Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
YDL027C3.164ON42042019230.0
Smik_4.2083.164ON41742113850.0
Skud_4.2243.164ON40841912861e-176
Suva_4.2223.164ON41642812461e-170
ZYRO0B04862g3.164ON4082483062e-30
SAKL0C07392g3.164ON3611892561e-23
TDEL0D045903.164ON3762442561e-23
Kwal_33.141793.164ON3741752198e-19
KLTH0F06512g3.164ON3702392181e-18
NCAS0I020703.164ON4232531862e-14
KAFR0F022103.164ON3572441763e-13
Kpol_1045.433.164ON3822501666e-12
TPHA0P006703.164ON3801841373e-08
KLLA0C03872g3.164ON376234980.001
Smik_6.728.69ON214364705.1
NOTE: 2 genes in the same pillar as YDL027C were not hit in these BLAST results
LIST: KNAG0K01730 CAGL0K01639g

BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= YDL027C
         (420 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

YDL027C Chr4 complement(403695..404957) [1263 bp, 420 aa] {ON} P...   745   0.0  
Smik_4.208 Chr4 complement(383879..385132) [1254 bp, 417 aa] {ON...   538   0.0  
Skud_4.224 Chr4 complement(398578..399804) [1227 bp, 408 aa] {ON...   499   e-176
Suva_4.222 Chr4 complement(394220..395470) [1251 bp, 416 aa] {ON...   484   e-170
ZYRO0B04862g Chr2 (391162..392388) [1227 bp, 408 aa] {ON} weakly...   122   2e-30
SAKL0C07392g Chr3 complement(682073..683158) [1086 bp, 361 aa] {...   103   1e-23
TDEL0D04590 Chr4 (841954..843084) [1131 bp, 376 aa] {ON} Anc_3.1...   103   1e-23
Kwal_33.14179 s33 complement(559209..560333) [1125 bp, 374 aa] {...    89   8e-19
KLTH0F06512g Chr6 complement(563724..564836) [1113 bp, 370 aa] {...    89   1e-18
NCAS0I02070 Chr9 (388867..390138) [1272 bp, 423 aa] {ON} Anc_3.1...    76   2e-14
KAFR0F02210 Chr6 (431088..432161) [1074 bp, 357 aa] {ON} Anc_3.1...    72   3e-13
Kpol_1045.43 s1045 complement(101542..102690) [1149 bp, 382 aa] ...    69   6e-12
TPHA0P00670 Chr16 (137985..139127) [1143 bp, 380 aa] {ON} Anc_3....    57   3e-08
KLLA0C03872g Chr3 complement(353385..354515) [1131 bp, 376 aa] {...    42   0.001
Smik_6.72 Chr6 (136688..143119) [6432 bp, 2143 aa] {ON} YFL007W ...    32   5.1  

>YDL027C Chr4 complement(403695..404957) [1263 bp, 420 aa] {ON}
           Putative protein of unknown function; the authentic,
           non-tagged protein is detected in highly purified
           mitochondria in high-throughput studies; YDL027C is not
           an essential gene
          Length = 420

 Score =  745 bits (1923), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 377/420 (89%), Positives = 377/420 (89%)

Query: 1   MFKVPVGLASRTRELMNSVTLNSLNNGKGFNMYLPGILRAFPKPVPSAITSPAIPKYRGE 60
           MFKVPVGLASRTRELMNSVTLNSLNNGKGFNMYLPGILRAFPKPVPSAITSPAIPKYRGE
Sbjct: 1   MFKVPVGLASRTRELMNSVTLNSLNNGKGFNMYLPGILRAFPKPVPSAITSPAIPKYRGE 60

Query: 61  SFQFRKLSCISSNYCSTTHQFLSSLKSSTSRLVGKRAFHSSRRAEIKFIFSSKSPKNGNK 120
           SFQFRKLSCISSNYCSTTHQFLSSLKSSTSRLVGKRAFHSSRRAEIKFIFSSKSPKNGNK
Sbjct: 61  SFQFRKLSCISSNYCSTTHQFLSSLKSSTSRLVGKRAFHSSRRAEIKFIFSSKSPKNGNK 120

Query: 121 PFVKVYKVSPXXXXXXXXXXXXXXLTSTIVVXXXXXXXXXXXXXXXXXXXXXXXXXXXXX 180
           PFVKVYKVSP              LTSTIVV                             
Sbjct: 121 PFVKVYKVSPFFIIFATASIFTFILTSTIVVIPLIFHFFFPLLIMFFFFKQFKKWQKNIF 180

Query: 181 YKDVLTSLPKTKLKITLPTMRSLQLQPMVQSWKEISSRMGIPNEFAKGLNVDLVKQEETR 240
           YKDVLTSLPKTKLKITLPTMRSLQLQPMVQSWKEISSRMGIPNEFAKGLNVDLVKQEETR
Sbjct: 181 YKDVLTSLPKTKLKITLPTMRSLQLQPMVQSWKEISSRMGIPNEFAKGLNVDLVKQEETR 240

Query: 241 KQFLSFLQKRVLESFTKNELGIRSYFLGDSVEKWIKESYDLELDIDNCRSELRKFQTFIF 300
           KQFLSFLQKRVLESFTKNELGIRSYFLGDSVEKWIKESYDLELDIDNCRSELRKFQTFIF
Sbjct: 241 KQFLSFLQKRVLESFTKNELGIRSYFLGDSVEKWIKESYDLELDIDNCRSELRKFQTFIF 300

Query: 301 SSVRYKLYLDSMKNLPLNPSKKLEGKKHIADVYVIILDESFPAIMFNGGAYSKADFFKIL 360
           SSVRYKLYLDSMKNLPLNPSKKLEGKKHIADVYVIILDESFPAIMFNGGAYSKADFFKIL
Sbjct: 301 SSVRYKLYLDSMKNLPLNPSKKLEGKKHIADVYVIILDESFPAIMFNGGAYSKADFFKIL 360

Query: 361 QESETSNSSKTLNTIIAIKSVNTLLSKHFVITTNGDSGEFFSKYNISKINDKNTEYTLKE 420
           QESETSNSSKTLNTIIAIKSVNTLLSKHFVITTNGDSGEFFSKYNISKINDKNTEYTLKE
Sbjct: 361 QESETSNSSKTLNTIIAIKSVNTLLSKHFVITTNGDSGEFFSKYNISKINDKNTEYTLKE 420

>Smik_4.208 Chr4 complement(383879..385132) [1254 bp, 417 aa] {ON}
           YDL027C (REAL)
          Length = 417

 Score =  538 bits (1385), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 282/421 (66%), Positives = 318/421 (75%), Gaps = 5/421 (1%)

Query: 1   MFKVPVGLASRTRELMNSVTLNSLNNGKGFNMYLPGILRAFPKPVPSAITSPAIPKYRGE 60
           M ++P+GL S TR   N+   N   N   FN +LP  L   PKPV  A+  P+I KY  E
Sbjct: 1   MLRIPLGLVSITRPATNTALFN---NTIRFNAFLPRKLGNSPKPVSLAVIFPSISKYARE 57

Query: 61  SFQFRKL-SCISSNYCSTTHQFLSSLKSSTSRLVGKRAFHSSRRAEIKFIFSSKSPKNGN 119
            FQ R++ S +SSNYCS  HQFLS+  S +S+L+ KRAFHS+R AEIKF F S+S +N N
Sbjct: 58  GFQPRRIFSLMSSNYCSCPHQFLSNSMSLSSKLISKRAFHSTRHAEIKFSFFSRSHRNNN 117

Query: 120 KPFVKVYKVSPXXXXXXXXXXXXXXLTSTIVVXXXXXXXXXXXXXXXXXXXXXXXXXXXX 179
           KPFVKVYKVSP              LTSTI+V                            
Sbjct: 118 KPFVKVYKVSPFFILFATASIFTFILTSTIIVIPFIFHFFFPLLIMLVFFKQFKKWQNNT 177

Query: 180 XYKDVLTSLPKTKLKITLPTMRSLQLQPMVQSWKEISSRMGIPNEFAKGLNVDLVKQEET 239
            YKD+L SLPKT+LKIT+PTMRSLQLQPM+QSW+EISSRMGIPNEFAKGLNVDL KQ+ET
Sbjct: 178 FYKDILISLPKTELKITVPTMRSLQLQPMIQSWREISSRMGIPNEFAKGLNVDLEKQDET 237

Query: 240 RKQFLSFLQKRVLESFTKNELGIRSYFLGDSVEKWIKESYDLELDIDNCRSELRKFQTFI 299
           RKQFLSFLQKRVLESFTKNE+GIRSYFLGD VEKWI+ESYDLELDIDNCRSELRKFQ F+
Sbjct: 238 RKQFLSFLQKRVLESFTKNEMGIRSYFLGDRVEKWIEESYDLELDIDNCRSELRKFQNFV 297

Query: 300 FSSVRYKLYLDSMKNLPLNPSKKLEGKKHIADVYVIILDESFPAIMFNGGAYSKADFFKI 359
           FSSVRY+LYLDS+K LPLNPSKK EGKKHIADVYVIILDESFP IMF+G  YSKADFFKI
Sbjct: 298 FSSVRYRLYLDSIKKLPLNPSKKFEGKKHIADVYVIILDESFPEIMFSGEGYSKADFFKI 357

Query: 360 LQESETSNSSKTLNTIIAIKSVNTLLSKHFVITTNGDSGEFFSKYNISKINDKNTEYTLK 419
           L+ESET+NSSK LN IIAIKSVN  LS HFVIT NGDSG FFSKY+I+KI+ KNTEYTL+
Sbjct: 358 LRESETANSSKMLNMIIAIKSVNP-LSSHFVITANGDSGNFFSKYHITKIDGKNTEYTLR 416

Query: 420 E 420
           E
Sbjct: 417 E 417

>Skud_4.224 Chr4 complement(398578..399804) [1227 bp, 408 aa] {ON}
           YDL027C (REAL)
          Length = 408

 Score =  499 bits (1286), Expect = e-176,   Method: Compositional matrix adjust.
 Identities = 266/419 (63%), Positives = 304/419 (72%), Gaps = 12/419 (2%)

Query: 1   MFKVPVGLASRTRELMNSVTLNSLNNGKGFNMYLPGILRAFPKPVPSAITSPAIPKYRGE 60
           MF++P+GL S TR + N++  NS        ++    LR          +  A+PK+  E
Sbjct: 1   MFRLPLGLTSWTRAVSNNIPCNSAG------IFNRCSLRQL------GTSYRALPKHGME 48

Query: 61  SFQFRKLSCISSNYCSTTHQFLSSLKSSTSRLVGKRAFHSSRRAEIKFIFSSKSPKNGNK 120
            FQ  KLS IS  Y S   + + S  SS  +   KR FHSS RAEIKF+FSS+SPKNG+K
Sbjct: 49  GFQSYKLSLISHKYRSYPLKAVFSPVSSIFKFTSKRTFHSSARAEIKFMFSSRSPKNGDK 108

Query: 121 PFVKVYKVSPXXXXXXXXXXXXXXLTSTIVVXXXXXXXXXXXXXXXXXXXXXXXXXXXXX 180
           P VK+YKVSP              LTSTI+V                             
Sbjct: 109 PLVKIYKVSPFFIIFATASLFTFILTSTIIVIPFVLHFFFPLLIIFIFFKQFKKWQKNIF 168

Query: 181 YKDVLTSLPKTKLKITLPTMRSLQLQPMVQSWKEISSRMGIPNEFAKGLNVDLVKQEETR 240
           YKD+L+SLP+T+LKI +PTMRSLQLQPMVQSWK+ISSRMGIPNEFAKGLNVDLVKQ ETR
Sbjct: 169 YKDILSSLPRTELKIAVPTMRSLQLQPMVQSWKDISSRMGIPNEFAKGLNVDLVKQNETR 228

Query: 241 KQFLSFLQKRVLESFTKNELGIRSYFLGDSVEKWIKESYDLELDIDNCRSELRKFQTFIF 300
           KQFLSFLQKRVLESFTKNE+G+RSYFLGD+VEKWI+ SYDLELDID+CRSELRKFQ  IF
Sbjct: 229 KQFLSFLQKRVLESFTKNEMGVRSYFLGDNVEKWIENSYDLELDIDSCRSELRKFQESIF 288

Query: 301 SSVRYKLYLDSMKNLPLNPSKKLEGKKHIADVYVIILDESFPAIMFNGGAYSKADFFKIL 360
           SSVRYKLYLDSMKN PL+PSK LEGK+HIADVYVIILDESFP IMFNGG YSKADFFKIL
Sbjct: 289 SSVRYKLYLDSMKNSPLSPSKNLEGKRHIADVYVIILDESFPEIMFNGGGYSKADFFKIL 348

Query: 361 QESETSNSSKTLNTIIAIKSVNTLLSKHFVITTNGDSGEFFSKYNISKINDKNTEYTLK 419
           QESET+NSSKT N IIAIKSVNT LSKHFVIT  GDSG+FFSKY IS ++  +TEYTL+
Sbjct: 349 QESETANSSKTHNMIIAIKSVNTPLSKHFVITAKGDSGDFFSKYQISNVDGSHTEYTLR 407

>Suva_4.222 Chr4 complement(394220..395470) [1251 bp, 416 aa] {ON}
           YDL027C (REAL)
          Length = 416

 Score =  484 bits (1246), Expect = e-170,   Method: Compositional matrix adjust.
 Identities = 262/428 (61%), Positives = 310/428 (72%), Gaps = 20/428 (4%)

Query: 1   MFKVPVGLASRTRELMNSVTLNS--LNNGKGFNMY------LPGILRAFPKPVPSAITSP 52
           M ++P+GL  R R + N    NS  L N   F         LP +LR     +PS  TS 
Sbjct: 1   MSRLPLGLVIRARAVANIQPFNSTRLFNPCSFRQLSVSSKVLP-LLR-----LPSTCTSS 54

Query: 53  AIPKYRGESFQFRKLSCISSNYCSTTHQFLSSLKSSTSRLVGKRAFHSSRRAEIKFIFSS 112
            I     E  +  KLS +S N  S   + +S+  +S  +L  KRAFHSS  A+IKF+FS 
Sbjct: 55  GI-----EGHKSYKLSSLSHNCGSYLFRPVSNPVNSIFKLTNKRAFHSSPHAQIKFMFS- 108

Query: 113 KSPKNGNKPFVKVYKVSPXXXXXXXXXXXXXXLTSTIVVXXXXXXXXXXXXXXXXXXXXX 172
           +SPKNG+KP VK+YKVSP              LTST++V                     
Sbjct: 109 RSPKNGDKPIVKIYKVSPLLILFTTVSLFTFILTSTMIVIPFIFHFFFPFLIMFIFFKQF 168

Query: 173 XXXXXXXXYKDVLTSLPKTKLKITLPTMRSLQLQPMVQSWKEISSRMGIPNEFAKGLNVD 232
                   YKD+L SLP+T+LKIT+PTMRSLQ+QPM+QSWK+ISSRMGIPNEFAKGLNVD
Sbjct: 169 KRWQKNVFYKDILNSLPRTELKITVPTMRSLQMQPMIQSWKDISSRMGIPNEFAKGLNVD 228

Query: 233 LVKQEETRKQFLSFLQKRVLESFTKNELGIRSYFLGDSVEKWIKESYDLELDIDNCRSEL 292
           LVKQ+ETRKQFLSFL+KRVLESFTKNE+GIRSYFLGD+VEKWIKESYDLELDI+NCRSEL
Sbjct: 229 LVKQDETRKQFLSFLEKRVLESFTKNEMGIRSYFLGDNVEKWIKESYDLELDIENCRSEL 288

Query: 293 RKFQTFIFSSVRYKLYLDSMKNLPLNPSKKLEGKKHIADVYVIILDESFPAIMFNGGAYS 352
           RKFQ  IF+SV+YKLYLDSMK+LPLNPSKK EGKKH+ADVYVIILD+SFP IMFNGG YS
Sbjct: 289 RKFQDSIFASVQYKLYLDSMKDLPLNPSKKFEGKKHLADVYVIILDKSFPEIMFNGGGYS 348

Query: 353 KADFFKILQESETSNSSKTLNTIIAIKSVNTLLSKHFVITTNGDSGEFFSKYNISKINDK 412
           KADFFKILQESET+NS+K  NTIIA+KSVNT LS HF+IT  GDSG+FFSKY++SK++ K
Sbjct: 349 KADFFKILQESETANSNKMHNTIIAVKSVNTPLSHHFIITAKGDSGDFFSKYHVSKVDGK 408

Query: 413 NTEYTLKE 420
           +TEYTL+E
Sbjct: 409 HTEYTLRE 416

>ZYRO0B04862g Chr2 (391162..392388) [1227 bp, 408 aa] {ON} weakly
           similar to uniprot|Q7LHC7 Saccharomyces cerevisiae
           YDL027C Hypothetical ORF
          Length = 408

 Score =  122 bits (306), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 74/248 (29%), Positives = 130/248 (52%), Gaps = 28/248 (11%)

Query: 181 YKDVLTSLPKTKLKITLPTMRSLQLQPMVQSWKEISS-RMGIPNEFAKGLNVDLVKQE-- 237
           +  +L  L K+++++   T+ ++ ++ + + +    +   G+  E  KG++  + +    
Sbjct: 177 FDQLLNGLKKSEMRLNSQTLNAMYVKSISKFFDAAQNPNAGVFEEIFKGVDAKMKRDGIW 236

Query: 238 ------ETRKQFLSFLQKRVLESFTKNELGIRSYFLGDSVEKWIKESYDLELDIDNCRSE 291
                     + LSF+Q RV+E+   +E GIR+YFLGD V  WIKE YD EL   +CRS 
Sbjct: 237 PNANNVSEADRLLSFVQSRVMEAIKSDEQGIRTYFLGDDVSNWIKEGYDFELGSSDCRSF 296

Query: 292 LRKFQTFIFSSVRYKLYLDSMKNLPLNPSKKLEGKKHIADVYVIILDESFPAIMFNGGAY 351
           +R F+  I   + Y +YL S              K+H+ADV V +L         +    
Sbjct: 297 VRGFKNEIIFWIVYPIYLKS----------STHPKRHLADVSVAVLQG-------HHAER 339

Query: 352 SKADFFKILQESETSNSSKTLNTIIAIKSVNTLLSKHFVITTNGDSGEFFSKYNISKIND 411
           +  DFF  L ++     +   N  I++KS +++L K FVI   G+SG+F++KY++ + +D
Sbjct: 340 NNYDFF--LVQTNLIRQNAKCNMAISVKSTSSILPKQFVIIDGGESGDFWTKYDVHENSD 397

Query: 412 KNTEYTLK 419
            +TEYT++
Sbjct: 398 GHTEYTIR 405

>SAKL0C07392g Chr3 complement(682073..683158) [1086 bp, 361 aa] {ON}
           some similarities with uniprot|Q7LHC7 Saccharomyces
           cerevisiae YDL027C Hypothetical ORF
          Length = 361

 Score =  103 bits (256), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 63/189 (33%), Positives = 90/189 (47%), Gaps = 26/189 (13%)

Query: 232 DLVKQEETR---KQFLSFLQKRVLESFTKNELGIRSYFLGDSVEKWIKESYDLELDIDNC 288
           D+   E  R   +Q L+FL+ RVLES   NE G+R +FLG  V+ WI++ YDL+LD   C
Sbjct: 194 DMWGDENDRLRSRQLLAFLESRVLESIRNNEDGVREFFLGTDVDSWIRDGYDLQLDTRIC 253

Query: 289 RSELRKFQTFIFSSVRYKLYLDSMKNLPLNPSKKLEGKKHIADVYVIILDESFPAIMFNG 348
            +  R     +  SV Y LYL S  N           ++ +ADV ++ LDE   A     
Sbjct: 254 GTTGRSIGGKLAMSVTYPLYLVSSTN-----------RRKLADVSIVFLDERLAA---GS 299

Query: 349 GAYSKADFFKILQESETSNSSKTLNTIIAIKSVNTLLSKHFVITTNGDSGEFFSKYNISK 408
           G Y   D          +   +    +I+I  V TL+ + F+I+T G SG   S+     
Sbjct: 300 GFYPPGDL---------AGQDERCPMVISIVPVRTLVPRQFIISTPGASGNNASRLTQRT 350

Query: 409 INDKNTEYT 417
             D + EYT
Sbjct: 351 TRDGHREYT 359

>TDEL0D04590 Chr4 (841954..843084) [1131 bp, 376 aa] {ON} Anc_3.164
           YDL027C
          Length = 376

 Score =  103 bits (256), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 68/244 (27%), Positives = 126/244 (51%), Gaps = 24/244 (9%)

Query: 181 YKDVLTSLPKTKLKITLPTMRSLQLQPMVQSWKEISSRMGIPNEFAKGLNVDLVKQEET- 239
           ++D+L  L  + +K+   T+++L ++ + +  +       +  +  K  + DL  + +  
Sbjct: 149 FQDILRHLKTSTMKVNYNTVKALHVKSLDKIVRLEQQNAKVFEDLLKSFDADLRARLDKF 208

Query: 240 ----RKQFLSFLQKRVLESFTKNELGIRSYFLGDSVEKWIKESYDLELDIDNCRSELRKF 295
                 + L F+  R+LE+   NE GIR+YFLGD V +W++++Y LELD    ++  +  
Sbjct: 209 SSAKADKLLRFIDDRLLEAIETNEQGIRNYFLGDDVGRWVEDNYQLELDTTQYKTNAQVG 268

Query: 296 QTFIFSSVRYKLYLDSMKNLPLNPSKKLEGKKHIADVYVIILDESFPAIMFNGGAYSKAD 355
              +   + + LYL S  N           +KH+A+V + +L   F     NG     A+
Sbjct: 269 DGELIMLLVFPLYLKSNSN----------PRKHLANVSLALLQGLFEGT--NG-----AN 311

Query: 356 FFKILQESETSNSSKTLNTIIAIKSVNTLLSKHFVITTNGDSGEFFSKYNISKINDKNTE 415
           + + L  S  S +      +IA++ V    +K FVI+T+G SG+++SKY+  + +D +TE
Sbjct: 312 YLEFL--SSISETDAECQMVIAVQPVTNFSTKLFVISTDGRSGDWYSKYDSKEDSDGHTE 369

Query: 416 YTLK 419
           YT+K
Sbjct: 370 YTVK 373

>Kwal_33.14179 s33 complement(559209..560333) [1125 bp, 374 aa] {ON}
           YDL027C - Hypothetical ORF [contig 105] FULL
          Length = 374

 Score = 89.0 bits (219), Expect = 8e-19,   Method: Compositional matrix adjust.
 Identities = 57/175 (32%), Positives = 87/175 (49%), Gaps = 21/175 (12%)

Query: 242 QFLSFLQKRVLESFTKNELGIRSYFLGDSVEKWIKESYDLELDIDNCRSELRKFQTFIFS 301
             +SFL  R+LE+F  NE GIR YFLG  V+ W++  Y+L LD D+ R+  +  +     
Sbjct: 217 DMISFLDSRILEAFKSNEQGIRDYFLGADVKTWVENGYELSLDSDSPRTIGKSIEGTFVM 276

Query: 302 SVRYKLYLDSMKNLPLNPSKKLEGKKHIADVYVIILDESFPAIMFNGGAYSKADFFKILQ 361
           ++ Y LYL     L  N  KKL     +ADV V +L +S P          K   F ++Q
Sbjct: 277 TITYPLYL-----LSSNQRKKL-----LADVTVAVLGDSTPG---------KPSPFFLMQ 317

Query: 362 ESETSNSSKTLNTIIAIKSVNTLLSKHFVITTNGDSGEFFSKYNISKINDKNTEY 416
           E+   N  K    +I+IK    L +  F++    D+G   S+Y +   +D + E+
Sbjct: 318 ENFADN--KDCPMVISIKPARALNTNQFILDETDDNGNHPSRYTVKTTSDGHREF 370

>KLTH0F06512g Chr6 complement(563724..564836) [1113 bp, 370 aa] {ON}
           weakly similar to uniprot|Q7LHC7 Saccharomyces
           cerevisiae YDL027C Hypothetical ORF
          Length = 370

 Score = 88.6 bits (218), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 69/239 (28%), Positives = 115/239 (48%), Gaps = 29/239 (12%)

Query: 188 LPKTKLKITLPTMRSLQLQPMVQSWK-----EISSRMGIPNEFAKGLNVDLVKQEETRKQ 242
           L  TK+ I   T+  LQ Q M +S          S  G+ +E  +   +D    +    +
Sbjct: 150 LLATKMSINYKTVWGLQTQ-MFESLLGSDGFAAGSFRGVMDEI-RSQKIDAANSKRRADE 207

Query: 243 FLSFLQKRVLESFTKNELGIRSYFLGDSVEKWIKESYDLELDIDNCRSELRKFQTFIFSS 302
            L+FL +RVLE+F  NELG+R +FLG     W+K+ YDL L  D  R   +     +  +
Sbjct: 208 ALAFLDRRVLEAFKNNELGLRDFFLGSDASTWVKKGYDLSLATDTPRIRGQSINNSLVMT 267

Query: 303 VRYKLYLDSMKNLPLNPSKKLEGKKHIADVYVIILDESFPAIMFNGGAYSKADFFKILQE 362
           + Y LYL       L+ S++   +K IA V + +LD+S            +   FK ++E
Sbjct: 268 ISYPLYL-------LSSSQE---RKLIAYVAIGVLDDSMAG---------QTGSFKFVEE 308

Query: 363 SETSNSSKTLNTIIAIKSVNTLLSKHFVITTNGDS-GEFFSKYNISKINDKNTEYTLKE 420
             + N  K    +I+I+   +L +K FV+   G++ G+  S Y +   +D + E+T ++
Sbjct: 309 LASQN--KECPMVISIRPARSLYAKQFVLKDYGEARGKPTSAYYVRTADDGHREFTYRD 365

>NCAS0I02070 Chr9 (388867..390138) [1272 bp, 423 aa] {ON} Anc_3.164
           YDL027C
          Length = 423

 Score = 76.3 bits (186), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 71/253 (28%), Positives = 115/253 (45%), Gaps = 38/253 (15%)

Query: 181 YKDVLTSL---PKTKLKITLPTMRSLQLQPMVQSWKEISSRMGIPNEFAKGLNVDLVKQE 237
           YK +L  L    K  + I   T+ SLQ + +       +S+   P+     +N  +    
Sbjct: 196 YKQLLAHLKNKSKGHMSIKYSTLNSLQYKILNDISFMKNSQGFKPDILNMKMNDFINSNA 255

Query: 238 ETRKQFLSFLQKRVLESFTKNELGIRSYFLG-----DSVEKWIKESYDLELDIDNCRSEL 292
              +  L+ LQ R++E+   +ELGIR+YFLG     ++V  W+ E  D ELD  N  S+ 
Sbjct: 256 RDSEALLNLLQSRIMEAIETDELGIRTYFLGAADNINNVTHWVNEGLDFELDTKNSISKG 315

Query: 293 RKFQTFIFSSVRYKLYLDSMKNLPLNPSKKLEGKKHIADVYVIILDESFPAIMFNGGAYS 352
           +     +  SV Y LYL S+K+           K+ IA+V +++LDES            
Sbjct: 316 KLVNGEMILSVTYALYLKSLKS----------PKRRIAEVSIVVLDES----------VE 355

Query: 353 KADFFKILQESETSNSSKTLNTIIAIKSVNTLLSK-----HFVITTNGDSGEFFSKYNIS 407
           K   F  +  ++ + ++K+   + AIK V   LS       F++   G SG   S Y++ 
Sbjct: 356 KNHVF--ISINDLAKTNKSCPMVFAIKPVKIDLSLLLQPFQFILDDYGRSG---SNYDVY 410

Query: 408 KINDKNTEYTLKE 420
                N E+ L+E
Sbjct: 411 NTKSGNREFRLRE 423

>KAFR0F02210 Chr6 (431088..432161) [1074 bp, 357 aa] {ON} Anc_3.164
           YDL027C
          Length = 357

 Score = 72.4 bits (176), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 67/244 (27%), Positives = 119/244 (48%), Gaps = 46/244 (18%)

Query: 181 YKDVLTSLPKTKLKITLPTMRSLQLQPMVQSWKEISSRMGIPNEFAKGLNVDLVKQEETR 240
           +  +   L +T L I   T+ SLQ   + +  K+      +P  +    N D+   E   
Sbjct: 155 FDQIFRGLGRTNLSIKYKTLNSLQYNYVPKILKK-----SVPKSWYT--NEDISDAE--- 204

Query: 241 KQFLSFLQKRVLESFTKNELGIRSYFL--GDSVEKWIKESYDLELDIDNCRSE--LRKFQ 296
              LSF++ RV+E+F KNE+GI  YFL  G + +       DL L ID   S+  +R+  
Sbjct: 205 -ILLSFIKLRVIEAFKKNEMGISDYFLRRGQNFD-------DLSLLIDKENSQFLIRRLA 256

Query: 297 TFIFSSVRYKLYLDSMKNLPLNPSKKLEGKKHIADVYVIILDESFPAIMFNGGAYSKADF 356
                ++R++L L + +N+ +          ++ADV + +LD+S           S+   
Sbjct: 257 GNFIVTMRHQLLLKN-ENVDI----------YLADVMISVLDDS-----------SQTGI 294

Query: 357 FKILQESETSNSSKTLNTIIAIKSVNTLLSKHFVITTNGDSGEFFSKYNISKINDKNTEY 416
           F  L+E   SN  K+   +I++ S + +L + FVIT  G++G+F+ K+ +S   D + E+
Sbjct: 295 FMPLKELAKSN--KSCKMVISVVSNSDILPRQFVITDEGETGKFYGKFTVSHGKDGHREF 352

Query: 417 TLKE 420
            + +
Sbjct: 353 RIDD 356

>Kpol_1045.43 s1045 complement(101542..102690) [1149 bp, 382 aa]
           {ON} complement(101544..102692) [1149 nt, 383 aa]
          Length = 382

 Score = 68.6 bits (166), Expect = 6e-12,   Method: Compositional matrix adjust.
 Identities = 69/250 (27%), Positives = 118/250 (47%), Gaps = 43/250 (17%)

Query: 187 SLPKTKLKITLPTMRSLQ---LQPMVQS-WKEISSRMGIPNEFAKGLNVDL-----VKQE 237
            L  + L+  + TM ++    L+ M+ +  K+  S  GI NE    + ++      ++  
Sbjct: 160 GLKNSHLRTRMSTMYAIHTKNLEEMLHNEAKQFGSYGGIFNETLNAMKMNPMYKNSIEFN 219

Query: 238 ETRKQFLSFLQKRVLESFTKNELGIRSYFLGDSVEKWIKESYD--LELDIDNCRSELRKF 295
           E+ ++  +F++ RV+E+  KNE GIR+  L  + EK +  + D    LD +N  S    F
Sbjct: 220 ESGEKLRNFIEYRVIEAIYKNEEGIRTT-LFHNYEKALDPNIDKPFRLDFNNVNS----F 274

Query: 296 QTF-----IFSSVRYKLYLDSMKNLPLNPSKKLEGKKHIADVYVIILDESFPAIMFNGGA 350
           Q F     + SSV Y LY     NL   P+        +  V ++ +++    I    G 
Sbjct: 275 QRFEKDGSLISSVTYPLY----TNLKDKPAVV------VGYVSIVTMNDHPLRINLGSGD 324

Query: 351 YSKADFFKILQESETSNSSKTLNTIIAIKSVNTLLSKHFVITTNGDSGEFFSKYNISKIN 410
             K D             SK L  II+I+S + ++  +F+I T G++G+ FS Y++ K  
Sbjct: 325 IPKVDL------------SKKLKFIISIRSPSEMIPNYFIIDTVGETGKIFSHYSVGKTT 372

Query: 411 DKNTEYTLKE 420
           D + EYTL +
Sbjct: 373 DGHNEYTLNK 382

>TPHA0P00670 Chr16 (137985..139127) [1143 bp, 380 aa] {ON} Anc_3.164
           YDL027C
          Length = 380

 Score = 57.4 bits (137), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 50/184 (27%), Positives = 78/184 (42%), Gaps = 32/184 (17%)

Query: 238 ETRKQFLSFLQKRVLESFTKNELGIRSYFLGDSVEKW-IKESYDLELDIDNCRSELRKFQ 296
           E   +F  F++ RVLE+F  +E G+RS    D   K  IK S  L ++           +
Sbjct: 228 EASDKFKKFIEARVLEAFVSDEDGVRSALASDHTWKQAIKTSRPLGIEFGRMVE-----R 282

Query: 297 TFIFSSVRYKLYLDSMKNLPLNPSKKLEGKKHIADVYVIILDESFPAIMFNGGAYSKADF 356
           +F+    +Y  Y       PL+ +     + H+  V ++                     
Sbjct: 283 SFVARDKKYMTY-----AFPLSINSPSGSQSHLGRVSIVACHP----------------- 320

Query: 357 FKILQESETSNSSKTLNTIIAIKSVNTLLSKHFVITTNGDSGEFFSKYNISKINDKNTEY 416
              L           L  I+ I+S + L    F+I TNG +GEFFSKY++ K  D +TEY
Sbjct: 321 ---LSAGFNPPDKTNLKLILCIESNSKLSPDLFIIDTNGMTGEFFSKYDVQKFKD-HTEY 376

Query: 417 TLKE 420
           T+K+
Sbjct: 377 TVKK 380

>KLLA0C03872g Chr3 complement(353385..354515) [1131 bp, 376 aa] {ON}
           some similarities with uniprot|Q7LHC7 Saccharomyces
           cerevisiae YDL027C Hypothetical ORF
          Length = 376

 Score = 42.4 bits (98), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 60/234 (25%), Positives = 106/234 (45%), Gaps = 37/234 (15%)

Query: 190 KTKLKITLPTMRSL---QLQPMVQSWKEISSRMGIPNEFAKGLNVDLVKQE-ETRKQFLS 245
           +TK+K++  T R L   Q+ P  +S+ ++    G P + ++         E     +FLS
Sbjct: 170 QTKMKLSSTTRRELIMKQMVPKFKSFTQLKDFSGFPFKLSQAFTDKFQSGEFPNADRFLS 229

Query: 246 FLQKRVLESFTKNELGIRSYFLGDSVEKWIKESYDLELDIDNCRSELRKFQTFIFSSVRY 305
           F++ R+ ESF KNE  I+S  LG S   ++    +L   + N  S          SSVR 
Sbjct: 230 FVKSRLDESFYKNEHNIKSIVLG-SDTAYVPGHMEL---VTNSYS--------FVSSVRN 277

Query: 306 KLYLDSMKNLPLNPSKKLEG-KKHIADVYVII-LDESFPAIMFNGGAYSKADFFKILQES 363
              + +   + LN     EG +K +A VY++   +     +MF G               
Sbjct: 278 NENIQAFSFMLLNMGS--EGVRKPVALVYIVTKANPGDELLMFTG--------------- 320

Query: 364 ETSNSSKTLNTIIAIKSVNTLLSKHFVITTNGDSGEFFSKYNISKINDKNTEYT 417
           +  + SK    +I +++++   SK   IT  G++G   ++Y++ +  D + EYT
Sbjct: 321 DYIDDSKLSPMVIYVRALSP-FSKCCFITDVGETGA-NAQYSVKRKKDGSKEYT 372

>Smik_6.72 Chr6 (136688..143119) [6432 bp, 2143 aa] {ON} YFL007W
            (REAL)
          Length = 2143

 Score = 31.6 bits (70), Expect = 5.1,   Method: Compositional matrix adjust.
 Identities = 21/64 (32%), Positives = 30/64 (46%), Gaps = 13/64 (20%)

Query: 205  LQPMVQSWKEISSRMGIPNEFAKGLNVDLVKQEETRKQFLSFLQKRVLESFTKNELGIRS 264
            L  +V +WKE  + + +   FAKGL+ D  K   T KQ LS           K ++ I  
Sbjct: 2014 LSDIVHNWKEEQALLSLIERFAKGLDAD--KYTSTEKQKLS-----------KTDIKIHG 2060

Query: 265  YFLG 268
            + LG
Sbjct: 2061 HVLG 2064

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.317    0.132    0.370 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 40,070,959
Number of extensions: 1666121
Number of successful extensions: 5820
Number of sequences better than 10.0: 31
Number of HSP's gapped: 6029
Number of HSP's successfully gapped: 32
Length of query: 420
Length of database: 53,481,399
Length adjustment: 112
Effective length of query: 308
Effective length of database: 40,638,807
Effective search space: 12516752556
Effective search space used: 12516752556
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 67 (30.4 bits)