Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
YDL010W (GRX6)3.189ON23123111511e-161
Skud_4.2423.189ON2322329251e-127
Smik_4.2233.189ON2322329231e-127
Suva_4.2383.189ON2332338971e-123
KAFR0A012303.189ON2202304954e-62
TBLA0F007503.189ON2341634443e-54
Kwal_56.231143.189ON2102314302e-52
ZYRO0A04928g3.189ON2512564322e-52
TDEL0D043203.189ON2431644253e-51
SAKL0C10494g3.189ON2302334071e-48
KLTH0G16060g3.189ON2132334051e-48
AER017C3.189ON2161703885e-46
NDAI0G018003.189ON2222283633e-42
NCAS0E016003.189ON2292233556e-41
Kpol_1045.693.189ON2622573507e-40
Suva_2.1413.189ON2041113432e-39
YBR014C (GRX7)3.189ON2032193397e-39
Smik_2.1333.189ON2041113353e-38
KLLA0E17733g3.189ON2111623345e-38
Ecym_53133.189ON2481163296e-37
Skud_2.1263.189ON2041113196e-36
KNAG0J012603.189ON1941343022e-33
TPHA0H006303.189ON1911102561e-26
CAGL0I04554g3.189ON2261972553e-26
KAFR0A038708.679ON2671862296e-22
SAKL0H06468g8.679ON2581352242e-21
NCAS0C013408.679ON3571442179e-20
NDAI0E011508.679ON2361682092e-19
NDAI0K013508.679ON2711752023e-18
Kpol_1072.148.679ON2501851981e-17
NCAS0B016408.679ON2401091971e-17
KNAG0G025808.679ON2781811884e-16
TPHA0G015908.679ON2971321814e-15
KLLA0D05973g8.679ON2811251796e-15
YPL156C (PRM4)8.679ON2841321692e-13
TBLA0B038208.679ON2511711672e-13
Kwal_26.88148.679ON2751291656e-13
Suva_16.1548.679ON2831321648e-13
Ecym_23948.679ON2811251631e-12
Skud_16.1268.679ON2871321603e-12
KLTH0D11308g8.679ON2711951551e-11
Smik_6.3538.679ON2861331542e-11
CAGL0M02167g8.679ON2331701513e-11
ACR146W8.679ON2131471478e-11
NDAI0F044301.38ON136831385e-10
Kpol_2002.361.38ON109881355e-10
CAGL0K05813g1.38ON142871342e-09
Kwal_33.131661.38ON138821323e-09
Smik_4.7941.38ON143881314e-09
Suva_2.6931.38ON143881315e-09
TBLA0A050801.38ON118931295e-09
YDR513W (GRX2)1.38ON143881305e-09
Skud_4.7881.38ON145881306e-09
TPHA0B03560singletonON106841269e-09
NCAS0A003601.38ON138871262e-08
KLLA0C01298g1.38ON107951233e-08
KNAG0C004501.38ON157841263e-08
Kpol_2000.991.38ON141881254e-08
Ecym_10441.38ON1581131254e-08
TPHA0E037301.38ON106951216e-08
KLTH0F01276g1.38ON1381081227e-08
AFR710W1.38ON111971163e-07
TDEL0E05740singletonON108811145e-07
ZYRO0F17732g1.38ON139821141e-06
TDEL0C066401.38ON143871132e-06
TPHA0B048201.38ON138811122e-06
KAFR0D003601.38ON109831084e-06
SAKL0C01320g1.38ON165851114e-06
KNAG0F002501.38ON142881086e-06
NDAI0A003801.38ON109871041e-05
NCAS0B088701.38ON109881041e-05
KLTH0A04004g7.226ON52271994e-04
Smik_3.421.38ON11081900.001
Suva_3.1781.38ON31688940.001
YCL035C (GRX1)1.38ON11074860.004
Skud_3.271.38ON11075860.004
Kwal_47.181637.226ON52271900.006
SAKL0F08294g7.226ON52388870.015
KNAG0L013707.226ON520117870.015
TDEL0H021907.226ON51858860.017
NDAI0E028908.519ON15597810.028
Suva_16.2558.519ON149115810.029
KAFR0L007807.226ON524118830.046
KLLA0F27599g7.226ON52258830.047
Suva_5.1577.226ON52750820.055
TBLA0D041807.226ON522133810.071
Kpol_1070.167.226ON52364810.071
NCAS0C022408.519ON16196780.078
TPHA0C012007.226ON52871800.091
KAFR0A011908.519ON15797780.094
YER052C (HOM3)7.226ON52750790.12
Smik_5.1797.226ON52750790.12
ZYRO0D16632g7.226ON51361790.13
NCAS0E031107.226ON52864790.13
Skud_5.1647.226ON52750780.17
KLLA0C17842g8.240ON264160770.20
ADL086C7.226ON55274770.22
NDAI0E047007.226ON53050760.31
TPHA0B009504.211ON10846720.32
Skud_16.2248.519ON149116730.34
KNAG0A020908.519ON149115730.38
Smik_16.1788.519ON149116720.43
CAGL0J02882g7.226ON53050750.44
TBLA0A082304.211ON10881700.54
SAKL0H04136g4.211ON11081700.61
AGR111W8.240ON23781730.62
YPL059W (GRX5)8.519ON150115710.69
NCAS0B022908.519ON13992700.80
KLLA0B07975g4.211ON11162690.87
NCAS0B048908.240ON27491720.91
CAGL0M07271g8.519ON14996691.1
Ecym_11878.519ON139124681.3
SAKL0H17710g8.240ON24181692.0
Kwal_27.119488.519ON13697672.1
NDAI0C053908.519ON14490662.4
Kpol_513.118.519ON14796662.6
Kwal_56.235068.240ON24081682.6
KLTH0E12034g8.519ON13697662.8
TDEL0A012408.240ON242161673.0
KLTH0G14234g8.240ON24081673.1
KLTH0A05104g7.276ON43964673.4
TPHA0A019108.240ON24187673.6
KLLA0B09636g8.519ON14297653.7
YOR132W (VPS17)5.466ON55154673.7
TPHA0B033408.240ON24981664.3
Skud_4.3568.240ON26285664.6
TBLA0H035008.519ON149116644.8
YER174C (GRX4)8.240ON24485655.5
Ecym_35148.240ON24581656.4
KNAG0A025408.429ON40168656.5
Smik_4.3398.240ON26585647.6
Ecym_80197.276ON44454648.4
SAKL0H10626g8.519ON14397628.6
Suva_5.3088.240ON24485639.1
CAGL0K02849g2.513ON44862649.7
YDR098C (GRX3)8.240ON28585639.8
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= YDL010W
         (231 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

YDL010W Chr4 (432330..433025) [696 bp, 231 aa] {ON}  GRX6Cis-gol...   447   e-161
Skud_4.242 Chr4 (427070..427768) [699 bp, 232 aa] {ON} YDL010W (...   360   e-127
Smik_4.223 Chr4 (414277..414975) [699 bp, 232 aa] {ON} YDL010W (...   360   e-127
Suva_4.238 Chr4 (425601..426302) [702 bp, 233 aa] {ON} YDL010W (...   350   e-123
KAFR0A01230 Chr1 (240673..241335) [663 bp, 220 aa] {ON} Anc_3.18...   195   4e-62
TBLA0F00750 Chr6 (190701..191405) [705 bp, 234 aa] {ON} Anc_3.18...   175   3e-54
Kwal_56.23114 s56 complement(406920..407552) [633 bp, 210 aa] {O...   170   2e-52
ZYRO0A04928g Chr1 complement(396257..397012) [756 bp, 251 aa] {O...   171   2e-52
TDEL0D04320 Chr4 complement(789241..789972) [732 bp, 243 aa] {ON...   168   3e-51
SAKL0C10494g Chr3 (955694..956386) [693 bp, 230 aa] {ON} similar...   161   1e-48
KLTH0G16060g Chr7 (1406291..1406932) [642 bp, 213 aa] {ON} simil...   160   1e-48
AER017C Chr5 complement(660137..660787) [651 bp, 216 aa] {ON} Sy...   154   5e-46
NDAI0G01800 Chr7 complement(394930..395598) [669 bp, 222 aa] {ON...   144   3e-42
NCAS0E01600 Chr5 complement(304962..305651) [690 bp, 229 aa] {ON...   141   6e-41
Kpol_1045.69 s1045 complement(161501..162289) [789 bp, 262 aa] {...   139   7e-40
Suva_2.141 Chr2 complement(245683..246297) [615 bp, 204 aa] {ON}...   136   2e-39
YBR014C Chr2 complement(266725..267336) [612 bp, 203 aa] {ON}  G...   135   7e-39
Smik_2.133 Chr2 complement(246955..247569) [615 bp, 204 aa] {ON}...   133   3e-38
KLLA0E17733g Chr5 complement(1571724..1572359) [636 bp, 211 aa] ...   133   5e-38
Ecym_5313 Chr5 complement(633521..634267) [747 bp, 248 aa] {ON} ...   131   6e-37
Skud_2.126 Chr2 complement(240244..240858) [615 bp, 204 aa] {ON}...   127   6e-36
KNAG0J01260 Chr10 complement(225941..226525) [585 bp, 194 aa] {O...   120   2e-33
TPHA0H00630 Chr8 (125748..126323) [576 bp, 191 aa] {ON} Anc_3.18...   103   1e-26
CAGL0I04554g Chr9 (407790..408470) [681 bp, 226 aa] {ON} some si...   102   3e-26
KAFR0A03870 Chr1 (787414..788217) [804 bp, 267 aa] {ON} Anc_8.67...    93   6e-22
SAKL0H06468g Chr8 complement(569965..570741) [777 bp, 258 aa] {O...    91   2e-21
NCAS0C01340 Chr3 complement(245717..246790) [1074 bp, 357 aa] {O...    88   9e-20
NDAI0E01150 Chr5 complement(228591..229301) [711 bp, 236 aa] {ON...    85   2e-19
NDAI0K01350 Chr11 complement(308152..308967) [816 bp, 271 aa] {O...    82   3e-18
Kpol_1072.14 s1072 complement(30780..31532) [753 bp, 250 aa] {ON...    81   1e-17
NCAS0B01640 Chr2 (268028..268750) [723 bp, 240 aa] {ON} Anc_8.679      80   1e-17
KNAG0G02580 Chr7 (585685..586521) [837 bp, 278 aa] {ON} Anc_8.67...    77   4e-16
TPHA0G01590 Chr7 complement(326061..326954) [894 bp, 297 aa] {ON...    74   4e-15
KLLA0D05973g Chr4 (512611..513456) [846 bp, 281 aa] {ON} some si...    74   6e-15
YPL156C Chr16 complement(255913..256767) [855 bp, 284 aa] {ON}  ...    70   2e-13
TBLA0B03820 Chr2 complement(878781..879536) [756 bp, 251 aa] {ON...    69   2e-13
Kwal_26.8814 s26 (953489..954316) [828 bp, 275 aa] {ON} YPL156C ...    68   6e-13
Suva_16.154 Chr16 complement(265047..265898) [852 bp, 283 aa] {O...    68   8e-13
Ecym_2394 Chr2 complement(763799..764644) [846 bp, 281 aa] {ON} ...    67   1e-12
Skud_16.126 Chr16 complement(227492..228355) [864 bp, 287 aa] {O...    66   3e-12
KLTH0D11308g Chr4 (925622..926437) [816 bp, 271 aa] {ON} some si...    64   1e-11
Smik_6.353 Chr6 (567550..568410) [861 bp, 286 aa] {ON} YPL156C (...    64   2e-11
CAGL0M02167g Chr13 complement(259132..259833) [702 bp, 233 aa] {...    63   3e-11
ACR146W Chr3 (607725..608366) [642 bp, 213 aa] {ON} Syntenic hom...    61   8e-11
NDAI0F04430 Chr6 complement(1083612..1084022) [411 bp, 136 aa] {...    58   5e-10
Kpol_2002.36 s2002 complement(73659..73988) [330 bp, 109 aa] {ON...    57   5e-10
CAGL0K05813g Chr11 (570054..570482) [429 bp, 142 aa] {ON} highly...    56   2e-09
Kwal_33.13166 s33 complement(102922..103338) [417 bp, 138 aa] {O...    55   3e-09
Smik_4.794 Chr4 (1393831..1394262) [432 bp, 143 aa] {ON} YDR513W...    55   4e-09
Suva_2.693 Chr2 (1223806..1224237) [432 bp, 143 aa] {ON} YDR513W...    55   5e-09
TBLA0A05080 Chr1 complement(1251350..1251706) [357 bp, 118 aa] {...    54   5e-09
YDR513W Chr4 (1471017..1471448) [432 bp, 143 aa] {ON}  GRX2Cytop...    55   5e-09
Skud_4.788 Chr4 (1391142..1391579) [438 bp, 145 aa] {ON} YDR513W...    55   6e-09
TPHA0B03560 Chr2 complement(832814..833134) [321 bp, 106 aa] {ON}      53   9e-09
NCAS0A00360 Chr1 complement(54875..55291) [417 bp, 138 aa] {ON} ...    53   2e-08
KLLA0C01298g Chr3 complement(101676..101999) [324 bp, 107 aa] {O...    52   3e-08
KNAG0C00450 Chr3 complement(77334..77807) [474 bp, 157 aa] {ON} ...    53   3e-08
Kpol_2000.99 s2000 (219541..219966) [426 bp, 141 aa] {ON} (21954...    53   4e-08
Ecym_1044 Chr1 complement(84062..84538) [477 bp, 158 aa] {ON} si...    53   4e-08
TPHA0E03730 Chr5 (787911..788231) [321 bp, 106 aa] {ON} Anc_1.38...    51   6e-08
KLTH0F01276g Chr6 complement(101034..101450) [417 bp, 138 aa] {O...    52   7e-08
AFR710W Chr6 (1744868..1745203) [336 bp, 111 aa] {ON} Syntenic h...    49   3e-07
TDEL0E05740 Chr5 complement(1072231..1072557) [327 bp, 108 aa] {...    49   5e-07
ZYRO0F17732g Chr6 (1469710..1470129) [420 bp, 139 aa] {ON} simil...    49   1e-06
TDEL0C06640 Chr3 (1213768..1214199) [432 bp, 143 aa] {ON} Anc_1....    48   2e-06
TPHA0B04820 Chr2 (1130278..1130694) [417 bp, 138 aa] {ON} Anc_1....    48   2e-06
KAFR0D00360 Chr4 complement(54064..54393) [330 bp, 109 aa] {ON} ...    46   4e-06
SAKL0C01320g Chr3 complement(118401..118898) [498 bp, 165 aa] {O...    47   4e-06
KNAG0F00250 Chr6 complement(26606..27034) [429 bp, 142 aa] {ON} ...    46   6e-06
NDAI0A00380 Chr1 complement(64438..64767) [330 bp, 109 aa] {ON} ...    45   1e-05
NCAS0B08870 Chr2 (1703167..1703496) [330 bp, 109 aa] {ON} Anc_1....    45   1e-05
KLTH0A04004g Chr1 complement(335054..336622) [1569 bp, 522 aa] {...    43   4e-04
Smik_3.42 Chr3 complement(62546..62878) [333 bp, 110 aa] {ON} YC...    39   0.001
Suva_3.178 Chr3 complement(270878..271828) [951 bp, 316 aa] {ON}...    41   0.001
YCL035C Chr3 complement(60841..61173) [333 bp, 110 aa] {ON}  GRX...    38   0.004
Skud_3.27 Chr3 complement(48731..49063) [333 bp, 110 aa] {ON} YC...    38   0.004
Kwal_47.18163 s47 complement(714420..715988) [1569 bp, 522 aa] {...    39   0.006
SAKL0F08294g Chr6 complement(633032..634603) [1572 bp, 523 aa] {...    38   0.015
KNAG0L01370 Chr12 complement(244724..246286) [1563 bp, 520 aa] {...    38   0.015
TDEL0H02190 Chr8 (370572..372128) [1557 bp, 518 aa] {ON} Anc_7.2...    38   0.017
NDAI0E02890 Chr5 (610133..610600) [468 bp, 155 aa] {ON} Anc_8.519      36   0.028
Suva_16.255 Chr16 (447649..448098) [450 bp, 149 aa] {ON} YPL059W...    36   0.029
KAFR0L00780 Chr12 complement(146584..148158) [1575 bp, 524 aa] {...    37   0.046
KLLA0F27599g Chr6 (2558178..2559746) [1569 bp, 522 aa] {ON} high...    37   0.047
Suva_5.157 Chr5 complement(232339..233922) [1584 bp, 527 aa] {ON...    36   0.055
TBLA0D04180 Chr4 (1034864..1036432) [1569 bp, 522 aa] {ON} Anc_7...    36   0.071
Kpol_1070.16 s1070 (40539..42110) [1572 bp, 523 aa] {ON} (40539....    36   0.071
NCAS0C02240 Chr3 (417174..417659) [486 bp, 161 aa] {ON} Anc_8.519      35   0.078
TPHA0C01200 Chr3 (275584..277170) [1587 bp, 528 aa] {ON} Anc_7.2...    35   0.091
KAFR0A01190 Chr1 complement(230841..231314) [474 bp, 157 aa] {ON...    35   0.094
YER052C Chr5 complement(256375..257958) [1584 bp, 527 aa] {ON}  ...    35   0.12 
Smik_5.179 Chr5 complement(260399..261982) [1584 bp, 527 aa] {ON...    35   0.12 
ZYRO0D16632g Chr4 complement(1378392..1379933) [1542 bp, 513 aa]...    35   0.13 
NCAS0E03110 Chr5 complement(617247..618833) [1587 bp, 528 aa] {O...    35   0.13 
Skud_5.164 Chr5 complement(252810..254393) [1584 bp, 527 aa] {ON...    35   0.17 
KLLA0C17842g Chr3 complement(1588951..1589745) [795 bp, 264 aa] ...    34   0.20 
ADL086C Chr4 complement(533178..534836) [1659 bp, 552 aa] {ON} S...    34   0.22 
NDAI0E04700 Chr5 complement(1061383..1062975) [1593 bp, 530 aa] ...    34   0.31 
TPHA0B00950 Chr2 complement(217773..218099) [327 bp, 108 aa] {ON...    32   0.32 
Skud_16.224 Chr16 (408961..409410) [450 bp, 149 aa] {ON} YPL059W...    33   0.34 
KNAG0A02090 Chr1 (175247..175696) [450 bp, 149 aa] {ON} Anc_8.51...    33   0.38 
Smik_16.178 Chr16 (319960..320409) [450 bp, 149 aa] {ON} YPL059W...    32   0.43 
CAGL0J02882g Chr10 complement(279998..281590) [1593 bp, 530 aa] ...    33   0.44 
TBLA0A08230 Chr1 complement(2028254..2028580) [327 bp, 108 aa] {...    32   0.54 
SAKL0H04136g Chr8 complement(386608..386940) [333 bp, 110 aa] {O...    32   0.61 
AGR111W Chr7 (947498..948211) [714 bp, 237 aa] {ON} Syntenic hom...    33   0.62 
YPL059W Chr16 (444579..445031) [453 bp, 150 aa] {ON}  GRX5Hydrop...    32   0.69 
NCAS0B02290 Chr2 (383984..384403) [420 bp, 139 aa] {ON} Anc_8.519      32   0.80 
KLLA0B07975g Chr2 complement(705661..705996) [336 bp, 111 aa] {O...    31   0.87 
NCAS0B04890 Chr2 complement(897400..898224) [825 bp, 274 aa] {ON}      32   0.91 
CAGL0M07271g Chr13 (731627..732076) [450 bp, 149 aa] {ON} simila...    31   1.1  
Ecym_1187 Chr1 (384530..384949) [420 bp, 139 aa] {ON} similar to...    31   1.3  
SAKL0H17710g Chr8 (1565867..1566592) [726 bp, 241 aa] {ON} simil...    31   2.0  
Kwal_27.11948 s27 complement(1014824..1015234) [411 bp, 136 aa] ...    30   2.1  
NDAI0C05390 Chr3 complement(1246280..1246714) [435 bp, 144 aa] {...    30   2.4  
Kpol_513.11 s513 complement(30908..31351) [444 bp, 147 aa] {ON} ...    30   2.6  
Kwal_56.23506 s56 complement(577407..578129) [723 bp, 240 aa] {O...    31   2.6  
KLTH0E12034g Chr5 complement(1069449..1069859) [411 bp, 136 aa] ...    30   2.8  
TDEL0A01240 Chr1 (208313..209041) [729 bp, 242 aa] {ON} Anc_8.24...    30   3.0  
KLTH0G14234g Chr7 (1233911..1234633) [723 bp, 240 aa] {ON} simil...    30   3.1  
KLTH0A05104g Chr1 (426808..428127) [1320 bp, 439 aa] {ON} weakly...    30   3.4  
TPHA0A01910 Chr1 (386720..387445) [726 bp, 241 aa] {ON} Anc_8.24...    30   3.6  
KLLA0B09636g Chr2 (836265..836693) [429 bp, 142 aa] {ON} similar...    30   3.7  
YOR132W Chr15 (573175..574830) [1656 bp, 551 aa] {ON}  VPS17Subu...    30   3.7  
TPHA0B03340 Chr2 (770614..771363) [750 bp, 249 aa] {ON} Anc_8.24...    30   4.3  
Skud_4.356 Chr4 complement(621126..621881,621915..621947) [789 b...    30   4.6  
TBLA0H03500 Chr8 complement(857008..857457) [450 bp, 149 aa] {ON...    29   4.8  
YER174C Chr5 complement(538434..539168) [735 bp, 244 aa] {ON}  G...    30   5.5  
Ecym_3514 Chr3 (962769..963506) [738 bp, 245 aa] {ON} similar to...    30   6.4  
KNAG0A02540 Chr1 (260985..262190) [1206 bp, 401 aa] {ON} Anc_8.4...    30   6.5  
Smik_4.339 Chr4 complement(610713..611480,611484..611513) [798 b...    29   7.6  
Ecym_8019 Chr8 complement(50209..51543) [1335 bp, 444 aa] {ON} s...    29   8.4  
SAKL0H10626g Chr8 (914158..914589) [432 bp, 143 aa] {ON} uniprot...    28   8.6  
Suva_5.308 Chr5 complement(506262..506996) [735 bp, 244 aa] {ON}...    29   9.1  
CAGL0K02849g Chr11 complement(256016..257362) [1347 bp, 448 aa] ...    29   9.7  
YDR098C Chr4 complement(644178..645035) [858 bp, 285 aa] {ON}  G...    29   9.8  

>YDL010W Chr4 (432330..433025) [696 bp, 231 aa] {ON}  GRX6Cis-golgi
           localized monothiol glutaredoxin that binds an
           iron-sulfur cluster; more similar in activity to dithiol
           than other monothiol glutaredoxins; involved in the
           oxidative stress response; functional overlap with GRX7
          Length = 231

 Score =  447 bits (1151), Expect = e-161,   Method: Compositional matrix adjust.
 Identities = 220/231 (95%), Positives = 220/231 (95%)

Query: 1   MIPSNKRNARXXXXXXXXXXXVFFVAQNANFLTVEIKEETSKAFSTNMDNMAGGSSREYA 60
           MIPSNKRNAR           VFFVAQNANFLTVEIKEETSKAFSTNMDNMAGGSSREYA
Sbjct: 1   MIPSNKRNARILSITTLLLLLVFFVAQNANFLTVEIKEETSKAFSTNMDNMAGGSSREYA 60

Query: 61  AMPTSTTNKGSSEVDEEINEIKQKVGLQQPIASVDDSLSAIKNDKGSRITKAFNVQKEYS 120
           AMPTSTTNKGSSEVDEEINEIKQKVGLQQPIASVDDSLSAIKNDKGSRITKAFNVQKEYS
Sbjct: 61  AMPTSTTNKGSSEVDEEINEIKQKVGLQQPIASVDDSLSAIKNDKGSRITKAFNVQKEYS 120

Query: 121 LILDLSPIIIFSKSTCSYSKGMKELLENEYQFIPNYYIIELDKHGHGEELQEYIKLVTGR 180
           LILDLSPIIIFSKSTCSYSKGMKELLENEYQFIPNYYIIELDKHGHGEELQEYIKLVTGR
Sbjct: 121 LILDLSPIIIFSKSTCSYSKGMKELLENEYQFIPNYYIIELDKHGHGEELQEYIKLVTGR 180

Query: 181 GTVPNLLVNGVSRGGNEEIKKLHTQGKLLESLQVWSDGKFSVEQREKPSNN 231
           GTVPNLLVNGVSRGGNEEIKKLHTQGKLLESLQVWSDGKFSVEQREKPSNN
Sbjct: 181 GTVPNLLVNGVSRGGNEEIKKLHTQGKLLESLQVWSDGKFSVEQREKPSNN 231

>Skud_4.242 Chr4 (427070..427768) [699 bp, 232 aa] {ON} YDL010W
           (REAL)
          Length = 232

 Score =  360 bits (925), Expect = e-127,   Method: Compositional matrix adjust.
 Identities = 174/232 (75%), Positives = 195/232 (84%), Gaps = 1/232 (0%)

Query: 1   MIPSNKRNARXXXXXXXXXXXVFFVAQNANFLTVEIKEETS-KAFSTNMDNMAGGSSREY 59
           MIP NKRNAR           VFF+ QNANFLT+E KEE   + FSTNMD+++ GSS++ 
Sbjct: 1   MIPPNKRNARILSITMLLLLLVFFIVQNANFLTIETKEEKPFQVFSTNMDSLSVGSSKKL 60

Query: 60  AAMPTSTTNKGSSEVDEEINEIKQKVGLQQPIASVDDSLSAIKNDKGSRITKAFNVQKEY 119
           A  PTS   KGSSEVDEEINEIKQKVGLQQPIAS DDSLSA+K+DKGS   K FNVQKEY
Sbjct: 61  ATEPTSAIKKGSSEVDEEINEIKQKVGLQQPIASADDSLSALKSDKGSGTGKGFNVQKEY 120

Query: 120 SLILDLSPIIIFSKSTCSYSKGMKELLENEYQFIPNYYIIELDKHGHGEELQEYIKLVTG 179
           SL+LDLSP+IIFSKS C YS+ MKELLENEYQF+PNYYIIELDKHGHGEELQEYI+L+TG
Sbjct: 121 SLMLDLSPVIIFSKSVCPYSRNMKELLENEYQFLPNYYIIELDKHGHGEELQEYIRLMTG 180

Query: 180 RGTVPNLLVNGVSRGGNEEIKKLHTQGKLLESLQVWSDGKFSVEQREKPSNN 231
           RG VPNLL+NG+SRGGNEEI+ LH+QGKLL SLQ WS+GKFSVEQREKPSNN
Sbjct: 181 RGAVPNLLINGISRGGNEEIRGLHSQGKLLGSLQAWSNGKFSVEQREKPSNN 232

>Smik_4.223 Chr4 (414277..414975) [699 bp, 232 aa] {ON} YDL010W
           (REAL)
          Length = 232

 Score =  360 bits (923), Expect = e-127,   Method: Compositional matrix adjust.
 Identities = 182/232 (78%), Positives = 201/232 (86%), Gaps = 1/232 (0%)

Query: 1   MIPSNKRNARXXXXXXXXXXXVFFVAQNANFLTVEIKE-ETSKAFSTNMDNMAGGSSREY 59
           M+ SNKRNAR           VFFVAQNANFLT+E KE E+S+ F + M+N+A  S+R+Y
Sbjct: 1   MVHSNKRNARILSITMLLLLLVFFVAQNANFLTLETKERESSELFDSEMNNLAAESTRKY 60

Query: 60  AAMPTSTTNKGSSEVDEEINEIKQKVGLQQPIASVDDSLSAIKNDKGSRITKAFNVQKEY 119
            A+PTS TNKGSSEVDEEINEIKQKVGLQ+PI S DDSLSAIK+DK S   K FNVQKEY
Sbjct: 61  VAVPTSATNKGSSEVDEEINEIKQKVGLQRPILSDDDSLSAIKSDKQSGTGKLFNVQKEY 120

Query: 120 SLILDLSPIIIFSKSTCSYSKGMKELLENEYQFIPNYYIIELDKHGHGEELQEYIKLVTG 179
           SL+LDLSP+IIFSKS+CSYSKGMKELLENEYQF+PNYYIIELDKHGHGEELQEYIKL TG
Sbjct: 121 SLMLDLSPVIIFSKSSCSYSKGMKELLENEYQFVPNYYIIELDKHGHGEELQEYIKLKTG 180

Query: 180 RGTVPNLLVNGVSRGGNEEIKKLHTQGKLLESLQVWSDGKFSVEQREKPSNN 231
           RGTVPNLLVNG+SRGGNEEI+KLH+QGKLLESLQ WSDGKFSVEQ EKPSNN
Sbjct: 181 RGTVPNLLVNGISRGGNEEIRKLHSQGKLLESLQSWSDGKFSVEQHEKPSNN 232

>Suva_4.238 Chr4 (425601..426302) [702 bp, 233 aa] {ON} YDL010W
           (REAL)
          Length = 233

 Score =  350 bits (897), Expect = e-123,   Method: Compositional matrix adjust.
 Identities = 170/233 (72%), Positives = 196/233 (84%), Gaps = 2/233 (0%)

Query: 1   MIPSNKRNARXXXXXXXXXXXVFFVAQNANFLTVEIKEE--TSKAFSTNMDNMAGGSSRE 58
           MI SNKRNAR           VFF+AQNANFL +E KEE    +    + ++++G SSR 
Sbjct: 1   MILSNKRNARILSITMLLLLLVFFIAQNANFLAIETKEEEKPPQLLDIDKNSISGRSSRR 60

Query: 59  YAAMPTSTTNKGSSEVDEEINEIKQKVGLQQPIASVDDSLSAIKNDKGSRITKAFNVQKE 118
            A++PTSTTNKG+SEVDEEINEIKQKVGLQQPIAS DDSLSAIK+DKG+   K FNVQ+E
Sbjct: 61  IASVPTSTTNKGNSEVDEEINEIKQKVGLQQPIASADDSLSAIKSDKGTGTGKGFNVQQE 120

Query: 119 YSLILDLSPIIIFSKSTCSYSKGMKELLENEYQFIPNYYIIELDKHGHGEELQEYIKLVT 178
           YSL+LDL+P+IIFSKSTCSYSKG+KELLE+EYQF+PNYYIIELDKH HGEEL+EYIK  T
Sbjct: 121 YSLMLDLAPVIIFSKSTCSYSKGLKELLESEYQFVPNYYIIELDKHAHGEELREYIKSTT 180

Query: 179 GRGTVPNLLVNGVSRGGNEEIKKLHTQGKLLESLQVWSDGKFSVEQREKPSNN 231
           GRGTVPNLL+NGVSRGG+EEIK+LH+QGKLL SLQ WS GKF+VEQREKPSNN
Sbjct: 181 GRGTVPNLLINGVSRGGSEEIKRLHSQGKLLSSLQEWSGGKFTVEQREKPSNN 233

>KAFR0A01230 Chr1 (240673..241335) [663 bp, 220 aa] {ON} Anc_3.189
           YDL010W
          Length = 220

 Score =  195 bits (495), Expect = 4e-62,   Method: Compositional matrix adjust.
 Identities = 101/230 (43%), Positives = 148/230 (64%), Gaps = 18/230 (7%)

Query: 5   NKRNARXXXXXXXXXXXVFFVAQNANFLTVEIKEETSKAFS-TNMDNMAGGSSREYAAMP 63
           NKRN R           VFFV ++AN +T+      S+  + T++D  +  + ++     
Sbjct: 6   NKRNIRIVSVTSILLLLVFFVIRDANSITLSQSISNSETVAKTDLDGASASNKKK----- 60

Query: 64  TSTTNKGSSEVDEEINEIKQKVGL--QQPIASVDDSLSAIKNDKGSRITKAFNVQKEYSL 121
                  +SE  EEI+ IKQ++G+    P+ + +   +  +N++ + +T  FN  KEY+ 
Sbjct: 61  -----TDNSEATEEIDRIKQEIGITDDSPVPATN---ANEQNEENTAVT--FNAAKEYAS 110

Query: 122 ILDLSPIIIFSKSTCSYSKGMKELLENEYQFIPNYYIIELDKHGHGEELQEYIKLVTGRG 181
           IL+LSP+++FSKS C +S  +KEL  NEYQF PN+YI+ELDKH HG+ LQ YIK  TGRG
Sbjct: 111 ILELSPMVVFSKSFCPFSAKLKELFANEYQFTPNFYIVELDKHQHGDLLQAYIKEKTGRG 170

Query: 182 TVPNLLVNGVSRGGNEEIKKLHTQGKLLESLQVWSDGKFSVEQREKPSNN 231
           TVPN+++NGVSRGG+++++ LH  GKLL+SL+ W  G F V+Q EKPSNN
Sbjct: 171 TVPNVVINGVSRGGSDDLRALHADGKLLDSLKTWGSGNFQVKQIEKPSNN 220

>TBLA0F00750 Chr6 (190701..191405) [705 bp, 234 aa] {ON} Anc_3.189
           YDL010W
          Length = 234

 Score =  175 bits (444), Expect = 3e-54,   Method: Compositional matrix adjust.
 Identities = 84/163 (51%), Positives = 112/163 (68%), Gaps = 5/163 (3%)

Query: 74  VDEEINEIKQKVGLQQPIASVDDSLSAIKNDKGSRITK-----AFNVQKEYSLILDLSPI 128
           VD + ++IKQ+VGL     +     S+I     ++I+       F+  KEY++ILDLSP+
Sbjct: 72  VDAQFDKIKQEVGLDTGKTTQGGLPSSIGTATDNKISNNDENGTFDAAKEYAMILDLSPV 131

Query: 129 IIFSKSTCSYSKGMKELLENEYQFIPNYYIIELDKHGHGEELQEYIKLVTGRGTVPNLLV 188
           IIFSKS C +S  +K+LL  E+ F PNYY+IELD+H HG ELQ YI   T R TVPN++V
Sbjct: 132 IIFSKSYCPFSSNLKQLLSKEFSFTPNYYVIELDRHSHGAELQAYIAKKTDRSTVPNMIV 191

Query: 189 NGVSRGGNEEIKKLHTQGKLLESLQVWSDGKFSVEQREKPSNN 231
           NG+SRGG +EI  L+ +GKLLE+L  WSD  F+V+Q EKPSNN
Sbjct: 192 NGISRGGRDEIVALNDEGKLLEALNDWSDNTFTVKQAEKPSNN 234

>Kwal_56.23114 s56 complement(406920..407552) [633 bp, 210 aa] {ON}
           YBR014C - Hypothetical ORF [contig 183] FULL
          Length = 210

 Score =  170 bits (430), Expect = 2e-52,   Method: Compositional matrix adjust.
 Identities = 96/231 (41%), Positives = 134/231 (58%), Gaps = 22/231 (9%)

Query: 2   IPSNKRNARXXXXXXXXXXXVFFVAQNANFLTVEIKEETSKAFSTNMDNMAGGSSREYAA 61
           +PS KRN R           ++F+ QNA     +   +  KA +   + + G        
Sbjct: 1   MPS-KRNLRVFSFTAVLIFLIYFIVQNA-----QTSSDVGKAINRKPETLIGDG----VV 50

Query: 62  MPTSTTNKGSSEVDEEINEIKQKVGLQQPIASVDDSLSAIKNDKGSRITKAFNVQKEYSL 121
                T K   +VD+ I  I+++VG+++  +            K     KAF+   EY  
Sbjct: 51  AKAKETTKIDEDVDQAIRNIQEEVGIKEGSSG-----------KSEPTRKAFDPAMEYQQ 99

Query: 122 ILDLSPIIIFSKSTCSYSKGMKELLENEYQFIPNYYIIELDKHGHGEELQEYIKLVTGRG 181
           IL  SP+I+FSKS C YS  MKELL+ EY+F P+Y ++ELD+H HG+ELQ+YI  VT R 
Sbjct: 100 ILSNSPMIVFSKSMCPYSAKMKELLKQEYEFTPDYLVVELDRHDHGKELQDYIGKVTNRA 159

Query: 182 TVPNLLVNGVSRGGNEEIKKLHTQGKLLESLQVWSDGK-FSVEQREKPSNN 231
           TVPN++++GVSRGG ++ K L  +GKLLESLQ WSDGK  SV ++EKPSNN
Sbjct: 160 TVPNVVIHGVSRGGYDDFKALLDKGKLLESLQDWSDGKTLSVSKKEKPSNN 210

>ZYRO0A04928g Chr1 complement(396257..397012) [756 bp, 251 aa] {ON}
           weakly similar to Saccharomyces cerevisiae YDL010W
           Hypothetical ORF or YBR014C uniprot|P38068 Saccharomyces
           cerevisiae YBR014C Hypothetical ORF
          Length = 251

 Score =  171 bits (432), Expect = 2e-52,   Method: Compositional matrix adjust.
 Identities = 111/256 (43%), Positives = 148/256 (57%), Gaps = 39/256 (15%)

Query: 5   NKRNARXXXXXXXXXXXVFFVAQNANFLTVEIKEETSKA-FSTNMDNM--AGGSSREYAA 61
           NKRN R           VFFV QNAN  +V I E +S A  ++N D    + G+S    +
Sbjct: 6   NKRNLRVLSITSLLLLLVFFVVQNAN--SVSIGESSSLANANSNEDQTLTSAGTSINKES 63

Query: 62  MPTSTTNK---------GSSEVDEEINEIKQKVGLQQPIASVDD---------------- 96
                T K         G S VD EI +IKQ+VG    I   DD                
Sbjct: 64  KEEVVTEKQKAKEKQPEGDSVVDAEIGKIKQEVG----IGKTDDLETGSSGSISGGGVVG 119

Query: 97  -SLSAIKNDKGSRITKAFNVQKEYSLILDLSPIIIFSKSTCSYSKGMKELLENEYQFIPN 155
              SA ++ + +     F+  KEY++ILD SPII+FSKSTC YSK +KELL+ EY F P+
Sbjct: 120 KGGSASEHAQQTE----FDPVKEYAMILDFSPIIVFSKSTCPYSKKLKELLDKEYSFTPS 175

Query: 156 YYIIELDKHGHGEELQEYIKLVTGRGTVPNLLVNGVSRGGNEEIKKLHTQGKLLESLQVW 215
           Y++IELD+H +G ELQ+Y++  TGR TVPN+++NG SRGGN+E + LH +GKLL S + W
Sbjct: 176 YFVIELDRHHNGAELQKYVEQKTGRSTVPNVIINGKSRGGNDEFRSLHNEGKLLSSFKDW 235

Query: 216 SDGKFSVEQREKPSNN 231
           S G F+V Q ++PSNN
Sbjct: 236 SQGTFTVLQLDRPSNN 251

>TDEL0D04320 Chr4 complement(789241..789972) [732 bp, 243 aa] {ON}
           Anc_3.189 YDL010W
          Length = 243

 Score =  168 bits (425), Expect = 3e-51,   Method: Compositional matrix adjust.
 Identities = 88/164 (53%), Positives = 117/164 (71%), Gaps = 4/164 (2%)

Query: 71  SSEVDEEINEIKQKVGLQQPIASVDDSLS--AIKNDKGSRITKA-FNVQKEYSLILDLSP 127
           S+ VD EI++IKQ+V      AS D+S+S  A    K   +++  F+  KEYS+IL +SP
Sbjct: 81  SALVDAEIDKIKQEVNSGSG-ASKDNSISQKAGSGSKDGTVSEGEFDPAKEYSMILGISP 139

Query: 128 IIIFSKSTCSYSKGMKELLENEYQFIPNYYIIELDKHGHGEELQEYIKLVTGRGTVPNLL 187
           +I+FSKS C YS  +KELL  EY   P+Y +IELDKH HG  LQ++I+  TGR TVPNL+
Sbjct: 140 VIVFSKSFCPYSSRLKELLTKEYTITPSYVVIELDKHKHGVALQKFIEKKTGRATVPNLM 199

Query: 188 VNGVSRGGNEEIKKLHTQGKLLESLQVWSDGKFSVEQREKPSNN 231
           +NG SRGG ++IK LH++G+LLESL  W DG F+V+Q EKPSNN
Sbjct: 200 INGKSRGGFDDIKALHSKGELLESLNKWGDGDFTVKQLEKPSNN 243

>SAKL0C10494g Chr3 (955694..956386) [693 bp, 230 aa] {ON} similar to
           Saccharomyces cerevisiae YDL010W Hypothetical ORF or
           YBR014C uniprot|P38068 Saccharomyces cerevisiae YBR014C
           Hypothetical ORF
          Length = 230

 Score =  161 bits (407), Expect = 1e-48,   Method: Compositional matrix adjust.
 Identities = 90/233 (38%), Positives = 127/233 (54%), Gaps = 13/233 (5%)

Query: 6   KRNARXXXXXXXXXXXVFFVAQNANFLTVEIKEETSKAFSTNMDNMAGGSSREYAAMPTS 65
           KRN R           +FF+ QNAN + V  K             +      E       
Sbjct: 4   KRNLRVLTITGFLVFLIFFIVQNANTVAVANKNSGRANGVPPSSKLIHSDGDEQEVAVQK 63

Query: 66  TTNKGSSEVDEEINEIKQKVGLQQPIASVDDSLSAIKNDKGSRITKA-------FNVQKE 118
              K  S V+ EI +I      QQ IA       +     G++++ A       FN  KE
Sbjct: 64  QQEKEDSAVNAEIAQI------QQEIAGNQGGGGSNSGRTGNKVSAAKDSSSVEFNAAKE 117

Query: 119 YSLILDLSPIIIFSKSTCSYSKGMKELLENEYQFIPNYYIIELDKHGHGEELQEYIKLVT 178
           Y+ IL+ SP+++FSKS C +S  +K+LL  EYQF P+Y ++ELDKH HG ELQ+YI  VT
Sbjct: 118 YASILEESPMVVFSKSYCPFSTKLKDLLAQEYQFTPSYVVLELDKHEHGAELQKYIGDVT 177

Query: 179 GRGTVPNLLVNGVSRGGNEEIKKLHTQGKLLESLQVWSDGKFSVEQREKPSNN 231
           GR TVPN+++N VSRGG+++++ LH  GKLL+SL+ W   + +V + +KPSNN
Sbjct: 178 GRSTVPNVVINRVSRGGSDDLRALHKDGKLLDSLKEWGGKQLTVSKNQKPSNN 230

>KLTH0G16060g Chr7 (1406291..1406932) [642 bp, 213 aa] {ON} similar
           to Saccharomyces cerevisiae YDL010W Hypothetical ORF or
           YBR014C uniprot|P38068 Saccharomyces cerevisiae YBR014C
           Hypothetical ORF
          Length = 213

 Score =  160 bits (405), Expect = 1e-48,   Method: Compositional matrix adjust.
 Identities = 94/233 (40%), Positives = 138/233 (59%), Gaps = 28/233 (12%)

Query: 5   NKRNARXXXXXXXXXXXVFFVAQNANFLTVEIKEETSKAFSTNMDNMAGGSSREYAAMPT 64
           +KRN R           ++F+ QNA+  TV           T+ ++   G +   A + +
Sbjct: 3   SKRNLRVFVFTGVLLVLIYFIIQNAH-TTV-----------TSGNSSLSGQTASGAVIHS 50

Query: 65  STTNKGSSEVD----EEINEIKQKVGLQQPIASVDDSLSAIKNDKGSRIT--KAFNVQKE 118
              +K S EVD    +EI EIK +VG++      DD  S+     G+  T  K F+  KE
Sbjct: 51  KGNHKSSGEVDPSVDKEIQEIKNEVGIKG-----DDGASS-----GTDFTQEKEFDPAKE 100

Query: 119 YSLILDLSPIIIFSKSTCSYSKGMKELLENEYQFIPNYYIIELDKHGHGEELQEYIKLVT 178
           Y  IL   P+I+FSKS C +SK +K+LL  E++F P+Y ++ELDKH HG ELQ++I  +T
Sbjct: 101 YQYILANRPMIVFSKSRCPFSKKLKDLLAKEFEFSPSYMVVELDKHEHGAELQKHIGSLT 160

Query: 179 GRGTVPNLLVNGVSRGGNEEIKKLHTQGKLLESLQVWSDGKFSVEQREKPSNN 231
           GR TVPN+++NGVSRGG ++ +KL  +G+LL SL+ W D   +V ++EKPSNN
Sbjct: 161 GRSTVPNVIINGVSRGGCDDFEKLQEKGELLSSLKTWCDKALTVSKKEKPSNN 213

>AER017C Chr5 complement(660137..660787) [651 bp, 216 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDL010W and
           YBR014C
          Length = 216

 Score =  154 bits (388), Expect = 5e-46,   Method: Compositional matrix adjust.
 Identities = 71/170 (41%), Positives = 117/170 (68%), Gaps = 3/170 (1%)

Query: 62  MPTSTTNKGSSEVDEEINEIKQKVGLQQPIASVDDSLSAIKNDKGSRITKAFNVQKEYSL 121
           +P + + + + E +E   ++  K G +  +A+  + +   +  + S++   F+  K Y+ 
Sbjct: 50  VPNAPSVQDTVEAEEPSVQLLSK-GAEGAVAASKEDVDVARAQQQSKVL--FDAAKTYNE 106

Query: 122 ILDLSPIIIFSKSTCSYSKGMKELLENEYQFIPNYYIIELDKHGHGEELQEYIKLVTGRG 181
           IL LS +++FSKSTC  S G+K+LL N Y+F+P+Y ++ELDKH +G ELQ+Y+   T R 
Sbjct: 107 ILSLSSMVVFSKSTCPLSSGLKQLLNNNYEFLPDYQVVELDKHANGAELQKYVTKTTARS 166

Query: 182 TVPNLLVNGVSRGGNEEIKKLHTQGKLLESLQVWSDGKFSVEQREKPSNN 231
           TVPNL++NGVSRGG++ I +LH  G+LLESL+ W++GK +V Q+++PSN+
Sbjct: 167 TVPNLVINGVSRGGHDSIMELHKTGELLESLRKWANGKHAVTQKQRPSNS 216

>NDAI0G01800 Chr7 complement(394930..395598) [669 bp, 222 aa] {ON}
           Anc_3.189
          Length = 222

 Score =  144 bits (363), Expect = 3e-42,   Method: Compositional matrix adjust.
 Identities = 92/228 (40%), Positives = 119/228 (52%), Gaps = 19/228 (8%)

Query: 5   NKRNARXXXXXXXXXXXVFFVAQNANFLT-VEIKEETSKAFSTNMDNMAGGSSREYAAMP 63
           NKRN R             FV QNAN  T    K   S    TN    A G      A+ 
Sbjct: 6   NKRNIRVLITTCVLIVIGVFVFQNANASTYTSSKALKSTITDTNSIVQAHGEDENIPALK 65

Query: 64  TSTTNKGSSEV-DEEINEIKQKVGLQQPIASVDDSLSAIKNDKGSRITKAFNVQKEYSLI 122
               +  S+E+  EE ++I     + Q  A V                  F+V KEY+ I
Sbjct: 66  NVDNSPVSTEITSEEDSKINADSSIVQAEAEV-----------------PFDVAKEYTSI 108

Query: 123 LDLSPIIIFSKSTCSYSKGMKELLENEYQFIPNYYIIELDKHGHGEELQEYIKLVTGRGT 182
           L   P++IFSK+ C YSK +KELL   +Q  P   +IELDKH HGEELQ YIK  TGRGT
Sbjct: 109 LQRGPMVIFSKTFCPYSKALKELLSTNFQINPQPIVIELDKHEHGEELQAYIKEQTGRGT 168

Query: 183 VPNLLVNGVSRGGNEEIKKLHTQGKLLESLQVWSDGKFSVEQREKPSN 230
           VPNL++NG S+GG++++KKL  +  LL+SL  WS+G + V+  E  SN
Sbjct: 169 VPNLIINGNSKGGSDDMKKLFDENVLLDSLNEWSNGAYEVQATETASN 216

>NCAS0E01600 Chr5 complement(304962..305651) [690 bp, 229 aa] {ON}
           Anc_3.189
          Length = 229

 Score =  141 bits (355), Expect = 6e-41,   Method: Compositional matrix adjust.
 Identities = 83/223 (37%), Positives = 118/223 (52%), Gaps = 10/223 (4%)

Query: 5   NKRNARXXXXXXXXXXXVFFVAQNANFLTVEIKEETSKAFSTNMDNMAGGSSREYAAMPT 64
           NKRN R           VFF+ Q+AN      +  + ++    ++++ G    +     T
Sbjct: 6   NKRNIRVVGITAALLCLVFFIIQSANNSAFTTESPSKQSNKPALNSLVGAHGDDLNIPAT 65

Query: 65  STT---NKGSSEVDEEINEIKQKVGLQQPIASVDDSLSAIKNDKGSRITKAFNVQKEYSL 121
                 N  S+   E  +E    + L       D+S  + +    S     F+V KEY+ 
Sbjct: 66  HNVLQDNVESAPTVETESESNNNMEL-------DESADSAQEKDASTTAPDFDVAKEYAA 118

Query: 122 ILDLSPIIIFSKSTCSYSKGMKELLENEYQFIPNYYIIELDKHGHGEELQEYIKLVTGRG 181
           IL   P++IFSKSTC YS  +K+LL   +QF P   I+ELDKH HG+ LQ YIK  TGRG
Sbjct: 119 ILAKGPMVIFSKSTCPYSSKLKKLLRTNFQFSPEPVIVELDKHEHGDVLQGYIKEETGRG 178

Query: 182 TVPNLLVNGVSRGGNEEIKKLHTQGKLLESLQVWSDGKFSVEQ 224
           TVPNL+V G+SRGG+++I+KL  +G LL+ L+ W  G   V Q
Sbjct: 179 TVPNLIVGGLSRGGSDDIQKLFDEGTLLKELKTWGFGDLEVTQ 221

>Kpol_1045.69 s1045 complement(161501..162289) [789 bp, 262 aa] {ON}
           complement(161503..162291) [789 nt, 263 aa]
          Length = 262

 Score =  139 bits (350), Expect = 7e-40,   Method: Compositional matrix adjust.
 Identities = 84/257 (32%), Positives = 134/257 (52%), Gaps = 30/257 (11%)

Query: 5   NKRNARXXXXXXXXXXXVFFVAQNANFLTVEIKEETSKAFST-------NMDNMAGGSSR 57
           NKRN R           +F ++QN N +  +     S AF +       + DN+  G   
Sbjct: 6   NKRNIRILSITGVLLFVIFLISQNNNGMLTDPSGLISDAFESTSVKGMIDSDNVRVGGKV 65

Query: 58  EYAAMPTSTTNKGSSEVDEEINEIKQKVGL-----------------QQPIASVDDSLSA 100
            Y++           +V+ EI++IK++VGL                      +V +  S 
Sbjct: 66  RYSSDDLVKGTAKDDKVNAEIDKIKEEVGLPFNDNNNNNIANKKLTTDNNKNNVVNEKST 125

Query: 101 IKNDKGSRITKA------FNVQKEYSLILDLSPIIIFSKSTCSYSKGMKELLENEYQFIP 154
           ++N+   R  +       F+  +EY++I +LSPII+++K+ C Y K + +LLE  Y F P
Sbjct: 126 VQNNAAQRAVQGGSEPVKFDPAQEYAIISELSPIILYTKTFCPYCKRLAKLLEESYSFQP 185

Query: 155 NYYIIELDKHGHGEELQEYIKLVTGRGTVPNLLVNGVSRGGNEEIKKLHTQGKLLESLQV 214
            ++ ++LDKH HG+ELQ+++   TG  TVPN ++NG S GG ++I KLH  GKL+E++Q 
Sbjct: 186 EFHAVKLDKHTHGDELQQFVNKQTGHNTVPNFVINGKSLGGYDDILKLHEAGKLIETIQE 245

Query: 215 WSDGKFSVEQREKPSNN 231
            SD    V+  EKPSN+
Sbjct: 246 MSDYSVVVKAIEKPSNS 262

>Suva_2.141 Chr2 complement(245683..246297) [615 bp, 204 aa] {ON}
           YBR014C (REAL)
          Length = 204

 Score =  136 bits (343), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 59/111 (53%), Positives = 85/111 (76%)

Query: 113 FNVQKEYSLILDLSPIIIFSKSTCSYSKGMKELLENEYQFIPNYYIIELDKHGHGEELQE 172
           F+   EY  IL  S +++FSKS C +SK +K LL   Y+F P+Y+++ELD+HGH +ELQ+
Sbjct: 86  FDAATEYETILKQSHMVVFSKSYCPFSKKLKNLLAESYKFSPSYHVVELDQHGHTDELQD 145

Query: 173 YIKLVTGRGTVPNLLVNGVSRGGNEEIKKLHTQGKLLESLQVWSDGKFSVE 223
           YI+ VTGR TVPN+++NGVS+GG +++  LH + KLLESL+ WS+G F+VE
Sbjct: 146 YIEKVTGRRTVPNVIINGVSKGGCDDMVTLHKEDKLLESLKEWSNGAFTVE 196

>YBR014C Chr2 complement(266725..267336) [612 bp, 203 aa] {ON}
           GRX7Cis-golgi localized monothiol glutaredoxin; more
           similar in activity to dithiol than other monothiol
           glutaredoxins; involved in the oxidative stress
           response; does not bind metal ions; functional overlap
           with GRX6
          Length = 203

 Score =  135 bits (339), Expect = 7e-39,   Method: Compositional matrix adjust.
 Identities = 78/219 (35%), Positives = 109/219 (49%), Gaps = 29/219 (13%)

Query: 5   NKRNARXXXXXXXXXXXVFFVAQNANFLTVEIKEETSKAFSTNMDNMAGGSSREYAAMPT 64
           NKRN R           VFFV +N+N    E             DN         +   T
Sbjct: 6   NKRNVRVLVITNLLLIVVFFVLRNSNASVNESITTHHPDSLVTFDNSGNAPGTHQSVHDT 65

Query: 65  STTNKGSSEVDEEINEIKQKVGLQQPIASVDDSLSAIKNDKGSRITKAFNVQKEYSLILD 124
             T       D+E  E+ +  G  +                       F+   EY+ I++
Sbjct: 66  VNTQ------DKEAEEVDKNSGDAE-----------------------FDAAAEYNKIME 96

Query: 125 LSPIIIFSKSTCSYSKGMKELLENEYQFIPNYYIIELDKHGHGEELQEYIKLVTGRGTVP 184
            SP+I+FSK+ C YSK +K LL N Y F P+YY++ELD+H H +ELQ+ I+ VTGR TVP
Sbjct: 97  QSPMIVFSKTGCPYSKKLKALLTNSYTFSPSYYVVELDRHEHTKELQDQIEKVTGRRTVP 156

Query: 185 NLLVNGVSRGGNEEIKKLHTQGKLLESLQVWSDGKFSVE 223
           N+++ G SRGG  EI +LH   +LL+S + WSDG F+V+
Sbjct: 157 NVIIGGTSRGGYTEIAELHKNDELLDSFKKWSDGAFTVK 195

>Smik_2.133 Chr2 complement(246955..247569) [615 bp, 204 aa] {ON}
           YBR014C (REAL)
          Length = 204

 Score =  133 bits (335), Expect = 3e-38,   Method: Compositional matrix adjust.
 Identities = 60/111 (54%), Positives = 78/111 (70%)

Query: 113 FNVQKEYSLILDLSPIIIFSKSTCSYSKGMKELLENEYQFIPNYYIIELDKHGHGEELQE 172
           F+   EY  IL  SP+I+FSKS C +SK +K LL   Y F P+YY++ELDK  H  ELQE
Sbjct: 86  FDAAAEYDKILKKSPMIVFSKSFCPFSKKLKTLLAESYTFSPSYYVVELDKREHTSELQE 145

Query: 173 YIKLVTGRGTVPNLLVNGVSRGGNEEIKKLHTQGKLLESLQVWSDGKFSVE 223
           +I+  TGR TVPN++++G+SRGG +EI  LH   KLL S + WS GKF+VE
Sbjct: 146 HIEKSTGRRTVPNVVIDGISRGGCDEITALHENDKLLNSFKEWSSGKFTVE 196

>KLLA0E17733g Chr5 complement(1571724..1572359) [636 bp, 211 aa]
           {ON} similar to Saccharomyces cerevisiae YDL010W
           Hypothetical ORF or YBR014C uniprot|P38068 Saccharomyces
           cerevisiae YBR014C Hypothetical ORF
          Length = 211

 Score =  133 bits (334), Expect = 5e-38,   Method: Compositional matrix adjust.
 Identities = 69/162 (42%), Positives = 102/162 (62%), Gaps = 10/162 (6%)

Query: 72  SEVDEEINEIKQKVGLQQPIASVDDSLSAIKNDKGSRITK---------AFNVQKEYSLI 122
           ++V+ +IN I++ +   +  A V D+ +A+KN  G    K          +N + EY  I
Sbjct: 46  AKVESDINNIQEGIAETKSNAVVADTSNAVKNMAGPNGVKDSDFAAEVETYNAEAEYKNI 105

Query: 123 LDLSPIIIFSKSTCSYSKGMKELLENEYQFIPNYYIIELDKHGHGEELQEYIKLVTGRGT 182
           L  SPI++FSKS C +S  +K LL+ EY+F P Y I+ELDKH +G ELQ+YI   TGR T
Sbjct: 106 LSQSPIVVFSKSYCPFSTRLKNLLK-EYEFDPIYTIVELDKHENGAELQKYIGSKTGRST 164

Query: 183 VPNLLVNGVSRGGNEEIKKLHTQGKLLESLQVWSDGKFSVEQ 224
           VPN+++NG+SRGG++E   LH    LL+SL+ W+    SV++
Sbjct: 165 VPNVIINGISRGGSDEFAGLHEDNSLLQSLKTWAGSTLSVKK 206

>Ecym_5313 Chr5 complement(633521..634267) [747 bp, 248 aa] {ON}
           similar to Ashbya gossypii AER017C
          Length = 248

 Score =  131 bits (329), Expect = 6e-37,   Method: Compositional matrix adjust.
 Identities = 61/116 (52%), Positives = 81/116 (69%)

Query: 112 AFNVQKEYSLILDLSPIIIFSKSTCSYSKGMKELLENEYQFIPNYYIIELDKHGHGEELQ 171
            +N    Y  ILD++P+IIFSK+TC YS  +K LL   YQF P+Y +IELD     +ELQ
Sbjct: 131 GYNPADRYQKILDMAPVIIFSKTTCPYSLKLKSLLTQNYQFTPDYVVIELDLEKRTKELQ 190

Query: 172 EYIKLVTGRGTVPNLLVNGVSRGGNEEIKKLHTQGKLLESLQVWSDGKFSVEQREK 227
            YI   TGR TVPNLLVNG S GG++EI  LH++G+LL+S++ WSD K +V  ++K
Sbjct: 191 FYISQQTGRKTVPNLLVNGKSMGGHDEISALHSKGELLKSIEDWSDKKVTVTPKQK 246

>Skud_2.126 Chr2 complement(240244..240858) [615 bp, 204 aa] {ON}
           YBR014C (REAL)
          Length = 204

 Score =  127 bits (319), Expect = 6e-36,   Method: Compositional matrix adjust.
 Identities = 54/111 (48%), Positives = 77/111 (69%)

Query: 113 FNVQKEYSLILDLSPIIIFSKSTCSYSKGMKELLENEYQFIPNYYIIELDKHGHGEELQE 172
           F+   EY  IL+ SP ++FSK+ C YSK +K LL   Y   P+YY++ELD+H HG+EL++
Sbjct: 86  FDAAAEYGKILEYSPFVVFSKTGCPYSKKLKSLLAESYAITPSYYVVELDEHEHGKELKD 145

Query: 173 YIKLVTGRGTVPNLLVNGVSRGGNEEIKKLHTQGKLLESLQVWSDGKFSVE 223
           YI   TGR TVPN+++NG+SRGG  E+  LH    L++S + WS  KF+V+
Sbjct: 146 YIGDKTGRSTVPNVVINGISRGGYTEMAALHENDTLVDSFKEWSSDKFTVK 196

>KNAG0J01260 Chr10 complement(225941..226525) [585 bp, 194 aa] {ON}
           Anc_3.189 YDL010W
          Length = 194

 Score =  120 bits (302), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 59/134 (44%), Positives = 81/134 (60%)

Query: 91  IASVDDSLSAIKNDKGSRITKAFNVQKEYSLILDLSPIIIFSKSTCSYSKGMKELLENEY 150
           +A+V   +   ++ +       F+   EY  IL  SP++IFSKS C YS  +K+LL   +
Sbjct: 60  VAAVKPKIGTDRSGQAPEPAGVFSPAVEYDSILSRSPVVIFSKSYCPYSAKLKKLLAAGF 119

Query: 151 QFIPNYYIIELDKHGHGEELQEYIKLVTGRGTVPNLLVNGVSRGGNEEIKKLHTQGKLLE 210
           +F P Y ++ELD+H HG ELQ+YI   TGR TVPNL+VNGVS GG ++I  L   GKLL+
Sbjct: 120 KFTPAYTVVELDEHEHGPELQKYIAEKTGRSTVPNLIVNGVSHGGCDDIVALSENGKLLD 179

Query: 211 SLQVWSDGKFSVEQ 224
            L  W     +V Q
Sbjct: 180 RLNEWGGSAVNVIQ 193

>TPHA0H00630 Chr8 (125748..126323) [576 bp, 191 aa] {ON} Anc_3.189
           YDL010W
          Length = 191

 Score =  103 bits (256), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 53/110 (48%), Positives = 74/110 (67%), Gaps = 2/110 (1%)

Query: 113 FNVQKEYSLILDLSPIIIFSKSTCSYSKGMKELLENEYQFIPNYYIIELDKHGHGEELQE 172
           F+  +EY  I++++P+++FSK+ C Y K +K+LL + Y+F P+  IIELDKH +G+EL  
Sbjct: 70  FDPAQEYINIMEMAPVVLFSKTFCPYCKRLKKLLADNYRFSPDIKIIELDKHPNGDELFS 129

Query: 173 YIKLVTGRGTVPNLLVNGVSRGGNEEIKKLHTQGKLLESLQVWSDGKFSV 222
           YIK  T   TVPNL+VNG S GG + IKKL    KL+E   +  D  FSV
Sbjct: 130 YIKQQTSHTTVPNLIVNGKSLGGFDSIKKLQ-DDKLVEQ-TIQKDSDFSV 177

>CAGL0I04554g Chr9 (407790..408470) [681 bp, 226 aa] {ON} some
           similarities with uniprot|P38068 Saccharomyces
           cerevisiae YBR014c
          Length = 226

 Score =  102 bits (255), Expect = 3e-26,   Method: Compositional matrix adjust.
 Identities = 64/197 (32%), Positives = 100/197 (50%), Gaps = 23/197 (11%)

Query: 28  NANFLTVEIKEETSKAFSTNMDNMAGGSSREYAAMPTSTTNKGSSEVDEEINEIKQKVGL 87
           N N   +E  E  +KA  T  ++   G+S E A +P S       + D   N +  K G 
Sbjct: 52  NGNTNNIEKAEAGNKAMDTTSNS---GTSNENAQLPGS-----KDQTDSNSNSLSNKEG- 102

Query: 88  QQPIASVDDSLSAIKNDKGSRITKAFNVQKEYSLILDLSPIIIFSKSTCSYSKGMKELLE 147
                         + D        ++  KE+  ++  +PI+IFSKS C +SK +K+LL+
Sbjct: 103 --------------QEDAEEAADAEYSPAKEFQKLVKSAPIVIFSKSYCPFSKNLKKLLD 148

Query: 148 NEYQFIPNYYIIELDKHGHGEELQEYIKLVTGRGTVPNLLVNGVSRGGNEEIKKLHTQGK 207
             Y+  P Y  +E+D+H +G++L  YIK +TGR TVPNL+ NG S+GG +++  LH   +
Sbjct: 149 KNYRLDPAYVAVEVDQHPNGDKLYSYIKKLTGRNTVPNLIANGDSKGGFDDMLALHNSNE 208

Query: 208 LLESLQVWSDGKFSVEQ 224
           L   L  W  G+  V +
Sbjct: 209 LESKLIEWGVGELQVSK 225

>KAFR0A03870 Chr1 (787414..788217) [804 bp, 267 aa] {ON} Anc_8.679
           YPL156C
          Length = 267

 Score = 92.8 bits (229), Expect = 6e-22,   Method: Compositional matrix adjust.
 Identities = 57/186 (30%), Positives = 102/186 (54%), Gaps = 19/186 (10%)

Query: 60  AAMPTSTTNKGSSEVDEEINEIKQKVGLQQPIASVDDSLSAIKNDKGSRI---------- 109
           +  PT+ T+    + + E+N I+    +Q+ I+++ + +S  K  K  ++          
Sbjct: 85  SVTPTAQTSSTPIKNEMELNSIR----VQEQISTILNEMSTDKILKPKKLLSPSKLKKLN 140

Query: 110 --TKAFNVQKEYSLILDLSPIIIFSKSTCSYSKGMKELLENEYQFIPNYYIIELDKHGHG 167
             + +F+V+  ++ IL+ SP+++F K++   S   K LL  EY+  P   +++LDKH +G
Sbjct: 141 PESASFDVETNFNEILNTSPVVLFIKTSDKQSNYFKNLLLREYEISPEVAVVDLDKHSNG 200

Query: 168 EELQEYI---KLVTGRGTVPNLLVNGVSRGGNEEIKKLHTQGKLLESLQVWSDGKFSVEQ 224
            +LQEYI   KL+T    +P L +N V+   N+ +KK H  G LLE+ +   +GK   ++
Sbjct: 201 AKLQEYIRKNKLMTKDQKLPYLFINSVAITNNDNLKKFHKDGTLLENFKKLGNGKIMFKK 260

Query: 225 REKPSN 230
            E PSN
Sbjct: 261 IEAPSN 266

>SAKL0H06468g Chr8 complement(569965..570741) [777 bp, 258 aa] {ON}
           weakly similar to uniprot|Q12498 Saccharomyces
           cerevisiae YPL156C PRM4 Pheromone-regulated protein
           predicted to have 1 transmembrane segment
           transcriptionally regulated by Ste12p during mating and
           by Cat8p during the diauxic shift
          Length = 258

 Score = 90.9 bits (224), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 54/135 (40%), Positives = 78/135 (57%), Gaps = 15/135 (11%)

Query: 112 AFNVQKEYSLILDLSPIIIFSKSTCSYSKGMKELLENEYQFIPNYYIIELDKHGHGEELQ 171
           AF+    +  IL  SP++IF+KS+   S+ +K LL  EYQ  P   ++ELDKH  G+ELQ
Sbjct: 124 AFDPSINFKEILSTSPVVIFTKSSDLGSQYLKNLLTKEYQISPQVAVVELDKHAKGKELQ 183

Query: 172 EYIKL--VTGRGT----------VPNLLVNGVS---RGGNEEIKKLHTQGKLLESLQVWS 216
           +YIKL  +T   +          VP L +NGVS   +G  ++IKKLH  G LL+ L+ ++
Sbjct: 184 DYIKLNKLTAYKSNLSPSDDIPEVPYLFINGVSIINKGLKDDIKKLHKDGSLLDKLRSFA 243

Query: 217 DGKFSVEQREKPSNN 231
             K   E+   PSN+
Sbjct: 244 GEKVMFEKANLPSNS 258

>NCAS0C01340 Chr3 complement(245717..246790) [1074 bp, 357 aa] {ON}
           Anc_8.679
          Length = 357

 Score = 88.2 bits (217), Expect = 9e-20,   Method: Compositional matrix adjust.
 Identities = 50/144 (34%), Positives = 88/144 (61%), Gaps = 12/144 (8%)

Query: 99  SAIKNDKGSRI-TKAFNVQKEYSLILDLSPIIIFSKSTCSYSKGMKELLENEYQFIPNYY 157
           +A++  + S++  K F+ ++ ++ I+  SP ++F KS+ + S  +++LL+ EY+  P   
Sbjct: 213 NAMRTKESSKLNVKPFDPERSFNQIIHTSPAVLFIKSSSTDSLNLRKLLKEEYEISPELA 272

Query: 158 IIELDKHGHGEELQEYI---KLVTGRGT-----VPNLLVNG---VSRGGNEEIKKLHTQG 206
           +++LDKH +G EL++YI   KL+T   T     VP L +NG   ++ G +++I KLH  G
Sbjct: 273 VVDLDKHSNGVELEQYIKQNKLLTEERTNSPINVPYLFLNGNSVINNGLSKDISKLHKNG 332

Query: 207 KLLESLQVWSDGKFSVEQREKPSN 230
            LLE L+  SDG     +++ PSN
Sbjct: 333 HLLEKLRSLSDGHIMFVKKDHPSN 356

>NDAI0E01150 Chr5 complement(228591..229301) [711 bp, 236 aa] {ON}
           Anc_8.679
          Length = 236

 Score = 85.1 bits (209), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 52/168 (30%), Positives = 93/168 (55%), Gaps = 19/168 (11%)

Query: 73  EVDEEINEIKQKVGLQQPIASVDDSLSAIKNDKGSRITKAFNVQKEYSLILDLSPIIIFS 132
           +V++EI  IK ++     ++ +  S S I+         +FN +  +  IL+ SP+++F 
Sbjct: 77  KVNDEILTIKNQIKTTSILSPIPTSSSPIQ---------SFNPEVNFFQILETSPMVLFI 127

Query: 133 KSTCSYSKGMKELLENEYQFIPNYYIIELDKHGHGEELQEYIKL---------VTGRGTV 183
           KS+   SK ++++L  EY+  P   +++LDKH HG+EL+E+I+L          +   ++
Sbjct: 128 KSSERDSKIIRDILTKEYEISPELAVVDLDKHKHGDELEEFIRLNKLNEQAIFSSSLASL 187

Query: 184 PNLLVNGVSRG-GNEEIKKLHTQGKLLESLQVWSDGKFSVEQREKPSN 230
           P L VN VS       IK LH++  L++  ++ S+GK   E++  PSN
Sbjct: 188 PYLFVNEVSMEIDTATIKDLHSKNFLIKKFELMSNGKVLFERKNPPSN 235

>NDAI0K01350 Chr11 complement(308152..308967) [816 bp, 271 aa] {ON}
           Anc_8.679
          Length = 271

 Score = 82.4 bits (202), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 57/175 (32%), Positives = 95/175 (54%), Gaps = 17/175 (9%)

Query: 73  EVDEEINEIKQKVGLQQPIASVDDSLSAIKNDKGSR-----ITKAFNVQKEYSLILDLSP 127
           +V +EI++IK+++   + I   +D     K  K S+      + +FN +  +  IL+ SP
Sbjct: 96  KVWKEISDIKKELSKDEHILKKNDGNDNSKKLKDSQNVHLLSSTSFNAEDNFKQILNTSP 155

Query: 128 IIIFSKSTCSYSKGMKELLENEYQFIPNYYIIELDKHGHGEELQEYIK---------LVT 178
            ++F KS+   S+ +K LL  EY+  P   I++L+KH +G +L  YIK           +
Sbjct: 156 AVLFIKSSEWDSQYLKNLLSIEYEISPQLAIVDLEKHSNGNQLLNYIKKNKLLPPSNKAS 215

Query: 179 GRGTVPNLLVNGVS---RGGNEEIKKLHTQGKLLESLQVWSDGKFSVEQREKPSN 230
               +P L +NGVS    G +++IK+LH+ G LL  L+ +SDG    E++  PSN
Sbjct: 216 STPNLPYLFINGVSIINNGLSKDIKQLHSNGHLLNKLKSYSDGHIFFEKKNFPSN 270

>Kpol_1072.14 s1072 complement(30780..31532) [753 bp, 250 aa] {ON}
           complement(30780..31532) [753 nt, 251 aa]
          Length = 250

 Score = 80.9 bits (198), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 59/185 (31%), Positives = 99/185 (53%), Gaps = 22/185 (11%)

Query: 66  TTNKGSSEVDEEINEIKQKVGLQQPIASVDDSLSAIK------NDKGSRITKA----FNV 115
           T NK  S + EEI     +V  ++ I+++   LS I       N +   IT      F+ 
Sbjct: 67  TNNKVPSNMKEEIELNSLRV--EEQISTIRGELSNIAPTHINTNIRAPTITPGLGLNFDA 124

Query: 116 QKEYSLILDLSPIIIFSKSTCSYSKGMKELLENEYQFIPNYYIIELDKHGHGEELQEYIK 175
           ++ +  I++ SP++IF KS+   S  +K LL  EY+  P   +++LD+H  G+ LQ+YIK
Sbjct: 125 ERNFKEIINTSPVVIFIKSSDPASHYLKNLLLREYEVSPEMAVVDLDRHVQGQLLQKYIK 184

Query: 176 ---LVTGRG----TVPNLLVNGVS---RGGNEEIKKLHTQGKLLESLQVWSDGKFSVEQR 225
              L +G       VP L +NGVS    G  ++IK+  T+G LL+ L+ ++     ++++
Sbjct: 185 AYQLTSGENGNPPEVPYLFINGVSVINNGIEKDIKQAQTKGILLDKLKSFASDNVMIQKK 244

Query: 226 EKPSN 230
           + PSN
Sbjct: 245 DMPSN 249

>NCAS0B01640 Chr2 (268028..268750) [723 bp, 240 aa] {ON} Anc_8.679
          Length = 240

 Score = 80.5 bits (197), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 41/109 (37%), Positives = 67/109 (61%), Gaps = 7/109 (6%)

Query: 112 AFNVQKEYSLILDLSPIIIFSKSTCSYSKGMKELLENEYQFIPNYYIIELDKHGHGEELQ 171
           AFNVQ+ ++ I+  SP+++F KS+   S+ M++LL+ EY+  P   +++LDKH HG  LQ
Sbjct: 114 AFNVQQHFTQIIHTSPVVLFMKSSQDDSRLMRDLLQKEYEISPEIAVVDLDKHTHGAALQ 173

Query: 172 EYIKL--VTGRGT----VPNLLVN-GVSRGGNEEIKKLHTQGKLLESLQ 213
           +YI+L  +  RGT    +P L +N        + +K LH  G LL++ +
Sbjct: 174 DYIRLNKLDNRGTAYVKLPYLFINEQFVHVDVKNVKSLHKDGALLKTFK 222

>KNAG0G02580 Chr7 (585685..586521) [837 bp, 278 aa] {ON} Anc_8.679
           YPL156C
          Length = 278

 Score = 77.0 bits (188), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 56/181 (30%), Positives = 97/181 (53%), Gaps = 26/181 (14%)

Query: 71  SSEVDEEINEIKQKVGLQ-QPIASVDD-------SLSAIKNDKGSRITKAFNVQKEYSLI 122
           S +VD+EI+ +++++  Q QP A  D        +   + +D        ++    ++ +
Sbjct: 104 SQKVDQEISAVRKEIDAQTQPTARGDRRKKKKVLATELLADDA------PWDPLSTFTEV 157

Query: 123 LDLSPIIIFSKST--CSYSKGMKELLENEYQFIPNYYIIELDKHGHGEELQEYI---KLV 177
           +++SP+++F KS+   S +  ++++L  EY+  P   +++LDKH +GEELQ YI   KL 
Sbjct: 158 MNMSPVVLFIKSSERNSLADHVRKVLSTEYEISPGAAVVDLDKHRYGEELQNYIETQKLP 217

Query: 178 TGRG-TVPNLLVNGVSRGGNEEI------KKLHTQGKLLESLQVWSDGKFSVEQREKPSN 230
            G    +P L VN V   G  EI      K+LH+ G LL+  +  ++ K   E+ E PSN
Sbjct: 218 GGSSQQLPYLFVNRVPVIGAGEIDSVAEFKRLHSTGALLDRFKQLAERKVLFEKIELPSN 277

Query: 231 N 231
           N
Sbjct: 278 N 278

>TPHA0G01590 Chr7 complement(326061..326954) [894 bp, 297 aa] {ON}
           Anc_8.679 YPL156C
          Length = 297

 Score = 74.3 bits (181), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 44/132 (33%), Positives = 73/132 (55%), Gaps = 13/132 (9%)

Query: 112 AFNVQKEYSLILDLSPIIIFSKSTCSYSKGMKELLENEYQFIPNYYIIELDKHGHGEELQ 171
           AF+    Y  I++ S +++F KS+ S S  +K+LL N Y+ +P   I++LD+H  G  L 
Sbjct: 165 AFDAAANYKEIINTSRVVLFMKSSDSQSNEIKKLLLNSYEILPEIAIVDLDRHVQGALLH 224

Query: 172 EYI---KLVTG--------RGTVPNLLVNGVS--RGGNEEIKKLHTQGKLLESLQVWSDG 218
           +YI   K++T         +  VP L++NGVS     N+   KLH +G LL+ L+  +  
Sbjct: 225 DYIAKKKILTNQLGYHKDDQLEVPFLVINGVSFVTSSNKNFHKLHNEGLLLQKLKNLAGD 284

Query: 219 KFSVEQREKPSN 230
              + +++ PSN
Sbjct: 285 SVMISKKDSPSN 296

>KLLA0D05973g Chr4 (512611..513456) [846 bp, 281 aa] {ON} some
           similarities with uniprot|Q12498 Saccharomyces
           cerevisiae YPL156C PRM4 Pheromone-regulated protein
           predicted to have 1 transmembrane segment
           transcriptionally regulated by Ste12p during mating and
           by Cat8p during the diauxic shift
          Length = 281

 Score = 73.6 bits (179), Expect = 6e-15,   Method: Compositional matrix adjust.
 Identities = 45/125 (36%), Positives = 68/125 (54%), Gaps = 15/125 (12%)

Query: 122 ILDLSPIIIFSKSTCSYSKGMKELLENEYQFIPNYYIIELDKHGHGEELQEYI---KLVT 178
           IL+ SP+I+F KS+   S  +K +L  EY F P   +++LDKH  G+ +QEYI   +L T
Sbjct: 157 ILNTSPVILFIKSSEKNSVDLKNVLTLEYTFSPEIIVVDLDKHQFGDSMQEYIQLNRLAT 216

Query: 179 GRGT---------VPNLLVNGVS---RGGNEEIKKLHTQGKLLESLQVWSDGKFSVEQRE 226
            +           VP L +NGVS   +   ++I   H  G LL  L+  +D K S+ + +
Sbjct: 217 YKSNYGESSKSPDVPYLFINGVSLINKSLKDDILNKHADGSLLSKLRHVADSKVSISKVD 276

Query: 227 KPSNN 231
            PSN+
Sbjct: 277 IPSNS 281

>YPL156C Chr16 complement(255913..256767) [855 bp, 284 aa] {ON}
           PRM4Pheromone-regulated protein proposed to be involved
           in mating; predicted to have 1 transmembrane segment;
           transcriptionally regulated by Ste12p during mating and
           by Cat8p during the diauxic shift
          Length = 284

 Score = 69.7 bits (169), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 44/132 (33%), Positives = 74/132 (56%), Gaps = 12/132 (9%)

Query: 111 KAFNVQKEYSLILDLSPIIIFSKSTCSYSKGMKELLENEYQFIPNYYIIELDKHGHGEEL 170
           K F+ + ++  I+  SP ++F KS+ + S  +K LL+ E++  P    ++L+KH HG EL
Sbjct: 152 KKFDPRTDFLDIIRTSPAVLFIKSSQADSIFLKNLLQREFEISPELATVDLEKHSHGYEL 211

Query: 171 QEYIK-----LVTGRGT----VPNLLVNGVS---RGGNEEIKKLHTQGKLLESLQVWSDG 218
           ++YIK     + T         P L +NG+S   RG   +I + H++G LL  L+  + G
Sbjct: 212 EKYIKQNKLNIDTSAALESIQSPYLFLNGISVINRGMVRDIIEPHSKGLLLPLLKSEARG 271

Query: 219 KFSVEQREKPSN 230
              VE+++ PSN
Sbjct: 272 NLLVEKKDIPSN 283

>TBLA0B03820 Chr2 complement(878781..879536) [756 bp, 251 aa] {ON}
           Anc_8.679 YPL156C
          Length = 251

 Score = 68.9 bits (167), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 55/171 (32%), Positives = 91/171 (53%), Gaps = 12/171 (7%)

Query: 70  GSSEVDEEINEIKQKVGLQQPI-ASVDDSLSAIKNDKGSRITKAFNVQKEYSLILDLSPI 128
            S +V+E+I+ I   +    P    VDD  S+ ++      T ++N +  +  IL+ SP+
Sbjct: 84  NSIKVEEQISTILNDITNHHPTKLPVDDIPSSTRDPNP---TGSYNPELNFKQILNTSPM 140

Query: 129 IIFSKSTCSYSKGMKELLENEYQFIPNYYIIELDKHGHGEELQEYI---KLVTGRGT--V 183
           ++F +S+   SK +K+L  NEY+  P + I++LD H +G  LQ YI   K++    T  V
Sbjct: 141 VLFIRSSQKSSKFIKKLFLNEYEISPEFAIVDLDLHKNGNILQNYIQTKKIINKDDTLDV 200

Query: 184 PNLLVNGVS---RGGNEEIKKLHTQGKLLESLQVWSDGKFSVEQREKPSNN 231
           P L +NGVS      N++I  LH    LL+ L+  +      +++  PSNN
Sbjct: 201 PYLFINGVSVINSNLNKDIISLHVNDLLLDKLKSLAGDNVMFQKKGVPSNN 251

>Kwal_26.8814 s26 (953489..954316) [828 bp, 275 aa] {ON} YPL156C
           (PRM4) -  [contig 68] FULL
          Length = 275

 Score = 68.2 bits (165), Expect = 6e-13,   Method: Compositional matrix adjust.
 Identities = 40/129 (31%), Positives = 67/129 (51%), Gaps = 11/129 (8%)

Query: 113 FNVQKEYSLILDLSPIIIFSKSTCSYSKGMKELLENEYQFIPNYYIIELDKHGHGEELQE 172
           F+    +S IL+ SP++IF  S    S+ ++ LL   Y+  P   +++L+KH  G +L+ 
Sbjct: 148 FDAAASFSEILNTSPVVIFVDS-AQDSELLRSLLHRHYEVSPAPAVVDLEKHSRGAQLES 206

Query: 173 YIKLVTGRGTV-------PNLLVNG---VSRGGNEEIKKLHTQGKLLESLQVWSDGKFSV 222
           +I+L     T        P L VNG   ++     +I+ LH Q KLLE L+  ++G+   
Sbjct: 207 FIRLYKTDQTSNPSPREPPYLFVNGQSVINTDFKSDIQDLHAQNKLLEKLRSVAEGQVMF 266

Query: 223 EQREKPSNN 231
            +   PSN+
Sbjct: 267 TRNNAPSNS 275

>Suva_16.154 Chr16 complement(265047..265898) [852 bp, 283 aa] {ON}
           YPL156C (REAL)
          Length = 283

 Score = 67.8 bits (164), Expect = 8e-13,   Method: Compositional matrix adjust.
 Identities = 46/132 (34%), Positives = 73/132 (55%), Gaps = 12/132 (9%)

Query: 111 KAFNVQKEYSLILDLSPIIIFSKSTCSYSKGMKELLENEYQFIPNYYIIELDKHGHGEEL 170
           K F+ +  +  I++ SP ++F KS+   S  +K LL+ E++  P   I++L+KH +G EL
Sbjct: 151 KKFDPKVNFLDIINTSPAVLFIKSSQMDSVFLKRLLQREFETSPELAIVDLEKHSYGYEL 210

Query: 171 QEYI---KLVTGRGTV------PNLLVNGVS---RGGNEEIKKLHTQGKLLESLQVWSDG 218
           ++YI   KL     T       P L +NGVS    G   +I + H++G LL  L+  + G
Sbjct: 211 EKYIKENKLDVDPSTALEAIHSPYLFLNGVSVINNGIARDIIEPHSKGLLLPVLKSKAGG 270

Query: 219 KFSVEQREKPSN 230
              VE+R+ PSN
Sbjct: 271 NLLVEKRDIPSN 282

>Ecym_2394 Chr2 complement(763799..764644) [846 bp, 281 aa] {ON}
           similar to Ashbya gossypii ACR146W
          Length = 281

 Score = 67.4 bits (163), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 44/125 (35%), Positives = 67/125 (53%), Gaps = 15/125 (12%)

Query: 122 ILDLSPIIIFSKSTCSYSKGMKELLENEYQFIPNYYIIELDKHGHGEELQEYIKL--VTG 179
           IL+ SP+++F+K     S+ +K LL  EY+  P   I++L KH  G+ELQ+YI L  +  
Sbjct: 157 ILNTSPVVVFAKGMNRDSEYLKNLLHAEYEVTPEIAIVDLMKHDQGDELQKYIMLNKLNT 216

Query: 180 RGT----------VPNLLVNGVS---RGGNEEIKKLHTQGKLLESLQVWSDGKFSVEQRE 226
             T          VP L +NGVS       ++IK  HT G L+E L+ ++  K   ++  
Sbjct: 217 YNTHYDASDDIPDVPYLFINGVSVINVSLEKDIKLQHTSGLLIEKLRSFAGEKVKFKRLS 276

Query: 227 KPSNN 231
            PSN+
Sbjct: 277 PPSNS 281

>Skud_16.126 Chr16 complement(227492..228355) [864 bp, 287 aa] {ON}
           YPL156C (REAL)
          Length = 287

 Score = 66.2 bits (160), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 44/132 (33%), Positives = 72/132 (54%), Gaps = 12/132 (9%)

Query: 111 KAFNVQKEYSLILDLSPIIIFSKSTCSYSKGMKELLENEYQFIPNYYIIELDKHGHGEEL 170
           K F+ +  +  I+  SP ++F KS+   S  +K LL+ E++  P    ++L+KH HG +L
Sbjct: 155 KEFDPKVSFLDIISTSPAVLFIKSSQMDSIFLKNLLQREFEISPELATVDLEKHSHGYQL 214

Query: 171 QEYI---KLVTGRGTV------PNLLVNGVS---RGGNEEIKKLHTQGKLLESLQVWSDG 218
           ++YI   KL     T       P L +NGVS    G  ++I + H++G LL  L+  + G
Sbjct: 215 EKYIKQNKLSINPSTALESIHSPYLFLNGVSVINNGMAKDIIEPHSEGLLLSILKSEARG 274

Query: 219 KFSVEQREKPSN 230
              VE+++ PSN
Sbjct: 275 NLLVEKKDIPSN 286

>KLTH0D11308g Chr4 (925622..926437) [816 bp, 271 aa] {ON} some
           similarities with uniprot|Q12498 Saccharomyces
           cerevisiae YPL156C PRM4 Pheromone-regulated protein
           predicted to have 1 transmembrane segment
           transcriptionally regulated by Ste12p during mating and
           by Cat8p during the diauxic shift
          Length = 271

 Score = 64.3 bits (155), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 47/195 (24%), Positives = 94/195 (48%), Gaps = 19/195 (9%)

Query: 55  SSREYAAMPTSTTNKGSSEVDEEINEIKQKV----GLQQPIASVDDSLSA--IKNDKGSR 108
           S  E AA P+++   G   V++  ++I+ ++    G+   +A+  + + +  +   +  R
Sbjct: 78  SRAEAAAKPSASAEAGPRAVEQIFSDIRLEISDNSGVATRVATRAEIVRSEVVHGPRNYR 137

Query: 109 ITKA-FNVQKEYSLILDLSPIIIFSKSTCSYSKGMKELLENEYQFIPNYYIIELDKHGHG 167
              A F+    +  IL  SP+++F  S    S+ ++ LL+ +Y+  P   +++L+KH  G
Sbjct: 138 PPSADFDPAANFQEILSASPVVLFVDSAQD-SERLRALLQRDYEVSPAPAVVDLEKHSRG 196

Query: 168 EELQEYIKLVTGRGT--------VPNLLVNG---VSRGGNEEIKKLHTQGKLLESLQVWS 216
            +L+ YI+    +           P L VNG   ++     +I+ LH Q +LL  L+  +
Sbjct: 197 AQLETYIRYYRTKPASATAVPRQPPYLFVNGNSVINSDFQSDIQDLHAQNELLAKLKTVA 256

Query: 217 DGKFSVEQREKPSNN 231
           +G     +   PSN+
Sbjct: 257 EGNVMFARNNAPSNS 271

>Smik_6.353 Chr6 (567550..568410) [861 bp, 286 aa] {ON} YPL156C
           (REAL)
          Length = 286

 Score = 63.9 bits (154), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 42/133 (31%), Positives = 72/133 (54%), Gaps = 12/133 (9%)

Query: 111 KAFNVQKEYSLILDLSPIIIFSKSTCSYSKGMKELLENEYQFIPNYYIIELDKHGHGEEL 170
           K F+ +  +  I+  SP ++F KS+ S S  ++ LL+ E++  P    ++L+KH  G EL
Sbjct: 154 KNFDPKANFLDIIKTSPAVLFIKSSQSDSIFLRNLLQKEFEISPELATVDLEKHSRGYEL 213

Query: 171 QEYIK---------LVTGRGTVPNLLVNGVS---RGGNEEIKKLHTQGKLLESLQVWSDG 218
           ++YIK         +       P L +NGVS    G  ++I + H++G LL  L+  + G
Sbjct: 214 EKYIKQNKLNIDPDIALESIHPPYLFLNGVSLINNGIEKDIIEPHSKGSLLSVLKSEARG 273

Query: 219 KFSVEQREKPSNN 231
              VE+++ PSN+
Sbjct: 274 NLLVEKKDIPSNS 286

>CAGL0M02167g Chr13 complement(259132..259833) [702 bp, 233 aa] {ON}
           some similarities with uniprot|Q12498 Saccharomyces
           cerevisiae YPL156c PRM4
          Length = 233

 Score = 62.8 bits (151), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 46/170 (27%), Positives = 86/170 (50%), Gaps = 20/170 (11%)

Query: 78  INEIKQKVGLQQPIASVDDSLSAIKNDKGSRITKAFNVQKEYSLILDLSPIIIFSKSTCS 137
           +N IK++      +A    S S++  D G+ I   ++ +K +  I++ SP ++F +S+  
Sbjct: 66  VNSIKKESNNLNSVAHTSMSSSSVAKD-GTVI--EYDPEKNFKQIINTSPAVLFIRSSEY 122

Query: 138 YSKGMKELLENEYQFIPNYYIIELDKHGHGEELQEYI--------KLVTGRGT------V 183
            S  +++LL  +Y+  P   I++LDKH H   L+ +I        K+   + T       
Sbjct: 123 ESNILRKLLTRDYEITPELAIVDLDKHDHDVLLERHILSHKIKSTKVEVLKSTSVKQAKA 182

Query: 184 PNLLVNG---VSRGGNEEIKKLHTQGKLLESLQVWSDGKFSVEQREKPSN 230
           P L +NG   ++ G  ++I K H +G+LL  L+ ++       +R+ PSN
Sbjct: 183 PYLFINGHSLINNGIADDILKFHEKGQLLTKLKAFAGENIVFNKRDLPSN 232

>ACR146W Chr3 (607725..608366) [642 bp, 213 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YPL156C (PRM4)
          Length = 213

 Score = 61.2 bits (147), Expect = 8e-11,   Method: Compositional matrix adjust.
 Identities = 40/147 (27%), Positives = 70/147 (47%), Gaps = 18/147 (12%)

Query: 98  LSAIKNDKGSRITKAFNVQKEYSLILDLSPIIIFSKSTCSYSKGMKELLENEYQFIPNYY 157
           L A++   G      F   + +  I+  SP ++F K T   S+ ++ LL NEY+  P   
Sbjct: 72  LDAVRRGGGD-----FRPAQNFQEIISTSPFVLFVKGTDESSRYLRHLLTNEYEVTPEIA 126

Query: 158 IIELDKHGHGEELQEYIK----------LVTGRGTVPNLLVNG---VSRGGNEEIKKLHT 204
           +++L KH +  +LQ YI+          L      VP L V G   ++    ++I++ H 
Sbjct: 127 VVDLSKHRYSGDLQRYIREHKLHGPLFQLTENTPDVPYLFVKGESVINTSVEKDIREPHE 186

Query: 205 QGKLLESLQVWSDGKFSVEQREKPSNN 231
           +G+L   LQ  +     +++R  PSN+
Sbjct: 187 RGQLQAELQRHAGLDAVIKKRSPPSNS 213

>NDAI0F04430 Chr6 complement(1083612..1084022) [411 bp, 136 aa] {ON}
           Anc_1.38 YCL035C
          Length = 136

 Score = 57.8 bits (138), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 29/83 (34%), Positives = 51/83 (61%), Gaps = 3/83 (3%)

Query: 128 IIIFSKSTCSYSKGMKELLENEYQFIPN--YYIIELDKHGHGEELQEYIKLVTGRGTVPN 185
           +IIF+KS C Y K  K  +  E   +P     +++LD   +G+E+Q+ +  + G+ TVP+
Sbjct: 48  VIIFAKSYCPYCKAAKHTIFEEIN-VPKSKALVLDLDLMDNGQEIQQALLAINGQKTVPH 106

Query: 186 LLVNGVSRGGNEEIKKLHTQGKL 208
           + +NG   GGN E++K++  G+L
Sbjct: 107 VYINGEFIGGNSEVQKIYKSGEL 129

>Kpol_2002.36 s2002 complement(73659..73988) [330 bp, 109 aa] {ON}
           complement(73659..73988) [330 nt, 110 aa]
          Length = 109

 Score = 56.6 bits (135), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 30/88 (34%), Positives = 49/88 (55%), Gaps = 3/88 (3%)

Query: 127 PIIIFSKSTCSYSKGMKELLENEYQFIPN--YYIIELDKHGHGEELQEYIKLVTGRGTVP 184
           P+ + +KS C + +  +E L  EY  +P     ++ELD    G E+QE +  +T + TVP
Sbjct: 18  PVFVAAKSYCPHCRATRETLFEEYN-LPREKALVLELDLMTDGAEIQEALAEITHQDTVP 76

Query: 185 NLLVNGVSRGGNEEIKKLHTQGKLLESL 212
           N+ + G   GGN +++ L   G+L E L
Sbjct: 77  NIFIYGQHVGGNSDLQALKKDGQLKEML 104

>CAGL0K05813g Chr11 (570054..570482) [429 bp, 142 aa] {ON} highly
           similar to uniprot|P17695 Saccharomyces cerevisiae
           YDR513w TTR1
          Length = 142

 Score = 56.2 bits (134), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 30/87 (34%), Positives = 50/87 (57%), Gaps = 1/87 (1%)

Query: 128 IIIFSKSTCSYSKGMKELLENEYQF-IPNYYIIELDKHGHGEELQEYIKLVTGRGTVPNL 186
           I + SKS C Y +  K+ L  E +  +    ++ELD+   G ++Q+ +  + G+ TVPN+
Sbjct: 52  IFVASKSYCPYCRAAKQTLFEELKVPMDKAVVLELDEIEEGSDIQQALAEINGQNTVPNI 111

Query: 187 LVNGVSRGGNEEIKKLHTQGKLLESLQ 213
            ++G   GGN +++KL   GKL   LQ
Sbjct: 112 YIDGQHIGGNSDLQKLKQTGKLQPLLQ 138

>Kwal_33.13166 s33 complement(102922..103338) [417 bp, 138 aa] {ON}
           YCL035C (GRX1) - Glutaredoxin [contig 121] FULL
          Length = 138

 Score = 55.5 bits (132), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 28/82 (34%), Positives = 49/82 (59%), Gaps = 1/82 (1%)

Query: 128 IIIFSKSTCSYSKG-MKELLENEYQFIPNYYIIELDKHGHGEELQEYIKLVTGRGTVPNL 186
           I + SK+ C Y +  +K L E++       Y+++LD    G E+QE +  ++G+ TVPN+
Sbjct: 48  IFVASKTYCPYCQATLKLLFEDKKLTKDQVYVVQLDTIKEGSEIQEALAEISGQKTVPNV 107

Query: 187 LVNGVSRGGNEEIKKLHTQGKL 208
            ++G   GGN +++ L + GKL
Sbjct: 108 YISGEHIGGNSDLQALESSGKL 129

>Smik_4.794 Chr4 (1393831..1394262) [432 bp, 143 aa] {ON} YDR513W
           (REAL)
          Length = 143

 Score = 55.1 bits (131), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 29/88 (32%), Positives = 51/88 (57%), Gaps = 3/88 (3%)

Query: 128 IIIFSKSTCSYSKGMKELLENEYQFIPN--YYIIELDKHGHGEELQEYIKLVTGRGTVPN 185
           + + +K+ C Y K     L  E   +P     ++ELD+  +G E+Q+ ++ ++G+ TVPN
Sbjct: 53  VFVAAKTYCPYCKATLSTLFQELN-VPKSKALVLELDEMSNGSEIQDALEEISGQKTVPN 111

Query: 186 LLVNGVSRGGNEEIKKLHTQGKLLESLQ 213
           + +NG   GGN +++ L   GKL E L+
Sbjct: 112 VYINGKHIGGNSDLETLKKNGKLAEILK 139

>Suva_2.693 Chr2 (1223806..1224237) [432 bp, 143 aa] {ON} YDR513W
           (REAL)
          Length = 143

 Score = 55.1 bits (131), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 29/88 (32%), Positives = 51/88 (57%), Gaps = 3/88 (3%)

Query: 128 IIIFSKSTCSYSKGMKELLENEYQFIPN--YYIIELDKHGHGEELQEYIKLVTGRGTVPN 185
           + + +K+ C Y K     L  E   +P     ++ELD+  +G E+Q+ ++ ++G+ TVPN
Sbjct: 53  VFVAAKTYCPYCKATLSTLFQELN-VPKSKAVVLELDEMSNGSEIQDALEEISGQKTVPN 111

Query: 186 LLVNGVSRGGNEEIKKLHTQGKLLESLQ 213
           + +NG   GGN +++ L   GKL E L+
Sbjct: 112 VYINGKHIGGNSDLEALKKNGKLAELLK 139

>TBLA0A05080 Chr1 complement(1251350..1251706) [357 bp, 118 aa] {ON}
           Anc_1.38 YCL035C
          Length = 118

 Score = 54.3 bits (129), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 33/93 (35%), Positives = 54/93 (58%), Gaps = 3/93 (3%)

Query: 123 LDLSPIIIFSKSTCSYSKGMKELLENEYQFIPN--YYIIELDKHGHGEELQEYIKLVTGR 180
           ++  PI +  KS C YSK   E L ++   +P     +I +D+  +G E+++ I   TG+
Sbjct: 24  INAKPIFVARKSDCPYSKKTLETLFDDLH-VPKDKVLLITVDEIENGAEVKQAIIDYTGQ 82

Query: 181 GTVPNLLVNGVSRGGNEEIKKLHTQGKLLESLQ 213
            TVPN  +NG   GGN++++KL   G+L E L+
Sbjct: 83  KTVPNTYINGRHIGGNDDLQKLKQTGELQELLR 115

>YDR513W Chr4 (1471017..1471448) [432 bp, 143 aa] {ON}
           GRX2Cytoplasmic glutaredoxin, thioltransferase,
           glutathione-dependent disulfide oxidoreductase involved
           in maintaining redox state of target proteins, also
           exhibits glutathione peroxidase activity, expression
           induced in response to stress
          Length = 143

 Score = 54.7 bits (130), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 29/88 (32%), Positives = 51/88 (57%), Gaps = 3/88 (3%)

Query: 128 IIIFSKSTCSYSKGMKELLENEYQFIPN--YYIIELDKHGHGEELQEYIKLVTGRGTVPN 185
           + + +K+ C Y K     L  E   +P     ++ELD+  +G E+Q+ ++ ++G+ TVPN
Sbjct: 53  VFVAAKTYCPYCKATLSTLFQELN-VPKSKALVLELDEMSNGSEIQDALEEISGQKTVPN 111

Query: 186 LLVNGVSRGGNEEIKKLHTQGKLLESLQ 213
           + +NG   GGN +++ L   GKL E L+
Sbjct: 112 VYINGKHIGGNSDLETLKKNGKLAEILK 139

>Skud_4.788 Chr4 (1391142..1391579) [438 bp, 145 aa] {ON} YDR513W
           (REAL)
          Length = 145

 Score = 54.7 bits (130), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 29/88 (32%), Positives = 51/88 (57%), Gaps = 3/88 (3%)

Query: 128 IIIFSKSTCSYSKGMKELLENEYQFIPN--YYIIELDKHGHGEELQEYIKLVTGRGTVPN 185
           + + +K+ C Y K     L  E   +P     ++ELD+  +G E+Q+ ++ ++G+ TVPN
Sbjct: 53  VFVAAKTYCPYCKATLSTLFQELN-VPKSKALVLELDEMSNGSEIQDALEEISGQRTVPN 111

Query: 186 LLVNGVSRGGNEEIKKLHTQGKLLESLQ 213
           + +NG   GGN +++ L   GKL E L+
Sbjct: 112 VYINGKHIGGNSDLESLKKSGKLAEILK 139

>TPHA0B03560 Chr2 complement(832814..833134) [321 bp, 106 aa] {ON} 
          Length = 106

 Score = 53.1 bits (126), Expect = 9e-09,   Method: Compositional matrix adjust.
 Identities = 27/84 (32%), Positives = 46/84 (54%), Gaps = 3/84 (3%)

Query: 127 PIIIFSKSTCSYSKGMKELLENEYQFIP--NYYIIELDKHGHGEELQEYIKLVTGRGTVP 184
           PI + +KS C Y +  K  L  E   +P     +++LD+   G+ +Q  +  +T + TVP
Sbjct: 17  PIFVAAKSYCPYCQASKSTLFKELN-VPADKATVLDLDQMQDGQAIQAILAELTQQNTVP 75

Query: 185 NLLVNGVSRGGNEEIKKLHTQGKL 208
           N+ +NG   GGN +++ L   G+L
Sbjct: 76  NIFINGKHIGGNSDLQALKNNGEL 99

>NCAS0A00360 Chr1 complement(54875..55291) [417 bp, 138 aa] {ON}
           Anc_1.38 YCL035C
          Length = 138

 Score = 53.1 bits (126), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 29/87 (33%), Positives = 52/87 (59%), Gaps = 3/87 (3%)

Query: 128 IIIFSKSTCSYSKGMKELLENEYQFIPN--YYIIELDKHGHGEELQEYIKLVTGRGTVPN 185
           II+F+KS C YS   +  L N+ + +P     ++ELD    G+E+Q+ +  + G+ TVP+
Sbjct: 48  IIVFAKSYCPYSIATRRTLFNDCK-VPQSKALVLELDLMQDGQEIQQALLAINGQKTVPH 106

Query: 186 LLVNGVSRGGNEEIKKLHTQGKLLESL 212
           + + G   GGN E++++   G+L + L
Sbjct: 107 VYIAGEFIGGNHELQQIFQSGELQKKL 133

>KLLA0C01298g Chr3 complement(101676..101999) [324 bp, 107 aa] {ON}
           weakly similar to uniprot|P25567 Saccharomyces
           cerevisiae YCL037C SRO9 Associates with translating
           ribosomes and weakly similar to uniprot|Q12034
           Saccharomyces cerevisiae YDR515W SLF1 RNA binding
           protein that associates with polysomes
          Length = 107

 Score = 52.0 bits (123), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 30/95 (31%), Positives = 56/95 (58%), Gaps = 4/95 (4%)

Query: 122 ILDLSPIIIFSKSTCSYSKG-MKELLENEYQFIPNYYIIELDKHGHGEELQEYIKLVTGR 180
           +++ S I + SK+ C Y +  +K L E +        +++L++   G ++Q+ +  +TG+
Sbjct: 13  LINSSKIFVASKTYCPYCQATLKTLFEEKKVDKKLATVLQLNQLEDGSDIQDALAEITGQ 72

Query: 181 GTVPNLLVNGVSRGGNEEIKKLHTQG---KLLESL 212
            TVPN+ +NG   GGN ++++L+  G   KLL SL
Sbjct: 73  KTVPNIFINGKHIGGNSDLQELNNSGDLDKLLASL 107

>KNAG0C00450 Chr3 complement(77334..77807) [474 bp, 157 aa] {ON}
           Anc_1.38 YCL035C
          Length = 157

 Score = 53.1 bits (126), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 29/84 (34%), Positives = 48/84 (57%), Gaps = 3/84 (3%)

Query: 127 PIIIFSKSTCSYSKGMKELLENEYQFIPN--YYIIELDKHGHGEELQEYIKLVTGRGTVP 184
           PI + SK+ C Y +   + L  E + IP     +++LD+   G E+QE +  + G+ TVP
Sbjct: 66  PIFVASKTYCPYCRATLKTLFKELE-IPESEAVVLQLDEMPDGPEIQEALFDINGQKTVP 124

Query: 185 NLLVNGVSRGGNEEIKKLHTQGKL 208
           N+ + G   GGN++++ L   GKL
Sbjct: 125 NIYIKGQHIGGNDDLQTLKKAGKL 148

>Kpol_2000.99 s2000 (219541..219966) [426 bp, 141 aa] {ON}
           (219541..219966) [426 nt, 142 aa]
          Length = 141

 Score = 52.8 bits (125), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 26/88 (29%), Positives = 53/88 (60%), Gaps = 3/88 (3%)

Query: 128 IIIFSKSTCSYSKGMKELLENEYQFIPN--YYIIELDKHGHGEELQEYIKLVTGRGTVPN 185
           + + +KS C Y +   + L  +Y  +P     +++L++   G+++Q  +  +TG+ TVPN
Sbjct: 51  VFVAAKSYCPYCQASLQTLFTDYH-VPKDKSLVLQLNQMEDGDDIQAALAEITGQRTVPN 109

Query: 186 LLVNGVSRGGNEEIKKLHTQGKLLESLQ 213
           + ++G   GGN ++++L + GKL E L+
Sbjct: 110 IYIDGKHIGGNSDLQQLKSSGKLDELLK 137

>Ecym_1044 Chr1 complement(84062..84538) [477 bp, 158 aa] {ON}
           similar to Ashbya gossypii AFR710W
          Length = 158

 Score = 52.8 bits (125), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 36/113 (31%), Positives = 61/113 (53%), Gaps = 3/113 (2%)

Query: 98  LSAIKNDKGSRITKAFNVQKEYSLILDLSPIIIFSKSTCSYSK-GMKELLENEYQFIPNY 156
           L  +K  +  ++     VQ+  SLI   S I + SK+ C Y +   K L E++   +P  
Sbjct: 38  LIIVKIRQQKKMVSPATVQQVQSLIKQ-SKIFVASKTYCPYCRRAKKTLFEDKKIPLPEA 96

Query: 157 YIIELDKHGH-GEELQEYIKLVTGRGTVPNLLVNGVSRGGNEEIKKLHTQGKL 208
            ++ELD  G  G ++Q  +  ++G+ TVPN+ + G   GGN E++ L + G+L
Sbjct: 97  KVLELDIMGQEGVDIQAALLELSGQRTVPNIYIGGKHIGGNSELQALESSGEL 149

>TPHA0E03730 Chr5 (787911..788231) [321 bp, 106 aa] {ON} Anc_1.38
           YCL035C
          Length = 106

 Score = 51.2 bits (121), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 29/95 (30%), Positives = 55/95 (57%), Gaps = 4/95 (4%)

Query: 122 ILDLSPIIIFSKSTCSYSKGMKELLENEYQFIPN-YYIIELDKHGHGEELQEYIKLVTGR 180
           ++D  P+ I +KS C+ S   K  L +EY  + +   ++ELDK   GE +   +  ++ +
Sbjct: 12  MIDEKPVFIATKSYCNESNAAKGTLFDEYSILDDEATVLELDKMSDGEAVLFALSKISQQ 71

Query: 181 GTVPNLLVNGVSRGGNEEIKKLHTQG---KLLESL 212
            T+PN+ + G   GG +++K+++  G   KLL+S+
Sbjct: 72  STLPNIFIKGKHIGGYQDLKEMNESGELEKLLDSI 106

>KLTH0F01276g Chr6 complement(101034..101450) [417 bp, 138 aa] {ON}
           similar to uniprot|P25373 Saccharomyces cerevisiae
           YCL035C GRX1 and similar to uniprot|P17695 Saccharomyces
           cerevisiae YDR513w TTR1
          Length = 138

 Score = 51.6 bits (122), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 34/108 (31%), Positives = 58/108 (53%), Gaps = 2/108 (1%)

Query: 107 SRITKAFNVQKEYSLILDLSPIIIFSKSTCSYSKGMKELLENEYQFIPN-YYIIELDKHG 165
           S++     VQ   SLI D + I + +K+ C Y     +LL  + +   +   +++LD   
Sbjct: 28  SKMASPQTVQHVRSLIKD-NKIFVAAKTYCPYCNATLKLLFQDKKLRKDQVLLLQLDTMK 86

Query: 166 HGEELQEYIKLVTGRGTVPNLLVNGVSRGGNEEIKKLHTQGKLLESLQ 213
            G E+QE +  ++G+ TVPN+ + G   GGN +++ L   GKL E L+
Sbjct: 87  EGSEIQEALTEISGQRTVPNIYILGEHIGGNSDLQALEASGKLDELLE 134

>AFR710W Chr6 (1744868..1745203) [336 bp, 111 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YCL035C (GRX1) and
           YDR513W (TTR1)
          Length = 111

 Score = 49.3 bits (116), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 30/97 (30%), Positives = 53/97 (54%), Gaps = 2/97 (2%)

Query: 114 NVQKEYSLILDLSPIIIFSKSTCSYSKGMKE-LLENEYQFIPNYYIIELDKHGH-GEELQ 171
           +V K+   ++  + + I SK+ C Y +  K  LLE +        ++ELD  G  G  +Q
Sbjct: 5   SVIKQVQALIQQNRVFIASKTYCPYCQAAKRTLLEEKRVPASAVKLLELDTMGEEGAVIQ 64

Query: 172 EYIKLVTGRGTVPNLLVNGVSRGGNEEIKKLHTQGKL 208
             ++ ++G+ TVPN+ +NG   GGN +++ L   G+L
Sbjct: 65  AALQELSGQRTVPNIYINGRHVGGNSDLEALKASGEL 101

>TDEL0E05740 Chr5 complement(1072231..1072557) [327 bp, 108 aa] {ON}
           Anc_1.38 YCL035C
          Length = 108

 Score = 48.5 bits (114), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 25/81 (30%), Positives = 45/81 (55%)

Query: 128 IIIFSKSTCSYSKGMKELLENEYQFIPNYYIIELDKHGHGEELQEYIKLVTGRGTVPNLL 187
           ++IFSK+ C Y K   +  +     +    +++LDK   G E+Q+ +  + G+ TVP++ 
Sbjct: 19  VVIFSKTFCPYCKATLKTFDEARLPVGLVRVLQLDKLDDGSEIQDALYELNGQKTVPSIY 78

Query: 188 VNGVSRGGNEEIKKLHTQGKL 208
           +     GGN E++KL  +G L
Sbjct: 79  ILKRHIGGNSELQKLKHEGVL 99

>ZYRO0F17732g Chr6 (1469710..1470129) [420 bp, 139 aa] {ON} similar
           to uniprot|P17695 Saccharomyces cerevisiae YDR513W TTR1
           Glutaredoxin (thioltransferase) (glutathione
           reductase)and similar to uniprot|P25373 Saccharomyces
           cerevisiae YCL035c
          Length = 139

 Score = 48.5 bits (114), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 23/82 (28%), Positives = 48/82 (58%), Gaps = 1/82 (1%)

Query: 128 IIIFSKSTCSYSKGMKELLENEYQFI-PNYYIIELDKHGHGEELQEYIKLVTGRGTVPNL 186
           + + SK+ C Y +   + L  + QF      +++L+    G+++Q+ +  + G+ TVPN+
Sbjct: 53  LFVASKTYCPYCQATLKTLFTDLQFPEAQAIVLQLNTIDDGQDIQDALYEINGQRTVPNI 112

Query: 187 LVNGVSRGGNEEIKKLHTQGKL 208
            ++G   GGN ++++L+  GKL
Sbjct: 113 YIDGKHIGGNSDLQELNASGKL 134

>TDEL0C06640 Chr3 (1213768..1214199) [432 bp, 143 aa] {ON} Anc_1.38
           YCL035C
          Length = 143

 Score = 48.1 bits (113), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 26/87 (29%), Positives = 49/87 (56%), Gaps = 1/87 (1%)

Query: 128 IIIFSKSTCSYSKG-MKELLENEYQFIPNYYIIELDKHGHGEELQEYIKLVTGRGTVPNL 186
           I + SK+ C Y +  +K L ++         +++L+    G E+QE +  + G+ +VPN+
Sbjct: 53  IFVASKTYCPYCQATLKTLFDDLNVPKSKSLVLQLNTMDDGAEIQEALFEINGQKSVPNI 112

Query: 187 LVNGVSRGGNEEIKKLHTQGKLLESLQ 213
            ++G   GGN ++++L   GKL E L+
Sbjct: 113 YIDGKHIGGNSDLQELKNAGKLDEVLK 139

>TPHA0B04820 Chr2 (1130278..1130694) [417 bp, 138 aa] {ON} Anc_1.38
           YCL035C
          Length = 138

 Score = 47.8 bits (112), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 26/81 (32%), Positives = 45/81 (55%), Gaps = 3/81 (3%)

Query: 128 IIIFSKSTCSYSKGMKELLENEYQFIPN--YYIIELDKHGHGEELQEYIKLVTGRGTVPN 185
           + + +KS C Y K     L +E + +P     +++LD    G ELQ+ ++ + G+ TVP 
Sbjct: 48  VFVAAKSYCPYCKNTLITLFDELK-VPKEKALVLQLDGMSDGLELQDTLQQINGQRTVPQ 106

Query: 186 LLVNGVSRGGNEEIKKLHTQG 206
           + ++G   GGN E++KL   G
Sbjct: 107 IYIDGKHVGGNSELQKLKKSG 127

>KAFR0D00360 Chr4 complement(54064..54393) [330 bp, 109 aa] {ON}
           Anc_1.38 YCL035C
          Length = 109

 Score = 46.2 bits (108), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 26/83 (31%), Positives = 47/83 (56%), Gaps = 3/83 (3%)

Query: 128 IIIFSKSTCSYSKGMKELLENEYQFIPN--YYIIELDKHGHGEELQEYIKLVTGRGTVPN 185
           + + SKS C YSK     L  E   +P     ++++++   G ++Q+ +  +TG+ TVPN
Sbjct: 19  VFVASKSYCPYSKAALNTLFTELN-VPTSKALVLQVNQLPEGSDIQDALLELTGQRTVPN 77

Query: 186 LLVNGVSRGGNEEIKKLHTQGKL 208
           + + G   GGN++++ L   GKL
Sbjct: 78  IYIKGKHIGGNDDLQILKQSGKL 100

>SAKL0C01320g Chr3 complement(118401..118898) [498 bp, 165 aa] {ON}
           similar to uniprot|P25373 Saccharomyces cerevisiae
           YCL035C GRX1 Hydroperoxide and superoxide-radical
           responsive heat-stable glutathione-dependent disulfide
           oxidoreductase with active site cysteine pair protects
           cells from oxidative damage and similar to
           uniprot|P17695 Saccharomyces cerevisiae YDR513w
           cytoplasmic glutaredoxin, thioltransferase,
           glutathione-dependent disulfide oxidoreductase
          Length = 165

 Score = 47.4 bits (111), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 25/85 (29%), Positives = 51/85 (60%), Gaps = 3/85 (3%)

Query: 126 SPIIIFSKSTCSYSKGMKELLENEYQFIPN--YYIIELDKHGHGEELQEYIKLVTGRGTV 183
           S I + SK+ C Y +     L ++ + +PN    +++L++   G E+Q+ ++ ++G+ TV
Sbjct: 73  SKIFVASKTYCPYCQATLRTLFDDKK-VPNDKIKVLQLNQLDDGAEIQDALQEISGQRTV 131

Query: 184 PNLLVNGVSRGGNEEIKKLHTQGKL 208
           PN+ + G   GGN ++++L   G+L
Sbjct: 132 PNIYILGKHIGGNSDLQELAAAGEL 156

>KNAG0F00250 Chr6 complement(26606..27034) [429 bp, 142 aa] {ON}
           Anc_1.38 YCL035C
          Length = 142

 Score = 46.2 bits (108), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 25/88 (28%), Positives = 51/88 (57%), Gaps = 3/88 (3%)

Query: 123 LDLSPIIIFSKSTCSYSKGMKELLENEYQFIP--NYYIIELDKHGHGEELQEYIKLVTGR 180
           +D + + +  K+ C Y K     L ++ + +P     +++L++  HG E+QE +  + G+
Sbjct: 43  IDDNAVFVAVKTWCPYCKATIVTLLDQMK-VPASKIKVLKLNELKHGREIQEALFQMNGQ 101

Query: 181 GTVPNLLVNGVSRGGNEEIKKLHTQGKL 208
            TVP++ +N +  GGN ++++L   GKL
Sbjct: 102 KTVPHIYINQIFIGGNSDLEELRVSGKL 129

>NDAI0A00380 Chr1 complement(64438..64767) [330 bp, 109 aa] {ON}
           Anc_1.38 YCL035C
          Length = 109

 Score = 44.7 bits (104), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 27/87 (31%), Positives = 47/87 (54%), Gaps = 1/87 (1%)

Query: 128 IIIFSKSTCSYS-KGMKELLENEYQFIPNYYIIELDKHGHGEELQEYIKLVTGRGTVPNL 186
           I I SK+ C Y    +K L E          +++L++   G ++QE +  + G+ TVPN+
Sbjct: 19  IFIASKTYCPYCFSTIKTLFEELKVPKSKALVLQLNEMDDGADIQEALFEINGQKTVPNI 78

Query: 187 LVNGVSRGGNEEIKKLHTQGKLLESLQ 213
            +NG   GGN +++ L   G+L + L+
Sbjct: 79  YINGKHIGGNSQLQDLKESGELDDLLE 105

>NCAS0B08870 Chr2 (1703167..1703496) [330 bp, 109 aa] {ON} Anc_1.38
           YCL035C
          Length = 109

 Score = 44.7 bits (104), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 26/88 (29%), Positives = 49/88 (55%), Gaps = 3/88 (3%)

Query: 128 IIIFSKSTCSYSKGMKELLENEYQFIPN--YYIIELDKHGHGEELQEYIKLVTGRGTVPN 185
           I + SK+ C Y     + L  E   +P     +++L++   G E+Q+ +  + G+ TVPN
Sbjct: 19  IFVASKTYCPYCHATIKTLFKELN-VPKSKALVLQLNEMDDGAEIQQALFEINGQKTVPN 77

Query: 186 LLVNGVSRGGNEEIKKLHTQGKLLESLQ 213
           + +NG   GGN++++ L   G+L + L+
Sbjct: 78  IYINGKHVGGNDKLQDLKESGELEDLLE 105

>KLTH0A04004g Chr1 complement(335054..336622) [1569 bp, 522 aa] {ON}
           highly similar to uniprot|P10869 Saccharomyces
           cerevisiae YER052C HOM3 Aspartate kinase (L-aspartate
           4-P- transferase) cytoplasmic enzyme that catalyzes the
           first step in the common pathway for methionine and
           threonine biosynthesis expression regulated by Gcn4p and
           the general control of amino acid synthesis
          Length = 522

 Score = 42.7 bits (99), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 27/71 (38%), Positives = 37/71 (52%), Gaps = 6/71 (8%)

Query: 161 LDKHGHGEELQEYIKLVTGR-GTVPNLLVNGVSRGGNEEIKKLHTQGKLLESLQVWS--D 217
           LD H  GE +   + ++TG  G VP  L+NGV RG  +    L   G   + LQVW   D
Sbjct: 197 LDLHAKGEPV---VPVITGFFGLVPMGLLNGVGRGYTDLCAALIAVGLNADELQVWKEVD 253

Query: 218 GKFSVEQREKP 228
           G F+ + R+ P
Sbjct: 254 GIFTADPRKVP 264

>Smik_3.42 Chr3 complement(62546..62878) [333 bp, 110 aa] {ON}
           YCL035C (REAL)
          Length = 110

 Score = 39.3 bits (90), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 24/81 (29%), Positives = 43/81 (53%), Gaps = 2/81 (2%)

Query: 121 LILDLSPIIIFSKSTCSYSKG-MKELLENEYQFIPNYYIIELDKHGHGEELQEYIKLVTG 179
           LI D + I + SK+ C Y    +  L E          +++L++   G E+Q  +  + G
Sbjct: 13  LIAD-NEIFVASKTYCPYCHAALNTLFEKLKVPRSKVLVLQLNEMKDGAEIQAALCEING 71

Query: 180 RGTVPNLLVNGVSRGGNEEIK 200
           + TVPN+ +NG   GGN++++
Sbjct: 72  QRTVPNIYINGKHIGGNDDLQ 92

>Suva_3.178 Chr3 complement(270878..271828) [951 bp, 316 aa] {ON}
           YCL035C (REAL)
          Length = 316

 Score = 40.8 bits (94), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 24/88 (27%), Positives = 48/88 (54%), Gaps = 3/88 (3%)

Query: 128 IIIFSKSTCSYSKGMKELLENEYQFIPN--YYIIELDKHGHGEELQEYIKLVTGRGTVPN 185
           I + SK+ C Y       L  +   +P     +++L++   G ++Q  +  + G+ TVPN
Sbjct: 225 IFVASKTYCPYCHAALNTLFQKMN-VPKSKVLVLQLNEMKDGVDIQAALYQLNGQRTVPN 283

Query: 186 LLVNGVSRGGNEEIKKLHTQGKLLESLQ 213
           + +NG   GGN+++++L   G+L + L+
Sbjct: 284 IYINGKHIGGNDDLQELRETGELEDLLE 311

>YCL035C Chr3 complement(60841..61173) [333 bp, 110 aa] {ON}
           GRX1Hydroperoxide and superoxide-radical responsive
           heat-stable glutathione-dependent disulfide
           oxidoreductase with active site cysteine pair; protects
           cells from oxidative damage
          Length = 110

 Score = 37.7 bits (86), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 20/74 (27%), Positives = 38/74 (51%), Gaps = 1/74 (1%)

Query: 128 IIIFSKSTCSYSKG-MKELLENEYQFIPNYYIIELDKHGHGEELQEYIKLVTGRGTVPNL 186
           I + SK+ C Y    +  L E          +++L+    G ++Q  +  + G+ TVPN+
Sbjct: 19  IFVASKTYCPYCHAALNTLFEKLKVPRSKVLVLQLNDMKEGADIQAALYEINGQRTVPNI 78

Query: 187 LVNGVSRGGNEEIK 200
            +NG   GGN++++
Sbjct: 79  YINGKHIGGNDDLQ 92

>Skud_3.27 Chr3 complement(48731..49063) [333 bp, 110 aa] {ON}
           YCL035C (REAL)
          Length = 110

 Score = 37.7 bits (86), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 20/75 (26%), Positives = 41/75 (54%), Gaps = 3/75 (4%)

Query: 128 IIIFSKSTCSYSKGMKELLENEYQFIPN--YYIIELDKHGHGEELQEYIKLVTGRGTVPN 185
           I + SK+ C Y       L  + + +P     +++L++   G ++Q  +  + G+ TVPN
Sbjct: 19  IFVASKTYCPYCHAALNTLFQQLK-VPKSKVLVLQLNEMEDGADIQAALYEINGQRTVPN 77

Query: 186 LLVNGVSRGGNEEIK 200
           + +NG   GGN++++
Sbjct: 78  VYINGKHIGGNDDLQ 92

>Kwal_47.18163 s47 complement(714420..715988) [1569 bp, 522 aa] {ON}
           YER052C (HOM3) - Aspartate kinase (L-aspartate
           4-P-transferase) (EC 2.7.2.4) [contig 197] FULL
          Length = 522

 Score = 39.3 bits (90), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 25/71 (35%), Positives = 36/71 (50%), Gaps = 6/71 (8%)

Query: 161 LDKHGHGEELQEYIKLVTGR-GTVPNLLVNGVSRGGNEEIKKLHTQGKLLESLQVWS--D 217
           L+ H  G  +   + ++TG  G VP  L+NGV RG  +    L   G   + LQVW   D
Sbjct: 197 LEAHSQGTPV---VPVITGFFGLVPMGLLNGVGRGYTDLCAALIAVGLNADELQVWKEVD 253

Query: 218 GKFSVEQREKP 228
           G F+ + R+ P
Sbjct: 254 GIFTADPRKVP 264

>SAKL0F08294g Chr6 complement(633032..634603) [1572 bp, 523 aa] {ON}
           highly similar to uniprot|P10869 Saccharomyces
           cerevisiae YER052C HOM3 Aspartate kinase (L-aspartate
           4-P- transferase) cytoplasmic enzyme that catalyzes the
           first step in the common pathway for methionine and
           threonine biosynthesis expression regulated by Gcn4p and
           the general control of amino acid synthesis
          Length = 523

 Score = 38.1 bits (87), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 29/88 (32%), Positives = 42/88 (47%), Gaps = 10/88 (11%)

Query: 148 NEYQFIPNYYIIELD----KHGHGEELQEYIKLVTGR-GTVPNLLVNGVSRGGNEEIKKL 202
           N Y F+ N +   L      H  G+ +   + ++TG  G VP  L+NGV RG  +    L
Sbjct: 180 NFYTFLVNAFKEALQPVLKSHSIGKPV---VPVITGFFGLVPMGLLNGVGRGYTDLCAAL 236

Query: 203 HTQGKLLESLQVWS--DGKFSVEQREKP 228
              G   + LQVW   DG F+ + R+ P
Sbjct: 237 IAVGLNADELQVWKEVDGIFTADPRKVP 264

>KNAG0L01370 Chr12 complement(244724..246286) [1563 bp, 520 aa] {ON}
           Anc_7.226 YER052C
          Length = 520

 Score = 38.1 bits (87), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 34/117 (29%), Positives = 52/117 (44%), Gaps = 19/117 (16%)

Query: 130 IFSKSTCSYSKGMKELLENEYQFIP-NYYIIELDKHGHG-------EELQEYIK------ 175
           +F  + C+  +G+K    +    IP +Y +  LD   +        E LQ +I       
Sbjct: 147 LFMTALCN-DRGIKAKYVDLSHIIPSDYNVAVLDTSFYTFLVRALRERLQPFIDADEKIV 205

Query: 176 -LVTGR-GTVPNLLVNGVSRGGNEEIKKLHTQGKLLESLQVWS--DGKFSVEQREKP 228
            +VTG  G VP  L+NGV RG  +    L       + LQ+W   DG F+ + R+ P
Sbjct: 206 PVVTGFFGLVPMGLLNGVGRGYTDLCAALIAVALNADELQIWKEVDGIFTADPRKVP 262

>TDEL0H02190 Chr8 (370572..372128) [1557 bp, 518 aa] {ON} Anc_7.226
           YER052C
          Length = 518

 Score = 37.7 bits (86), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 22/58 (37%), Positives = 30/58 (51%), Gaps = 3/58 (5%)

Query: 174 IKLVTGR-GTVPNLLVNGVSRGGNEEIKKLHTQGKLLESLQVWS--DGKFSVEQREKP 228
           + L+TG  G VPN L+NGV RG  +    L       + L VW   DG F+ + R+ P
Sbjct: 202 VPLITGFFGLVPNGLLNGVGRGYTDLCAALIAVALNADELHVWKEVDGIFTADPRKVP 259

>NDAI0E02890 Chr5 (610133..610600) [468 bp, 155 aa] {ON} Anc_8.519
          Length = 155

 Score = 35.8 bits (81), Expect = 0.028,   Method: Compositional matrix adjust.
 Identities = 29/97 (29%), Positives = 46/97 (47%), Gaps = 16/97 (16%)

Query: 126 SPIIIFSKST-----CSYSKGMKELLENE----YQFIPNYYIIELDKHGHGEELQEYIKL 176
           +P+++F K T     C +SK   +LL  +     +F   Y ++E        EL++ IK 
Sbjct: 43  APVVLFMKGTPEFPKCGFSKATIQLLGQQGVDPAKFA-AYNVLE------DPELRDAIKE 95

Query: 177 VTGRGTVPNLLVNGVSRGGNEEIKKLHTQGKLLESLQ 213
            T   T+P L VN    GG + I  +   G+L E L+
Sbjct: 96  FTEWPTIPQLFVNKEFVGGCDVITSMSRSGELAEVLE 132

>Suva_16.255 Chr16 (447649..448098) [450 bp, 149 aa] {ON} YPL059W
           (REAL)
          Length = 149

 Score = 35.8 bits (81), Expect = 0.029,   Method: Compositional matrix adjust.
 Identities = 32/115 (27%), Positives = 54/115 (46%), Gaps = 16/115 (13%)

Query: 107 SRITKAFNVQKEYSLILDLSPIIIFSKST-----CSYSKGMKELLENE----YQFIPNYY 157
           +R+  +  ++K     +D +P+++F K T     C +S+    LL N+     +F   Y 
Sbjct: 26  TRMFLSTEIRKAIQDAIDSAPVVLFMKGTPEFPKCGFSRATIGLLGNQGVDPAKFA-AYN 84

Query: 158 IIELDKHGHGEELQEYIKLVTGRGTVPNLLVNGVSRGGNEEIKKLHTQGKLLESL 212
           ++E        EL+E IK  +   T+P L VN    GG + I  +   G+L E L
Sbjct: 85  VLE------DPELREGIKEFSEWPTIPQLYVNKEFVGGCDVITSMARSGELAELL 133

>KAFR0L00780 Chr12 complement(146584..148158) [1575 bp, 524 aa] {ON}
           Anc_7.226 YER052C
          Length = 524

 Score = 36.6 bits (83), Expect = 0.046,   Method: Compositional matrix adjust.
 Identities = 33/118 (27%), Positives = 54/118 (45%), Gaps = 19/118 (16%)

Query: 130 IFSKSTCSYSKGMKELLENEYQFIP-NYYIIELDKHGHG-------EELQEYIK------ 175
           +F  + C+  +G+K    +    IP +Y +  LD   +        E+LQ +++      
Sbjct: 143 LFMTALCN-DRGVKAKYVDLTHIIPSDYNVALLDNSFYTFLVQALKEKLQPFVESSEKIV 201

Query: 176 -LVTGR-GTVPNLLVNGVSRGGNEEIKKLHTQGKLLESLQVWS--DGKFSVEQREKPS 229
            + TG  G VP  L+NGV RG  +    L       + LQVW   DG F+ + R+ P+
Sbjct: 202 PVFTGFFGLVPMGLLNGVGRGYTDLCAALIAVALNADELQVWKEVDGIFTADPRKVPA 259

>KLLA0F27599g Chr6 (2558178..2559746) [1569 bp, 522 aa] {ON} highly
           similar to uniprot|P10869 Saccharomyces cerevisiae
           YER052C HOM3 Aspartate kinase (L-aspartate 4-P-
           transferase) cytoplasmic enzyme that catalyzes the first
           step in the common pathway for methionine and threonine
           biosynthesis expression regulated by Gcn4p and the
           general control of amino acid synthesis
          Length = 522

 Score = 36.6 bits (83), Expect = 0.047,   Method: Compositional matrix adjust.
 Identities = 22/58 (37%), Positives = 30/58 (51%), Gaps = 3/58 (5%)

Query: 174 IKLVTGR-GTVPNLLVNGVSRGGNEEIKKLHTQGKLLESLQVWS--DGKFSVEQREKP 228
           I ++TG  G VP  L+NGV RG  +    L       + LQVW   DG F+ + R+ P
Sbjct: 207 IPVITGFFGVVPMGLLNGVGRGYTDLCAALIAVALNADELQVWKEVDGIFTADPRKVP 264

>Suva_5.157 Chr5 complement(232339..233922) [1584 bp, 527 aa] {ON}
           YER052C (REAL)
          Length = 527

 Score = 36.2 bits (82), Expect = 0.055,   Method: Compositional matrix adjust.
 Identities = 20/50 (40%), Positives = 25/50 (50%), Gaps = 2/50 (4%)

Query: 181 GTVPNLLVNGVSRGGNEEIKKLHTQGKLLESLQVWS--DGKFSVEQREKP 228
           G VP  L+NGV RG  +    L       + LQVW   DG FS + R+ P
Sbjct: 218 GLVPTGLLNGVGRGYTDLCAALIAVALNADELQVWKEVDGIFSADPRKVP 267

>TBLA0D04180 Chr4 (1034864..1036432) [1569 bp, 522 aa] {ON}
           Anc_7.226 YER052C
          Length = 522

 Score = 35.8 bits (81), Expect = 0.071,   Method: Compositional matrix adjust.
 Identities = 38/133 (28%), Positives = 61/133 (45%), Gaps = 22/133 (16%)

Query: 98  LSAIKNDKGSRITKAFNVQKEYSLILDLSPIIIFSKSTCSYSKGMKELLENE-YQFIPNY 156
           ++A+ ND+G        V+ +Y   +DLS II        Y+   + +L+N  Y F+   
Sbjct: 147 MAALCNDRG--------VKAKY---VDLSHII-----PSDYTIQAENVLDNTFYSFLVTA 190

Query: 157 YIIELDKHGHGEELQEYIKLVTGR-GTVPNLLVNGVSRGGNEEIKKLHTQGKLLESLQVW 215
              EL      +E  + + + TG  G +P  L+NGV RG  +    L       + LQVW
Sbjct: 191 LKDELKPFVESKE--KIVPIFTGFFGLIPMGLLNGVGRGYTDLCAALIAVALNADELQVW 248

Query: 216 S--DGKFSVEQRE 226
              DG F+ + R+
Sbjct: 249 KEVDGIFTADPRK 261

>Kpol_1070.16 s1070 (40539..42110) [1572 bp, 523 aa] {ON}
           (40539..42110) [1572 nt, 524 aa]
          Length = 523

 Score = 35.8 bits (81), Expect = 0.071,   Method: Compositional matrix adjust.
 Identities = 22/64 (34%), Positives = 32/64 (50%), Gaps = 3/64 (4%)

Query: 168 EELQEYIKLVTGR-GTVPNLLVNGVSRGGNEEIKKLHTQGKLLESLQVWS--DGKFSVEQ 224
           E  +  + ++TG  G VP  L+NGV RG  +    L       + LQVW   DG F+ + 
Sbjct: 201 ESKERIVPVITGFFGLVPTGLLNGVGRGYTDLCAALIAVALNSDELQVWKEVDGIFTADP 260

Query: 225 REKP 228
           R+ P
Sbjct: 261 RKVP 264

>NCAS0C02240 Chr3 (417174..417659) [486 bp, 161 aa] {ON} Anc_8.519
          Length = 161

 Score = 34.7 bits (78), Expect = 0.078,   Method: Compositional matrix adjust.
 Identities = 29/96 (30%), Positives = 44/96 (45%), Gaps = 16/96 (16%)

Query: 126 SPIIIFSKST-----CSYSKGMKELLENE----YQFIPNYYIIELDKHGHGEELQEYIKL 176
           +P+++F K T     C +SK   +LL  +     +F   Y ++E        EL+E IK 
Sbjct: 46  APVVLFMKGTPEFPKCGFSKATIQLLGQQGVDPAKFA-AYNVLE------DPELREAIKE 98

Query: 177 VTGRGTVPNLLVNGVSRGGNEEIKKLHTQGKLLESL 212
            T   T+P L V     GG + I  +   G+L E L
Sbjct: 99  FTEWPTIPQLFVENEFVGGCDVITSMARSGELAELL 134

>TPHA0C01200 Chr3 (275584..277170) [1587 bp, 528 aa] {ON} Anc_7.226
           YER052C
          Length = 528

 Score = 35.4 bits (80), Expect = 0.091,   Method: Compositional matrix adjust.
 Identities = 24/71 (33%), Positives = 36/71 (50%), Gaps = 10/71 (14%)

Query: 168 EELQEYIK-------LVTGR-GTVPNLLVNGVSRGGNEEIKKLHTQGKLLESLQVWS--D 217
           E+LQ +I        ++TG  G +P  L+NGV RG  +    L +     + LQVW   D
Sbjct: 199 EKLQPFIDSKERIVPVLTGFFGLIPMGLLNGVGRGYTDLCAALVSVALNADELQVWKEVD 258

Query: 218 GKFSVEQREKP 228
           G F+ + R+ P
Sbjct: 259 GIFTADPRKVP 269

>KAFR0A01190 Chr1 complement(230841..231314) [474 bp, 157 aa] {ON}
           Anc_8.519 YPL059W
          Length = 157

 Score = 34.7 bits (78), Expect = 0.094,   Method: Compositional matrix adjust.
 Identities = 27/97 (27%), Positives = 46/97 (47%), Gaps = 16/97 (16%)

Query: 126 SPIIIFSKST-----CSYSKGMKELLE----NEYQFIPNYYIIELDKHGHGEELQEYIKL 176
           +P+++F K T     C +S+    +L     N  +F   Y ++E        EL++ IK 
Sbjct: 46  APVVLFMKGTPEFPQCGFSRATIAMLGQQGVNPAKFA-AYNVLE------DPELRDAIKE 98

Query: 177 VTGRGTVPNLLVNGVSRGGNEEIKKLHTQGKLLESLQ 213
            +   T+P L VN    GG + I  + T G+L + L+
Sbjct: 99  FSNWPTIPQLYVNKEFVGGCDVITTMATSGELADVLE 135

>YER052C Chr5 complement(256375..257958) [1584 bp, 527 aa] {ON}
           HOM3Aspartate kinase (L-aspartate 4-P-transferase);
           cytoplasmic enzyme that catalyzes the first step in the
           common pathway for methionine and threonine
           biosynthesis; expression regulated by Gcn4p and the
           general control of amino acid synthesis
          Length = 527

 Score = 35.0 bits (79), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 19/50 (38%), Positives = 25/50 (50%), Gaps = 2/50 (4%)

Query: 181 GTVPNLLVNGVSRGGNEEIKKLHTQGKLLESLQVWS--DGKFSVEQREKP 228
           G VP  L+NGV RG  +    L       + LQVW   DG F+ + R+ P
Sbjct: 218 GLVPTGLLNGVGRGYTDLCAALIAVAVNADELQVWKEVDGIFTADPRKVP 267

>Smik_5.179 Chr5 complement(260399..261982) [1584 bp, 527 aa] {ON}
           YER052C (REAL)
          Length = 527

 Score = 35.0 bits (79), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 19/50 (38%), Positives = 25/50 (50%), Gaps = 2/50 (4%)

Query: 181 GTVPNLLVNGVSRGGNEEIKKLHTQGKLLESLQVWS--DGKFSVEQREKP 228
           G VP  L+NGV RG  +    L       + LQVW   DG F+ + R+ P
Sbjct: 218 GLVPTGLLNGVGRGYTDLCAALIAVAVNADELQVWKEVDGIFTADPRKVP 267

>ZYRO0D16632g Chr4 complement(1378392..1379933) [1542 bp, 513 aa]
           {ON} highly similar to uniprot|P10869 Saccharomyces
           cerevisiae YER052C HOM3 Aspartate kinase (L-aspartate
           4-P- transferase) cytoplasmic enzyme that catalyzes the
           first step in the common pathway for methionine and
           threonine biosynthesis expression regulated by Gcn4p and
           the general control of amino acid synthesis
          Length = 513

 Score = 35.0 bits (79), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 21/61 (34%), Positives = 31/61 (50%), Gaps = 3/61 (4%)

Query: 171 QEYIKLVTGR-GTVPNLLVNGVSRGGNEEIKKLHTQGKLLESLQVWS--DGKFSVEQREK 227
           +  + ++TG  G VP  L+NGV RG  +    L       + LQVW   DG F+ + R+ 
Sbjct: 197 ERIVPIITGFFGLVPMGLLNGVGRGYTDLCAALIAVALNSDELQVWKEVDGIFTADPRKV 256

Query: 228 P 228
           P
Sbjct: 257 P 257

>NCAS0E03110 Chr5 complement(617247..618833) [1587 bp, 528 aa] {ON}
           Anc_7.226 YER052C
          Length = 528

 Score = 35.0 bits (79), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 23/64 (35%), Positives = 31/64 (48%), Gaps = 3/64 (4%)

Query: 168 EELQEYIKLVTGR-GTVPNLLVNGVSRGGNEEIKKLHTQGKLLESLQVWS--DGKFSVEQ 224
           E  +  I + TG  G VP  L+NGV RG  +    L       + LQVW   DG F+ + 
Sbjct: 200 ESKERVIPVFTGFFGLVPMGLLNGVGRGYTDLCAALIAVAVNADELQVWKEVDGIFTADP 259

Query: 225 REKP 228
           R+ P
Sbjct: 260 RKVP 263

>Skud_5.164 Chr5 complement(252810..254393) [1584 bp, 527 aa] {ON}
           YER052C (REAL)
          Length = 527

 Score = 34.7 bits (78), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 18/50 (36%), Positives = 25/50 (50%), Gaps = 2/50 (4%)

Query: 181 GTVPNLLVNGVSRGGNEEIKKLHTQGKLLESLQVWS--DGKFSVEQREKP 228
           G +P  L+NGV RG  +    L       + LQVW   DG F+ + R+ P
Sbjct: 218 GLIPTGLLNGVGRGYTDLCAALIAVALNADELQVWKEVDGIFTADPRKVP 267

>KLLA0C17842g Chr3 complement(1588951..1589745) [795 bp, 264 aa]
           {ON} similar to uniprot|Q03835 Saccharomyces cerevisiae
           YDR098C GRX3 Hydroperoxide and superoxide-radical
           responsive glutathione-dependent oxidoreductase
           monothiol glutaredoxin subfamily member along with Grx4p
           and Grx5p protects cells from oxidative damage
          Length = 264

 Score = 34.3 bits (77), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 39/160 (24%), Positives = 66/160 (41%), Gaps = 21/160 (13%)

Query: 47  NMDNMAGGSSREYAAMPTSTTNKGSSEVDEEINEIKQKVGLQQPIASVDDSLSAIKNDKG 106
           N  N +G    E  A  +S  N   S V     E    VG   P+   ++     +   G
Sbjct: 106 NQLNASGTDDNESGAANSSADNGAGSNVASSRTENVSNVGPGSPLGEDNEEQEETEEQLG 165

Query: 107 SRITKAFNVQKEYSLILDLSPIIIFSKST-----CSYSKGMKELLENEYQFIPNYYIIEL 161
            R+ K          +   +P+++F K T     C +S+ M  +L  E+Q    ++ I  
Sbjct: 166 ERLKK----------LTQAAPVMLFMKGTPSEPKCGFSRQMVGIL-REHQIRFGFFDILK 214

Query: 162 DKHGHGEELQEYIKLVTGRGTVPNLLVNGVSRGGNEEIKK 201
           D     E +++ +K  +   T P L +NG  +GG + IK+
Sbjct: 215 D-----ENVRQGLKKFSDWPTFPQLYINGEFQGGLDIIKE 249

>ADL086C Chr4 complement(533178..534836) [1659 bp, 552 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YER052C
           (HOM3)
          Length = 552

 Score = 34.3 bits (77), Expect = 0.22,   Method: Compositional matrix adjust.
 Identities = 23/74 (31%), Positives = 37/74 (50%), Gaps = 8/74 (10%)

Query: 158 IIELDKHGHGEELQEYIKLVTGR-GTVPNLLVNGVSRGGNEEIKKLHTQGKLLESLQVWS 216
           I++ +K G     +  + ++TG  G +P  L+NGV RG  +    L       + LQVW 
Sbjct: 225 IVQANKEG-----KRIVPVITGFFGLLPMGLLNGVGRGYTDLCAALVAVALNADELQVWK 279

Query: 217 --DGKFSVEQREKP 228
             DG F+ + R+ P
Sbjct: 280 EVDGIFTADPRKVP 293

>NDAI0E04700 Chr5 complement(1061383..1062975) [1593 bp, 530 aa]
           {ON} Anc_7.226 YER052C
          Length = 530

 Score = 33.9 bits (76), Expect = 0.31,   Method: Compositional matrix adjust.
 Identities = 19/50 (38%), Positives = 25/50 (50%), Gaps = 2/50 (4%)

Query: 181 GTVPNLLVNGVSRGGNEEIKKLHTQGKLLESLQVWS--DGKFSVEQREKP 228
           G VP  L+NGV RG  +    L       + LQVW   DG F+ + R+ P
Sbjct: 216 GLVPMGLLNGVGRGYTDLCAALIAVAANADELQVWKEVDGIFTADPRKVP 265

>TPHA0B00950 Chr2 complement(217773..218099) [327 bp, 108 aa] {ON}
           Anc_4.211 YLR364W
          Length = 108

 Score = 32.3 bits (72), Expect = 0.32,   Method: Compositional matrix adjust.
 Identities = 14/46 (30%), Positives = 24/46 (52%)

Query: 168 EELQEYIKLVTGRGTVPNLLVNGVSRGGNEEIKKLHTQGKLLESLQ 213
           E+ ++  + VTG   +P + VNGV  G   E+ K    G + + L+
Sbjct: 58  EQWRQAFQRVTGSRNLPTIFVNGVIWGTESELHKFENNGSIQQELE 103

>Skud_16.224 Chr16 (408961..409410) [450 bp, 149 aa] {ON} YPL059W
           (REAL)
          Length = 149

 Score = 32.7 bits (73), Expect = 0.34,   Method: Compositional matrix adjust.
 Identities = 30/116 (25%), Positives = 55/116 (47%), Gaps = 16/116 (13%)

Query: 107 SRITKAFNVQKEYSLILDLSPIIIFSKST-----CSYSKGMKELLENE----YQFIPNYY 157
           +R+  +  ++K     ++ +P+++F K T     C +S+    LL N+     +F   Y 
Sbjct: 26  TRMFLSTEIKKAIEDAIESAPVVLFMKGTPEFPKCGFSRATIGLLGNQGVDPAKFA-AYN 84

Query: 158 IIELDKHGHGEELQEYIKLVTGRGTVPNLLVNGVSRGGNEEIKKLHTQGKLLESLQ 213
           ++E        EL+E IK  +   T+P L VN    GG + I  +   G+L + L+
Sbjct: 85  VLE------DPELREGIKEFSEWPTIPQLYVNKEFIGGCDVITSMARSGELADLLE 134

>KNAG0A02090 Chr1 (175247..175696) [450 bp, 149 aa] {ON} Anc_8.519
           YPL059W
          Length = 149

 Score = 32.7 bits (73), Expect = 0.38,   Method: Compositional matrix adjust.
 Identities = 31/115 (26%), Positives = 52/115 (45%), Gaps = 19/115 (16%)

Query: 111 KAF---NVQKEYSLILDLSPIIIFSKST-----CSYSKGMKELL----ENEYQFIPNYYI 158
           KAF    ++K  +  +  +P+++F K T     C +SK    LL     +  +F   Y +
Sbjct: 24  KAFMSTEIRKAITEAVASAPVVLFMKGTPEFPQCGFSKATINLLGKQGVDPAKFA-AYNV 82

Query: 159 IELDKHGHGEELQEYIKLVTGRGTVPNLLVNGVSRGGNEEIKKLHTQGKLLESLQ 213
           +E        EL+  IK  +   T+P L VN    GG + I  +   G+L + L+
Sbjct: 83  LE------DPELRTAIKEFSDWPTIPQLYVNNEFVGGCDVITSMAKSGELADVLE 131

>Smik_16.178 Chr16 (319960..320409) [450 bp, 149 aa] {ON} YPL059W
           (REAL)
          Length = 149

 Score = 32.3 bits (72), Expect = 0.43,   Method: Compositional matrix adjust.
 Identities = 30/116 (25%), Positives = 55/116 (47%), Gaps = 16/116 (13%)

Query: 107 SRITKAFNVQKEYSLILDLSPIIIFSKST-----CSYSKGMKELLENE----YQFIPNYY 157
           +R+  +  ++K     ++ +P+++F K T     C +S+    LL N+     +F   Y 
Sbjct: 26  TRMFLSTEIRKAIEDAIESAPVVLFMKGTPEFPKCGFSRATIGLLGNQGVDPAKFA-AYN 84

Query: 158 IIELDKHGHGEELQEYIKLVTGRGTVPNLLVNGVSRGGNEEIKKLHTQGKLLESLQ 213
           ++E        EL+E IK  +   T+P L VN    GG + I  +   G+L + L+
Sbjct: 85  VLE------DPELREGIKEFSEWPTIPQLYVNKEFIGGCDVITSMARSGELADLLE 134

>CAGL0J02882g Chr10 complement(279998..281590) [1593 bp, 530 aa]
           {ON} highly similar to uniprot|P10869 Saccharomyces
           cerevisiae YER052c HOM3
          Length = 530

 Score = 33.5 bits (75), Expect = 0.44,   Method: Compositional matrix adjust.
 Identities = 18/50 (36%), Positives = 25/50 (50%), Gaps = 2/50 (4%)

Query: 181 GTVPNLLVNGVSRGGNEEIKKLHTQGKLLESLQVWS--DGKFSVEQREKP 228
           G +P  L+NGV RG  +    L       + LQVW   DG F+ + R+ P
Sbjct: 218 GFIPMGLLNGVGRGYTDLCAALIAVALNADELQVWKEVDGIFTADPRKVP 267

>TBLA0A08230 Chr1 complement(2028254..2028580) [327 bp, 108 aa] {ON}
           Anc_4.211 YLR364W
          Length = 108

 Score = 31.6 bits (70), Expect = 0.54,   Method: Compositional matrix adjust.
 Identities = 22/81 (27%), Positives = 40/81 (49%), Gaps = 9/81 (11%)

Query: 136 CSYSKGMKELLENEYQFIPN--YYIIELDKHGHGE--ELQEYIKLVTGRGTVPNLLVNGV 191
           C YSK + E +      IP    Y  E+  +   E  E +  +K + G G +P+++++G 
Sbjct: 27  CKYSKRVYEKMN-----IPQDKIYFFEISGYSKKEQSECRAALKKIIGTGNLPSIMIDGK 81

Query: 192 SRGGNEEIKKLHTQGKLLESL 212
             G  +E+ +L  +G+L E  
Sbjct: 82  LWGTEKELHELEDKGELQEEF 102

>SAKL0H04136g Chr8 complement(386608..386940) [333 bp, 110 aa] {ON}
           similar to uniprot|Q05926 Saccharomyces cerevisiae
           YLR364W Hypothetical ORF
          Length = 110

 Score = 31.6 bits (70), Expect = 0.61,   Method: Compositional matrix adjust.
 Identities = 19/81 (23%), Positives = 38/81 (46%), Gaps = 7/81 (8%)

Query: 136 CSYSKGMKELLENEYQFIPNYYIIELDKHGHGEELQEY---IKLVTGRGTVPNLLVNGVS 192
           C Y+      +  +Y  +   Y+ ++ K    EE   Y      ++G   +P + VNG  
Sbjct: 28  CVYANS----IWKKYGVLDKVYLFDIAKLPTREEGNAYRDAFHKISGIRWLPTIFVNGTK 83

Query: 193 RGGNEEIKKLHTQGKLLESLQ 213
            G   ++++L  +GKL++ L+
Sbjct: 84  WGTEADLRRLDKEGKLVDELK 104

>AGR111W Chr7 (947498..948211) [714 bp, 237 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YER174C (GRX4) and
           YDR098C (GRX3)
          Length = 237

 Score = 32.7 bits (73), Expect = 0.62,   Method: Compositional matrix adjust.
 Identities = 23/81 (28%), Positives = 42/81 (51%), Gaps = 11/81 (13%)

Query: 126 SPIIIFSKST-----CSYSKGMKELLENEYQFIPNYYIIELDKHGHGEELQEYIKLVTGR 180
           +P+++F K T     C +S+ M  +L  E+Q    ++ I  D     E +++ +K  +  
Sbjct: 148 APVMLFMKGTPSEPKCGFSRQMVGIL-REHQVRFGFFDILKD-----ESVRQGLKTFSDW 201

Query: 181 GTVPNLLVNGVSRGGNEEIKK 201
            T P L +NG  +GG + IK+
Sbjct: 202 PTFPQLYINGEFQGGLDIIKE 222

>YPL059W Chr16 (444579..445031) [453 bp, 150 aa] {ON}
           GRX5Hydroperoxide and superoxide-radical responsive
           glutathione-dependent oxidoreductase; mitochondrial
           matrix protein involved in the synthesis/assembly of
           iron-sulfur centers; monothiol glutaredoxin subfamily
           member along with Grx3p and Grx4p
          Length = 150

 Score = 32.0 bits (71), Expect = 0.69,   Method: Compositional matrix adjust.
 Identities = 30/115 (26%), Positives = 54/115 (46%), Gaps = 16/115 (13%)

Query: 108 RITKAFNVQKEYSLILDLSPIIIFSKST-----CSYSKGMKELLENE----YQFIPNYYI 158
           R+  +  ++K     ++ +P+++F K T     C +S+    LL N+     +F   Y +
Sbjct: 27  RMYLSTEIRKAIEDAIESAPVVLFMKGTPEFPKCGFSRATIGLLGNQGVDPAKFA-AYNV 85

Query: 159 IELDKHGHGEELQEYIKLVTGRGTVPNLLVNGVSRGGNEEIKKLHTQGKLLESLQ 213
           +E        EL+E IK  +   T+P L VN    GG + I  +   G+L + L+
Sbjct: 86  LE------DPELREGIKEFSEWPTIPQLYVNKEFIGGCDVITSMARSGELADLLE 134

>NCAS0B02290 Chr2 (383984..384403) [420 bp, 139 aa] {ON} Anc_8.519
          Length = 139

 Score = 31.6 bits (70), Expect = 0.80,   Method: Compositional matrix adjust.
 Identities = 27/92 (29%), Positives = 42/92 (45%), Gaps = 16/92 (17%)

Query: 126 SPIIIFSKST-----CSYSKGMKELLE----NEYQFIPNYYIIELDKHGHGEELQEYIKL 176
           +P+++F K T     C +S+    LL     N  +F   + I++        EL++ IK 
Sbjct: 38  APVVLFMKGTPDAPKCGFSRATVALLGYEGLNPSKF-KAFNILD------DVELRDGIKE 90

Query: 177 VTGRGTVPNLLVNGVSRGGNEEIKKLHTQGKL 208
            T   T+P L VNG   GG + I  +   G L
Sbjct: 91  YTDWPTIPQLFVNGEFIGGCDVIVSMSKNGDL 122

>KLLA0B07975g Chr2 complement(705661..705996) [336 bp, 111 aa] {ON}
           similar to uniprot|Q05926 Saccharomyces cerevisiae
           YLR364W
          Length = 111

 Score = 31.2 bits (69), Expect = 0.87,   Method: Compositional matrix adjust.
 Identities = 19/62 (30%), Positives = 29/62 (46%), Gaps = 1/62 (1%)

Query: 153 IPNYYIIEL-DKHGHGEELQEYIKLVTGRGTVPNLLVNGVSRGGNEEIKKLHTQGKLLES 211
           I NY I E+ +      E+++  +  TG   +P L V+G   G   E+ +    G L E 
Sbjct: 44  IFNYDIAEVTNSRSEWNEIRDAFQKATGSRNLPTLYVDGKVWGTESELARFERNGTLKEE 103

Query: 212 LQ 213
           LQ
Sbjct: 104 LQ 105

>NCAS0B04890 Chr2 complement(897400..898224) [825 bp, 274 aa] {ON} 
          Length = 274

 Score = 32.3 bits (72), Expect = 0.91,   Method: Compositional matrix adjust.
 Identities = 24/91 (26%), Positives = 50/91 (54%), Gaps = 13/91 (14%)

Query: 117 KEYSLILDLSPIIIFSKST-----CSYSKGMKELL-ENEYQFIPNYYIIELDKHGHGEEL 170
           K+ S ++  +P+++F K +     C YS+ M ++L EN+ +F   ++ I  D     + +
Sbjct: 167 KKLSKLVQAAPVMVFLKGSPSEPKCGYSRQMVKILRENKIRF--GFFDILRD-----DNV 219

Query: 171 QEYIKLVTGRGTVPNLLVNGVSRGGNEEIKK 201
           ++ +K  +   T P L +NG  +GG + +K+
Sbjct: 220 RKNMKRFSDWPTFPQLYINGEFQGGLDIVKE 250

>CAGL0M07271g Chr13 (731627..732076) [450 bp, 149 aa] {ON} similar
           to uniprot|Q02784 Saccharomyces cerevisiae YPL059w GRX5
          Length = 149

 Score = 31.2 bits (69), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 25/96 (26%), Positives = 44/96 (45%), Gaps = 14/96 (14%)

Query: 126 SPIIIFSKST-----CSYSKGMKELLENE---YQFIPNYYIIELDKHGHGEELQEYIKLV 177
           +P+++F K T     C +S+    +L  +    +    Y ++E        EL+E IK  
Sbjct: 45  APVVLFMKGTPEFPQCGFSRATISMLGQQGVDPEKFAAYNVLE------DPELREGIKEF 98

Query: 178 TGRGTVPNLLVNGVSRGGNEEIKKLHTQGKLLESLQ 213
           +   T+P L VN    GG + I  +   G+L + L+
Sbjct: 99  SNWPTIPQLYVNKEFIGGCDVITSMARSGELADVLE 134

>Ecym_1187 Chr1 (384530..384949) [420 bp, 139 aa] {ON} similar to
           Ashbya gossypii ADR053W
          Length = 139

 Score = 30.8 bits (68), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 30/124 (24%), Positives = 57/124 (45%), Gaps = 12/124 (9%)

Query: 99  SAIKNDKGSRITKAFNVQKEYSLILD----LSPIIIFSKST-----CSYSKGMKELLENE 149
           S ++   GSR+T    + KE    ++     +P+++F K T     C +S+   ++L  +
Sbjct: 9   SVLRPTLGSRLTVIRLLSKETKSAIEGAIGSAPVVLFMKGTPEFPQCGFSRASIQILGQQ 68

Query: 150 YQFIPNYYIIELDKHGHGEELQEYIKLVTGRGTVPNLLVNGVSRGGNEEIKKLHTQGKLL 209
                 +    + +H    EL+E IK  +   T+P L +N    GG + +  +   G+L 
Sbjct: 69  GVDPSKFAAYNVLEH---PELREGIKEYSEWPTIPQLYINKEFIGGCDILTNMAQSGELA 125

Query: 210 ESLQ 213
           E L+
Sbjct: 126 ELLE 129

>SAKL0H17710g Chr8 (1565867..1566592) [726 bp, 241 aa] {ON} similar
           to uniprot|Q03835 Saccharomyces cerevisiae YDR098C GRX3
           Hydroperoxide and superoxide-radical responsive
           glutathione-dependent oxidoreductase monothiol
           glutaredoxin subfamily member along with Grx4p and Grx5p
           protects cells from oxidative damage
          Length = 241

 Score = 31.2 bits (69), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 23/81 (28%), Positives = 42/81 (51%), Gaps = 11/81 (13%)

Query: 126 SPIIIFSKST-----CSYSKGMKELLENEYQFIPNYYIIELDKHGHGEELQEYIKLVTGR 180
           +P+++F K T     C +S+ M  +L  E+Q    ++ I  D     + +++ +K  +  
Sbjct: 151 APVMLFMKGTPSEPKCGFSRQMVGIL-REHQVRFGFFDILKD-----DAVRQGLKSFSDW 204

Query: 181 GTVPNLLVNGVSRGGNEEIKK 201
            T P L VNG  +GG + IK+
Sbjct: 205 PTFPQLYVNGEFQGGLDIIKE 225

>Kwal_27.11948 s27 complement(1014824..1015234) [411 bp, 136 aa]
           {ON} YPL059W (GRX5) - Protein with glutaredoxin activity
           [contig 26] FULL
          Length = 136

 Score = 30.4 bits (67), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 26/97 (26%), Positives = 46/97 (47%), Gaps = 16/97 (16%)

Query: 126 SPIIIFSKST-----CSYSKGMKELLENE----YQFIPNYYIIELDKHGHGEELQEYIKL 176
           +P+++F K T     C +S+    +L  +     +F   Y ++E        EL+E IK 
Sbjct: 36  APVVLFMKGTPEFPQCGFSRATVGMLGQQGVDPLKFA-AYNVLE------DPELREGIKE 88

Query: 177 VTGRGTVPNLLVNGVSRGGNEEIKKLHTQGKLLESLQ 213
           ++   T+P L VN    GG + I  +   G+L + L+
Sbjct: 89  LSDWPTIPQLYVNEEFVGGCDIITSMAQTGELTKLLE 125

>NDAI0C05390 Chr3 complement(1246280..1246714) [435 bp, 144 aa] {ON}
           Anc_8.519
          Length = 144

 Score = 30.0 bits (66), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 28/90 (31%), Positives = 41/90 (45%), Gaps = 12/90 (13%)

Query: 126 SPIIIFSKST-----CSYSKGMKELLENEYQFIPNYY--IIELDKHGHGEELQEYIKLVT 178
           +P+++F K T     C +S+    +L  E    PN +     LD      EL+E IK  T
Sbjct: 43  APVVLFMKGTPEFPKCGFSRATIGILGYE-GIDPNKFKAFNVLDDA----ELREGIKEFT 97

Query: 179 GRGTVPNLLVNGVSRGGNEEIKKLHTQGKL 208
              T+P L VN    GG + I  +   G+L
Sbjct: 98  QWPTIPQLFVNKEFIGGCDVIVSMSKSGEL 127

>Kpol_513.11 s513 complement(30908..31351) [444 bp, 147 aa] {ON}
           complement(30908..31351) [444 nt, 148 aa]
          Length = 147

 Score = 30.0 bits (66), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 25/96 (26%), Positives = 44/96 (45%), Gaps = 14/96 (14%)

Query: 126 SPIIIFSKST-----CSYSKGMKELLENE---YQFIPNYYIIELDKHGHGEELQEYIKLV 177
           +P+++F K T     C +S+    +L  +    Q    Y ++E        EL++ IK  
Sbjct: 47  APVVLFMKGTPEFPQCGFSRATINILGQQGVDPQKFAAYNVLE------DPELRQGIKEY 100

Query: 178 TGRGTVPNLLVNGVSRGGNEEIKKLHTQGKLLESLQ 213
           +   T+P L VN    GG + I  +   G+L + L+
Sbjct: 101 SEWPTIPQLYVNKEFVGGCDIITTMAQDGQLADLLE 136

>Kwal_56.23506 s56 complement(577407..578129) [723 bp, 240 aa] {ON}
           YER174C (GRX4) - Protein with glutaredoxin activity
           [contig 176] FULL
          Length = 240

 Score = 30.8 bits (68), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 22/81 (27%), Positives = 42/81 (51%), Gaps = 11/81 (13%)

Query: 126 SPIIIFSKST-----CSYSKGMKELLENEYQFIPNYYIIELDKHGHGEELQEYIKLVTGR 180
           +P+++F K T     C +S+ M  +L  EYQ    ++ I  D     + +++ +K  +  
Sbjct: 151 APVMLFMKGTPSEPKCGFSRQMVGIL-REYQVRFGFFDILKD-----DSIRQGLKKFSDW 204

Query: 181 GTVPNLLVNGVSRGGNEEIKK 201
            T P L ++G  +GG + IK+
Sbjct: 205 PTFPQLYISGEFQGGLDIIKE 225

>KLTH0E12034g Chr5 complement(1069449..1069859) [411 bp, 136 aa]
           {ON} similar to uniprot|Q02784 Saccharomyces cerevisiae
           YPL059W GRX5 Hydroperoxide and superoxide- radical
           responsive glutathione-dependent oxidoreductase
           mitochondrial matrix protein involved in the
           synthesis/assembly of iron-sulfur centers monothiol
           glutaredoxin subfamily member along with Grx3p and Grx4p
          Length = 136

 Score = 30.0 bits (66), Expect = 2.8,   Method: Compositional matrix adjust.
 Identities = 26/97 (26%), Positives = 46/97 (47%), Gaps = 16/97 (16%)

Query: 126 SPIIIFSKST-----CSYSKGMKELLENE----YQFIPNYYIIELDKHGHGEELQEYIKL 176
           +P+++F K T     C +S+    LL  +     +F   Y ++E        EL+E IK 
Sbjct: 36  APVVLFMKGTPEFPQCGFSRATVSLLGQQGVDPLKFA-AYNVLE------DPELREGIKE 88

Query: 177 VTGRGTVPNLLVNGVSRGGNEEIKKLHTQGKLLESLQ 213
           ++   T+P L VN    GG + +  +   G+L + L+
Sbjct: 89  LSEWPTIPQLYVNEEFIGGCDILVSMAQSGELTKLLE 125

>TDEL0A01240 Chr1 (208313..209041) [729 bp, 242 aa] {ON} Anc_8.240
           YDR098C
          Length = 242

 Score = 30.4 bits (67), Expect = 3.0,   Method: Compositional matrix adjust.
 Identities = 35/161 (21%), Positives = 73/161 (45%), Gaps = 27/161 (16%)

Query: 46  TNMDNMAGGSSREYAAMPTSTTNKGSSEVDEEINEIKQKVGLQQPIASVDDSLSAIKNDK 105
           T +  ++G   +E+      + +KGS +V+++ +  ++ V         ++      ND+
Sbjct: 88  TILKELSGADPKEFVK--ALSEHKGSKKVEQQPS-AQENVAEDDEEREEEEETEEELNDR 144

Query: 106 GSRITKAFNVQKEYSLILDLSPIIIFSKST-----CSYSKGMKELLENEYQFIPNYYIIE 160
            +++T+A             +PI++F K +     C +S+ M  +L  E+Q    ++ I 
Sbjct: 145 LTKLTQA-------------APIMLFMKGSPSEPKCGFSRQMVGIL-REHQVRFGFFDIL 190

Query: 161 LDKHGHGEELQEYIKLVTGRGTVPNLLVNGVSRGGNEEIKK 201
            D       ++E +K  +   T P L V G  +GG + IK+
Sbjct: 191 KDSC-----VREGLKKFSDWPTFPQLYVQGEFQGGLDIIKE 226

>KLTH0G14234g Chr7 (1233911..1234633) [723 bp, 240 aa] {ON} similar
           to uniprot|Q03835 Saccharomyces cerevisiae YDR098C GRX3
           Hydroperoxide and superoxide- radical responsive
           glutathione-dependent oxidoreductase monothiol
           glutaredoxin subfamily member along with Grx4p and Grx5p
           protects cells from oxidative damage
          Length = 240

 Score = 30.4 bits (67), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 22/81 (27%), Positives = 42/81 (51%), Gaps = 11/81 (13%)

Query: 126 SPIIIFSKST-----CSYSKGMKELLENEYQFIPNYYIIELDKHGHGEELQEYIKLVTGR 180
           +P+++F K T     C +S+ M  +L  EYQ    ++ I  D     + +++ +K  +  
Sbjct: 151 APVMLFMKGTPSEPKCGFSRQMVGIL-REYQVRFGFFDILKD-----DSIRQGLKKFSDW 204

Query: 181 GTVPNLLVNGVSRGGNEEIKK 201
            T P L ++G  +GG + IK+
Sbjct: 205 PTFPQLYISGEFQGGLDIIKE 225

>KLTH0A05104g Chr1 (426808..428127) [1320 bp, 439 aa] {ON} weakly
           similar to uniprot|P28272 Saccharomyces cerevisiae
           YKL216W URA1 The enzyme catalyzes the conversion of
           dihydroorotic acid to orotic acid
          Length = 439

 Score = 30.4 bits (67), Expect = 3.4,   Method: Compositional matrix adjust.
 Identities = 20/64 (31%), Positives = 36/64 (56%)

Query: 159 IELDKHGHGEELQEYIKLVTGRGTVPNLLVNGVSRGGNEEIKKLHTQGKLLESLQVWSDG 218
           I L K+ +G+E+Q+Y+K V    ++ ++LV  VS      ++ L  + KL + LQ   D 
Sbjct: 214 INLGKNKNGDEVQDYLKGVETFQSLADVLVINVSSPNTPGLRDLQNESKLADLLQKVVDK 273

Query: 219 KFSV 222
           + S+
Sbjct: 274 RNSL 277

>TPHA0A01910 Chr1 (386720..387445) [726 bp, 241 aa] {ON} Anc_8.240
           YDR098C
          Length = 241

 Score = 30.4 bits (67), Expect = 3.6,   Method: Compositional matrix adjust.
 Identities = 24/87 (27%), Positives = 46/87 (52%), Gaps = 13/87 (14%)

Query: 121 LILDLSPIIIFSKST-----CSYSKGMKELL-ENEYQFIPNYYIIELDKHGHGEELQEYI 174
           ++ + +P+++F K T     C +S+ +  +L EN  +F   Y+ I  DK      +++ +
Sbjct: 148 MLTNAAPVMVFLKGTPSDPKCGFSRQIIGILRENNLRF--GYFDILKDKS-----VRDGL 200

Query: 175 KLVTGRGTVPNLLVNGVSRGGNEEIKK 201
           K  +   T P L +NG  +GG + IK+
Sbjct: 201 KAFSDWPTFPQLYINGEFQGGLDIIKE 227

>KLLA0B09636g Chr2 (836265..836693) [429 bp, 142 aa] {ON} similar to
           uniprot|Q02784 Saccharomyces cerevisiae YPL059W GRX5
           Hydroperoxide and superoxide-radical responsive
           glutathione-dependent oxidoreductase mitochondrial
           matrix protein involved in the synthesis/assembly of
           iron-sulfur centers monothiol glutaredoxin subfamily
           member along with Grx3p and Grx4p
          Length = 142

 Score = 29.6 bits (65), Expect = 3.7,   Method: Compositional matrix adjust.
 Identities = 25/97 (25%), Positives = 46/97 (47%), Gaps = 16/97 (16%)

Query: 126 SPIIIFSKST-----CSYSKGMKELLENE----YQFIPNYYIIELDKHGHGEELQEYIKL 176
           +P+++F K T     C +S+    +L  +     +F   Y ++E        EL+E IK 
Sbjct: 42  APVVLFMKGTPEFPQCGFSRATINMLGQQGVDPVKFA-AYNVLE------DPELREGIKE 94

Query: 177 VTGRGTVPNLLVNGVSRGGNEEIKKLHTQGKLLESLQ 213
           ++   T+P L VN    GG + +  +   G+L + L+
Sbjct: 95  ISEWPTIPQLYVNKEFVGGCDIVMNMAQTGELAKLLE 131

>YOR132W Chr15 (573175..574830) [1656 bp, 551 aa] {ON}  VPS17Subunit
           of the membrane-associated retromer complex essential
           for endosome-to-Golgi retrograde protein transport;
           peripheral membrane protein that assembles onto the
           membrane with Vps5p to promote vesicle formation
          Length = 551

 Score = 30.4 bits (67), Expect = 3.7,   Method: Compositional matrix adjust.
 Identities = 19/54 (35%), Positives = 29/54 (53%), Gaps = 6/54 (11%)

Query: 47  NMDNMAGGSSREYAAMPTSTTNKGSSEVDEEINEIKQKVGLQQPIASVDDSLSA 100
           ++DN      +E  + P +TT  GSS + EE      +VG +Q  ASV D+ +A
Sbjct: 12  DLDNNPFAEPQEEDSEPAATTTDGSSSMSEE------RVGTEQTAASVQDNGTA 59

>TPHA0B03340 Chr2 (770614..771363) [750 bp, 249 aa] {ON} Anc_8.240
           YDR098C
          Length = 249

 Score = 30.0 bits (66), Expect = 4.3,   Method: Compositional matrix adjust.
 Identities = 21/81 (25%), Positives = 41/81 (50%), Gaps = 11/81 (13%)

Query: 126 SPIIIFSKST-----CSYSKGMKELLENEYQFIPNYYIIELDKHGHGEELQEYIKLVTGR 180
           +P+++F K       C +S+ +  +L  EYQ    ++ I  D     + +++ +K  +  
Sbjct: 160 APVMLFMKGNPTEPKCGFSRQLVGILR-EYQLRFGFFDILKD-----DSVRQGLKKFSDW 213

Query: 181 GTVPNLLVNGVSRGGNEEIKK 201
            T P L +NG  +GG + IK+
Sbjct: 214 PTFPQLYINGEFQGGLDIIKR 234

>Skud_4.356 Chr4 complement(621126..621881,621915..621947) [789 bp,
           262 aa] {ON} YDR098C (REAL)
          Length = 262

 Score = 30.0 bits (66), Expect = 4.6,   Method: Compositional matrix adjust.
 Identities = 20/85 (23%), Positives = 46/85 (54%), Gaps = 11/85 (12%)

Query: 122 ILDLSPIIIFSKST-----CSYSKGMKELLENEYQFIPNYYIIELDKHGHGEELQEYIKL 176
           +++ +P+++F K +     C +S+ +  +L  E+Q    ++ I  D     + +++++K 
Sbjct: 169 LVNAAPVMLFMKGSPSEPKCGFSRQLVGIL-REHQVRFGFFDILRD-----DSVRQHLKK 222

Query: 177 VTGRGTVPNLLVNGVSRGGNEEIKK 201
            +   T P L +NG  +GG + IK+
Sbjct: 223 FSEWPTFPQLYINGEFQGGLDIIKE 247

>TBLA0H03500 Chr8 complement(857008..857457) [450 bp, 149 aa] {ON}
           Anc_8.519 YPL059W
          Length = 149

 Score = 29.3 bits (64), Expect = 4.8,   Method: Compositional matrix adjust.
 Identities = 29/116 (25%), Positives = 52/116 (44%), Gaps = 16/116 (13%)

Query: 107 SRITKAFNVQKEYSLILDLSPIIIFSKST-----CSYSKGMKELLENE----YQFIPNYY 157
           +R+  +  V+K     +  +P+++F K T     C +S+    LL  +     +F   + 
Sbjct: 27  TRLFLSTEVKKAIEEAIGTAPVVLFMKGTPEFPQCGFSRATISLLGQQGVDPAKFA-AFN 85

Query: 158 IIELDKHGHGEELQEYIKLVTGRGTVPNLLVNGVSRGGNEEIKKLHTQGKLLESLQ 213
           ++E        EL+  IK  T   T+P L VN    GG + I  +   G+L + L+
Sbjct: 86  VLE------DPELRNGIKEYTEWPTIPQLFVNKEFVGGCDIITNMSQSGELAKLLE 135

>YER174C Chr5 complement(538434..539168) [735 bp, 244 aa] {ON}
           GRX4Hydroperoxide and superoxide-radical responsive
           glutathione-dependent oxidoreductase; monothiol
           glutaredoxin subfamily member along with Grx3p and
           Grx5p; protects cells from oxidative damage; mutant has
           increased aneuploidy tolerance; transcription is
           regulated by Yap5
          Length = 244

 Score = 29.6 bits (65), Expect = 5.5,   Method: Compositional matrix adjust.
 Identities = 21/85 (24%), Positives = 44/85 (51%), Gaps = 11/85 (12%)

Query: 122 ILDLSPIIIFSKST-----CSYSKGMKELLENEYQFIPNYYIIELDKHGHGEELQEYIKL 176
           ++  +P+++F K +     C +S+ +  +L  E+Q    ++ I  D     E +++ +K 
Sbjct: 152 LVQAAPVMLFMKGSPSEPKCGFSRQLVGIL-REHQIRFGFFDILRD-----ENVRQSLKK 205

Query: 177 VTGRGTVPNLLVNGVSRGGNEEIKK 201
            +   T P L +NG  +GG + IK+
Sbjct: 206 FSDWPTFPQLYINGEFQGGLDIIKE 230

>Ecym_3514 Chr3 (962769..963506) [738 bp, 245 aa] {ON} similar to
           Ashbya gossypii AGR111W
          Length = 245

 Score = 29.6 bits (65), Expect = 6.4,   Method: Compositional matrix adjust.
 Identities = 22/81 (27%), Positives = 41/81 (50%), Gaps = 11/81 (13%)

Query: 126 SPIIIFSKST-----CSYSKGMKELLENEYQFIPNYYIIELDKHGHGEELQEYIKLVTGR 180
           +P+++F K T     C +S+ M  +L  E+Q    ++ I  D     + +++ +K  +  
Sbjct: 156 APVMLFMKGTPSEPKCGFSRQMVGIL-REHQVRFGFFDILKD-----DSVRQGLKTFSDW 209

Query: 181 GTVPNLLVNGVSRGGNEEIKK 201
            T P L  NG  +GG + IK+
Sbjct: 210 PTFPQLYANGDFQGGLDIIKE 230

>KNAG0A02540 Chr1 (260985..262190) [1206 bp, 401 aa] {ON} Anc_8.429
           YLR226W
          Length = 401

 Score = 29.6 bits (65), Expect = 6.5,   Method: Compositional matrix adjust.
 Identities = 16/68 (23%), Positives = 34/68 (50%), Gaps = 5/68 (7%)

Query: 110 TKAFNVQ---KEYSLILDLSPIIIFSKSTCSYSKGMKELLENEYQFIPNYYIIELDKHGH 166
           +++F VQ   +  SL+ D    +I S   C      K++++ ++++  N+++   D H  
Sbjct: 224 SRSFIVQAITQPVSLLFDGPTFVILSLIYCGLQ--YKQMVDKDFRYPKNFFLDRFDVHVK 281

Query: 167 GEELQEYI 174
            E+ Q Y 
Sbjct: 282 AEDFQNYF 289

>Smik_4.339 Chr4 complement(610713..611480,611484..611513) [798 bp,
           265 aa] {ON} YDR098C (REAL)
          Length = 265

 Score = 29.3 bits (64), Expect = 7.6,   Method: Compositional matrix adjust.
 Identities = 21/85 (24%), Positives = 45/85 (52%), Gaps = 11/85 (12%)

Query: 122 ILDLSPIIIFSKST-----CSYSKGMKELLENEYQFIPNYYIIELDKHGHGEELQEYIKL 176
           +++ +P+++F K +     C +S+ +  +L  E+Q    ++ I  D     E +++ +K 
Sbjct: 172 LVNAAPVMLFMKGSPSEPKCGFSRQLVGILR-EHQVRFGFFDILRD-----ESVRQNLKK 225

Query: 177 VTGRGTVPNLLVNGVSRGGNEEIKK 201
            +   T P L +NG  +GG + IK+
Sbjct: 226 FSEWPTFPQLYINGEFQGGLDIIKE 250

>Ecym_8019 Chr8 complement(50209..51543) [1335 bp, 444 aa] {ON}
           similar to Ashbya gossypii ACL035C
          Length = 444

 Score = 29.3 bits (64), Expect = 8.4,   Method: Compositional matrix adjust.
 Identities = 17/54 (31%), Positives = 31/54 (57%)

Query: 159 IELDKHGHGEELQEYIKLVTGRGTVPNLLVNGVSRGGNEEIKKLHTQGKLLESL 212
           I L K+  G+E+++++K V     + ++LV  VS      ++ L  +GKL+E L
Sbjct: 219 INLGKNKDGDEVKDFVKGVEKFQALADVLVINVSSPNTPGLRDLQHEGKLVELL 272

>SAKL0H10626g Chr8 (914158..914589) [432 bp, 143 aa] {ON}
           uniprot|Q6YFE4 Saccharomyces kluyveri Glutaredoxin
          Length = 143

 Score = 28.5 bits (62), Expect = 8.6,   Method: Compositional matrix adjust.
 Identities = 25/97 (25%), Positives = 45/97 (46%), Gaps = 16/97 (16%)

Query: 126 SPIIIFSKST-----CSYSKGMKELLENE----YQFIPNYYIIELDKHGHGEELQEYIKL 176
           +P+++F K T     C +SK    +L  +     +F   Y ++E        EL+E +K 
Sbjct: 43  APVVLFMKGTPEFPQCGFSKATINMLGQQGVDPMKFA-AYNVLE------DAELREGVKE 95

Query: 177 VTGRGTVPNLLVNGVSRGGNEEIKKLHTQGKLLESLQ 213
            +   T+P L VN    GG + +  +   G+L + L+
Sbjct: 96  FSEWPTIPQLYVNKEFVGGCDIVMNMAQTGELAKLLE 132

>Suva_5.308 Chr5 complement(506262..506996) [735 bp, 244 aa] {ON}
           YER174C (REAL)
          Length = 244

 Score = 28.9 bits (63), Expect = 9.1,   Method: Compositional matrix adjust.
 Identities = 20/85 (23%), Positives = 44/85 (51%), Gaps = 11/85 (12%)

Query: 122 ILDLSPIIIFSKST-----CSYSKGMKELLENEYQFIPNYYIIELDKHGHGEELQEYIKL 176
           ++  +P+++F K +     C +S+ +  +L  E+Q    ++ I  D     + +++ +K 
Sbjct: 152 LVQAAPVMLFMKGSPSEPKCGFSRQLVGILR-EHQIRFGFFDILRD-----DNVRQSLKK 205

Query: 177 VTGRGTVPNLLVNGVSRGGNEEIKK 201
            +   T P L +NG  +GG + IK+
Sbjct: 206 FSDWPTFPQLYINGEFQGGLDIIKE 230

>CAGL0K02849g Chr11 complement(256016..257362) [1347 bp, 448 aa]
           {ON} highly similar to uniprot|P38755 Saccharomyces
           cerevisiae YHR001w OSH7
          Length = 448

 Score = 29.3 bits (64), Expect = 9.7,   Method: Compositional matrix adjust.
 Identities = 23/62 (37%), Positives = 31/62 (50%), Gaps = 8/62 (12%)

Query: 120 SLILDLSPIIIFSKSTCSY----SKGMKELLENEYQFIPNYYIIELDKHGHGEELQEYIK 175
           S+I  L P    SK T        K M E + N+ QF P+   I LD H   +ELQ ++K
Sbjct: 54  SIIAQLKPGCDLSKITLPTFILEKKSMLERITNQLQF-PD---IVLDAHQEKDELQRFVK 109

Query: 176 LV 177
           +V
Sbjct: 110 IV 111

>YDR098C Chr4 complement(644178..645035) [858 bp, 285 aa] {ON}
           GRX3Hydroperoxide and superoxide-radical responsive
           glutathione-dependent oxidoreductase; monothiol
           glutaredoxin subfamily member along with Grx4p and
           Grx5p; protects cells from oxidative damage; evidence
           exists indicating that the translation start site is not
           Met1 as currently annotated, but rather Met36
          Length = 285

 Score = 28.9 bits (63), Expect = 9.8,   Method: Compositional matrix adjust.
 Identities = 21/85 (24%), Positives = 45/85 (52%), Gaps = 11/85 (12%)

Query: 122 ILDLSPIIIFSKST-----CSYSKGMKELLENEYQFIPNYYIIELDKHGHGEELQEYIKL 176
           +++ +P+++F K +     C +S+ +  +L  E+Q    ++ I  D     E +++ +K 
Sbjct: 192 LVNAAPVMLFMKGSPSEPKCGFSRQLVGILR-EHQVRFGFFDILRD-----ESVRQNLKK 245

Query: 177 VTGRGTVPNLLVNGVSRGGNEEIKK 201
            +   T P L +NG  +GG + IK+
Sbjct: 246 FSEWPTFPQLYINGEFQGGLDIIKE 270

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.310    0.129    0.349 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 24,689,522
Number of extensions: 1092163
Number of successful extensions: 3605
Number of sequences better than 10.0: 192
Number of HSP's gapped: 3642
Number of HSP's successfully gapped: 192
Length of query: 231
Length of database: 53,481,399
Length adjustment: 106
Effective length of query: 125
Effective length of database: 41,326,803
Effective search space: 5165850375
Effective search space used: 5165850375
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.7 bits)
S2: 64 (29.3 bits)