATPAATTPASASTVEV 355

Query: 399 PLGPDGLPMPYWLYKLHGLDREYRCEICSNKVYNGRRTFERHFNEERHIYHLRCLGI--E 456
               DG  +P WLY+L GL   + CE+C  + ++GR  +ERHF   +H   L CLG+  E
Sbjct: 356 ----DGRHVPRWLYRLQGLSSIFTCELCDGREFHGRTRYERHFTSTQHRTRLVCLGVPAE 411

Query: 457 PSSVFKGITKIKEAQEL 473
               F+G+ K+    EL
Sbjct: 412 QHVQFRGLGKLDAVLEL 428

>SAKL0B00704g Chr2 (65060..65569) [510 bp, 169 aa] {ON} highly
           similar to gnl|GLV|KLLA0D05621g Kluyveromyces lactis
           KLLA0D05621g and similar to YLR074C uniprot|Q08004
           Saccharomyces cerevisiae YLR074C BUD20 Protein involved
           in bud-site selection diploid mutants display a random
           budding pattern instead of the wild-type bipolar pattern
          Length = 169

 Score = 38.9 bits (89), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 12/38 (31%), Positives = 25/38 (65%)

Query: 281 YCPFCSRWFKTSSVFESHLVGKIHKKNESKRRNFVYSE 318
           YC  C+++F+T+   ++HL GK+HK+   + +   Y++
Sbjct: 50  YCIHCAKYFETAMALKTHLKGKVHKRRVKELKGVPYTQ 87

>Kwal_14.1064 s14 (178979..179467) [489 bp, 162 aa] {ON} YLR074C
           (BUD20) -  [contig 244] FULL
          Length = 162

 Score = 37.4 bits (85), Expect = 0.030,   Method: Compositional matrix adjust.
 Identities = 12/38 (31%), Positives = 24/38 (63%)

Query: 281 YCPFCSRWFKTSSVFESHLVGKIHKKNESKRRNFVYSE 318
           YC  C+++F+T    ++HL GK+HK+   + +   Y++
Sbjct: 50  YCIHCAKYFETRIALKTHLKGKVHKRRVKELKGVPYTQ 87

>CAGL0K12804g Chr11 complement(1269506..1270024) [519 bp, 172 aa]
           {ON} similar to uniprot|Q08004 Saccharomyces cerevisiae
           YLR074c
          Length = 172

 Score = 37.0 bits (84), Expect = 0.042,   Method: Compositional matrix adjust.
 Identities = 12/38 (31%), Positives = 25/38 (65%)

Query: 281 YCPFCSRWFKTSSVFESHLVGKIHKKNESKRRNFVYSE 318
           YC  C+++F+T    ++HL GKIH++   + ++  Y++
Sbjct: 50  YCIHCAKYFETGIALKTHLKGKIHRRRVKELKSIPYTQ 87

>YLR074C Chr12 complement(281956..282456) [501 bp, 166 aa] {ON}
           BUD20Protein involved in bud-site selection; diploid
           mutants display a random budding pattern instead of the
           wild-type bipolar pattern
          Length = 166

 Score = 36.6 bits (83), Expect = 0.055,   Method: Compositional matrix adjust.
 Identities = 15/53 (28%), Positives = 30/53 (56%), Gaps = 8/53 (15%)

Query: 281 YCPFCSRWFKTSSVFESHLVGKIHKKNESKRRNFVYSE--------YKLHRYL 325
           YC  C+++ +T+   ++HL GK+HK+   + R   Y++        Y L+++L
Sbjct: 50  YCIHCAKYMETAIALKTHLKGKVHKRRVKELRGVPYTQEVSDAAAGYNLNKFL 102

>ABR234C Chr2 complement(841361..841888) [528 bp, 175 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YLR074C
           (BUD20)
          Length = 175

 Score = 36.6 bits (83), Expect = 0.062,   Method: Composition-based stats.
 Identities = 13/38 (34%), Positives = 25/38 (65%)

Query: 281 YCPFCSRWFKTSSVFESHLVGKIHKKNESKRRNFVYSE 318
           YC  C+++F+T +  ++HL GK+HK+   + R   Y++
Sbjct: 65  YCIHCAKYFETPAALKTHLKGKVHKRRVKELRGVPYTQ 102

>Ecym_1531 Chr1 complement(1094489..1095004) [516 bp, 171 aa] {ON}
           similar to Ashbya gossypii ABR234C
          Length = 171

 Score = 36.2 bits (82), Expect = 0.078,   Method: Composition-based stats.
 Identities = 13/38 (34%), Positives = 25/38 (65%)

Query: 281 YCPFCSRWFKTSSVFESHLVGKIHKKNESKRRNFVYSE 318
           YC  C+++F+T+   ++HL GKIHK+   + +   Y++
Sbjct: 50  YCIHCAKYFETAVALKTHLKGKIHKRRVKELKGVPYTQ 87

>Skud_12.139 Chr12 complement(266691..267185) [495 bp, 164 aa] {ON}
           YLR074C (REAL)
          Length = 164

 Score = 35.8 bits (81), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 14/53 (26%), Positives = 30/53 (56%), Gaps = 8/53 (15%)

Query: 281 YCPFCSRWFKTSSVFESHLVGKIHKKNESKRRNFVYSE--------YKLHRYL 325
           YC  C+++ +T+   ++HL GK+HK+   + +   Y++        Y L+++L
Sbjct: 50  YCIHCAKYMETAIALKTHLKGKVHKRRVKELKGVPYTQEVSDAAAGYNLNKFL 102

>NDAI0C06580 Chr3 complement(1519086..1519595) [510 bp, 169 aa] {ON}
           Anc_8.11 YLR074C
          Length = 169

 Score = 34.7 bits (78), Expect = 0.26,   Method: Compositional matrix adjust.
 Identities = 14/53 (26%), Positives = 30/53 (56%), Gaps = 8/53 (15%)

Query: 281 YCPFCSRWFKTSSVFESHLVGKIHKKNESKRRNFVYSE--------YKLHRYL 325
           YC  C+++F+T+   ++HL  K+HK+   + +   Y++        Y L+++L
Sbjct: 50  YCIHCAKYFETAIALKTHLKTKVHKRRVKELKGVPYTQEVADAAAGYNLNKFL 102

>Suva_10.158 Chr10 complement(283475..283984) [510 bp, 169 aa] {ON}
           YLR074C (REAL)
          Length = 169

 Score = 34.7 bits (78), Expect = 0.32,   Method: Composition-based stats.
 Identities = 15/58 (25%), Positives = 32/58 (55%), Gaps = 8/58 (13%)

Query: 281 YCPFCSRWFKTSSVFESHLVGKIHKKNESKRRNFVYSE--------YKLHRYLKYLND 330
           YC  C+++ +T+   ++HL GK+HK+   + +   Y++        Y L+++L  + D
Sbjct: 50  YCIHCAKYMETAIALKTHLKGKVHKRRVKELKGVPYTQEVSDAAAGYNLNKFLDRVKD 107

>KLTH0G19096g Chr7 complement(1649335..1649814) [480 bp, 159 aa]
           {ON} highly similar to uniprot|Q08004 Saccharomyces
           cerevisiae YLR074C BUD20 Protein involved in bud-site
           selection diploid mutants display a random budding
           pattern instead of the wild-type bipolar pattern
          Length = 159

 Score = 34.3 bits (77), Expect = 0.36,   Method: Composition-based stats.
 Identities = 12/38 (31%), Positives = 24/38 (63%)

Query: 281 YCPFCSRWFKTSSVFESHLVGKIHKKNESKRRNFVYSE 318
           YC  C+++F+T    ++HL GK+HK+   + +   Y++
Sbjct: 50  YCIHCAKYFETGVALKTHLKGKVHKRRVKELKGVPYTQ 87

>Kpol_1023.12 s1023 (24892..25383) [492 bp, 163 aa] {ON}
           (24892..25383) [492 nt, 164 aa]
          Length = 163

 Score = 33.5 bits (75), Expect = 0.64,   Method: Compositional matrix adjust.
 Identities = 11/38 (28%), Positives = 22/38 (57%)

Query: 281 YCPFCSRWFKTSSVFESHLVGKIHKKNESKRRNFVYSE 318
           YC  C+++ +TS   ++HL  K+HK+     +   Y++
Sbjct: 50  YCIHCAKYMETSMALKTHLKSKVHKRRVKDLKGVPYTQ 87

>Smik_12.134 Chr12 complement(261773..262273) [501 bp, 166 aa] {ON}
           YLR074C (REAL)
          Length = 166

 Score = 33.5 bits (75), Expect = 0.68,   Method: Composition-based stats.
 Identities = 14/58 (24%), Positives = 33/58 (56%), Gaps = 8/58 (13%)

Query: 281 YCPFCSRWFKTSSVFESHLVGKIHKKNESKRRNFVYSE--------YKLHRYLKYLND 330
           YC  C+++ +T+   ++HL GK+HK+   + ++  Y++        Y L+++L  + +
Sbjct: 50  YCIHCAKYMETAIALKTHLKGKVHKRRVKELKSVPYTQEVSDAAAGYNLNKFLNRVQE 107

>TBLA0D02350 Chr4 (594084..594539) [456 bp, 151 aa] {ON} Anc_8.11
           YLR074C
          Length = 151

 Score = 33.1 bits (74), Expect = 0.72,   Method: Compositional matrix adjust.
 Identities = 14/54 (25%), Positives = 28/54 (51%), Gaps = 8/54 (14%)

Query: 281 YCPFCSRWFKTSSVFESHLVGKIHKKNESKRRNFVYSE--------YKLHRYLK 326
           YC  C+++ +TS   ++HL  K+HK+     +   Y +        Y L+++L+
Sbjct: 50  YCIHCAKYMETSIALKTHLKTKVHKRRVKALKGVPYGQEVADAAAGYNLNKFLQ 103

>KLLA0D05621g Chr4 complement(486879..487382) [504 bp, 167 aa] {ON}
           similar to uniprot|Q08004 Saccharomyces cerevisiae
           YLR074C BUD20 Protein involved in bud-site selection
           diploid mutants display a random budding pattern instead
           of the wild-type bipolar pattern
          Length = 167

 Score = 32.7 bits (73), Expect = 1.2,   Method: Composition-based stats.
 Identities = 12/38 (31%), Positives = 24/38 (63%)

Query: 281 YCPFCSRWFKTSSVFESHLVGKIHKKNESKRRNFVYSE 318
           YC  C+++F+T+   ++HL  KIHK+   + +   Y++
Sbjct: 50  YCIHCAKYFETAYALKTHLKTKIHKRRVKELKGVPYTQ 87

>ZYRO0B15994g Chr2 complement(1297942..1299285) [1344 bp, 447 aa]
           {ON} similar to uniprot|O00022 Saccharomyces cerevisiae
           YOR059C Hypothetical ORF
          Length = 447

 Score = 33.1 bits (74), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 26/82 (31%), Positives = 35/82 (42%), Gaps = 6/82 (7%)

Query: 315 VYSEYKLHRYLKYLNDEFSRTRSFVERKLAFTANERMAEMDILTQKYEAPAYDSTEKEGA 374
           +YS    +RY K LND  +   S V ++L F  + R    D+    Y     D TE  G 
Sbjct: 287 IYSHLVNYRYRKILND--AAAPSMVRQRLQFNNSVREFTEDV----YRTILGDPTESVGG 340

Query: 375 EQVDGEQRDGQLQEEHLSGKSF 396
              DG      L E+ +S K F
Sbjct: 341 SNSDGALERSDLLEDSISWKEF 362

>KNAG0L00170 Chr12 (16874..17341) [468 bp, 155 aa] {ON} Anc_8.11
           YLR074C
          Length = 155

 Score = 32.0 bits (71), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 10/38 (26%), Positives = 23/38 (60%)

Query: 281 YCPFCSRWFKTSSVFESHLVGKIHKKNESKRRNFVYSE 318
           YC  C+++ +T+   ++HL  K+HK+   + +   Y++
Sbjct: 50  YCIHCAKYCETAIALKTHLKTKVHKRRVKELKGVPYTQ 87

>TDEL0C00340 Chr3 (45150..45635) [486 bp, 161 aa] {ON} Anc_8.11
           YLR074C
          Length = 161

 Score = 32.3 bits (72), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 14/53 (26%), Positives = 29/53 (54%), Gaps = 8/53 (15%)

Query: 281 YCPFCSRWFKTSSVFESHLVGKIHKKNESKRRNFVYSE--------YKLHRYL 325
           YC  C+++ +T+   ++HL  K HK+  S+ +   Y++        Y L+++L
Sbjct: 50  YCIHCAKYLETAIALKTHLKSKRHKRRVSELKGVPYTQETSDAAAGYNLNKFL 102

>TPHA0D00200 Chr4 (25129..25629) [501 bp, 166 aa] {ON} Anc_8.11
           YLR074C
          Length = 166

 Score = 32.0 bits (71), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 10/38 (26%), Positives = 23/38 (60%)

Query: 281 YCPFCSRWFKTSSVFESHLVGKIHKKNESKRRNFVYSE 318
           YC  C+++ +T+   ++HL  K+HK+   + +   Y++
Sbjct: 50  YCIHCAKYMETAIALKTHLKTKVHKRRVKELKEVPYTQ 87

>KAFR0D00860 Chr4 (182173..182670) [498 bp, 165 aa] {ON} Anc_8.11
           YLR074C
          Length = 165

 Score = 32.0 bits (71), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 13/53 (24%), Positives = 30/53 (56%), Gaps = 8/53 (15%)

Query: 281 YCPFCSRWFKTSSVFESHLVGKIHKKNESKRRNFVYSE--------YKLHRYL 325
           YC  C+++ +T+   ++HL  K+HK+   + ++  Y++        Y L+++L
Sbjct: 50  YCIHCAKYCETAIALKTHLKTKVHKRRVKELKSVPYTQEVADAAAGYNLNKFL 102

>YDL223C Chr4 complement(57265..60405) [3141 bp, 1046 aa] {ON}
           HBT1Substrate of the Hub1p ubiquitin-like protein that
           localizes to the shmoo tip (mating projection); mutants
           are defective for mating projection formation, thereby
           implicating Hbt1p in polarized cell morphogenesis
          Length = 1046

 Score = 32.7 bits (73), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 16/42 (38%), Positives = 28/42 (66%), Gaps = 2/42 (4%)

Query: 147 SSDPSRRTNILSDRARDLDLNEIFTRDEQYG-EYM-ELEQFH 186
           S+D + R N++S   +D D+NE  T+  QYG +Y+ ++E +H
Sbjct: 572 SNDATTRNNVVSPAMKDEDMNEDSTKPHQYGLDYLDDVEDYH 613

>TBLA0G00170 Chr7 complement(26304..28283) [1980 bp, 659 aa] {ON}
           Anc_2.15 YNL227C
          Length = 659

 Score = 32.3 bits (72), Expect = 3.6,   Method: Compositional matrix adjust.
 Identities = 17/51 (33%), Positives = 26/51 (50%), Gaps = 10/51 (19%)

Query: 282 CPFCSRWFKTSSVFESHLVGKIHKKNESKRRNFVYSEYKLHRYLKYLNDEF 332
           C  C++ FK+    E+HL  ++HKKN           YK+ + +K  N EF
Sbjct: 355 CDICNKIFKSLKQLENHLSTRMHKKN----------VYKIQKQMKKENIEF 395

>NCAS0J00260 Chr10 (35339..35851) [513 bp, 170 aa] {ON} Anc_8.11
           YLR074C
          Length = 170

 Score = 31.2 bits (69), Expect = 4.3,   Method: Compositional matrix adjust.
 Identities = 10/38 (26%), Positives = 23/38 (60%)

Query: 281 YCPFCSRWFKTSSVFESHLVGKIHKKNESKRRNFVYSE 318
           YC  C+++ +T+   ++HL  K+HK+   + +   Y++
Sbjct: 50  YCIHCAKYCETAIALKTHLKTKVHKRRVKELKGVPYTQ 87

>Ecym_6231 Chr6 (431597..432946) [1350 bp, 449 aa] {ON} similar to
           Ashbya gossypii AER341W
          Length = 449

 Score = 31.6 bits (70), Expect = 5.9,   Method: Compositional matrix adjust.
 Identities = 14/35 (40%), Positives = 20/35 (57%), Gaps = 5/35 (14%)

Query: 421 YRCEICSNK-----VYNGRRTFERHFNEERHIYHL 450
           YRC+IC +K     +  G+R +E H    RH Y+L
Sbjct: 403 YRCDICRDKDQQPLIAIGKRNWELHLTSRRHRYNL 437

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.317    0.134    0.391 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 54,315,024
Number of extensions: 2433390
Number of successful extensions: 14398
Number of sequences better than 10.0: 149
Number of HSP's gapped: 14957
Number of HSP's successfully gapped: 152
Length of query: 530
Length of database: 53,481,399
Length adjustment: 114
Effective length of query: 416
Effective length of database: 40,409,475
Effective search space: 16810341600
Effective search space used: 16810341600
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 68 (30.8 bits)