Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
YDL013W (SLX5)3.186ON61961926890.0
Smik_4.2213.186ON61961924720.0
Skud_4.2403.186ON61962022760.0
Suva_4.2363.186ON63063022090.0
ZYRO0A04994g3.186ON60861512741e-168
NCAS0I019103.186ON61362312291e-161
NDAI0A065103.186ON71263711871e-154
KAFR0A012203.186ON64764111541e-150
SAKL0C07964g3.186ON62362110591e-136
AER213C3.186ON55760310221e-131
Kwal_27.98243.186ON5854749061e-113
KLTH0E15884g3.186ON5864828921e-111
KLLA0C04411g3.186ON6076418341e-103
TBLA0F007203.186ON6496358116e-99
TDEL0D043503.186ON5565897707e-94
KNAG0J012703.186ON5473536545e-77
Kpol_1036.523.186ON5913526305e-73
TPHA0A043703.186ON6642405172e-56
CAGL0K01881g3.186ON5062195073e-56
KLTH0A05214g7.281ON39635733.1
CAGL0E02893g4.91ON93071724.3
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= YDL013W
         (619 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

YDL013W Chr4 (429067..430926) [1860 bp, 619 aa] {ON}  SLX5Subuni...  1040   0.0  
Smik_4.221 Chr4 (411040..412899) [1860 bp, 619 aa] {ON} YDL013W ...   956   0.0  
Skud_4.240 Chr4 (423826..425685) [1860 bp, 619 aa] {ON} YDL013W ...   881   0.0  
Suva_4.236 Chr4 (422236..424128) [1893 bp, 630 aa] {ON} YDL013W ...   855   0.0  
ZYRO0A04994g Chr1 complement(400896..402722) [1827 bp, 608 aa] {...   495   e-168
NCAS0I01910 Chr9 complement(350296..352137) [1842 bp, 613 aa] {O...   478   e-161
NDAI0A06510 Chr1 complement(1479651..1481789) [2139 bp, 712 aa] ...   461   e-154
KAFR0A01220 Chr1 complement(238371..240314) [1944 bp, 647 aa] {O...   449   e-150
SAKL0C07964g Chr3 (740340..742211) [1872 bp, 623 aa] {ON} simila...   412   e-136
AER213C Chr5 complement(1028170..1029843) [1674 bp, 557 aa] {ON}...   398   e-131
Kwal_27.9824 s27 (74597..76354) [1758 bp, 585 aa] {ON} YDL013W (...   353   e-113
KLTH0E15884g Chr5 complement(1408264..1410024) [1761 bp, 586 aa]...   348   e-111
KLLA0C04411g Chr3 (403257..405080) [1824 bp, 607 aa] {ON} simila...   325   e-103
TBLA0F00720 Chr6 (182887..184836) [1950 bp, 649 aa] {ON} Anc_3.1...   317   6e-99
TDEL0D04350 Chr4 complement(793070..794740) [1671 bp, 556 aa] {O...   301   7e-94
KNAG0J01270 Chr10 (226858..228501) [1644 bp, 547 aa] {ON} Anc_3....   256   5e-77
Kpol_1036.52 s1036 complement(140685..142460) [1776 bp, 591 aa] ...   247   5e-73
TPHA0A04370 Chr1 (980168..982162) [1995 bp, 664 aa] {ON} Anc_3.1...   203   2e-56
CAGL0K01881g Chr11 (167939..169459) [1521 bp, 506 aa] {ON} weakl...   199   3e-56
KLTH0A05214g Chr1 (434058..435248) [1191 bp, 396 aa] {ON} simila...    33   3.1  
CAGL0E02893g Chr5 (273462..276254) [2793 bp, 930 aa] {ON} simila...    32   4.3  

>YDL013W Chr4 (429067..430926) [1860 bp, 619 aa] {ON}  SLX5Subunit
           of the Slx5-Slx8 SUMO-targeted ubiquitin ligase (STUbL)
           complex, stimulated by SUMO-modified substrates;
           contains a RING domain and two SIMs (SUMO-interacting
           motifs); forms SUMO-dependent nuclear foci, including
           DNA repair centers
          Length = 619

 Score = 1040 bits (2689), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 522/619 (84%), Positives = 522/619 (84%)

Query: 1   MHSDTNGRTKXXXXXXXXXXXETVILIDSDKEEDASIREANLPVRLYPDRRVGRRRDALN 60
           MHSDTNGRTK           ETVILIDSDKEEDASIREANLPVRLYPDRRVGRRRDALN
Sbjct: 1   MHSDTNGRTKSNNSPSDNNPNETVILIDSDKEEDASIREANLPVRLYPDRRVGRRRDALN 60

Query: 61  RFVRSDSRSRNSQRTHITASSERPDFQANNDDITIIREVGRFFGDDGPIDPSAHYVDLDQ 120
           RFVRSDSRSRNSQRTHITASSERPDFQANNDDITIIREVGRFFGDDGPIDPSAHYVDLDQ
Sbjct: 61  RFVRSDSRSRNSQRTHITASSERPDFQANNDDITIIREVGRFFGDDGPIDPSAHYVDLDQ 120

Query: 121 EPGSETLETPRTIQVXXXXXXXXXXXXXXXXXXXLTIVEERTTRPRVTLNLPGGERLEVT 180
           EPGSETLETPRTIQV                   LTIVEERTTRPRVTLNLPGGERLEVT
Sbjct: 121 EPGSETLETPRTIQVDNTNGYLNDNGNNNESDDGLTIVEERTTRPRVTLNLPGGERLEVT 180

Query: 181 ATTTDIPIRRSFEFQEDLGASRRQLLRRSATRARNLFVDRSDENDEDWTDDTHNLPEAXX 240
           ATTTDIPIRRSFEFQEDLGASRRQLLRRSATRARNLFVDRSDENDEDWTDDTHNLPEA  
Sbjct: 181 ATTTDIPIRRSFEFQEDLGASRRQLLRRSATRARNLFVDRSDENDEDWTDDTHNLPEAIQ 240

Query: 241 XXXXXXXXXXXXXXXXXXXXXXXXXXSSDENISTSIRLQSIRERIQSYTPDIRSAFHRAE 300
                                     SSDENISTSIRLQSIRERIQSYTPDIRSAFHRAE
Sbjct: 241 RARRESRMRMSRRIAERQRRVQQQRVSSDENISTSIRLQSIRERIQSYTPDIRSAFHRAE 300

Query: 301 SLHEFRSILQNVAPITLQECEEELMALFTEFRNQLLQNWAIDRVRNTXXXXXXXXXXXXX 360
           SLHEFRSILQNVAPITLQECEEELMALFTEFRNQLLQNWAIDRVRNT             
Sbjct: 301 SLHEFRSILQNVAPITLQECEEELMALFTEFRNQLLQNWAIDRVRNTQEEALRLHREALE 360

Query: 361 XXXXTAGRVFHRGTLRESITNYLNFNGEDGFLSRLWSGPALSDADEERHTQNIIDMIQER 420
               TAGRVFHRGTLRESITNYLNFNGEDGFLSRLWSGPALSDADEERHTQNIIDMIQER
Sbjct: 361 RQERTAGRVFHRGTLRESITNYLNFNGEDGFLSRLWSGPALSDADEERHTQNIIDMIQER 420

Query: 421 EERERDVVMKNLMNKTXXXXXXXXXXXXSLPEGYSASFDTTPKMKLDITKNGKEETIIVT 480
           EERERDVVMKNLMNKT            SLPEGYSASFDTTPKMKLDITKNGKEETIIVT
Sbjct: 421 EERERDVVMKNLMNKTRAQQEEFEARAASLPEGYSASFDTTPKMKLDITKNGKEETIIVT 480

Query: 481 DDDLAKTLEDIPVCCLCGAELGVGIPDDFTGISQKDRGVSFEGLVSKYKFHCPYQTLARP 540
           DDDLAKTLEDIPVCCLCGAELGVGIPDDFTGISQKDRGVSFEGLVSKYKFHCPYQTLARP
Sbjct: 481 DDDLAKTLEDIPVCCLCGAELGVGIPDDFTGISQKDRGVSFEGLVSKYKFHCPYQTLARP 540

Query: 541 SMLDRDLSKRTFIASCGHAFCGRCFARIDNAXXXXXXXXXXLAQLKGSAHPDNYGPKLCP 600
           SMLDRDLSKRTFIASCGHAFCGRCFARIDNA          LAQLKGSAHPDNYGPKLCP
Sbjct: 541 SMLDRDLSKRTFIASCGHAFCGRCFARIDNAKKKSKMPKKKLAQLKGSAHPDNYGPKLCP 600

Query: 601 ADSCKKLIRSRGRLKEVYF 619
           ADSCKKLIRSRGRLKEVYF
Sbjct: 601 ADSCKKLIRSRGRLKEVYF 619

>Smik_4.221 Chr4 (411040..412899) [1860 bp, 619 aa] {ON} YDL013W
           (REAL)
          Length = 619

 Score =  956 bits (2472), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 471/619 (76%), Positives = 496/619 (80%)

Query: 1   MHSDTNGRTKXXXXXXXXXXXETVILIDSDKEEDASIREANLPVRLYPDRRVGRRRDALN 60
           MH DTNGRTK           E VILIDSDKEEDASIREANLPVRLYPDRRVGRRRDALN
Sbjct: 1   MHGDTNGRTKSDHSPSASSPDEAVILIDSDKEEDASIREANLPVRLYPDRRVGRRRDALN 60

Query: 61  RFVRSDSRSRNSQRTHITASSERPDFQANNDDITIIREVGRFFGDDGPIDPSAHYVDLDQ 120
           RFVRSDSR+RN+QR H T +SE  + Q NNDD+TIIREVGRFFGD+GPIDPSAHYVDLD+
Sbjct: 61  RFVRSDSRNRNAQRIHTTTTSEYSNTQGNNDDVTIIREVGRFFGDEGPIDPSAHYVDLDE 120

Query: 121 EPGSETLETPRTIQVXXXXXXXXXXXXXXXXXXXLTIVEERTTRPRVTLNLPGGERLEVT 180
           EPGSETLE PRTI+V                   LTIVEERTTRPR+TLNLPGGERLEV 
Sbjct: 121 EPGSETLEAPRTIRVDNANGYLNDSHDDNENDDGLTIVEERTTRPRITLNLPGGERLEVN 180

Query: 181 ATTTDIPIRRSFEFQEDLGASRRQLLRRSATRARNLFVDRSDENDEDWTDDTHNLPEAXX 240
           ATTTDIPIRRSFEFQEDL ASRRQLLRRSATRAR+LFVDRSDENDEDWT+ TH+LPE   
Sbjct: 181 ATTTDIPIRRSFEFQEDLAASRRQLLRRSATRARSLFVDRSDENDEDWTEHTHSLPETIQ 240

Query: 241 XXXXXXXXXXXXXXXXXXXXXXXXXXSSDENISTSIRLQSIRERIQSYTPDIRSAFHRAE 300
                                     S DEN STS RLQSIRERIQSYTPD+RSAFH AE
Sbjct: 241 RARRESHMRMNRRIAERQLMAQQQRISRDENTSTSFRLQSIRERIQSYTPDVRSAFHHAE 300

Query: 301 SLHEFRSILQNVAPITLQECEEELMALFTEFRNQLLQNWAIDRVRNTXXXXXXXXXXXXX 360
           SLHEFRSILQNVAP+TLQECEEELMALFTEFRNQLLQNWAI+RVRNT             
Sbjct: 301 SLHEFRSILQNVAPVTLQECEEELMALFTEFRNQLLQNWAIERVRNTQEEALRLHREALE 360

Query: 361 XXXXTAGRVFHRGTLRESITNYLNFNGEDGFLSRLWSGPALSDADEERHTQNIIDMIQER 420
               T GR FHRG  RESI NYLNFNG+DGFLSRLWSG  L+DADEERHTQNIIDMIQER
Sbjct: 361 RQGRTTGRNFHRGVFRESIANYLNFNGDDGFLSRLWSGSVLNDADEERHTQNIIDMIQER 420

Query: 421 EERERDVVMKNLMNKTXXXXXXXXXXXXSLPEGYSASFDTTPKMKLDITKNGKEETIIVT 480
           EERERDVVMKNLMNKT            SLPEGYSASFDTTPKMKLDI KNGKEETIIVT
Sbjct: 421 EERERDVVMKNLMNKTKAQQEEFEARAASLPEGYSASFDTTPKMKLDIMKNGKEETIIVT 480

Query: 481 DDDLAKTLEDIPVCCLCGAELGVGIPDDFTGISQKDRGVSFEGLVSKYKFHCPYQTLARP 540
           DDDLAKTL+DIPVCCLCGAELGVGIPDDFTG+SQ+DRG+SFEGLVSKYKFHCPYQTLARP
Sbjct: 481 DDDLAKTLDDIPVCCLCGAELGVGIPDDFTGMSQRDRGISFEGLVSKYKFHCPYQTLARP 540

Query: 541 SMLDRDLSKRTFIASCGHAFCGRCFARIDNAXXXXXXXXXXLAQLKGSAHPDNYGPKLCP 600
           S+LDRDLSKRTFIASCGHA+CGRCFARIDNA          LAQLKGSAHPDNYGPKLCP
Sbjct: 541 SVLDRDLSKRTFIASCGHAYCGRCFARIDNAKKKSKTPKKKLAQLKGSAHPDNYGPKLCP 600

Query: 601 ADSCKKLIRSRGRLKEVYF 619
           A+SCKKLIRSRG+LKEVYF
Sbjct: 601 AESCKKLIRSRGKLKEVYF 619

>Skud_4.240 Chr4 (423826..425685) [1860 bp, 619 aa] {ON} YDL013W
           (REAL)
          Length = 619

 Score =  881 bits (2276), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 441/620 (71%), Positives = 477/620 (76%), Gaps = 2/620 (0%)

Query: 1   MHSDTNGRTKXXXXXXXXXXXETVILIDSDKEEDASIREANLPVRLYPDRRVGRRRDALN 60
           MH   +GRTK           ++VILI+SDKEEDASIREANLPVRLYPDRRVGRRRDALN
Sbjct: 1   MHG-GDGRTKSDHTPSVNHPDDSVILIESDKEEDASIREANLPVRLYPDRRVGRRRDALN 59

Query: 61  RFVRSDSRSRNSQRTHITASSERPDFQANNDDITIIREVGRFFGDDGPIDPSAHYVDLDQ 120
           RFVRSDS   N QR H TA   R D Q +NDD+TI+REVGRFFGDDGPIDPSAH+VDLD 
Sbjct: 60  RFVRSDSVGINPQRIHTTARPNRSDPQNDNDDVTIVREVGRFFGDDGPIDPSAHFVDLDH 119

Query: 121 EPGSETLETPRTIQVXXXXXXXXXXXXXXXXXXX-LTIVEERTTRPRVTLNLPGGERLEV 179
           EP SETLETP T+QV                    LTIVEERTTRPRVTLNLPGGERLEV
Sbjct: 120 EPDSETLETPTTLQVDNINGYLNDNFNDNDNNDDGLTIVEERTTRPRVTLNLPGGERLEV 179

Query: 180 TATTTDIPIRRSFEFQEDLGASRRQLLRRSATRARNLFVDRSDENDEDWTDDTHNLPEAX 239
            ATTTD+PIRRSFEFQ+DL  SRRQLLRRSA RAR LFVDRSDENDE+WT+DT N+PEA 
Sbjct: 180 NATTTDMPIRRSFEFQDDLAVSRRQLLRRSAARARTLFVDRSDENDEEWTEDTDNVPEAI 239

Query: 240 XXXXXXXXXXXXXXXXXXXXXXXXXXXSSDENISTSIRLQSIRERIQSYTPDIRSAFHRA 299
                                      +S+EN++TSIR QSIRERIQ+Y PDIRSAF+ A
Sbjct: 240 QRARRESHMRMSRRIAERQLRAQQHRMASNENMNTSIRFQSIRERIQAYAPDIRSAFYHA 299

Query: 300 ESLHEFRSILQNVAPITLQECEEELMALFTEFRNQLLQNWAIDRVRNTXXXXXXXXXXXX 359
           ESLHEFRSILQNVAP+TLQECE ELMALFTEFRNQLLQ+WAIDRVRNT            
Sbjct: 300 ESLHEFRSILQNVAPVTLQECEGELMALFTEFRNQLLQDWAIDRVRNTQEEALRLHREAL 359

Query: 360 XXXXXTAGRVFHRGTLRESITNYLNFNGEDGFLSRLWSGPALSDADEERHTQNIIDMIQE 419
                  GRVFHRG  RESITNYLNF+GE+GFL+RLW  P L+DADEERHTQNIIDMIQE
Sbjct: 360 ERQERATGRVFHRGPFRESITNYLNFSGENGFLTRLWGSPVLNDADEERHTQNIIDMIQE 419

Query: 420 REERERDVVMKNLMNKTXXXXXXXXXXXXSLPEGYSASFDTTPKMKLDITKNGKEETIIV 479
           REERERDVVMKNLM+KT             LPEGYSASFDTTPKMKLDI KN KEETI V
Sbjct: 420 REERERDVVMKNLMSKTKAQQEEFEDRAARLPEGYSASFDTTPKMKLDIMKNDKEETITV 479

Query: 480 TDDDLAKTLEDIPVCCLCGAELGVGIPDDFTGISQKDRGVSFEGLVSKYKFHCPYQTLAR 539
           TDDDLA+TLE IPVCCLCG ELGVGIPDDF G++QKDRG+SFEGLVSKYKFHCPYQTLAR
Sbjct: 480 TDDDLARTLEVIPVCCLCGVELGVGIPDDFIGMNQKDRGISFEGLVSKYKFHCPYQTLAR 539

Query: 540 PSMLDRDLSKRTFIASCGHAFCGRCFARIDNAXXXXXXXXXXLAQLKGSAHPDNYGPKLC 599
           PSMLDRDLS+RTFIA+CGHA+CGRCFARIDNA          LA L+GSAHPDNYGPK C
Sbjct: 540 PSMLDRDLSRRTFIAACGHAYCGRCFARIDNAKKKSKTPKKKLASLRGSAHPDNYGPKFC 599

Query: 600 PADSCKKLIRSRGRLKEVYF 619
           PA+SCKK IRSRGRLKEVYF
Sbjct: 600 PAESCKKPIRSRGRLKEVYF 619

>Suva_4.236 Chr4 (422236..424128) [1893 bp, 630 aa] {ON} YDL013W
           (REAL)
          Length = 630

 Score =  855 bits (2209), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 437/630 (69%), Positives = 473/630 (75%), Gaps = 11/630 (1%)

Query: 1   MHSDTNGRTKXXXXXXXXXXXETVILIDSDKEEDASIREANLPVRLYPDRRVGRRRDALN 60
           M S  + RTK            +VILIDSDKEEDASIREANLPVRLYPDRRVGRRRDALN
Sbjct: 1   MQSAGDDRTKSDHTPSVSHPDNSVILIDSDKEEDASIREANLPVRLYPDRRVGRRRDALN 60

Query: 61  RFVRSDSRSRNSQRTHITASSERPDFQANNDDITIIREVGRFFGDDGPIDPSAHYVDLDQ 120
           RF+RSD+     QR   T  S+ PD Q + DD+TIIREVGRFFGDDGPIDPSA YVDLDQ
Sbjct: 61  RFIRSDTTDATPQRIGTTLRSDGPDTQNDIDDVTIIREVGRFFGDDGPIDPSALYVDLDQ 120

Query: 121 EPGSETLETPRTIQVXXXX------XXXXXXXXXXXXXXXLTIVEERTTRPRVTLNLPGG 174
           EPGSET+ETPR IQV                         LTIVEERT RPR+TLNLPGG
Sbjct: 121 EPGSETVETPRIIQVNNTNGYLNENSNENNNDNDNDNDDGLTIVEERTARPRITLNLPGG 180

Query: 175 ERLEVTATTTDIPIRRSFEFQEDLGASRRQLLRRSATRARNLFVDRSDENDED---WTDD 231
           ERLEV AT  DIPIRRSFEFQEDL ASRRQLLRRSA RARNLFV+RSDE+DE+   WT++
Sbjct: 181 ERLEVNATPRDIPIRRSFEFQEDLAASRRQLLRRSAARARNLFVERSDEDDENDEEWTEN 240

Query: 232 THNLPEAXXXXXXXXXXXXXXXXXXXXXX--XXXXXXSSDENISTSIRLQSIRERIQSYT 289
           T++LPE                                S+EN+ T+IRLQSIRERIQ+Y 
Sbjct: 241 TNDLPETIQRARRESHMRMSRRVAERQHRIRAQQQRMVSNENMGTAIRLQSIRERIQAYV 300

Query: 290 PDIRSAFHRAESLHEFRSILQNVAPITLQECEEELMALFTEFRNQLLQNWAIDRVRNTXX 349
           PDIRSAFH AESLHEFRSILQNVAP+TLQECE ELMALFTEFRNQLLQNWAIDRVRNT  
Sbjct: 301 PDIRSAFHHAESLHEFRSILQNVAPVTLQECEGELMALFTEFRNQLLQNWAIDRVRNTQE 360

Query: 350 XXXXXXXXXXXXXXXTAGRVFHRGTLRESITNYLNFNGEDGFLSRLWSGPALSDADEERH 409
                           AG   H G  RESI++YLNFNGEDGFL+RLW GP L++ADEERH
Sbjct: 361 EALRLHREALEGQERVAGGALHHGPYRESISSYLNFNGEDGFLTRLWGGPVLNEADEERH 420

Query: 410 TQNIIDMIQEREERERDVVMKNLMNKTXXXXXXXXXXXXSLPEGYSASFDTTPKMKLDIT 469
           TQNIIDMIQEREERERDVVMKNLMNKT            +LPEGYSASFDTTPKMKLDI 
Sbjct: 421 TQNIIDMIQEREERERDVVMKNLMNKTKAQQDEFEERAANLPEGYSASFDTTPKMKLDIM 480

Query: 470 KNGKEETIIVTDDDLAKTLEDIPVCCLCGAELGVGIPDDFTGISQKDRGVSFEGLVSKYK 529
           KNGKEETI V DDDLAKTLED+ VCCLCG ELGVGIPDDF G+SQKDRG+SFEGLVS+YK
Sbjct: 481 KNGKEETITVLDDDLAKTLEDVSVCCLCGVELGVGIPDDFVGMSQKDRGISFEGLVSRYK 540

Query: 530 FHCPYQTLARPSMLDRDLSKRTFIASCGHAFCGRCFARIDNAXXXXXXXXXXLAQLKGSA 589
           FHCPYQTLARPS+LDRDLSKRTF+ASCGH +CGRC+ARIDNA          LA+LKGSA
Sbjct: 541 FHCPYQTLARPSVLDRDLSKRTFVASCGHTYCGRCYARIDNAKKKSKSPKKKLAELKGSA 600

Query: 590 HPDNYGPKLCPADSCKKLIRSRGRLKEVYF 619
           HPDNYGPKLCPADSCKKLIRSRGRLKEVYF
Sbjct: 601 HPDNYGPKLCPADSCKKLIRSRGRLKEVYF 630

>ZYRO0A04994g Chr1 complement(400896..402722) [1827 bp, 608 aa] {ON}
           similar to uniprot|P32828 Saccharomyces cerevisiae
           YDL013W HEX3 Ring finger protein involved in the DNA
           damage response with possible recombination role
           genetically identified by synthetic lethality with SGS1
           (DNA helicase) and TOP3 (DNA topoisomerase) sporulation
           role interacts with Slx8p and Lin1p
          Length = 608

 Score =  495 bits (1274), Expect = e-168,   Method: Compositional matrix adjust.
 Identities = 277/615 (45%), Positives = 364/615 (59%), Gaps = 45/615 (7%)

Query: 22  ETVILIDSDKEEDASIREANLPVRLYPDRRVGRRRDALNRFVRSDSRSRNSQRTHITASS 81
           E  I+I+SD+EED  IR+   P+RL+PD R+ R RD LNRFV       NS+ T++ A++
Sbjct: 22  EDPIIIESDQEEDQRIRDDARPIRLHPDGRIHRPRDGLNRFV-------NSEGTNV-ATT 73

Query: 82  ERPDFQANNDDITIIREVGRFFG-DDGPIDPSAHYVDLDQEPGSETLETPRTIQVXXXXX 140
              D   ++D++ I+ E+    G ++GPI   A YVDLD + G + +E            
Sbjct: 74  RSQDNGGSDDEVAIVGEINNTRGNEEGPIGSDAEYVDLDADNGPQVIEV----------N 123

Query: 141 XXXXXXXXXXXXXXLTIVEERTTRPRVTLNLPGGERLEVTATTTDIPIRRSFEFQEDLGA 200
                         L IV+ERTT PRVTLNLPGGE L++ A+ TD P RRSFE+Q+    
Sbjct: 124 DNNRNNNENSDDDGLVIVQERTTAPRVTLNLPGGESLQIDASPTDRPYRRSFEWQQQ-DR 182

Query: 201 SRRQLLRRSATRARNLFVDRSDENDE---DWTDDTHNLPEAXXXXXXXXXXXXXXXXXXX 257
           +RRQ + RSA RA  L    SD++D+   + T +   LP +                   
Sbjct: 183 TRRQAMERSARRASRLLFHTSDDDDDDSGNGTVENGRLPPSVLQLRRQEEERSRLRNITR 242

Query: 258 XXXXXXXXXSSDENISTSIRLQSIRERIQSYTPDIRSAFHRAESLHEFRSILQNVAPITL 317
                         +     L  +RERI S+ PD+RSAF  A+SL+EFRSILQ+VAP+TL
Sbjct: 243 RRDQMRSDAMQGNPV-----LMRLRERIDSFPPDVRSAFVHAQSLYEFRSILQSVAPLTL 297

Query: 318 QECEEELMALFTEFRNQLLQNWAIDRVRNTXXXXXXXXXXXXXXXXXTAGRVFHR----- 372
           QEC+ EL+ LFTE+R++++QNWA +RV++                     R++H      
Sbjct: 298 QECDNELVPLFTEYRSRMVQNWATNRVQSNQQESRRLNEENHERQR----RLWHNRRHFR 353

Query: 373 ------GTLRESITNY--LNFNGEDGFLSRLWSGPALSDADEERHTQNIIDMIQEREERE 424
                 G   ES+ NY  +N NG     +       + D DEE  TQ+I+ MIQEREERE
Sbjct: 354 IHMGVGGGFGESLANYILMNANGMGSNDAAWLYNGYVGDMDEEESTQSIVSMIQEREERE 413

Query: 425 RDVVMKNLMNKTXXXXXXXXXXXXSLPEGYSASFDTTPKMKLDITKNGKEETIIVTDDDL 484
            D   K  M KT             LP+GYSASFDT PK+KLDI ++GKEET++V DD +
Sbjct: 414 HDSRTKKYMEKTQDQQQSYVQRAMELPDGYSASFDTEPKIKLDIVRDGKEETVVVKDDSV 473

Query: 485 AKTLEDIPVCCLCGAELGVGIPDDFTGISQKDRGVSFEGLVSKYKFHCPYQTLARPSMLD 544
           +   +++PVC LCG ELGVGIPD+F GI++ DRGVSFE LV KY+FHCPYQTLARPS LD
Sbjct: 474 SDQWQEVPVCTLCGVELGVGIPDEFEGITKMDRGVSFECLVYKYQFHCPYQTLARPSQLD 533

Query: 545 RDLSKRTFIASCGHAFCGRCFARIDNAXXXXXXXXXXLAQLKGSAHPDNYGPKLCPADSC 604
           RDLS+RTF+A CGH +CGRCFARIDNA          LAQLKGSAHPDNYGPK+CPA  C
Sbjct: 534 RDLSRRTFVAPCGHTYCGRCFARIDNARGKSRMAKRKLAQLKGSAHPDNYGPKICPAKGC 593

Query: 605 KKLIRSRGRLKEVYF 619
           K  IR+RG+++E +F
Sbjct: 594 KSPIRTRGKMREAFF 608

>NCAS0I01910 Chr9 complement(350296..352137) [1842 bp, 613 aa] {ON}
           Anc_3.186 YDL013W
          Length = 613

 Score =  478 bits (1229), Expect = e-161,   Method: Compositional matrix adjust.
 Identities = 281/623 (45%), Positives = 367/623 (58%), Gaps = 45/623 (7%)

Query: 22  ETVILIDSDKEEDASIR-EANLPVRLYPDRRVGRRRDALNRFVRSDSRSRNSQRT----H 76
           + +I I+SD E+DA IR +    +RLYPD R  R RD++NRFV +   +R  + T    H
Sbjct: 11  DPIITIESDPEDDARIRNDQQQIIRLYPDARTDRPRDSMNRFVDAQGSNRAIRSTPDLSH 70

Query: 77  ITASSERPDFQANNDDITIIREV--GRFFGDDGPIDPSAHYVDLDQEP--GSETLETPRT 132
           +    ++   Q ++DDITI+RE+       DD PI+P A ++DLDQE    + T+  PRT
Sbjct: 71  LNDDQDQ--DQDDDDDITIVREIVNPNVARDDAPINPDAEFIDLDQEVPYANATIPRPRT 128

Query: 133 IQVXXXXXXXXXXXXXXXXXXXLTIVEERTTRPRVTLNLPGGERLEVTATTTDIPIRRSF 192
           IQ+                   L I +ERT RP VTLNLPGG+ L+V AT TD   R SF
Sbjct: 129 IQIITPSPPQQQQDDD------LVITQERTMRPTVTLNLPGGQTLQVDATPTDQLARSSF 182

Query: 193 EFQEDLGASRRQLLRRSATRARNLFVDRSDENDEDWTDDTHNLPEAXXXXXXXXXXXXXX 252
           E+QE++  +RRQLLRRS  RA +LF     E+D D  + +  LP                
Sbjct: 183 EWQENIPLARRQLLRRSTNRANSLFFHDDHESDND--NGSVPLPP-------NVIRLRQR 233

Query: 253 XXXXXXXXXXXXXXSSDENISTSIRLQSIRERIQSYTPDIRSAFHRAESLHEFRSILQNV 312
                           D+      RL   R RI +Y+PDI+SAF+ A SLHEF SILQNV
Sbjct: 234 QQQQNREEPPPPPPPQDDANPIMTRL---RTRINTYSPDIQSAFNHAHSLHEFTSILQNV 290

Query: 313 APITLQECEEELMALFTEFRNQLLQNWAIDRVRNTXXXXXXXXXXXXXXXXXT---AGRV 369
           AP+TLQEC +EL++LFT++R+QL+ NWA  RVR++                     A RV
Sbjct: 291 APLTLQECGDELLSLFTQYRSQLMVNWATRRVRSSQQNTSSSNHRQRNLRNLRRNGALRV 350

Query: 370 ------FHRGTLRESITNYL---NFNGEDGFLSRLWSGPALSDAD----EERHTQNIIDM 416
                 F+    R  + N L   N N ED + +  ++    +D +    ++  TQNII+M
Sbjct: 351 TPNANGFNVNLARLFLMNQLGINNGNDEDQYFTGAYNSEDDADHNGDDEDDTQTQNIINM 410

Query: 417 IQEREERERDVVMKNLMNKTXXXXXXXXXXXXSLPEGYSASFDTTPKMKLDITKNGKEET 476
           IQ REE+E D   K+ M +T             LPE YSA+F+T P MKLDI KNGKEET
Sbjct: 411 IQRREEQEHDTRTKSFMARTKPQQDAFKKRANELPENYSANFNTEPTMKLDIKKNGKEET 470

Query: 477 IIVTDDDLAKTLEDIPVCCLCGAELGVGIPDDFTGISQKDRGVSFEGLVSKYKFHCPYQT 536
           IIV D+D AK   ++P C LCG ELGVGIP DF GI+  DRG SFE LVSKYKFHCPYQ+
Sbjct: 471 IIVEDNDAAKNYIEVPACTLCGVELGVGIPKDFQGINDTDRGGSFESLVSKYKFHCPYQS 530

Query: 537 LARPSMLDRDLSKRTFIASCGHAFCGRCFARIDNAXXXXXXXXXXLAQLKGSAHPDNYGP 596
           LA+PS LD+DLS+R F+ASCGH FCGRC+ARIDNA          L QLKGS+HPDNYGP
Sbjct: 531 LAKPSQLDKDLSQRVFMASCGHTFCGRCYARIDNAKSKSKLPKKTLKQLKGSSHPDNYGP 590

Query: 597 KLCPADSCKKLIRSRGRLKEVYF 619
           ++CPADSC+ L+R + +++EV+F
Sbjct: 591 RVCPADSCRSLLRVKTKMREVFF 613

>NDAI0A06510 Chr1 complement(1479651..1481789) [2139 bp, 712 aa]
           {ON} Anc_3.186 YDL013W
          Length = 712

 Score =  461 bits (1187), Expect = e-154,   Method: Compositional matrix adjust.
 Identities = 271/637 (42%), Positives = 350/637 (54%), Gaps = 41/637 (6%)

Query: 23  TVILIDSDKEEDASIREANLPVRLYPDRRVGRRRDALNRFVRSDSRS------RNSQRTH 76
           + ILI+SD EEDA IRE +  + L PDRR+GR RDAL+RF+ ++  +      R++Q  +
Sbjct: 77  SAILIESDPEEDARIREESRQISLVPDRRIGRPRDALHRFISTNPNNTNTTSRRDAQEEN 136

Query: 77  ITASSERPDFQANNDDITIIREVGRFFGDDGPIDPSAHYVDLDQEPGSETLETPRTIQVX 136
                   DF A  D+I           + GPIDP+A YVDLD EP   T   PRTI + 
Sbjct: 137 EENDENDDDF-AIMDEIIDPTHNNNNINEIGPIDPTAEYVDLDAEPEYITNSRPRTIIIN 195

Query: 137 XXXXXXXXXX----XXXXXXXXLTIVEERTTRPRVTLNLPGGERLEVTATTTDIPIRRSF 192
                                 + I+EERT+ P VTLNLPGGERL + A   + P R SF
Sbjct: 196 NNSSNNNIENSNGDANDDDDDEVMILEERTSTPTVTLNLPGGERLRINADPNERPTRSSF 255

Query: 193 E-FQEDL-GASRRQLLRRSATRARN-LFVDRSDENDEDWTDDTHNLPEAXXXXXXXXXXX 249
           E   E++   SRRQLLRR+  RA N LF   SDEN+ D   D  +LP +           
Sbjct: 256 ESLNENIVPLSRRQLLRRATRRATNSLFFHGSDENESDNDTDEVSLPASILGMRQRARMM 315

Query: 250 XXXXXXXXXXXXXXXXXSSD------ENISTSIRLQSIRERIQSYTPDIRSAFHRAESLH 303
                            + D      +N ST+  L ++RERI +Y PD+R AF  A+SL 
Sbjct: 316 AMQERQRQRQGQGQGHSAPDTSGNSVDNTSTNRNLINLRERIHTYPPDVRGAFDHAQSLQ 375

Query: 304 EFRSILQNVAPITLQECEEELMALFTEFRNQLLQNWAIDRVRNTXXXXXXXXXXXXXXXX 363
           EF SI+Q+VAP T  EC ++L++LFT++R Q++ +W + R+R +                
Sbjct: 376 EFTSIVQSVAPTTFAECSDDLISLFTQYRGQVMADWTLRRIRQSQRDNERLLRERHARVR 435

Query: 364 XTA---GRVFHRGTLRESITNYLNFN------------------GEDGFLSRLWSGPALS 402
            T     R F        + N L                      ED    R        
Sbjct: 436 STIRANNRHFGSNLASFFLMNQLGLGYGDVGAADDEDDGDYGIGEEDNDTGRAAGAYGYE 495

Query: 403 DADEERHTQNIIDMIQEREERERDVVMKNLMNKTXXXXXXXXXXXXSLPEGYSASFDTTP 462
             D++ HTQNII+MIQ RE+ ERD   K  M+KT            +LPEGYS+SF T P
Sbjct: 496 YEDDDAHTQNIINMIQRREDAERDSRTKGFMSKTKPQQDGFKKRALALPEGYSSSFSTEP 555

Query: 463 KMKLDITKNGKEETIIVTDDDLAKTLEDIPVCCLCGAELGVGIPDDFTGISQKDRGVSFE 522
           K+K+ + KNGK+ET+I+ D DLAK   D+P C LCG ELGVGIP DF G S KD GVSFE
Sbjct: 556 KVKMTVKKNGKDETVIMEDVDLAKYWMDVPACILCGVELGVGIPKDFVGTSDKDHGVSFE 615

Query: 523 GLVSKYKFHCPYQTLARPSMLDRDLSKRTFIASCGHAFCGRCFARIDNAXXXXXXXXXXL 582
            LVSKY FHCPYQ+L++PS LDRDLS++ ++ASCGH FCGRC+ RIDNA          L
Sbjct: 616 FLVSKYDFHCPYQSLSKPSQLDRDLSQKVYVASCGHTFCGRCYVRIDNAKSKSKLPKKKL 675

Query: 583 AQLKGSAHPDNYGPKLCPADSCKKLIRSRGRLKEVYF 619
           A+LKGS+HPDNYGPK CP  SCK L+RSRGR++E+YF
Sbjct: 676 AELKGSSHPDNYGPKTCPGPSCKTLLRSRGRMREIYF 712

>KAFR0A01220 Chr1 complement(238371..240314) [1944 bp, 647 aa] {ON}
           Anc_3.186 YDL013W
          Length = 647

 Score =  449 bits (1154), Expect = e-150,   Method: Compositional matrix adjust.
 Identities = 283/641 (44%), Positives = 367/641 (57%), Gaps = 57/641 (8%)

Query: 22  ETVILIDSDKEEDASIREANLPVRLYPDRRVGRRRDALNRFVRS-DSRSRNSQRTHITAS 80
           ++VILI++D+EED  IR+ N   RL PDRR+GR RD LNRFV + D    N   TH+   
Sbjct: 21  DSVILIETDEEEDERIRDENRYRRLVPDRRIGRPRDILNRFVSTRDPGDDNETTTHV--- 77

Query: 81  SERPDFQANNDDITIIREVGRFFGDDGPIDPSAHYVDLDQE----PGSETLETPRTIQVX 136
           S+  D   ++DD+ I+  +      +GPIDP A Y+DLD E     G     TPR + + 
Sbjct: 78  SQEGDNNDDDDDVEIVGAIEAPRDPNGPIDPGAEYIDLDTEDQYASGHHGFNTPRIVVIN 137

Query: 137 XXXXXXXXXXXXXXXXXXLTIVEERTTRPRVTLNLPGGERLEVTATTTDIPIRRSFEFQE 196
                             L I+EERTTRP VTLNLPGGE L++ A+ +D P  RSFE+Q+
Sbjct: 138 GDSNNGNNEDDG------LEIIEERTTRPTVTLNLPGGESLQINASDSDRPAHRSFEWQD 191

Query: 197 DLGASRRQLLRRSATRARNLFVDRSDENDEDWTDDTHN---LPEAXXXXXXXXXXXXXXX 253
            L   RR+LLRRSA R R+LF++ SD+ + D      N   LP                 
Sbjct: 192 ALPEPRRRLLRRSAGRIRSLFLNNSDDENNDTAAGRQNNRYLP----SNIRRLRQEEQAQ 247

Query: 254 XXXXXXXXXXXXXSSDENISTSIRLQSIRERIQSYTPDIRSAFHRAESLHEFRSILQNVA 313
                           E IS + R   IR RI +Y+PDIRSAF  A+++HEF+SIL+N+A
Sbjct: 248 MRQLAQRRRRMNEQRPEMISGNPRFDEIRNRINAYSPDIRSAFDHAQTIHEFKSILENIA 307

Query: 314 PITLQECEEELMALFTEFRNQLLQNWAIDRVRNTXXXXXXXXXXXXXXXXXTAGRVFHRG 373
           P+TLQ+C  EL++L+TE+R+ LLQNWA  RV+N+                    R     
Sbjct: 308 PVTLQDCGAELISLYTEYRSYLLQNWATRRVQNSAAPATAGRARTDGRDRRRRTRNQRLA 367

Query: 374 TLR---ESITNYLN-----------------FNGED----------GFLSRL--WSGPAL 401
            LR   ES    L                  F+G D          G+++    + G   
Sbjct: 368 RLRFDMESNEGGLTANNLARIFLANNGFQNVFDGGDIRDDEDGDYYGYMNEYDDYMGEHG 427

Query: 402 SDADEE-RHTQNIIDMIQEREERERDVVMKNLMNKTXXXXXXXXXXXXSLPEGYSASFDT 460
            + DEE + TQNII+MIQEREERE D   K  M  T            +LP+GYSA+FD+
Sbjct: 428 ENEDEEAQRTQNIINMIQEREEREHDSRTKGFMANTKSQREANHKKARNLPDGYSANFDS 487

Query: 461 TPKMKLDITKNGKEETIIVTDDDLA--KTLEDIPVCCLCGAELGVGIPDDFTGISQKDRG 518
           TPK  +   KNGKEE IIV DDD+A    L ++P+C LCGAELG+GIPDDF GI ++DRG
Sbjct: 488 TPKTVVKAMKNGKEEEIIV-DDDVAVRNNLMEVPICTLCGAELGIGIPDDFKGIGEEDRG 546

Query: 519 VSFEGLVSKYKFHCPYQTLARPSMLDRDLSKRTFIASCGHAFCGRCFARIDNAXXXXXXX 578
           +SF+ LVSKYK +CPYQ+LA+PS +DR LSKRTF+A CGH +CGRC ARI NA       
Sbjct: 547 LSFQFLVSKYKSYCPYQSLAKPSEIDRHLSKRTFVAKCGHLYCGRCVARISNAKENSRKP 606

Query: 579 XXXLAQLKGSAHPDNYGPKLCPADSCKKLIRSRGRLKEVYF 619
              LA+L GS+HP+NYGPK CPAD+CK L+RSRG+L EVYF
Sbjct: 607 KKELAKLIGSSHPENYGPKKCPADNCKGLLRSRGKLSEVYF 647

>SAKL0C07964g Chr3 (740340..742211) [1872 bp, 623 aa] {ON} similar
           to uniprot|P32828 Saccharomyces cerevisiae YDL013W HEX3
           Ring finger protein involved in the DNA damage response
           with possible recombination role genetically identified
           by synthetic lethality with SGS1 (DNA helicase) and TOP3
           (DNA topoisomerase) sporulation role interacts with
           Slx8p and Lin1p
          Length = 623

 Score =  412 bits (1059), Expect = e-136,   Method: Compositional matrix adjust.
 Identities = 253/621 (40%), Positives = 334/621 (53%), Gaps = 51/621 (8%)

Query: 24  VILIDSDKEEDASIREANLPVRLYPDRRVGRRRDALNRFVRSDSRSRNSQRTHITASSER 83
           VI I+SD EED  IR+     RL  DRR+ R RD+LNRF+ S   +RN      T ++  
Sbjct: 29  VIEIESDPEEDERIRQQYRQQRLVGDRRINRPRDSLNRFLNSQGENRN------TRAALE 82

Query: 84  PDFQANNDDITIIREVGRFFGDDGPIDPSAHYVDLDQEPGSETL-----ETPRTIQVXXX 138
           PD   ++DD+ ++ E        GPI   A +VDL    G +T      +    +     
Sbjct: 83  PDDDEDDDDLQVVGET--MLDRHGPIGEDADFVDLSSFGGGDTGSGGSGDNRNGVPTRTA 140

Query: 139 XXXXXXXXXXXXXXXXLTIVEERTTRPRVTLNLPGGERLEVTATTTDIPIRRSFEFQE-- 196
                           + I+EERTT P   LNLPGGE L ++ TT D P+RRSF+ Q+  
Sbjct: 141 IIRHSTGANGSDRGDDIEILEERTTAPNFVLNLPGGESLRISGTTADQPVRRSFQNQQPS 200

Query: 197 ------DLGASRRQLLRRSATRARNLFVDR--------SDENDEDWTDDTHNLPEAXXXX 242
                    A+RR+LL R+A  A NLF           S+END D+      +P      
Sbjct: 201 RTRAVSAAAAARRRLLNRTARSATNLFFSSGQGPQDGYSEENDPDY------IPAGVRQL 254

Query: 243 XXXXXXXXXXXXXXXXXXXXXXXXSSDENISTSIRLQSIRERIQSYTPDIRSAFHRAESL 302
                                    +  +   +  L ++R RI  Y  DI+SAF  A+SL
Sbjct: 255 RQQNAMRDRQASLEQRREQQRL---NGMDPGANAELTALRSRINGYPLDIQSAFDHAQSL 311

Query: 303 HEFRSILQNVAPITLQECEEELMALFTEFRNQLLQNWAIDRVR----NTXXXXXXXXXXX 358
           +EF  I+Q+V P   +  ++EL  L++ +R  ++ +WA +R R                 
Sbjct: 312 YEFEGIIQSVEPRMNENRKQELRELYSRYRGHVMHSWAQNRRRTYREQAARAQQTRAREQ 371

Query: 359 XXXXXXTAGRVFHRGTLRESITNYLNFNGEDGFLSRLWSGPALSDADEERHTQNIIDMIQ 418
                    +VFH    R S+T +L       F    W G     ADEE  TQNII+MIQ
Sbjct: 372 EQRQRELENQVFHN---RHSLTEFLIARA---FGPFHWGG---QQADEEIETQNIIEMIQ 422

Query: 419 EREERERDVVMKNLMNKTXXXXXXXXXXXXSLPEGYSASFDTTPKMKLDITKNGKEETII 478
            REERE+D   K  M  T             +PEGYSASFDT PKMK+ +T+NG+EE + 
Sbjct: 423 AREEREQDTRKKRYMEDTKFQQQGFLRRAEGVPEGYSASFDTAPKMKIAMTRNGREEEVT 482

Query: 479 VTDDDLAKTLEDIPVCCLCGAELGVGIPDDFTGISQKDRGVSFEGLVSKYKFHCPYQTLA 538
           VTDD  AK  ED+P CCLCG ELGVGIPD+F+GI+++DRGVSFE LV+KY FHCPYQ+LA
Sbjct: 483 VTDDHAAKQYEDVPACCLCGIELGVGIPDEFSGITKEDRGVSFESLVAKYGFHCPYQSLA 542

Query: 539 RPSMLDRDLSKRTFIASCGHAFCGRCFARIDNAXXXXXXXXXXLAQLKGSAHPDNYGPKL 598
           RPS+ DRDLSKRT++ASCGH FCGRCFAR+DNA          LA L+G++HPDNYGPK 
Sbjct: 543 RPSVADRDLSKRTYVASCGHTFCGRCFARVDNARAYSRASKKKLAGLQGASHPDNYGPKT 602

Query: 599 CPADSCKKLIRSRGRLKEVYF 619
           CPA+ C   +RS+GR+KEV+F
Sbjct: 603 CPAEGCSMQLRSKGRMKEVFF 623

>AER213C Chr5 complement(1028170..1029843) [1674 bp, 557 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDL013W
           (HEX3)
          Length = 557

 Score =  398 bits (1022), Expect = e-131,   Method: Compositional matrix adjust.
 Identities = 236/603 (39%), Positives = 319/603 (52%), Gaps = 61/603 (10%)

Query: 23  TVILIDSDKEEDASIREANLPVRLYPDRRVGRRRDALNRFVRSDSRSRNSQRTHITASSE 82
            VI I+SD EED  I       RL PDRR+ R RDA NRFV    R        + A++ 
Sbjct: 10  AVIEIESDPEEDQRIINQYRQTRLVPDRRLNRPRDAANRFVSVSGR--------VAAAAG 61

Query: 83  RPDFQANNDDITIIREVGRFFGDDGPIDPSAHYVDLDQEPGSETLETPRTIQVXXXXXXX 142
             D     D++ I+ EV  +  D+GPID +A +VDLD++ G      P +  V       
Sbjct: 62  EGD-----DEVEIVNEV--YLDDEGPIDSTADFVDLDEQQG------PSSSMVINHDGGG 108

Query: 143 XXXXXXXXXXXXLTIVEERTTRPRVTLNLPGGERLEVTATTTDIPIRRSFEFQEDLGASR 202
                       + I+EERTT P   LNLP G+ L ++ +  D P+RRSFE Q     +R
Sbjct: 109 DDD---------VAIIEERTTHPTFLLNLPNGQTLRISGSVHDRPLRRSFETQR---TAR 156

Query: 203 RQLLRRSATRARNLFVDRSD-ENDEDWTDDTHNLPEAXXXXXXXXXXXXXXXXXXXXXXX 261
             +LRR+A  A+ LF++ +D E  E    D   LP++                       
Sbjct: 157 ANMLRRAARSAQRLFMNENDGEPSEREASDREYLPQSVLRQRQQALMQERLQRQREHAR- 215

Query: 262 XXXXXSSDENISTSIRLQSIRERIQSYTPDIRSAFHRAESLHEFRSILQNVAPITLQECE 321
                   E+I+          ++ +  P++RS F+ AE+LHE R++L      T     
Sbjct: 216 ------QHEHIADP--------QVDALAPELRSIFYHAETLHEVRTMLNASGLGTSAAAM 261

Query: 322 EELMALFTEFRNQLLQNWAIDRVRNTXXXXXXXXXXXXXXXXXTAGRVFHRGTL-----R 376
           ++L+ L+ +FR++ + NWA  R +                   +A R   R        R
Sbjct: 262 QDLLQLYMQFRSRQINNWARQRAQE---FRHGSAREADHAQDDSASRARLRNPALNAQRR 318

Query: 377 ESITNYLNFNGEDGFLSRLWSGPALSDADEERHTQNIIDMIQEREERERDVVMKNLMNKT 436
            S T+Y+      GF   +W      D DE   TQNIID+IQ REER+ D   +  M  T
Sbjct: 319 NSFTSYVLARSLGGF--GVWPNDFFGDDDEV--TQNIIDIIQAREERDLDSRKRKYMEDT 374

Query: 437 XXXXXXXXXXXXSLPEGYSASFDTTPKMKLDITKNGKEETIIVTDDDLAKTLEDIPVCCL 496
                        LPEGY ASFD TPKMK+ + KNGK E ++V DD  AK+  ++PVCCL
Sbjct: 375 KSQQQAFVARAQRLPEGYYASFDPTPKMKMTLEKNGKTEEVVVADDLAAKSYVEVPVCCL 434

Query: 497 CGAELGVGIPDDFTGISQKDRGVSFEGLVSKYKFHCPYQTLARPSMLDRDLSKRTFIASC 556
           CG ELG+GIPDDF GIS  DRGVSFE LVSKY FHCPYQ LA PS+ DRDLS++TF+A C
Sbjct: 435 CGVELGLGIPDDFAGISAVDRGVSFESLVSKYDFHCPYQALAHPSIADRDLSRKTFVAHC 494

Query: 557 GHAFCGRCFARIDNAXXXXXXXXXXLAQLKGSAHPDNYGPKLCPADSCKKLIRSRGRLKE 616
           GH FCGRCFARI+NA          LA+L G +HPDNYGP++CPA+ C+  +R+RG+++E
Sbjct: 495 GHTFCGRCFARINNAKRFSKISKKRLAELHGPSHPDNYGPRVCPAEGCRGQLRTRGKMRE 554

Query: 617 VYF 619
           V+F
Sbjct: 555 VFF 557

>Kwal_27.9824 s27 (74597..76354) [1758 bp, 585 aa] {ON} YDL013W
           (HEX3) - involved in hexose metabolism [contig 43] FULL
          Length = 585

 Score =  353 bits (906), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 199/474 (41%), Positives = 270/474 (56%), Gaps = 16/474 (3%)

Query: 155 LTIVEERTTRPRVTLNLPGGERLEVTATTTDIPIRRSFEFQE----DLGASRRQLLRRSA 210
           L I+EERT+ P   LNLPGGE L +  +  D P+RRSF+ Q     D   +RR+L RR+A
Sbjct: 119 LVILEERTSSPSFVLNLPGGEYLRINGSPLDQPVRRSFQAQAPRQFDSAGARRRLARRTA 178

Query: 211 TRARNLFVDRSD-ENDEDWTDDTHNLPEAXXXXXXXXXXXXXXXXXXXXXXXXXXXXSSD 269
             A NLF+  SD E +E    +T+ LP                                 
Sbjct: 179 RTASNLFMQPSDDEQEESVEGNTYQLPSTVMARRQRNALLMQRRPQPSRRQPVRGF---- 234

Query: 270 ENISTSIRLQSIRERIQSYTPDIRSAFHRAESLHEFRSILQNVAPITLQECEEELMALFT 329
             +  S  L ++  +I    P++RSAF  A+S+HEFRSILQ++      + +++L +LF+
Sbjct: 235 -GMIQSPELSALEAQINRLPPNVRSAFDHAQSVHEFRSILQSIDWQNYHQRQDDLTSLFS 293

Query: 330 EFRNQLLQNWAIDRVRNTXXXXXXXXXXXXXXXXXTAGRVFHRGTLRESITNYLN---FN 386
           E+R  LL++ +  R+R                   +A  + +  +L   +    N     
Sbjct: 294 EYRANLLRSRSNQRIRRPGERSRLDSRMAGQDP--SAQNLPYSPSLVGIMAQTFNPVLGR 351

Query: 387 GEDGFLSRLWSG-PALSDADEERHTQNIIDMIQEREERERDVVMKNLMNKTXXXXXXXXX 445
              G+ +R   G     + DEE+ TQNII MIQEREE+E +   +  M  T         
Sbjct: 352 MHMGYDARTHGGIMGYGEVDEEQQTQNIIQMIQEREEQEYEARKRKYMEDTKSKQLGYLE 411

Query: 446 XXXSLPEGYSASFDTTPKMKLDITKNGKEETIIVTDDDLAKTLEDIPVCCLCGAELGVGI 505
               LPEGYS+SFDTTPKM + I KNGKEE + VTDD  A    D+P C LCG ELGVGI
Sbjct: 412 KAVKLPEGYSSSFDTTPKMNITIKKNGKEEELTVTDDQAAAFYMDLPSCSLCGVELGVGI 471

Query: 506 PDDFTGISQKDRGVSFEGLVSKYKFHCPYQTLARPSMLDRDLSKRTFIASCGHAFCGRCF 565
           PD+F G+S +DRGVSFE L +KY+FHCPYQ L++PS++DRDLS+RT++A+CGH+FCGRCF
Sbjct: 472 PDEFQGLSTQDRGVSFEALKAKYEFHCPYQALSKPSLVDRDLSRRTYVAACGHSFCGRCF 531

Query: 566 ARIDNAXXXXXXXXXXLAQLKGSAHPDNYGPKLCPADSCKKLIRSRGRLKEVYF 619
           ARIDNA          L  LKG++HPDNYGPK CPA  C   +R+RG+++EVYF
Sbjct: 532 ARIDNARSFNRASKQKLKDLKGASHPDNYGPKKCPAKDCNNQLRNRGKMREVYF 585

>KLTH0E15884g Chr5 complement(1408264..1410024) [1761 bp, 586 aa]
           {ON} similar to uniprot|P32828 Saccharomyces cerevisiae
           YDL013W HEX3 Ring finger protein involved in the DNA
           damage response with possible recombination role
           genetically identified by synthetic lethality with SGS1
           (DNA helicase) and TOP3 (DNA topoisomerase) sporulation
           role interacts with Slx8p and Lin1p
          Length = 586

 Score =  348 bits (892), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 208/482 (43%), Positives = 276/482 (57%), Gaps = 32/482 (6%)

Query: 155 LTIVEERTTRPRVTLNLPGGERLEVTATTTDIPIRRSFEFQ----EDLGASRRQLLRRSA 210
           L I+EER   P   LNLPGGE L+++ +  D P+RRSF+ Q     +    RR+LLRR+A
Sbjct: 120 LVILEERNNSPSFVLNLPGGEHLQISGSPLDQPVRRSFQTQGNRHTNSANGRRRLLRRTA 179

Query: 211 TRARNLFVDRSDENDEDWT-DDTHNLPEAXXXXXXXXXXXXXXXXXXXXXXXXXXXXSSD 269
            RA +LF+  SDE DE +  ++T  LP                                D
Sbjct: 180 RRASSLFLHPSDEEDEGFAYENTDLLPTGVRLRRQRNSMMQRRPNPPRRQLLGTGDDVDD 239

Query: 270 ENISTSIRLQSIRERIQSYTPDIRSAFHRAESLHEFRSILQNVAPITLQECEEELMALFT 329
                   L S+  +I S+  ++RSAF  A+S+HEFRSILQ+V   + ++ ++EL  LFT
Sbjct: 240 P------ELLSLEAQINSFPFEVRSAFDHAQSIHEFRSILQSVDRQSYEQRQDELTHLFT 293

Query: 330 EFRNQLLQNWAIDRVR---------NTXXXXXXXXXXXXXXXXXTAG---RVFHRGTLRE 377
            +R  ++++WA DR+R         NT                  AG   R F+      
Sbjct: 294 VYRGHVMRSWANDRLRRARDAASGMNTRTTDRTSQAHNLRYSPTLAGIIARTFN------ 347

Query: 378 SITNYLNFNGEDGFLSRLWSGPALSDADEERHTQNIIDMIQEREERERDVVMKNLMNKTX 437
            I  +++   E G  + +    A +DADEER TQNII MIQEREERE +   +  M  T 
Sbjct: 348 PILGHMHMAYEPGLGTGMA---AYNDADEERQTQNIIQMIQEREEREFESRKRKYMEDTK 404

Query: 438 XXXXXXXXXXXSLPEGYSASFDTTPKMKLDITKNGKEETIIVTDDDLAKTLEDIPVCCLC 497
                       LP+GYSASFDTTP+M + I KNG+ E + V DD       DIP CCLC
Sbjct: 405 PKQSGYLQKAAKLPDGYSASFDTTPRMNISIMKNGQNEELTVVDDHADALYMDIPACCLC 464

Query: 498 GAELGVGIPDDFTGISQKDRGVSFEGLVSKYKFHCPYQTLARPSMLDRDLSKRTFIASCG 557
           G ELGVGIPD F G+ ++DRGVSFE L +KY FHCPYQTL++PS+ DRDLS+RT++A CG
Sbjct: 465 GVELGVGIPDGFQGLYEEDRGVSFEALKAKYNFHCPYQTLSKPSVADRDLSRRTYVAQCG 524

Query: 558 HAFCGRCFARIDNAXXXXXXXXXXLAQLKGSAHPDNYGPKLCPADSCKKLIRSRGRLKEV 617
           H+FCGRCFARIDNA          L++LKG+++PDNYGPK CPA  C   +RSRG+++EV
Sbjct: 525 HSFCGRCFARIDNARSFNRASKKKLSELKGASNPDNYGPKNCPAKDCNNRLRSRGKMREV 584

Query: 618 YF 619
           YF
Sbjct: 585 YF 586

>KLLA0C04411g Chr3 (403257..405080) [1824 bp, 607 aa] {ON} similar
           to uniprot|P32828 Saccharomyces cerevisiae YDL013W HEX3
           Ring finger protein involved in the DNA damage response
           with possible recombination role genetically identified
           by synthetic lethality with SGS1 (DNA helicase) and TOP3
           (DNA topoisomerase) sporulation role interacts with
           Slx8p and Lin1p
          Length = 607

 Score =  325 bits (834), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 234/641 (36%), Positives = 315/641 (49%), Gaps = 85/641 (13%)

Query: 24  VILIDSDKEEDASIREANLPVRLYPDRRVGRRRDALNRFVRSDSRSRNSQRTHITASSER 83
           VI IDSD E DA IRE   P RL PDRR  R RD L+RFV S++  RN     I  +++ 
Sbjct: 7   VIEIDSDPELDAQIREEYAPRRLIPDRRRNRPRDHLSRFV-SNAEDRNV--APIAPATDL 63

Query: 84  PDFQANNDDITIIREVGRFFGDDGPIDPSAHYVDLDQEPGSETLETPRTIQVXXXXXXXX 143
           P    + +D+ I  EV      DGPI+  A Y++LD    S       T+ V        
Sbjct: 64  P-VSTDGEDLEITAEVS--LRPDGPINDDAEYINLDNYRASNN----GTVVVDHREGDDD 116

Query: 144 XXXXXXXXXXXLTIVEER---TTRPRVTLNLPGGERLEVTATTTDIPIRRSFEFQEDLGA 200
                      L +VEER   + RP V L LP G+ L+V A+  ++P+ RSF+ Q     
Sbjct: 117 -----------LMLVEERIQESGRP-VLLQLPAGQTLQVDASWNELPVGRSFQNQVYRNP 164

Query: 201 SRRQLLRRSATRARNLFV---DRSDENDEDWTDDTHNL--PEAXXXXXXXXXXXXXXXXX 255
           ++ + LRR    A  +F+   ++S   D D++D+  +   P+                  
Sbjct: 165 NQLRRLRRHIDHATAMFMGGYNQSGTGDSDFSDNDADYIPPDIVNERNQYTMQTRMREQR 224

Query: 256 XXXXXXXXXXXSSDENISTSIRLQSIRERIQSYTPDIRSAFHRAESLHEFRSILQ--NVA 313
                      ++DE I              S  PD+RS F  ++SL +FR  L   N  
Sbjct: 225 ERQNQMQRLQRAADETID-------------SLDPDLRSLFFESQSLSQFREGLARFNFP 271

Query: 314 PITLQECEEELMALFTEFRNQLLQNWAIDRVRNTXXXXXXXXXXXXXXXXXTAGRVFHRG 373
           P  L    E+L+  + +FR + +Q+WA  R R                      +   RG
Sbjct: 272 PARL----EQLLGQYRDFRARAMQSWAEGR-RTRSMSYQNRNSLRPQRTRSGTQQNHSRG 326

Query: 374 TLRESITNYL------------------NFNGEDGFLSRLWS--------------GPAL 401
           +  +S  N L                  NF G    L R+ S              GP  
Sbjct: 327 SNGDSRDNALYQQMLFGMPDDDENMDGNNFTGTTQSLQRIISNTMNRRFGNLPFGVGPEF 386

Query: 402 S---DADEERHTQNIIDMIQEREERERDVVMKNLMNKTXXXXXXXXXXXXSLPEGYSASF 458
               D D+  +T+ II MIQEREER+     K L   T            SLPEGYSASF
Sbjct: 387 GFYEDGDDAANTELIIRMIQEREERDASTRTKKLNEVTKSQQQKYIDKANSLPEGYSASF 446

Query: 459 DTTPKMKLDITKNGKEETIIVTDDDLAKTLEDIPVCCLCGAELGVGIPDDFTGISQKDRG 518
           +T P M + +   G+EET++VTDD  AKT  D+PVC LCG ELGVGIPDD+ G+S++D+G
Sbjct: 447 NTAPLMSMTMENEGREETVMVTDDVAAKTYIDVPVCVLCGVELGVGIPDDWKGVSEEDKG 506

Query: 519 VSFEGLVSKYKFHCPYQTLARPSMLDRDLSKRTFIASCGHAFCGRCFARIDNAXXXXXXX 578
           VSFE L S YKFHCPYQTLARP+++DRDLS+RT+++SCGH FCGRC  RI NA       
Sbjct: 507 VSFEALQSHYKFHCPYQTLARPTLVDRDLSRRTYVSSCGHTFCGRCQVRIKNARDISAKE 566

Query: 579 XXXLAQLKGSAHPDNYGPKLCPADSCKKLIRSRGRLKEVYF 619
              L   +G +HPDNYGPK CPA+ C   +R +G ++EVYF
Sbjct: 567 KNKLKNSQGPSHPDNYGPKKCPAEGCNSNLRKKGIMREVYF 607

>TBLA0F00720 Chr6 (182887..184836) [1950 bp, 649 aa] {ON} Anc_3.186
           YDL013W
          Length = 649

 Score =  317 bits (811), Expect = 6e-99,   Method: Compositional matrix adjust.
 Identities = 211/635 (33%), Positives = 304/635 (47%), Gaps = 66/635 (10%)

Query: 24  VILIDSDKEEDASIREANLPVRLYPDRRVGRRRDALNRFVR-SDSRSRNSQRTHITASSE 82
           VI+I+SD EEDA  +  N+P          + RD  +RF R  D+ +  +  + ++A+ +
Sbjct: 42  VIVIESDAEEDAIDKNRNVPW--------SQPRDEFHRFARIYDNINERNNHSSLSATLD 93

Query: 83  RPDFQANNDDITIIR--------EVGRF-------------------------FGDDGPI 109
           R     N    +I R        EVG                               GP+
Sbjct: 94  R----GNTPTTSIPRGTLPTQTFEVGHHNNAPDNNADDDDDDDIIITNEIIAPVDPSGPL 149

Query: 110 DPSAHYVDLDQEP---GSETLETPRTIQVXXXXXXXXXXXXXXXXXXXLTIVEERTTRPR 166
           +PS  YVDLD E     +      RT+ +                   L IV+ERT+ P 
Sbjct: 150 NPSTEYVDLDNEAEYSSNNNYGHSRTL-IVDGDNDNADVIDDGNGADDLVIVQERTSAPT 208

Query: 167 VTLNLPGGERLEVTATTTDIPIRRSFEFQEDLGASRRQLLRRSATRARNLFVDRSDENDE 226
           VTL LPG   +++ A  TD P+R SF +Q  +  SRR +L R     R LF +  ++   
Sbjct: 209 VTLTLPGNRSIQINAAPTDRPVRSSFGWQGGVPDSRRGMLARRYNSVRQLFFNSDEDASR 268

Query: 227 DWTDDTHNLPEAXXXXXXXXXXXXXXXXXXXXXXXXXXXXSSDENIS--TSIRLQSIRER 284
           + +D      +                                +  S   S  +  +R R
Sbjct: 269 NGSDSDSYDDDYTPARLQRIQNRERNAVRQRMMQQRRQQQILRQEQSRNESPIMAELRRR 328

Query: 285 IQSYTPDIRSAFHRAESLHEFRSILQNVAPITLQECEEELMALFTEFRNQLLQNWAIDRV 344
           I +Y PD+RS F  A +L+EF +++Q+ APITL++   +L+ +FT +R  L QNW I+R+
Sbjct: 329 INAYPPDVRSIFDHATTLNEFLALMQSTAPITLEDNRTDLIDIFTLYRGNLTQNWMINRM 388

Query: 345 RNTXXXXXXXXXXXXXXXXXTAGRVFHRGTLRESITNYLNFNGEDGFLSRLWSGPALSDA 404
            N+                  A   F +G L     + +   G+  +          +++
Sbjct: 389 -NSSRDNSARTASSTPMRNMPAHTRFVQGFLH----SIMGLGGDFPY--------GGTES 435

Query: 405 DEERHTQNIIDMIQEREERERDVVMKNLMNKTXXXXXXXXXXXXSLPEGYSASFDTTPKM 464
           DEE  TQNII MI+ERE  ERD  +K LM KT             LP+G+SASF   PK 
Sbjct: 436 DEEATTQNIIRMIEEREANERDSKVKQLMKKTKKQQEDFENKAKYLPKGFSASFSLVPKK 495

Query: 465 KLDITKNGKEETIIVTDDDLAKTLEDIPVCCLCGAELGVGIPDDFTGISQKDRGVSFEGL 524
            + I  +  +  I VTD+ LA+  E++PVCCLCG ELGVGIPD F GI+ ++  VSF+ L
Sbjct: 496 IISIDGDDSKREI-VTDEFLAEEYEELPVCCLCGVELGVGIPDSFRGITPEESKVSFDSL 554

Query: 525 VSKYKFHCPYQTLARPSMLDRDLSKRTFIASCGHAFCGRCFARIDNAXXXXXXXXXXLAQ 584
           V KY   CPY  L+ P  +DRDLS+RT++ASCGH+FCGRC  RI++A          L +
Sbjct: 555 VKKYNIPCPYNALSAPGDIDRDLSRRTYVASCGHSFCGRCVRRINHAKESGKISKQKLKE 614

Query: 585 LKGSAHPDNYGPKLCPADSCKKLIRSRGRLKEVYF 619
           L G  +PD YGPK CPA  C   +R +G+++EVYF
Sbjct: 615 LVGPENPDIYGPKTCPATDCTGKLRRKGQMREVYF 649

>TDEL0D04350 Chr4 complement(793070..794740) [1671 bp, 556 aa] {ON}
           Anc_3.186 YDL013W
          Length = 556

 Score =  301 bits (770), Expect = 7e-94,   Method: Compositional matrix adjust.
 Identities = 206/589 (34%), Positives = 292/589 (49%), Gaps = 86/589 (14%)

Query: 62  FVRSDSRSRNSQRTHITASSER----PDFQANNDDITIIREVGRFFGDDGPIDPSAHYVD 117
            + SD    +S+ + + +S+ R    P+   +N    + RE  R      P+  +A Y+D
Sbjct: 23  LIESDDEQHSSRDSGLRSSTTRDTMSPNSNGSNQSEVVSRESSRNADSVSPMGSTAEYID 82

Query: 118 LDQEPGS-----------ETLETPRTIQVXXXXXXXXXXXXXXXXXXXLTIVEERTTRPR 166
           L+ EP             E L TPR  +                    L  V+E+T    
Sbjct: 83  LEMEPAGNEEQDDMIVYDERLSTPRDAE-----------------DDELIFVQEQTRPST 125

Query: 167 VTLNLPGGERLEVTATTTDIPIRRSFEFQ-------EDLGASRRQLLRRSATRARNLFVD 219
           + LNLPG   + +TAT  D P RRSFE Q            +RRQ +RR+A RA N  ++
Sbjct: 126 IQLNLPGRNPMRITATEYDRPARRSFEQQASNRQLRHQTRVARRQPMRRAARRA-NHSMN 184

Query: 220 RSDENDEDWTDDTHNLPEAXXXXXXXXXXXXXXXXXXXXXXXXXXXXSSDENISTSIRLQ 279
             + +D   T                                     S+   I+      
Sbjct: 185 GYESDDGGLT-------------------------------------SNRNQINYDPEFA 207

Query: 280 SIRERIQSYTPDIRSAFHRAESLHEFRSILQNVAPITLQECEEELMALFTEFRNQLLQNW 339
           +I+ R+ SY  DIRSAF  A++++EF SI++NV P+T Q+C  +L  LF ++R  + +  
Sbjct: 208 AIQRRLDSYPLDIRSAFLHAQNMNEFSSIIENVDPLTWQDCRYDLERLFMDYRRMMARRA 267

Query: 340 AIDRVRNTXXXXXXXXXXXXXXXXXTAGRVFHR---GT-LRESITNYLNFNGEDGFLS-R 394
           A                          G +  R   GT + ES+T+Y+   G  G+ S R
Sbjct: 268 AQIGQNMPGYRSPPNRTQGNADLLRRLGPLGVRIGIGTGMGESLTHYILEPGIFGYGSFR 327

Query: 395 LWSGPALSD--ADEERHTQNIIDMIQEREERERDVVMKNLMNKTXXXXXXXXXXXXSLPE 452
           +   P   D   +EE  TQ+I++ IQEREE+ERD   K+ M KT            +LPE
Sbjct: 328 MIGNPGGFDDGMEEEARTQSILNAIQEREEQERDAQTKSNMEKTRSQEENFIEKCKNLPE 387

Query: 453 GYSASFDTTPK-MKLDITKNGKEETIIVTDDDLAKTLEDIPVCCLCGAELGVGIPDDFTG 511
           GYSASFDTTP  ++L+   +G ++ I+V D+      E+I VCCLCG ELGVG+PDDFTG
Sbjct: 388 GYSASFDTTPTTVRLEPLNDGNKQAIVVEDESAIAEWEEIAVCCLCGVELGVGLPDDFTG 447

Query: 512 ISQKDRGVSFEGLVSKYKFHCPYQTLARPSMLDRDLSKRTFIASCGHAFCGRCFARIDNA 571
           IS  DR +SF+ LV+KY  HCPYQ+L   +  +R LS +TF+ASCGH FCGRC  RI+NA
Sbjct: 448 ISADDRHLSFDELVTKYCSHCPYQSLTSANGTERALSMKTFVASCGHTFCGRCVVRIENA 507

Query: 572 XXXXXXXXXXLAQLKGSAHPDNYGPKLCPADSCKKLIR-SRGRLKEVYF 619
                     L++ KG  HPDNYGP+LCPA  CK+ IR  R +++E +F
Sbjct: 508 RTHSKSSKKELSKFKGPLHPDNYGPRLCPATGCKQNIRLGRTKMREAFF 556

>KNAG0J01270 Chr10 (226858..228501) [1644 bp, 547 aa] {ON} Anc_3.186
           YDL013W
          Length = 547

 Score =  256 bits (654), Expect = 5e-77,   Method: Compositional matrix adjust.
 Identities = 149/353 (42%), Positives = 193/353 (54%), Gaps = 32/353 (9%)

Query: 281 IRERIQSYTPDIRSAFHRAESLHEFRSILQNVAPITLQECEEELMALFTEFRNQLLQNWA 340
           IR RI SY P+I+S FH A+SL EF  I+QN  PIT  EC ++L  LF+++  Q +Q+  
Sbjct: 213 IRARINSYPPNIQSTFHYAQSLPEFTYIVQNTDPITFAECRDDLTNLFSQY--QSMQH-- 268

Query: 341 IDRVRNTXXXXXXXXXXXXXXXXXTAGRVFHRGTLRESITNYLNFNGEDG---------- 390
            DR+RN                      V H    R     +  +  ++           
Sbjct: 269 DDRMRNVGQQGSRQSEPRHGTNYSQRSAVSHSNN-RYFYPEFNQYESDEARAQSLLPRIH 327

Query: 391 -FLS-RLWSGPALSDADEERHTQNIIDMIQEREERERDVVMKNLMNKTXXXXXXXXXXXX 448
            FL  RL   P   + DEE  TQNII MIQERE+ ERD  +KN  +K+            
Sbjct: 328 DFLQMRLMGYP---NDDEETTTQNIISMIQEREDTERDTRVKNFTDKSKPLLKSILKEAK 384

Query: 449 SLPEGYSASFD--TTPKMKLDITKNGKEETIIVTDDDLAKTLEDIPVCCLCGAELGVGIP 506
           SLP  YSASF   ++P  K  I      ET            E++  C LCG+ELGVGIP
Sbjct: 385 SLPSNYSASFHYPSSPS-KPQIPGGSTSET---------AESEEVSCCVLCGSELGVGIP 434

Query: 507 DDFTGISQKDRGVSFEGLVSKYKFHCPYQTLARPSMLDRDLSKRTFIASCGHAFCGRCFA 566
           D F G S +DR + F  L+SKY F CPYQ+L RP+ LDRDLSKRTF++ CGH +CGRCFA
Sbjct: 435 DSFIGRSAEDRDLDFSSLISKYSFPCPYQSLIRPNQLDRDLSKRTFMSKCGHVYCGRCFA 494

Query: 567 RIDNAXXXXXXXXXXLAQLKGSAHPDNYGPKLCPADSCKKLIRSRGRLKEVYF 619
           RIDNA          LA LKG ++P+ YGP++C AD C  +IR++ RL+E+YF
Sbjct: 495 RIDNAKAKSKISKKELASLKGCSNPNIYGPRICVADGCTAVIRAKARLRELYF 547

>Kpol_1036.52 s1036 complement(140685..142460) [1776 bp, 591 aa]
           {ON} complement(140685..142460) [1776 nt, 592 aa]
          Length = 591

 Score =  247 bits (630), Expect = 5e-73,   Method: Compositional matrix adjust.
 Identities = 138/352 (39%), Positives = 186/352 (52%), Gaps = 21/352 (5%)

Query: 278 LQSIRERIQSYTPDIRSAFHRAESLHEFRSILQNVAPITLQECEEELMALFTEFRNQLLQ 337
           +  I   I  Y  +IRSAF  A S +EF +I++    + + +   +L     + RN+  Q
Sbjct: 251 IDEIAREISLYHTNIRSAFIHANSFNEFMAIIEVAPRLGITDDLVDLYLRLEDLRNRTHQ 310

Query: 338 NWA-----IDRVRNTXXXXXXXXXXXXXXXXXTAGRV---FHRGTLRESITNYLNFNGED 389
             +     ID + +                  T   +   FH   +R    NY   + +D
Sbjct: 311 ANSLFVPDIDNISSNSETTRYDEGWNPVTHPVTNRFIEDSFHSPMIRRIFGNYGGRHHQD 370

Query: 390 GFLSRLWSGPALSDADEERHTQNIIDMIQEREERERDVVMKNLMNKTXXXXXXXXXXXXS 449
                        D DEE  TQ+II MIQEREE E+D+  K     T             
Sbjct: 371 -----------YDDDDEEGRTQSIITMIQEREEVEKDLRTKKYSESTKEKQDEFERRATE 419

Query: 450 LPEGYSASFDTTPKMKLDITKNGKEETIIVTDDDLAKTLEDIPVCCLCGAELGVGIPDDF 509
           LP+GYS+SF+T PK K+D+TKNG   ++ V DD +A+  E+IP+CCLCG  L  GIPD+F
Sbjct: 420 LPDGYSSSFNTEPKAKVDMTKNGVNGSVSVVDDTMAEDWEEIPICCLCGVTLSEGIPDEF 479

Query: 510 TGISQKDRGVSFEGLVSKYKFHCPYQTLARPSMLDRDLSKRTFIASCGHAFCGRCFARID 569
            G+S +DR + FE L  KY   CPYQ L RPS  DRD SKR ++A+CGH +CGRC+ RI 
Sbjct: 480 QGMSNEDRFLPFEELKEKYDSFCPYQCLIRPSQSDRDFSKRVYVANCGHTYCGRCYRRIQ 539

Query: 570 NAXXXXXXXXXXLAQLKGSAHPDNYGPKLCPADSCKKLIR-SRG-RLKEVYF 619
           N+          LA+LKG+ HPDNYGPK CP  SC +L+R SRG   +E YF
Sbjct: 540 NSKEKSKLPKSQLAKLKGACHPDNYGPKKCPVTSCNRLLRISRGVAFREAYF 591

 Score = 57.8 bits (138), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 44/140 (31%), Positives = 62/140 (44%), Gaps = 13/140 (9%)

Query: 88  ANNDDITIIREVGRFFGDDGPIDPSAHYVDLDQEPGSETLETPRTIQVXXXXXXXXXXXX 147
           ANNDDITI+RE+ R    +   +    YVDLD EP          +              
Sbjct: 96  ANNDDITIVREINRSPRRERRNESVTEYVDLDHEPEDVEPIGTSNLDGRSSGSNVNDRDR 155

Query: 148 XXXXXXXLTIVEERTTRPR---VTLNLPGGERLEVTATTTDIPIRRSFEFQED-----LG 199
                  L I+ E+  +P    + L +PG + +E+   +TDIP R SFE+Q D     LG
Sbjct: 156 NNSNIDDLIIISEQHPQPSANSIFLTIPGRQLMELQVASTDIPTRSSFEYQNDRRPVRLG 215

Query: 200 AS-----RRQLLRRSATRAR 214
            S      RQ ++ S +R R
Sbjct: 216 NSGRPRINRQYMQNSFSRVR 235

>TPHA0A04370 Chr1 (980168..982162) [1995 bp, 664 aa] {ON} Anc_3.186
           YDL013W
          Length = 664

 Score =  203 bits (517), Expect = 2e-56,   Method: Compositional matrix adjust.
 Identities = 104/240 (43%), Positives = 142/240 (59%), Gaps = 27/240 (11%)

Query: 407 ERHTQNIIDMIQEREERERDVVMKNLMNKTXXXXXXXXXXXXSLPEGYSASFDTTPKMKL 466
           E+ TQ++I MIQEREERE D+  +    K             ++PEGYS+SF T   +KL
Sbjct: 425 EQETQDLIAMIQEREEREHDIRTRKFTKKNEKLQQLIREKAKTIPEGYSSSFSTEVPVKL 484

Query: 467 --DITKNGK-----EETIIVTDDDLA----KTLEDIPVCCLCGAELGVGIPDDFTGISQK 515
                KNG      EE  +  DD+      +++ ++PVCCLCG ELG+GIP+ F GIS +
Sbjct: 485 IDKQDKNGNNVIMLEEQQVEVDDEFGNKKNESVIEVPVCCLCGVELGIGIPETFAGISAE 544

Query: 516 DRGVS-FEGLVSKYKFHCPYQTLARPSMLDRDLSKRTFIASCGHAFCGRCFARI------ 568
           D+ +  F+ + +KY F CPYQT+ RP+ LDRDLS+RTFI++CGHAFCGRC+ RI      
Sbjct: 545 DKKLECFKDIATKYGFSCPYQTMVRPTELDRDLSRRTFISNCGHAFCGRCYNRIHLAKAE 604

Query: 569 --DNAXXXXXXXXXXLAQ-------LKGSAHPDNYGPKLCPADSCKKLIRSRGRLKEVYF 619
              N           L+Q       + GS +PDNYGPK+CP   CK  IR+R +++E YF
Sbjct: 605 TKKNNGRDITNKLTRLSQSNRISPVILGSLNPDNYGPKICPGSDCKYQIRARTKMREAYF 664

 Score = 47.0 bits (110), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 19/45 (42%), Positives = 28/45 (62%)

Query: 155 LTIVEERTTRPRVTLNLPGGERLEVTATTTDIPIRRSFEFQEDLG 199
           + + E+    P + LNLPGG   E++ TT D+P R SFE  ++LG
Sbjct: 116 MIVGEQVIENPHILLNLPGGRTFELSTTTNDLPFRSSFEMLQNLG 160

>CAGL0K01881g Chr11 (167939..169459) [1521 bp, 506 aa] {ON} weakly
           similar to uniprot|P32828 Saccharomyces cerevisiae
           YDL013w Hexose metabolism-related protein
          Length = 506

 Score =  199 bits (507), Expect = 3e-56,   Method: Compositional matrix adjust.
 Identities = 101/219 (46%), Positives = 137/219 (62%), Gaps = 11/219 (5%)

Query: 402 SDADEERHTQNIIDMIQEREERERDVVMKNLMNKTXXXXXXXXXXXXSLPEGYSASFDTT 461
           S+ DEE  TQ+IID+IQ+REE ERD  +K    K+             LP GYSASF T 
Sbjct: 298 SEDDEEAQTQSIIDIIQQREESERDKRVKEYTRKSESQKKKFYEEAKQLPPGYSASFATP 357

Query: 462 PKMKLDITKNGKEETIIVTDDDLAKTLEDIPVCCLCGAELGVGIPDDFTGISQKDRGVSF 521
             ++ +  ++                 ED+ VC LCG ELG+GIP++FTGIS++D  +SF
Sbjct: 358 EVIRENDDEDNSN----------NDDDEDMIVCNLCGVELGIGIPEEFTGISKEDFALSF 407

Query: 522 EGLVSKYKFHCPYQTLARPSMLDRDLSKRTFIASCGHAFCGRCFARIDNAXXXXXXXXXX 581
             L+ KY   CPYQ+L +PS LDRDLSKRT++++CGH FCGRC+ R  NA          
Sbjct: 408 AELMDKYGSRCPYQSLGKPSELDRDLSKRTYVSNCGHLFCGRCWRRYLNARSLMKTKAGK 467

Query: 582 LAQLK-GSAHPDNYGPKLCPADSCKKLIRSRGRLKEVYF 619
              +K G++HPDN+ PK+CPAD+CK  IRS+G+++EVYF
Sbjct: 468 SLNVKLGASHPDNFAPKVCPADNCKYQIRSKGKMREVYF 506

 Score = 45.1 bits (105), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 31/87 (35%), Positives = 48/87 (55%), Gaps = 13/87 (14%)

Query: 155 LTIVEERTTRPRVTLNLPGGERLEVTATTTDIPIRRSFE---------FQEDLGASRR-Q 204
           +T++EER     V LNLPGG R+ V A   + P+R SFE         +   + A R+ Q
Sbjct: 118 VTLLEERLADGLVPLNLPGGRRIIVNAANGEAPVRSSFERLMRNNQLRYLRTVPAERQNQ 177

Query: 205 LLRRSATRARN--LFVDRSDEN-DEDW 228
            ++R+    RN  +FV  SD++ D++W
Sbjct: 178 RVQRNYRPVRNDGMFVPESDDSQDDEW 204

>KLTH0A05214g Chr1 (434058..435248) [1191 bp, 396 aa] {ON} similar
           to uniprot|P40507 Saccharomyces cerevisiae YIL079C AIR1
           and similar to uniprot|Q12476 Saccharomyces cerevisiae
           YDL175C AIR2
          Length = 396

 Score = 32.7 bits (73), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 16/35 (45%), Positives = 21/35 (60%), Gaps = 5/35 (14%)

Query: 88  ANNDDITIIREVGRFFGDDGPIDPSAHYVDLDQEP 122
           +N +D+  +R  GR+FG D P DPS     LD EP
Sbjct: 63  SNPEDLRYLRGKGRYFGVDDPSDPS-----LDAEP 92

>CAGL0E02893g Chr5 (273462..276254) [2793 bp, 930 aa] {ON} similar
           to uniprot|P32786 Saccharomyces cerevisiae YBL014c RRN6
           RNA polymerase I specific transcription initiation
           factor
          Length = 930

 Score = 32.3 bits (72), Expect = 4.3,   Method: Compositional matrix adjust.
 Identities = 26/71 (36%), Positives = 37/71 (52%), Gaps = 4/71 (5%)

Query: 274 TSIRLQSIRERI--QSYTPDIRSAFHR-AESLHEFRSILQNVAPITLQECEEELMALFTE 330
           TSI+LQS+  +I  QS   +I+S   + +E   E   I  NV   TL +   E +     
Sbjct: 695 TSIKLQSLMPKIPVQSDLTEIQSFLEQLSEHYSELGLIFTNVIK-TLNQIIHEDIPTIDV 753

Query: 331 FRNQLLQNWAI 341
           F N+LLQ W+I
Sbjct: 754 FYNKLLQCWSI 764

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.318    0.134    0.391 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 55,685,101
Number of extensions: 2104757
Number of successful extensions: 6310
Number of sequences better than 10.0: 26
Number of HSP's gapped: 6375
Number of HSP's successfully gapped: 49
Length of query: 619
Length of database: 53,481,399
Length adjustment: 116
Effective length of query: 503
Effective length of database: 40,180,143
Effective search space: 20210611929
Effective search space used: 20210611929
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 69 (31.2 bits)