Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
YDL008W (APC11)3.190ON1651658881e-124
Smik_4.2243.190ON1651657901e-109
Skud_4.2433.190ON1651657841e-108
Suva_4.2393.190ON1651657731e-106
ZYRO0A04906g3.190ON1601654808e-62
TDEL0H033703.190ON1531654772e-61
Kpol_1045.683.190ON1761814592e-58
AER016C3.190ON1471644172e-52
SAKL0C10516g3.190ON1441713981e-49
KNAG0J012503.190ON2021484005e-49
KLTH0G16082g3.190ON1351423945e-49
KAFR0A012403.190ON1731363968e-49
CAGL0I04576g3.190ON1491393894e-48
TPHA0H006403.190ON1801813837e-47
NDAI0A065203.190ON2061423841e-46
Kwal_56.231123.190ON1351223762e-46
Ecym_53123.190ON1481263686e-45
TBLA0A002603.190ON1841473664e-44
KLLA0E17711g3.190ON1621503099e-36
NCAS0I019203.190ON1281122668e-30
TBLA0I019603.279ON184771094e-06
KLTH0F19228g3.28ON110671055e-06
KAFR0C017803.28ON118691031e-05
YOL133W (HRT1)3.28ON121691021e-05
Smik_15.203.28ON121691021e-05
Suva_15.263.28ON122691022e-05
NDAI0G038603.28ON123691022e-05
Skud_15.203.28ON1211061012e-05
NCAS0C044803.28ON1091061002e-05
SAKL0C13178g3.28ON138671012e-05
Ecym_20293.28ON1141061002e-05
ZYRO0C03058g3.28ON1161061002e-05
KNAG0A012803.28ON114106985e-05
Kpol_1014.163.28ON10769976e-05
KLLA0C14344g8.799ON1518471001e-04
ADL181W3.28ON10867951e-04
TPHA0I005908.799ON1591621001e-04
Kwal_55.220543.28ON11167942e-04
CAGL0E01567g3.28ON102106932e-04
KLLA0E07151g3.28ON11073932e-04
TPHA0P014703.28ON11169923e-04
NDAI0K007108.799ON159162964e-04
TDEL0A004703.28ON11869914e-04
Kpol_480.258.799ON157162955e-04
TBLA0B087103.28ON12269906e-04
SAKL0B06226g8.799ON155762947e-04
TDEL0B009808.799ON155962947e-04
TBLA0D006508.799ON156862930.001
KAFR0B036208.799ON156062930.001
NCAS0C006808.799ON156462920.001
NCAS0A082803.279ON11893880.001
YMR247C (RKR1)8.799ON156262910.002
Skud_13.4198.799ON156462910.002
Smik_13.4608.799ON156662910.002
KNAG0J005408.799ON156162910.002
KLTH0E13992g8.799ON155062910.002
Suva_13.4328.799ON155962910.002
CAGL0H10274g3.279ON17558880.002
ZYRO0F12760g8.799ON155555910.002
Kwal_27.123278.799ON157462900.002
Ecym_26583.279ON15960860.004
KLTH0F18502gsingletonON26779870.004
Smik_2.1963.279ON18559860.005
ABL058C8.799ON154659880.005
AGL079C2.542ON50649870.006
YBR062C3.279ON18059850.006
KAFR0B046002.157ON40897860.006
KLLA0F18458g3.279ON14067840.007
ZYRO0E06996g3.279ON17267840.007
Ecym_74188.799ON154763860.008
Suva_4.3023.279ON15059830.008
AGR034W3.279ON15966830.010
KNAG0A074303.405ON10231800.012
KAFR0C004603.279ON15776820.012
TDEL0C027707.416ON20874820.016
TBLA0G023102.542ON67464830.017
CAGL0H02651g8.799ON154462830.023
TPHA0C042502.542ON55664820.024
ZYRO0B02244g2.542ON56362820.027
Kwal_27.105463.279ON10465770.030
KAFR0I020901.389ON146629810.036
Kpol_1052.193.279ON10375770.037
NDAI0A074503.279ON17345790.037
Ecym_72442.542ON53249810.039
TPHA0A039903.279ON17587790.044
AGL217W8.808ON41466800.049
Kpol_1023.322.411ON117865800.053
Skud_2.1863.279ON17859770.062
TBLA0F032803.405ON55542780.086
TDEL0A031802.542ON56759780.094
KLLA0E07019g7.416ON27983770.10
Skud_8.352.542ON58549770.11
YHL010C (ETP1)2.542ON58549770.11
KLTH0D07150g2.542ON54082770.11
TPHA0C042602.545ON75787770.11
Smik_8.322.542ON58549770.11
Kwal_55.21206singletonON27563760.12
Suva_8.422.542ON58549770.12
CAGL0K02563g2.542ON58655770.12
CAGL0G03553g7.416ON21065750.13
KLLA0F25740g2.542ON51746760.13
SAKL0A09746g2.542ON54856760.13
SAKL0D03058g3.279ON15559740.17
KNAG0C056602.542ON50755760.17
Kpol_1056.271.448ON27578750.18
Kpol_505.182.157ON58565750.18
Kwal_27.104198.808ON30055750.19
TPHA0B036501.389ON157649750.19
NDAI0B018202.542ON62547750.22
TPHA0F018402.157ON52141750.22
NCAS0A04680singletonON27467740.23
NCAS0G025202.157ON51872740.24
NDAI0G052001.389ON158632750.24
CAGL0L03960g2.157ON60376740.24
Ecym_42508.317ON65753740.28
KAFR0F007402.157ON51076740.29
SAKL0E04488g2.411ON112743740.30
Ecym_26848.808ON38644730.35
KNAG0A070902.545ON76236730.37
KNAG0J008503.279ON16249710.37
TBLA0B012602.157ON88534730.37
ACR267C2.157ON467107730.39
KAFR0A019902.542ON56049730.39
KLTH0C05258g3.279ON15259710.40
KLLA0C05874g6.45ON55358720.42
KAFR0B014602.545ON76136730.43
Smik_11.2132.545ON75966730.43
KNAG0A060302.411ON115084730.45
YKL034W (TUL1)2.545ON75836720.45
Suva_11.1892.545ON75836720.46
NDAI0F027702.157ON55461720.48
SAKL0E10824g2.157ON47541720.53
Ecym_54453.405ON32127710.54
KLTH0E09834g2.157ON47941710.58
Kwal_47.179042.157ON47041710.69
Kpol_1002.82.542ON55847710.73
Suva_1.694.129ON127134710.74
TDEL0D034603.279ON14441680.77
Suva_13.4158.761ON102849710.77
Kpol_1030.298.761ON101673710.81
KNAG0H035102.157ON55172700.81
Skud_11.1922.545ON75836700.83
ZYRO0B16258g2.157ON57960700.83
CAGL0L01947g2.545ON75767700.97
YMR231W (PEP5)8.761ON102949701.0
TDEL0B063402.545ON76286701.0
Kpol_1036.668.317ON66828701.0
TDEL0F02870na 1ON26059691.1
TDEL0B052002.157ON52445691.1
Skud_8.1762.157ON41341691.1
Ecym_54282.157ON474101691.2
KLLA0C15697g3.405ON30458681.2
YDR143C (SAN1)8.317ON61051691.4
Kwal_26.80902.542ON52047681.4
Suva_15.3112.157ON26942681.4
Smik_1.664.129ON127235691.5
TDEL0F044408.317ON55485681.5
KLTH0D07216g2.545ON74736681.6
Kpol_1072.552.157ON42084681.6
Skud_1.604.129ON127534681.6
NCAS0A125502.542ON57247681.7
TDEL0B061701.389ON147044681.7
Skud_12.992.411ON117169681.7
SAKL0H15686g8.317ON59936681.8
Kpol_1002.72.545ON75467681.8
Skud_4.4028.317ON61236681.8
SAKL0D02354g8.808ON33155671.8
CAGL0E02299g6.45ON54578671.9
TBLA0I014902.545ON75036681.9
Kwal_26.80992.545ON75036672.0
Kwal_56.235438.247ON96547672.1
ZYRO0E05632g2.545ON76536672.2
ZYRO0G13376g8.808ON44554672.2
Kwal_55.220763.22ON128653672.2
NCAS0B009908.808ON39292672.2
CAGL0K08052g3.405ON30585662.2
YHR115C (DMA1)2.157ON41641672.3
NCAS0A047602.545ON76136672.3
Kpol_538.53.405ON33546662.4
Suva_15.223.22ON133674672.4
NCAS0B069902.157ON521107662.5
Suva_16.4203.405ON29064662.5
TPHA0J015708.761ON101848672.5
Suva_2.3048.317ON62489662.7
YAL002W (VPS8)4.129ON127435672.7
YOL138C (RTC1)3.22ON134155672.7
NDAI0K018102.545ON76230662.7
YLR032W (RAD5)2.411ON116941662.8
KAFR0B034208.761ON103648662.8
Ecym_24906.332ON46567663.1
AGL349C5.11ON109278663.3
Smik_8.1932.157ON41633653.4
KLLA0F25674g2.545ON75736653.6
Ecym_72412.545ON75827653.7
Smik_4.3878.317ON63436653.8
KNAG0M015605.322ON95029654.0
Ecym_43257.249ON64465654.2
Smik_13.4398.761ON103049654.5
Suva_10.1122.411ON116769654.7
TBLA0E013004.129ON144046654.8
KLLA0D02024g4.78ON55644645.4
NCAS0C033108.317ON57028645.5
KLTH0C04664g8.808ON30652635.5
ABR104W3.405ON32827635.6
Smik_15.163.22ON132655645.8
TDEL0C054203.405ON9327606.1
NDAI0G026308.317ON66128636.4
KLTH0A04532g7.249ON61165636.4
Kwal_23.58597.249ON61965636.5
Kpol_1048.731.389ON154997636.8
Suva_14.2232.157ON580106636.8
SAKL0H17116gsingletonON54436637.0
KNAG0I020902.157ON427106637.2
KLTH0F11044g3.405ON29148628.2
Smik_12.942.411ON117859638.3
Kpol_478.85.190ON202269638.4
NDAI0E004408.808ON41632628.6
YGL131C (SNT2)6.229ON140366628.8
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= YDL008W
         (165 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

YDL008W Chr4 (433497..433994) [498 bp, 165 aa] {ON}  APC11Cataly...   346   e-124
Smik_4.224 Chr4 (415442..415939) [498 bp, 165 aa] {ON} YDL008W (...   308   e-109
Skud_4.243 Chr4 (428190..428687) [498 bp, 165 aa] {ON} YDL008W (...   306   e-108
Suva_4.239 Chr4 (426773..427270) [498 bp, 165 aa] {ON} YDL008W (...   302   e-106
ZYRO0A04906g Chr1 complement(395608..396090) [483 bp, 160 aa] {O...   189   8e-62
TDEL0H03370 Chr8 complement(560397..560858) [462 bp, 153 aa] {ON...   188   2e-61
Kpol_1045.68 s1045 complement(160584..161114) [531 bp, 176 aa] {...   181   2e-58
AER016C Chr5 complement(659572..660015) [444 bp, 147 aa] {ON} Sy...   165   2e-52
SAKL0C10516g Chr3 (956666..957100) [435 bp, 144 aa] {ON} similar...   157   1e-49
KNAG0J01250 Chr10 complement(225063..225671) [609 bp, 202 aa] {O...   158   5e-49
KLTH0G16082g Chr7 (1407117..1407524) [408 bp, 135 aa] {ON} some ...   156   5e-49
KAFR0A01240 Chr1 (241805..242326) [522 bp, 173 aa] {ON} Anc_3.19...   157   8e-49
CAGL0I04576g Chr9 (408872..409321) [450 bp, 149 aa] {ON} similar...   154   4e-48
TPHA0H00640 Chr8 (126792..127334) [543 bp, 180 aa] {ON} Anc_3.19...   152   7e-47
NDAI0A06520 Chr1 (1482275..1482895) [621 bp, 206 aa] {ON} Anc_3....   152   1e-46
Kwal_56.23112 s56 complement(406291..406698) [408 bp, 135 aa] {O...   149   2e-46
Ecym_5312 Chr5 complement(632833..633279) [447 bp, 148 aa] {ON} ...   146   6e-45
TBLA0A00260 Chr1 complement(38358..38912) [555 bp, 184 aa] {ON} ...   145   4e-44
KLLA0E17711g Chr5 complement(1571018..1571506) [489 bp, 162 aa] ...   123   9e-36
NCAS0I01920 Chr9 (352307..352693) [387 bp, 128 aa] {ON} Anc_3.19...   107   8e-30
TBLA0I01960 Chr9 complement(444753..445291,445364..445379) [555 ...    47   4e-06
KLTH0F19228g Chr6 complement(1556655..1556987) [333 bp, 110 aa] ...    45   5e-06
KAFR0C01780 Chr3 complement(363161..363517) [357 bp, 118 aa] {ON...    44   1e-05
YOL133W Chr15 (70325..70690) [366 bp, 121 aa] {ON}  HRT1RING fin...    44   1e-05
Smik_15.20 Chr15 (38383..38748) [366 bp, 121 aa] {ON} YOL133W (R...    44   1e-05
Suva_15.26 Chr15 (48168..48536) [369 bp, 122 aa] {ON} YOL133W (R...    44   2e-05
NDAI0G03860 Chr7 (925672..926043) [372 bp, 123 aa] {ON} Anc_3.28...    44   2e-05
Skud_15.20 Chr15 (35550..35915) [366 bp, 121 aa] {ON} YOL133W (R...    44   2e-05
NCAS0C04480 Chr3 (919123..919452) [330 bp, 109 aa] {ON} Anc_3.28       43   2e-05
SAKL0C13178g Chr3 complement(1166576..1166992) [417 bp, 138 aa] ...    44   2e-05
Ecym_2029 Chr2 (47083..47427) [345 bp, 114 aa] {ON} similar to A...    43   2e-05
ZYRO0C03058g Chr3 complement(236925..237275) [351 bp, 116 aa] {O...    43   2e-05
KNAG0A01280 Chr1 (27372..27716) [345 bp, 114 aa] {ON} Anc_3.28 Y...    42   5e-05
Kpol_1014.16 s1014 complement(29615..29938) [324 bp, 107 aa] {ON...    42   6e-05
KLLA0C14344g Chr3 (1245226..1249782) [4557 bp, 1518 aa] {ON} sim...    43   1e-04
ADL181W Chr4 (379682..380008) [327 bp, 108 aa] {ON} Syntenic hom...    41   1e-04
TPHA0I00590 Chr9 (117658..122433) [4776 bp, 1591 aa] {ON} Anc_8....    43   1e-04
Kwal_55.22054 s55 complement(1091138..1091473) [336 bp, 111 aa] ...    41   2e-04
CAGL0E01567g Chr5 (148425..148733) [309 bp, 102 aa] {ON} similar...    40   2e-04
KLLA0E07151g Chr5 (651474..651806) [333 bp, 110 aa] {ON} similar...    40   2e-04
TPHA0P01470 Chr16 complement(301305..301640) [336 bp, 111 aa] {O...    40   3e-04
NDAI0K00710 Chr11 (155351..160126) [4776 bp, 1591 aa] {ON} Anc_8...    42   4e-04
TDEL0A00470 Chr1 (82852..83208) [357 bp, 118 aa] {ON} Anc_3.28 Y...    40   4e-04
Kpol_480.25 s480 (57636..62351) [4716 bp, 1571 aa] {ON} (57636.....    41   5e-04
TBLA0B08710 Chr2 complement(2075746..2076114) [369 bp, 122 aa] {...    39   6e-04
SAKL0B06226g Chr2 (524855..529528) [4674 bp, 1557 aa] {ON} simil...    41   7e-04
TDEL0B00980 Chr2 (181064..185743) [4680 bp, 1559 aa] {ON} Anc_8....    41   7e-04
TBLA0D00650 Chr4 (172839..177545) [4707 bp, 1568 aa] {ON} Anc_8....    40   0.001
KAFR0B03620 Chr2 complement(752307..756989) [4683 bp, 1560 aa] {...    40   0.001
NCAS0C00680 Chr3 (109845..114539) [4695 bp, 1564 aa] {ON} Anc_8....    40   0.001
NCAS0A08280 Chr1 (1636423..1636779) [357 bp, 118 aa] {ON} Anc_3....    39   0.001
YMR247C Chr13 complement(763351..768039) [4689 bp, 1562 aa] {ON}...    40   0.002
Skud_13.419 Chr13 complement(738148..742842) [4695 bp, 1564 aa] ...    40   0.002
Smik_13.460 Chr13 complement(747753..752453) [4701 bp, 1566 aa] ...    40   0.002
KNAG0J00540 Chr10 (86360..91045) [4686 bp, 1561 aa] {ON} Anc_8.7...    40   0.002
KLTH0E13992g Chr5 (1234550..1239202) [4653 bp, 1550 aa] {ON} sim...    40   0.002
Suva_13.432 Chr13 complement(744705..749384) [4680 bp, 1559 aa] ...    40   0.002
CAGL0H10274g Chr8 complement(1003801..1004312,1004468..1004483) ...    39   0.002
ZYRO0F12760g Chr6 complement(1037460..1042127) [4668 bp, 1555 aa...    40   0.002
Kwal_27.12327 s27 (1178866..1183590) [4725 bp, 1574 aa] {ON} YMR...    39   0.002
Ecym_2658 Chr2 (1270952..1271431) [480 bp, 159 aa] {ON} similar ...    38   0.004
KLTH0F18502g Chr6 (1496235..1497038) [804 bp, 267 aa] {ON} conse...    38   0.004
Smik_2.196 Chr2 complement(347806..348363) [558 bp, 185 aa] {ON}...    38   0.005
ABL058C Chr2 complement(288353..292993) [4641 bp, 1546 aa] {ON} ...    39   0.005
AGL079C Chr7 complement(557422..558942) [1521 bp, 506 aa] {ON} S...    38   0.006
YBR062C Chr2 complement(365976..366502,366585..366600) [543 bp, ...    37   0.006
KAFR0B04600 Chr2 complement(956458..957684) [1227 bp, 408 aa] {O...    38   0.006
KLLA0F18458g Chr6 complement(1697871..1698293) [423 bp, 140 aa] ...    37   0.007
ZYRO0E06996g Chr5 complement(530578..531080,531138..531153) [519...    37   0.007
Ecym_7418 Chr7 (853469..858112) [4644 bp, 1547 aa] {ON} similar ...    38   0.008
Suva_4.302 Chr4 complement(532902..533210,533286..533429) [453 b...    37   0.008
AGR034W Chr7 (772766..773245) [480 bp, 159 aa] {ON} Syntenic hom...    37   0.010
KNAG0A07430 Chr1 complement(1165740..1166048) [309 bp, 102 aa] {...    35   0.012
KAFR0C00460 Chr3 complement(94989..95446,95522..95537) [474 bp, ...    36   0.012
TDEL0C02770 Chr3 complement(486107..486733) [627 bp, 208 aa] {ON...    36   0.016
TBLA0G02310 Chr7 (598514..600538) [2025 bp, 674 aa] {ON} Anc_2.5...    37   0.017
CAGL0H02651g Chr8 (238495..243129) [4635 bp, 1544 aa] {ON} simil...    37   0.023
TPHA0C04250 Chr3 (915632..917302) [1671 bp, 556 aa] {ON} Anc_2.5...    36   0.024
ZYRO0B02244g Chr2 (186386..188077) [1692 bp, 563 aa] {ON} simila...    36   0.027
Kwal_27.10546 s27 complement(386744..387058) [315 bp, 104 aa] {O...    34   0.030
KAFR0I02090 Chr9 complement(427023..431423) [4401 bp, 1466 aa] {...    36   0.036
Kpol_1052.19 s1052 (60008..60319) [312 bp, 103 aa] {ON} (60008.....    34   0.037
NDAI0A07450 Chr1 complement(1699546..1700051,1700150..1700165) [...    35   0.037
Ecym_7244 Chr7 complement(512748..514346) [1599 bp, 532 aa] {ON}...    36   0.039
TPHA0A03990 Chr1 (887214..887741) [528 bp, 175 aa] {ON} Anc_3.27...    35   0.044
AGL217W Chr7 (290043..291287) [1245 bp, 414 aa] {ON} Syntenic ho...    35   0.049
Kpol_1023.32 s1023 complement(68737..72273) [3537 bp, 1178 aa] {...    35   0.053
Skud_2.186 Chr2 complement(334347..334867,334953..334968) [537 b...    34   0.062
TBLA0F03280 Chr6 complement(805882..807549) [1668 bp, 555 aa] {O...    35   0.086
TDEL0A03180 Chr1 (569298..571001) [1704 bp, 567 aa] {ON} Anc_2.5...    35   0.094
KLLA0E07019g Chr5 (641391..642230) [840 bp, 279 aa] {ON} some si...    34   0.10 
Skud_8.35 Chr8 complement(70011..71768) [1758 bp, 585 aa] {ON} Y...    34   0.11 
YHL010C Chr8 complement(81964..83721) [1758 bp, 585 aa] {ON}  ET...    34   0.11 
KLTH0D07150g Chr4 (627115..628737) [1623 bp, 540 aa] {ON} simila...    34   0.11 
TPHA0C04260 Chr3 complement(917526..919799) [2274 bp, 757 aa] {O...    34   0.11 
Smik_8.32 Chr8 complement(65542..67299) [1758 bp, 585 aa] {ON} Y...    34   0.11 
Kwal_55.21206 s55 complement(730534..731361) [828 bp, 275 aa] {O...    34   0.12 
Suva_8.42 Chr8 complement(84493..86250) [1758 bp, 585 aa] {ON} Y...    34   0.12 
CAGL0K02563g Chr11 complement(231812..233572) [1761 bp, 586 aa] ...    34   0.12 
CAGL0G03553g Chr7 complement(345057..345689) [633 bp, 210 aa] {O...    33   0.13 
KLLA0F25740g Chr6 complement(2389226..2390779) [1554 bp, 517 aa]...    34   0.13 
SAKL0A09746g Chr1 (858392..860038) [1647 bp, 548 aa] {ON} simila...    34   0.13 
SAKL0D03058g Chr4 complement(252198..252649,252717..252732) [468...    33   0.17 
KNAG0C05660 Chr3 complement(1091851..1093374) [1524 bp, 507 aa] ...    34   0.17 
Kpol_1056.27 s1056 complement(62728..63555) [828 bp, 275 aa] {ON...    33   0.18 
Kpol_505.18 s505 complement(48530..50287) [1758 bp, 585 aa] {ON}...    33   0.18 
Kwal_27.10419 s27 (337699..338601) [903 bp, 300 aa] {ON} YOL054W...    33   0.19 
TPHA0B03650 Chr2 complement(857083..861813) [4731 bp, 1576 aa] {...    33   0.19 
NDAI0B01820 Chr2 (433938..435815) [1878 bp, 625 aa] {ON} Anc_2.542     33   0.22 
TPHA0F01840 Chr6 complement(422396..423961) [1566 bp, 521 aa] {O...    33   0.22 
NCAS0A04680 Chr1 complement(932306..933130) [825 bp, 274 aa] {ON}      33   0.23 
NCAS0G02520 Chr7 (451683..453239) [1557 bp, 518 aa] {ON} Anc_2.1...    33   0.24 
NDAI0G05200 Chr7 (1261661..1266421) [4761 bp, 1586 aa] {ON} Anc_...    33   0.24 
CAGL0L03960g Chr12 complement(463751..465562) [1812 bp, 603 aa] ...    33   0.24 
Ecym_4250 Chr4 complement(517592..519560,519632..519636) [1974 b...    33   0.28 
KAFR0F00740 Chr6 (144375..145907) [1533 bp, 510 aa] {ON} Anc_2.1...    33   0.29 
SAKL0E04488g Chr5 (359434..362817) [3384 bp, 1127 aa] {ON} simil...    33   0.30 
Ecym_2684 Chr2 complement(1321556..1322716) [1161 bp, 386 aa] {O...    33   0.35 
KNAG0A07090 Chr1 complement(1110424..1112712) [2289 bp, 762 aa] ...    33   0.37 
KNAG0J00850 Chr10 complement(146187..146675) [489 bp, 162 aa] {O...    32   0.37 
TBLA0B01260 Chr2 (266584..269241) [2658 bp, 885 aa] {ON} Anc_2.1...    33   0.37 
ACR267C Chr3 complement(841323..842726) [1404 bp, 467 aa] {ON} S...    33   0.39 
KAFR0A01990 Chr1 (418279..419961) [1683 bp, 560 aa] {ON} Anc_2.5...    33   0.39 
KLTH0C05258g Chr3 complement(455688..456130,456190..456205) [459...    32   0.40 
KLLA0C05874g Chr3 complement(520079..521740) [1662 bp, 553 aa] {...    32   0.42 
KAFR0B01460 Chr2 (277155..279440) [2286 bp, 761 aa] {ON} Anc_2.5...    33   0.43 
Smik_11.213 Chr11 (358262..360541) [2280 bp, 759 aa] {ON} YKL034...    33   0.43 
KNAG0A06030 Chr1 complement(909762..913214) [3453 bp, 1150 aa] {...    33   0.45 
YKL034W Chr11 (371829..374105) [2277 bp, 758 aa] {ON}  TUL1Golgi...    32   0.45 
Suva_11.189 Chr11 (354713..356989) [2277 bp, 758 aa] {ON} YKL034...    32   0.46 
NDAI0F02770 Chr6 complement(677011..678675) [1665 bp, 554 aa] {O...    32   0.48 
SAKL0E10824g Chr5 complement(902623..904050) [1428 bp, 475 aa] {...    32   0.53 
Ecym_5445 Chr5 complement(920562..921527) [966 bp, 321 aa] {ON} ...    32   0.54 
KLTH0E09834g Chr5 complement(885503..886942) [1440 bp, 479 aa] {...    32   0.58 
Kwal_47.17904 s47 complement(602106..603518) [1413 bp, 470 aa] {...    32   0.69 
Kpol_1002.8 s1002 complement(21450..23126) [1677 bp, 558 aa] {ON...    32   0.73 
Suva_1.69 Chr1 (120731..124546) [3816 bp, 1271 aa] {ON} YAL002W ...    32   0.74 
TDEL0D03460 Chr4 (637921..638355) [435 bp, 144 aa] {ON} Anc_3.27...    31   0.77 
Suva_13.415 Chr13 (714887..717973) [3087 bp, 1028 aa] {ON} YMR23...    32   0.77 
Kpol_1030.29 s1030 complement(56650..59700) [3051 bp, 1016 aa] {...    32   0.81 
KNAG0H03510 Chr8 complement(654395..656050) [1656 bp, 551 aa] {O...    32   0.81 
Skud_11.192 Chr11 (351379..353655) [2277 bp, 758 aa] {ON} YKL034...    32   0.83 
ZYRO0B16258g Chr2 complement(1317605..1319344) [1740 bp, 579 aa]...    32   0.83 
CAGL0L01947g Chr12 (227996..230269) [2274 bp, 757 aa] {ON} simil...    32   0.97 
YMR231W Chr13 (733545..736634) [3090 bp, 1029 aa] {ON}  PEP5Comp...    32   1.0  
TDEL0B06340 Chr2 complement(1122797..1125085) [2289 bp, 762 aa] ...    32   1.0  
Kpol_1036.66 s1036 complement(182540..184546) [2007 bp, 668 aa] ...    32   1.0  
TDEL0F02870 Chr6 complement(518828..519610) [783 bp, 260 aa] {ON}      31   1.1  
TDEL0B05200 Chr2 (914227..915801) [1575 bp, 524 aa] {ON} Anc_2.1...    31   1.1  
Skud_8.176 Chr8 complement(313886..315127) [1242 bp, 413 aa] {ON...    31   1.1  
Ecym_5428 Chr5 complement(881972..883396) [1425 bp, 474 aa] {ON}...    31   1.2  
KLLA0C15697g Chr3 (1360289..1361203) [915 bp, 304 aa] {ON} simil...    31   1.2  
YDR143C Chr4 complement(742042..743874) [1833 bp, 610 aa] {ON}  ...    31   1.4  
Kwal_26.8090 s26 complement(641408..642970) [1563 bp, 520 aa] {O...    31   1.4  
Suva_15.311 Chr15 complement(542475..543284) [810 bp, 269 aa] {O...    31   1.4  
Smik_1.66 Chr1 (126883..130701) [3819 bp, 1272 aa] {ON} YAL002W ...    31   1.5  
TDEL0F04440 Chr6 complement(833116..834780) [1665 bp, 554 aa] {O...    31   1.5  
KLTH0D07216g Chr4 complement(631219..633462) [2244 bp, 747 aa] {...    31   1.6  
Kpol_1072.55 s1072 (126281..127543) [1263 bp, 420 aa] {ON} (1262...    31   1.6  
Skud_1.60 Chr1 (118757..122584) [3828 bp, 1275 aa] {ON} YAL002W ...    31   1.6  
NCAS0A12550 Chr1 (2476209..2477927) [1719 bp, 572 aa] {ON} Anc_2...    31   1.7  
TDEL0B06170 Chr2 (1088912..1093324) [4413 bp, 1470 aa] {ON} Anc_...    31   1.7  
Skud_12.99 Chr12 (196796..200311) [3516 bp, 1171 aa] {ON} YLR032...    31   1.7  
SAKL0H15686g Chr8 (1367935..1367948,1368042..1369827) [1800 bp, ...    31   1.8  
Kpol_1002.7 s1002 (19006..21270) [2265 bp, 754 aa] {ON} (19006.....    31   1.8  
Skud_4.402 Chr4 complement(713711..715549) [1839 bp, 612 aa] {ON...    31   1.8  
SAKL0D02354g Chr4 (188524..189519) [996 bp, 331 aa] {ON} weakly ...    30   1.8  
CAGL0E02299g Chr5 complement(219246..220883) [1638 bp, 545 aa] {...    30   1.9  
TBLA0I01490 Chr9 (322980..325232) [2253 bp, 750 aa] {ON} Anc_2.5...    31   1.9  
Kwal_26.8099 s26 complement(645436..647688) [2253 bp, 750 aa] {O...    30   2.0  
Kwal_56.23543 s56 complement(591514..594411) [2898 bp, 965 aa] {...    30   2.1  
ZYRO0E05632g Chr5 complement(434758..437055) [2298 bp, 765 aa] {...    30   2.2  
ZYRO0G13376g Chr7 complement(1066321..1067658) [1338 bp, 445 aa]...    30   2.2  
Kwal_55.22076 s55 (1098857..1102717) [3861 bp, 1286 aa] {ON} YOL...    30   2.2  
NCAS0B00990 Chr2 complement(154925..156103) [1179 bp, 392 aa] {O...    30   2.2  
CAGL0K08052g Chr11 complement(800991..801908) [918 bp, 305 aa] {...    30   2.2  
YHR115C Chr8 complement(340109..341359) [1251 bp, 416 aa] {ON}  ...    30   2.3  
NCAS0A04760 Chr1 (948786..951071) [2286 bp, 761 aa] {ON} Anc_2.5...    30   2.3  
Kpol_538.5 s538 (7029..8036) [1008 bp, 335 aa] {ON} (7029..8036)...    30   2.4  
Suva_15.22 Chr15 complement(39171..43181) [4011 bp, 1336 aa] {ON...    30   2.4  
NCAS0B06990 Chr2 complement(1330221..1331786) [1566 bp, 521 aa] ...    30   2.5  
Suva_16.420 Chr16 complement(726959..727831) [873 bp, 290 aa] {O...    30   2.5  
TPHA0J01570 Chr10 (360114..363170) [3057 bp, 1018 aa] {ON} Anc_8...    30   2.5  
Suva_2.304 Chr2 complement(537292..539166) [1875 bp, 624 aa] {ON...    30   2.7  
YAL002W Chr1 (143707..147531) [3825 bp, 1274 aa] {ON}  VPS8Membr...    30   2.7  
YOL138C Chr15 complement(61325..65350) [4026 bp, 1341 aa] {ON}  ...    30   2.7  
NDAI0K01810 Chr11 (405118..407406) [2289 bp, 762 aa] {ON} Anc_2....    30   2.7  
YLR032W Chr12 (204991..208500) [3510 bp, 1169 aa] {ON}  RAD5DNA ...    30   2.8  
KAFR0B03420 Chr2 (713034..716144) [3111 bp, 1036 aa] {ON} Anc_8....    30   2.8  
Ecym_2490 Chr2 (961218..962615) [1398 bp, 465 aa] {ON} similar t...    30   3.1  
AGL349C Chr7 complement(53004..56282) [3279 bp, 1092 aa] {ON} Sy...    30   3.3  
Smik_8.193 Chr8 complement(316475..317725) [1251 bp, 416 aa] {ON...    30   3.4  
KLLA0F25674g Chr6 (2384293..2386566) [2274 bp, 757 aa] {ON} simi...    30   3.6  
Ecym_7241 Chr7 (507764..510040) [2277 bp, 758 aa] {ON} similar t...    30   3.7  
Smik_4.387 Chr4 complement(702765..704669) [1905 bp, 634 aa] {ON...    30   3.8  
KNAG0M01560 Chr13 (276011..278863) [2853 bp, 950 aa] {ON} Anc_5....    30   4.0  
Ecym_4325 Chr4 complement(699162..701096) [1935 bp, 644 aa] {ON}...    30   4.2  
Smik_13.439 Chr13 (717478..720570) [3093 bp, 1030 aa] {ON} YMR23...    30   4.5  
Suva_10.112 Chr10 (211443..214946) [3504 bp, 1167 aa] {ON} YLR03...    30   4.7  
TBLA0E01300 Chr5 (285940..290262) [4323 bp, 1440 aa] {ON} Anc_4....    30   4.8  
KLLA0D02024g Chr4 complement(173877..175547) [1671 bp, 556 aa] {...    29   5.4  
NCAS0C03310 Chr3 (649744..651456) [1713 bp, 570 aa] {ON} Anc_8.317     29   5.5  
KLTH0C04664g Chr3 (405366..406286) [921 bp, 306 aa] {ON} some si...    29   5.5  
ABR104W Chr2 (574068..575054) [987 bp, 328 aa] {ON} Syntenic hom...    29   5.6  
Smik_15.16 Chr15 complement(29410..33390) [3981 bp, 1326 aa] {ON...    29   5.8  
TDEL0C05420 Chr3 complement(972821..973102) [282 bp, 93 aa] {ON}...    28   6.1  
NDAI0G02630 Chr7 (602238..604223) [1986 bp, 661 aa] {ON} Anc_8.317     29   6.4  
KLTH0A04532g Chr1 (378016..379851) [1836 bp, 611 aa] {ON} simila...    29   6.4  
Kwal_23.5859 s23 (1345113..1346972) [1860 bp, 619 aa] {ON} YER06...    29   6.5  
Kpol_1048.73 s1048 (207883..212532) [4650 bp, 1549 aa] {ON} (207...    29   6.8  
Suva_14.223 Chr14 (404941..406683) [1743 bp, 580 aa] {ON} YNL116...    29   6.8  
SAKL0H17116g Chr8 complement(1512627..1514261) [1635 bp, 544 aa]...    29   7.0  
KNAG0I02090 Chr9 complement(407893..409176) [1284 bp, 427 aa] {O...    29   7.2  
KLTH0F11044g Chr6 (937668..938543) [876 bp, 291 aa] {ON} weakly ...    28   8.2  
Smik_12.94 Chr12 (191768..195304) [3537 bp, 1178 aa] {ON} YLR032...    29   8.3  
Kpol_478.8 s478 complement(33393..38306,38308..39462) [6069 bp, ...    29   8.4  
NDAI0E00440 Chr5 (80965..82215) [1251 bp, 416 aa] {ON} Anc_8.808...    28   8.6  
YGL131C Chr7 complement(261648..265859) [4212 bp, 1403 aa] {ON} ...    28   8.8  

>YDL008W Chr4 (433497..433994) [498 bp, 165 aa] {ON}  APC11Catalytic
           core subunit of the Anaphase-Promoting Complex/Cyclosome
           (APC/C), which is a ubiquitin-protein ligase required
           for degradation of anaphase inhibitors, including
           mitotic cyclins, during the metaphase/anaphase
           transition; contains a RING-H2 domain that is required
           for activity
          Length = 165

 Score =  346 bits (888), Expect = e-124,   Method: Compositional matrix adjust.
 Identities = 165/165 (100%), Positives = 165/165 (100%)

Query: 1   MKVKINEVHSVFAWSWHIPSTSDEDAANNDPIGNDEDEDVCGICRASYNGTCPSCKFPGD 60
           MKVKINEVHSVFAWSWHIPSTSDEDAANNDPIGNDEDEDVCGICRASYNGTCPSCKFPGD
Sbjct: 1   MKVKINEVHSVFAWSWHIPSTSDEDAANNDPIGNDEDEDVCGICRASYNGTCPSCKFPGD 60

Query: 61  QCPLVIGLCHHNFHDHCIYRWLDTPTSKGLCPMCRQTFQLQKGLAINDAHVQKFVEIVSR 120
           QCPLVIGLCHHNFHDHCIYRWLDTPTSKGLCPMCRQTFQLQKGLAINDAHVQKFVEIVSR
Sbjct: 61  QCPLVIGLCHHNFHDHCIYRWLDTPTSKGLCPMCRQTFQLQKGLAINDAHVQKFVEIVSR 120

Query: 121 RREEMIEEGVAEEFVDFDEPIRQNTDNPIGRQQVDTILDEDFLLR 165
           RREEMIEEGVAEEFVDFDEPIRQNTDNPIGRQQVDTILDEDFLLR
Sbjct: 121 RREEMIEEGVAEEFVDFDEPIRQNTDNPIGRQQVDTILDEDFLLR 165

>Smik_4.224 Chr4 (415442..415939) [498 bp, 165 aa] {ON} YDL008W
           (REAL)
          Length = 165

 Score =  308 bits (790), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 145/165 (87%), Positives = 152/165 (92%)

Query: 1   MKVKINEVHSVFAWSWHIPSTSDEDAANNDPIGNDEDEDVCGICRASYNGTCPSCKFPGD 60
           MKVKINEVHSVFAW+W IPS SDE   N+    NDE+EDVCGICRASYNGTCPSCKFPGD
Sbjct: 1   MKVKINEVHSVFAWTWQIPSISDEKVTNDKLNDNDENEDVCGICRASYNGTCPSCKFPGD 60

Query: 61  QCPLVIGLCHHNFHDHCIYRWLDTPTSKGLCPMCRQTFQLQKGLAINDAHVQKFVEIVSR 120
           QCPLVIG+CHHNFHDHCIYRWLDTPTSKGLCPMCRQ FQLQKGLAINDAH+QKFVEIVSR
Sbjct: 61  QCPLVIGVCHHNFHDHCIYRWLDTPTSKGLCPMCRQRFQLQKGLAINDAHIQKFVEIVSR 120

Query: 121 RREEMIEEGVAEEFVDFDEPIRQNTDNPIGRQQVDTILDEDFLLR 165
           RREEMIEEGVAE+FVDFDEPIRQNTDN I R QVDT+LDEDFLLR
Sbjct: 121 RREEMIEEGVAEDFVDFDEPIRQNTDNAIDRSQVDTVLDEDFLLR 165

>Skud_4.243 Chr4 (428190..428687) [498 bp, 165 aa] {ON} YDL008W
           (REAL)
          Length = 165

 Score =  306 bits (784), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 143/165 (86%), Positives = 153/165 (92%)

Query: 1   MKVKINEVHSVFAWSWHIPSTSDEDAANNDPIGNDEDEDVCGICRASYNGTCPSCKFPGD 60
           MKVKINEVHSVFAWSWHIPS SDE   N  P  NDEDEDVCGICRASYNGTCPSCK+PGD
Sbjct: 1   MKVKINEVHSVFAWSWHIPSISDEVIGNEVPNENDEDEDVCGICRASYNGTCPSCKYPGD 60

Query: 61  QCPLVIGLCHHNFHDHCIYRWLDTPTSKGLCPMCRQTFQLQKGLAINDAHVQKFVEIVSR 120
           QCPLVIG+CHHNFHDHCIYRWLDT  SKGLCPMCRQTFQLQKGLAINDAH+QKFV+IVSR
Sbjct: 61  QCPLVIGVCHHNFHDHCIYRWLDTSNSKGLCPMCRQTFQLQKGLAINDAHIQKFVDIVSR 120

Query: 121 RREEMIEEGVAEEFVDFDEPIRQNTDNPIGRQQVDTILDEDFLLR 165
           RREEMIEEGVAE+FV+FDEP+RQNTD+ I RQQ+DT+LDEDFLLR
Sbjct: 121 RREEMIEEGVAEDFVNFDEPMRQNTDSAIERQQIDTVLDEDFLLR 165

>Suva_4.239 Chr4 (426773..427270) [498 bp, 165 aa] {ON} YDL008W
           (REAL)
          Length = 165

 Score =  302 bits (773), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 141/165 (85%), Positives = 151/165 (91%)

Query: 1   MKVKINEVHSVFAWSWHIPSTSDEDAANNDPIGNDEDEDVCGICRASYNGTCPSCKFPGD 60
           MKVKIN+VHSVFAWSWHIP  SDE+  N     ND+DEDVCGICRASYNGTCPSCKFPGD
Sbjct: 1   MKVKINQVHSVFAWSWHIPRISDENETNEVTNENDDDEDVCGICRASYNGTCPSCKFPGD 60

Query: 61  QCPLVIGLCHHNFHDHCIYRWLDTPTSKGLCPMCRQTFQLQKGLAINDAHVQKFVEIVSR 120
           QCPLVIG+CHHNFHDHCIYRWLDT  SKGLCPMCRQ FQLQKGLAINDAH++KFVE+VSR
Sbjct: 61  QCPLVIGVCHHNFHDHCIYRWLDTSNSKGLCPMCRQVFQLQKGLAINDAHIRKFVEVVSR 120

Query: 121 RREEMIEEGVAEEFVDFDEPIRQNTDNPIGRQQVDTILDEDFLLR 165
           RREEMIEEGVAE+FVDFDEPIRQNTD+ I RQQVDT+LDEDFLLR
Sbjct: 121 RREEMIEEGVAEDFVDFDEPIRQNTDSAIDRQQVDTVLDEDFLLR 165

>ZYRO0A04906g Chr1 complement(395608..396090) [483 bp, 160 aa] {ON}
           similar to uniprot|Q12157 Saccharomyces cerevisiae
           YDL008W APC11 Catalytic core subunit of the Anaphase-
           Promoting Complex/Cyclosome (APC/C) which is a
           ubiquitin- protein ligase required for degradation of
           anaphase inhibitors including mitotic cyclins during the
           metaphase/anaphase transition
          Length = 160

 Score =  189 bits (480), Expect = 8e-62,   Method: Compositional matrix adjust.
 Identities = 90/165 (54%), Positives = 113/165 (68%), Gaps = 5/165 (3%)

Query: 1   MKVKINEVHSVFAWSWHIPSTSDEDAANNDPIGNDEDEDVCGICRASYNGTCPSCKFPGD 60
           MKV I EVHSVFAW+WHIP  +      +  +  D+D+DVCGICRASYN TCPSCK+PGD
Sbjct: 1   MKVDIEEVHSVFAWTWHIPKDN-----KDGSLEADDDDDVCGICRASYNATCPSCKYPGD 55

Query: 61  QCPLVIGLCHHNFHDHCIYRWLDTPTSKGLCPMCRQTFQLQKGLAINDAHVQKFVEIVSR 120
           +C LV+G C+HNFH HCIYRWLDT TSKGLCPMCRQ FQL++GLAIND+ ++KF E+  R
Sbjct: 56  ECSLVVGECNHNFHVHCIYRWLDTTTSKGLCPMCRQLFQLKRGLAINDSQLEKFKELQLR 115

Query: 121 RREEMIEEGVAEEFVDFDEPIRQNTDNPIGRQQVDTILDEDFLLR 165
           +R     E   E+  +  E      D      Q D I+D+  ++R
Sbjct: 116 KRTNTAGEFADEDDEEAIERAMAQQDQAEVDDQGDVIMDQGLVVR 160

>TDEL0H03370 Chr8 complement(560397..560858) [462 bp, 153 aa] {ON}
           Anc_3.190 YDL008W
          Length = 153

 Score =  188 bits (477), Expect = 2e-61,   Method: Compositional matrix adjust.
 Identities = 92/165 (55%), Positives = 120/165 (72%), Gaps = 12/165 (7%)

Query: 1   MKVKINEVHSVFAWSWHIPSTSDEDAANNDPIGNDEDEDVCGICRASYNGTCPSCKFPGD 60
           MKVK+ EVHSVFAW+WHIP  S +  A+ + I +++ +DVCGICRASYN TCP CKFPGD
Sbjct: 1   MKVKLREVHSVFAWTWHIPKESQD--AHAETIDDNDGDDVCGICRASYNATCPGCKFPGD 58

Query: 61  QCPLVIGLCHHNFHDHCIYRWLDTPTSKGLCPMCRQTFQLQKGLAINDAHVQKFVEIVSR 120
            CPLV+G C+HNFH HCIYRWLDT TS+GLCPMCRQTFQL+KGLAIND+ + KF E+ ++
Sbjct: 59  GCPLVVGECNHNFHVHCIYRWLDTATSRGLCPMCRQTFQLKKGLAINDSQISKFQELRNK 118

Query: 121 RREEMIEEGVAEEFVDFDEPIRQNTDNPIGRQQVDTILDEDFLLR 165
           + +        +EF D  +P      NP+   Q D ++D+  ++R
Sbjct: 119 QWQTR-----QQEFGDQQDP----ETNPL-EDQDDPMMDQGLIVR 153

>Kpol_1045.68 s1045 complement(160584..161114) [531 bp, 176 aa] {ON}
           complement(160586..161116) [531 nt, 177 aa]
          Length = 176

 Score =  181 bits (459), Expect = 2e-58,   Method: Compositional matrix adjust.
 Identities = 91/181 (50%), Positives = 120/181 (66%), Gaps = 21/181 (11%)

Query: 1   MKVKINEVHSVFAWSWHIPSTSD--EDAANNDPIGN-------DEDEDVCGICRASYNGT 51
           MKV++ +VH VF+WSWHIP  +   E     D IG+       D++EDVCGICRAS+N T
Sbjct: 1   MKVEVKKVHCVFSWSWHIPKNAGTIESGLGEDAIGDIHGMVHEDDEEDVCGICRASFNRT 60

Query: 52  CPSCKFPGDQCPLVIGLCHHNFHDHCIYRWLDTPTSKGLCPMCRQTFQLQKGLAINDAHV 111
           CP+CKFPGD CPLVIG C HNFH HCIY WLDT TS+GLCPMCRQ FQL+KG++IND+H+
Sbjct: 61  CPNCKFPGDGCPLVIGECQHNFHVHCIYEWLDTSTSRGLCPMCRQLFQLKKGVSINDSHI 120

Query: 112 QKFVEIVSRRREEMIE-------EGVAEEFVDFDEPIRQNTDNPIGRQQVDTILDEDFLL 164
           ++F E+  +R++E  E       +      +   E   +N DN     Q D I+D+D ++
Sbjct: 121 ERFRELAIKRQQEQNEFESNLDDDAAIARAIAEQEDTGRNVDN-----QGDIIMDQDLVV 175

Query: 165 R 165
           R
Sbjct: 176 R 176

>AER016C Chr5 complement(659572..660015) [444 bp, 147 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDL008W
           (APC11)
          Length = 147

 Score =  165 bits (417), Expect = 2e-52,   Method: Compositional matrix adjust.
 Identities = 76/164 (46%), Positives = 107/164 (65%), Gaps = 19/164 (11%)

Query: 1   MKVKINEVHSVFAWSWHIPSTSDEDAANNDPIGNDEDE-DVCGICRASYNGTCPSCKFPG 59
           M+++IN +  V +W W +P     D+    P+  DEDE DVCGICR SYNGTCP+CK PG
Sbjct: 1   MQLQINNIQCVASWYWDVPKELKRDS----PVYEDEDEEDVCGICRGSYNGTCPNCKLPG 56

Query: 60  DQCPLVIGLCHHNFHDHCIYRWLDTPTSKGLCPMCRQTFQLQKGLAINDAHVQKFVEIVS 119
           + CPL++G CHHNFH HCIY+WL+T TSKGLCPMCRQ F L++G+ IN+ H  KF +++ 
Sbjct: 57  ETCPLIVGSCHHNFHVHCIYQWLNTSTSKGLCPMCRQAFSLREGIRINEPHRDKFEKVLM 116

Query: 120 RRREEMIEEGVAEEFVDFDEPIRQNTDNPIGRQQVDTILDEDFL 163
           + R++ +              +     NP+G  Q D I+D++F+
Sbjct: 117 KARQQSV--------------VSVAGANPVGPDQDDVIIDQEFI 146

>SAKL0C10516g Chr3 (956666..957100) [435 bp, 144 aa] {ON} similar to
           uniprot|Q12157 Saccharomyces cerevisiae YDL008W APC11
           Catalytic core subunit of the Anaphase- Promoting
           Complex/Cyclosome (APC/C) which is a ubiquitin- protein
           ligase required for degradation of anaphase inhibitors
           including mitotic cyclins during the metaphase/anaphase
           transition
          Length = 144

 Score =  157 bits (398), Expect = 1e-49,   Method: Compositional matrix adjust.
 Identities = 82/171 (47%), Positives = 111/171 (64%), Gaps = 33/171 (19%)

Query: 1   MKVKINEVHSVFAWSWHIP--STSDEDAANNDPIGNDEDEDVCGICRASYNGTCPSCKFP 58
           MKV + +VH+V +WSWHIP   T   +AA       D +EDVCGICR SYNGTCPSCK+P
Sbjct: 1   MKVVVKKVHAVCSWSWHIPRDGTHQHEAA-------DTEEDVCGICRVSYNGTCPSCKYP 53

Query: 59  GDQCPLVIGLCHHNFHDHCIYRWLDTPTSKGLCPMCRQTFQLQKGLAINDAHVQKFVEIV 118
           GD+CPLV+G C+HNFH HCI +WLDT TS+GLCPMCRQ F L++G+AIND+ +  F +++
Sbjct: 54  GDECPLVVGECNHNFHVHCIVQWLDTATSRGLCPMCRQLFSLKRGVAINDSQLDHFAKLL 113

Query: 119 SRRRE----EMIEEGVAEEFVDFDEPIRQNTDNPIGRQQVDTILDEDFLLR 165
           ++       E+   G+AEE                     D ++++DFL+R
Sbjct: 114 NKVNRAGATELANAGLAEE--------------------QDLMMEQDFLVR 144

>KNAG0J01250 Chr10 complement(225063..225671) [609 bp, 202 aa] {ON}
           Anc_3.190 YDL008W
          Length = 202

 Score =  158 bits (400), Expect = 5e-49,   Method: Compositional matrix adjust.
 Identities = 80/148 (54%), Positives = 90/148 (60%), Gaps = 25/148 (16%)

Query: 1   MKVKINEVHSVFAWSWHIPSTSDEDAA----------------------NNDPIGNDEDE 38
           MK+ I  V+ VF WSW    T D  AA                      N + +  DEDE
Sbjct: 1   MKLDIKRVNPVFTWSW---DTRDPAAAKDRQYPFLYNYYPVDVEKAHLENGNAVDGDEDE 57

Query: 39  DVCGICRASYNGTCPSCKFPGDQCPLVIGLCHHNFHDHCIYRWLDTPTSKGLCPMCRQTF 98
           DVCGICRASYNGTCPSCK PGD CPLV GLCHH+FH HCI+RWLDT TSKGLCPMCRQ F
Sbjct: 58  DVCGICRASYNGTCPSCKIPGDSCPLVAGLCHHHFHYHCIFRWLDTNTSKGLCPMCRQQF 117

Query: 99  QLQKGLAINDAHVQKFVEIVSRRREEMI 126
           QL   L IN  +++KF  I    RE + 
Sbjct: 118 QLNSKLPINRPYLEKFESITKAIRERVF 145

>KLTH0G16082g Chr7 (1407117..1407524) [408 bp, 135 aa] {ON} some
           similarities with uniprot|Q12157 Saccharomyces
           cerevisiae YDL008W APC11 Catalytic core subunit of the
           Anaphase-Promoting Complex/Cyclosome (APC/C) which is a
           ubiquitin-protein ligase required for degradation of
           anaphase inhibitors including mitotic cyclins during the
           metaphase/anaphase transition
          Length = 135

 Score =  156 bits (394), Expect = 5e-49,   Method: Compositional matrix adjust.
 Identities = 72/142 (50%), Positives = 96/142 (67%), Gaps = 7/142 (4%)

Query: 1   MKVKINEVHSVFAWSWHIPSTSDEDAANNDPIGNDEDEDVCGICRASYNGTCPSCKFPGD 60
           M+++  +V+ VF+WSW IP   D D      IG   DED+CGICR SYNGTCP CK+PGD
Sbjct: 1   MQLEFKKVYPVFSWSWDIPGDDDADRE----IG---DEDLCGICRVSYNGTCPGCKYPGD 53

Query: 61  QCPLVIGLCHHNFHDHCIYRWLDTPTSKGLCPMCRQTFQLQKGLAINDAHVQKFVEIVSR 120
            CPLVIG C+HNFH HCI +WL TPT+KGLCPMCRQ F L++G+AIN+  V+K   ++ +
Sbjct: 54  NCPLVIGECNHNFHVHCIQQWLATPTAKGLCPMCRQQFSLKRGVAINEGQVEKLANLLLQ 113

Query: 121 RREEMIEEGVAEEFVDFDEPIR 142
            R   +     +  +D +  +R
Sbjct: 114 PRPAALAADDQDMMMDQEFAVR 135

>KAFR0A01240 Chr1 (241805..242326) [522 bp, 173 aa] {ON} Anc_3.190
           YDL008W
          Length = 173

 Score =  157 bits (396), Expect = 8e-49,   Method: Compositional matrix adjust.
 Identities = 72/136 (52%), Positives = 95/136 (69%), Gaps = 4/136 (2%)

Query: 1   MKVKINEVHSVFAWSWHIPSTSDEDAANNDPIGN---DEDEDVCGICRASYNGTCPSCKF 57
           MKV + +++ V+AWSW I +   E  ++   + +    E +DVCGICRASYNGTCPSCK 
Sbjct: 1   MKVTVKKIYPVYAWSWDIVTRKGEQKSDVYSVLDKYRSEKDDVCGICRASYNGTCPSCKI 60

Query: 58  PGDQCPLVIGLCHHNFHDHCIYRWLDTPTSKGLCPMCRQTFQLQKGLAINDAHVQKFVEI 117
           PG  CPL++G C+HNFH HCI+RWL+T  SKGLCPMCRQ F+L K L IN  ++QKF E+
Sbjct: 61  PGTMCPLIVGSCNHNFHYHCIFRWLNTLNSKGLCPMCRQEFKLDKKLVINSDYLQKF-EV 119

Query: 118 VSRRREEMIEEGVAEE 133
           ++R+  E     V EE
Sbjct: 120 LARKNRERRALNVDEE 135

>CAGL0I04576g Chr9 (408872..409321) [450 bp, 149 aa] {ON} similar to
           uniprot|Q12157 Saccharomyces cerevisiae YDL008w APC11
           subunit of the anaphase promoting complex
          Length = 149

 Score =  154 bits (389), Expect = 4e-48,   Method: Compositional matrix adjust.
 Identities = 72/139 (51%), Positives = 92/139 (66%), Gaps = 4/139 (2%)

Query: 1   MKVKINEVHSVFAWSWHIPSTSDEDAANNDPIGNDEDEDVCGICRASYNGTCPSCKFPGD 60
           M++++ EVH VF W W IP   D      D    DEDEDVCGICRASY+  CP+C++PG+
Sbjct: 1   MRIELTEVHGVFNWVWDIPKNED----RLDESMADEDEDVCGICRASYHAPCPNCRYPGE 56

Query: 61  QCPLVIGLCHHNFHDHCIYRWLDTPTSKGLCPMCRQTFQLQKGLAINDAHVQKFVEIVSR 120
            C +V+G C HNFH HCI RW+DTPTSKGLCPMCRQ FQL +   IN+ H+  F EI  +
Sbjct: 57  SCAIVLGRCGHNFHVHCISRWVDTPTSKGLCPMCRQKFQLLQRTKINEPHIPLFKEIEIK 116

Query: 121 RREEMIEEGVAEEFVDFDE 139
           R  ++ EE  A  +   +E
Sbjct: 117 RYRQLQEEIEAGNYDALEE 135

>TPHA0H00640 Chr8 (126792..127334) [543 bp, 180 aa] {ON} Anc_3.190
           YDL008W
          Length = 180

 Score =  152 bits (383), Expect = 7e-47,   Method: Compositional matrix adjust.
 Identities = 84/181 (46%), Positives = 107/181 (59%), Gaps = 17/181 (9%)

Query: 1   MKVKINEVHSVFAWSWHIP---------------STSDEDAANNDPIGNDEDEDVCGICR 45
           MKV+I  V+ VFAW W IP               S SD D    +    D++ED CGICR
Sbjct: 1   MKVQIKNVNGVFAWGWQIPKHDQKVKKDHNNSIVSGSDVDHQEQNSDDEDDEEDFCGICR 60

Query: 46  ASYNGTCPSCKFPGDQCPLVIGLCHHNFHDHCIYRWLDTPTSKGLCPMCRQTFQLQKGLA 105
           AS+   CP+CKFP D CP+VIG C HNFH HCI+ WL+T  S+GLCPMCRQ F+L+KG+ 
Sbjct: 61  ASFIRACPNCKFPSDGCPIVIGKCKHNFHVHCIFEWLETEASRGLCPMCRQVFELRKGVV 120

Query: 106 INDAHVQKFVEIVSRRREEMIE-EGVAEEFVDFDEPIRQNTDNPIGRQQVDTILDEDFLL 164
           IND H   F E++ +R++E  E E  AE+       I     N  G   VD ILD+D ++
Sbjct: 121 INDLHYVTFKELILKRQKEQNEFEATAEDDEALARMIAAQEGNN-GDVPVDDILDQDMVV 179

Query: 165 R 165
           R
Sbjct: 180 R 180

>NDAI0A06520 Chr1 (1482275..1482895) [621 bp, 206 aa] {ON} Anc_3.190
           YDL008W
          Length = 206

 Score =  152 bits (384), Expect = 1e-46,   Method: Compositional matrix adjust.
 Identities = 71/142 (50%), Positives = 91/142 (64%), Gaps = 12/142 (8%)

Query: 1   MKVKINEVHSVFAWSWHIPST-----SDEDAANNDPIG-------NDEDEDVCGICRASY 48
           MK+++  ++ + AWSW +P       SDE    ND  G        +  +DVCGICRASY
Sbjct: 1   MKIEVQNIYPLVAWSWDMPKNLDDPDSDEPDNANDSYGIRRRAPNKNAVDDVCGICRASY 60

Query: 49  NGTCPSCKFPGDQCPLVIGLCHHNFHDHCIYRWLDTPTSKGLCPMCRQTFQLQKGLAIND 108
           NGTCP+CKFPG  CPLV+G C+HNFH HCIY+WL T TSKGLCPMCRQ F+L+    +N 
Sbjct: 61  NGTCPNCKFPGTDCPLVLGRCNHNFHFHCIYQWLKTLTSKGLCPMCRQKFRLKPNATVNT 120

Query: 109 AHVQKFVEIVSRRREEMIEEGV 130
            H+  F E+    R  +I EG+
Sbjct: 121 DHLGAFKELAITTRARLISEGL 142

>Kwal_56.23112 s56 complement(406291..406698) [408 bp, 135 aa] {ON}
           YDL008W (APC11) - subunit of the anaphase promoting
           complex (APC) [contig 183] FULL
          Length = 135

 Score =  149 bits (376), Expect = 2e-46,   Method: Compositional matrix adjust.
 Identities = 66/122 (54%), Positives = 88/122 (72%), Gaps = 7/122 (5%)

Query: 1   MKVKINEVHSVFAWSWHIPSTSDEDAANNDPIGNDEDEDVCGICRASYNGTCPSCKFPGD 60
           MK++  +V+ VF+WSW IP   + D      IG   DED+CGICR SYNGTCP C+FPGD
Sbjct: 1   MKIEFKKVYPVFSWSWDIPGDDNADKE----IG---DEDLCGICRVSYNGTCPGCRFPGD 53

Query: 61  QCPLVIGLCHHNFHDHCIYRWLDTPTSKGLCPMCRQTFQLQKGLAINDAHVQKFVEIVSR 120
            CPLVIG C+HNFH HCI +WL+T T+KGLCPMCRQ F L++G+AIN+  +    +++ +
Sbjct: 54  NCPLVIGECNHNFHVHCIQQWLETATAKGLCPMCRQQFSLKRGVAINECQMDSLAKLLLQ 113

Query: 121 RR 122
            +
Sbjct: 114 SQ 115

>Ecym_5312 Chr5 complement(632833..633279) [447 bp, 148 aa] {ON}
           similar to Ashbya gossypii AER016C
          Length = 148

 Score =  146 bits (368), Expect = 6e-45,   Method: Compositional matrix adjust.
 Identities = 66/126 (52%), Positives = 92/126 (73%), Gaps = 3/126 (2%)

Query: 1   MKVKINEVHSVFAWSWHIPSTSDEDAANNDPIGNDEDEDVCGICRASYNGTCPSCKFPGD 60
           M+++I  V  V +W W +P     D    +   +++DEDVCGICRASYNGTCP+CK PG+
Sbjct: 1   MQLQIKNVQCVASWYWDVPKELKRDLHEGE---DEDDEDVCGICRASYNGTCPNCKLPGE 57

Query: 61  QCPLVIGLCHHNFHDHCIYRWLDTPTSKGLCPMCRQTFQLQKGLAINDAHVQKFVEIVSR 120
            CPL++G CHHNFH HCIY+WL+T TSKGLCPMCRQ F L+ G+ IN+ H +KF +++ +
Sbjct: 58  TCPLIVGSCHHNFHVHCIYQWLNTSTSKGLCPMCRQAFSLRDGIRINEPHKEKFEKVLMK 117

Query: 121 RREEMI 126
            R++ +
Sbjct: 118 ARQQNV 123

>TBLA0A00260 Chr1 complement(38358..38912) [555 bp, 184 aa] {ON}
           Anc_3.190 YDL008W
          Length = 184

 Score =  145 bits (366), Expect = 4e-44,   Method: Compositional matrix adjust.
 Identities = 70/147 (47%), Positives = 94/147 (63%), Gaps = 11/147 (7%)

Query: 1   MKVKINEVHSVFAWSWHIPSTSDEDAANNDPIG---------NDEDEDVCGICRASYNGT 51
           MK+++  ++ VFAW W IP+ +         +G          DEDEDVCGICR +YN T
Sbjct: 1   MKIEVKGIYPVFAWKWDIPNDNHFIQNKERELGIDYSSGHNMVDEDEDVCGICRFNYNRT 60

Query: 52  CPSCKFPGDQCPLVIGLCHHNFHDHCIYRWLDTPTSKGLCPMCRQTFQLQKGLAINDAHV 111
           CP+CK PG +CPLV+G C HNFH HCIY+WLDT TSKGLCPMCRQ F+L++G+A+N +  
Sbjct: 61  CPNCKVPGKRCPLVVGNCFHNFHVHCIYKWLDTTTSKGLCPMCRQEFKLKEGVALNKSQE 120

Query: 112 QKFVEIVSRRREEMIEEGVAEEFVDFD 138
             F  +  ++  +    G  +E VD D
Sbjct: 121 DVFKSLELKQARQRF--GAFDEDVDVD 145

>KLLA0E17711g Chr5 complement(1571018..1571506) [489 bp, 162 aa]
           {ON} similar to uniprot|Q12157 Saccharomyces cerevisiae
           YDL008W APC11 Catalytic core subunit of the Anaphase-
           Promoting Complex/Cyclosome (APC/C) which is a
           ubiquitin- protein ligase required for degradation of
           anaphase inhibitors including mitotic cyclins during the
           metaphase/anaphase transition
          Length = 162

 Score =  123 bits (309), Expect = 9e-36,   Method: Compositional matrix adjust.
 Identities = 60/150 (40%), Positives = 86/150 (57%), Gaps = 18/150 (12%)

Query: 1   MKVKINEVHSVFAWSWHIPS--TSDEDAANNDPIGNDEDED----------------VCG 42
           M++++ +V  V  W+W IP   +  +    +  +  ++ ED                VCG
Sbjct: 1   MRIEVTDVSLVSTWAWDIPKDLSKGKHGVADQTVHMEKWEDIQNEDEDAENDEEEYEVCG 60

Query: 43  ICRASYNGTCPSCKFPGDQCPLVIGLCHHNFHDHCIYRWLDTPTSKGLCPMCRQTFQLQK 102
           ICR  Y+ TCPSC +PG  CP+V+GLC+HNFH HCI +WL T TSKGLCP+CRQ FQL+ 
Sbjct: 61  ICRNRYDATCPSCDYPGSGCPIVLGLCNHNFHVHCIKQWLSTETSKGLCPLCRQGFQLRP 120

Query: 103 GLAINDAHVQKFVEIVSRRREEMIEEGVAE 132
            + IN  H  +F +++   R+  I  G  E
Sbjct: 121 NVLINKMHHDEFQKLLMSVRQHNIPMGGGE 150

>NCAS0I01920 Chr9 (352307..352693) [387 bp, 128 aa] {ON} Anc_3.190
           YDL008W
          Length = 128

 Score =  107 bits (266), Expect = 8e-30,   Method: Compositional matrix adjust.
 Identities = 51/112 (45%), Positives = 69/112 (61%), Gaps = 5/112 (4%)

Query: 1   MKVKINEVHSVFAWSWHIPSTSDED-----AANNDPIGNDEDEDVCGICRASYNGTCPSC 55
           MK+++ EV+ VF WSW I S +++          +   +D+D++VCGICRA YN  CPSC
Sbjct: 1   MKLEVREVYPVFEWSWDITSETEQQQNHEPEEQPEDDDDDDDDEVCGICRAGYNAVCPSC 60

Query: 56  KFPGDQCPLVIGLCHHNFHDHCIYRWLDTPTSKGLCPMCRQTFQLQKGLAIN 107
             PG  CP+V+G C H FH HC+  WL T  ++G CPMCRQ F L     +N
Sbjct: 61  SHPGVTCPVVVGTCQHAFHVHCVVPWLATAAARGACPMCRQPFALDPLRRVN 112

>TBLA0I01960 Chr9 complement(444753..445291,445364..445379) [555 bp,
           184 aa] {ON} Anc_3.279 YBR062C
          Length = 184

 Score = 46.6 bits (109), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 29/77 (37%), Positives = 39/77 (50%), Gaps = 15/77 (19%)

Query: 38  EDVCGICRASYNGTCPSCKFPGDQCPLVIGL--CHHNFHDHCIYRWLDTPTSKGLCPMCR 95
           +++C ICR         CKF  D  PL+I L  C H F   CI  WL   +S   CP+CR
Sbjct: 112 DEICSICR---------CKFFDDDYPLIIELPNCKHYFDLECITLWLQKNSS---CPICR 159

Query: 96  QTFQLQKGLAINDAHVQ 112
               L+K   I+D+ V+
Sbjct: 160 NDV-LEKKFKIDDSQVE 175

>KLTH0F19228g Chr6 complement(1556655..1556987) [333 bp, 110 aa]
           {ON} similar to uniprot|Q08273 Saccharomyces cerevisiae
           YOL133W HRT1 RING finger containing subunit of
           Skp1-Cullin- F-box ubiquitin protein ligases (SCF)
           required for Gic2p Far1p Sic1p and Cln2p degradation may
           tether Cdc34p (a ubiquitin conjugating enzyme or E2) and
           Cdc53p (a cullin) subunits of SCF
          Length = 110

 Score = 45.1 bits (105), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 24/67 (35%), Positives = 32/67 (47%), Gaps = 8/67 (11%)

Query: 41  CGICRASYNGTCPSCKFPG-----DQCPLVIGLCHHNFHDHCIYRWLDTPTSKGLCPMCR 95
           C ICR      C  C+        ++C    G C+H FH HCI +WL T   +  CP+  
Sbjct: 44  CAICRNHIMEPCIQCQPTAMTDTDNECVAAWGACNHAFHLHCINKWLQT---RNACPLDN 100

Query: 96  QTFQLQK 102
           QT+Q  K
Sbjct: 101 QTWQFAK 107

>KAFR0C01780 Chr3 complement(363161..363517) [357 bp, 118 aa] {ON}
           Anc_3.28 YOL133W
          Length = 118

 Score = 44.3 bits (103), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 24/69 (34%), Positives = 35/69 (50%), Gaps = 8/69 (11%)

Query: 39  DVCGICRASYNGTCPSCKF-----PGDQCPLVIGLCHHNFHDHCIYRWLDTPTSKGLCPM 93
           D C ICR      C  C+      P ++C    G+C+H FH HCI +W+ T   +  CP+
Sbjct: 50  DNCAICRNHIMEPCIECQPKAMTDPDNECVAAWGVCNHAFHLHCINKWIKT---RDACPL 106

Query: 94  CRQTFQLQK 102
             Q +QL +
Sbjct: 107 DNQPWQLAR 115

>YOL133W Chr15 (70325..70690) [366 bp, 121 aa] {ON}  HRT1RING finger
           containing subunit of Skp1-Cullin-F-box ubiquitin
           protein ligases (SCF); required for Gic2p, Far1p, Sic1p
           and Cln2p degradation; may tether Cdc34p (a ubiquitin
           conjugating enzyme or E2) and Cdc53p (a cullin) subunits
           of SCF
          Length = 121

 Score = 43.9 bits (102), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 23/69 (33%), Positives = 34/69 (49%), Gaps = 8/69 (11%)

Query: 39  DVCGICRASYNGTCPSCKFPG-----DQCPLVIGLCHHNFHDHCIYRWLDTPTSKGLCPM 93
           D C ICR      C  C+        ++C    G+C+H FH HCI +W+ T   +  CP+
Sbjct: 53  DNCAICRNHIMEPCIECQPKAMTDTDNECVAAWGVCNHAFHLHCINKWIKT---RDACPL 109

Query: 94  CRQTFQLQK 102
             Q +QL +
Sbjct: 110 DNQPWQLAR 118

>Smik_15.20 Chr15 (38383..38748) [366 bp, 121 aa] {ON} YOL133W
           (REAL)
          Length = 121

 Score = 43.9 bits (102), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 23/69 (33%), Positives = 34/69 (49%), Gaps = 8/69 (11%)

Query: 39  DVCGICRASYNGTCPSCKFPG-----DQCPLVIGLCHHNFHDHCIYRWLDTPTSKGLCPM 93
           D C ICR      C  C+        ++C    G+C+H FH HCI +W+ T   +  CP+
Sbjct: 53  DNCAICRNHIMEPCIECQPKAMTDTDNECVAAWGVCNHAFHLHCINKWIKT---RDACPL 109

Query: 94  CRQTFQLQK 102
             Q +QL +
Sbjct: 110 DNQPWQLAR 118

>Suva_15.26 Chr15 (48168..48536) [369 bp, 122 aa] {ON} YOL133W
           (REAL)
          Length = 122

 Score = 43.9 bits (102), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 23/69 (33%), Positives = 34/69 (49%), Gaps = 8/69 (11%)

Query: 39  DVCGICRASYNGTCPSCKFPG-----DQCPLVIGLCHHNFHDHCIYRWLDTPTSKGLCPM 93
           D C ICR      C  C+        ++C    G+C+H FH HCI +W+ T   +  CP+
Sbjct: 54  DNCAICRNHIMEPCIECQPKAMTDTDNECVAAWGVCNHAFHLHCINKWIKT---RDACPL 110

Query: 94  CRQTFQLQK 102
             Q +QL +
Sbjct: 111 DNQPWQLAR 119

>NDAI0G03860 Chr7 (925672..926043) [372 bp, 123 aa] {ON} Anc_3.28
           YOL133W
          Length = 123

 Score = 43.9 bits (102), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 23/69 (33%), Positives = 34/69 (49%), Gaps = 8/69 (11%)

Query: 39  DVCGICRASYNGTCPSCKFPG-----DQCPLVIGLCHHNFHDHCIYRWLDTPTSKGLCPM 93
           D C ICR      C  C+        ++C    G+C+H FH HCI +W+ T   +  CP+
Sbjct: 55  DNCAICRNHIMEPCIECQPKAMTDTDNECVAAWGVCNHAFHLHCINKWIQT---RDACPL 111

Query: 94  CRQTFQLQK 102
             Q +QL +
Sbjct: 112 DNQPWQLAR 120

>Skud_15.20 Chr15 (35550..35915) [366 bp, 121 aa] {ON} YOL133W
           (REAL)
          Length = 121

 Score = 43.5 bits (101), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 29/106 (27%), Positives = 44/106 (41%), Gaps = 26/106 (24%)

Query: 2   KVKINEVHSVFAWSWHIPSTSDEDAANNDPIGNDEDEDVCGICRASYNGTCPSCKFPG-- 59
           + +I +  +V  WSW I                    D C ICR      C  C+     
Sbjct: 34  RFEIKKWTAVAFWSWDIAV------------------DNCAICRNHIMEPCIECQPKAMT 75

Query: 60  ---DQCPLVIGLCHHNFHDHCIYRWLDTPTSKGLCPMCRQTFQLQK 102
              ++C    G+C+H FH HCI +W+ T   +  CP+  Q +QL +
Sbjct: 76  DTDNECVAAWGVCNHAFHLHCINKWIKT---RDACPLDNQPWQLAR 118

>NCAS0C04480 Chr3 (919123..919452) [330 bp, 109 aa] {ON} Anc_3.28
          Length = 109

 Score = 43.1 bits (100), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 30/106 (28%), Positives = 43/106 (40%), Gaps = 26/106 (24%)

Query: 2   KVKINEVHSVFAWSWHIPSTSDEDAANNDPIGNDEDEDVCGICRASYNGTCPSCKFPG-- 59
           K +I +  +V  WSW I                    D C ICR      C  C+     
Sbjct: 22  KFEIKKWTAVAFWSWDIAV------------------DNCAICRNHIMEPCIECQPKAMT 63

Query: 60  ---DQCPLVIGLCHHNFHDHCIYRWLDTPTSKGLCPMCRQTFQLQK 102
              ++C    G C+H FH HCI +W+ T   +  CP+  Q +QL +
Sbjct: 64  DTDNECVAAWGTCNHAFHLHCINKWIKT---RDACPLDNQPWQLAR 106

>SAKL0C13178g Chr3 complement(1166576..1166992) [417 bp, 138 aa]
           {ON} similar to uniprot|Q08273 Saccharomyces cerevisiae
           YOL133W HRT1 RING finger containing subunit of
           Skp1-Cullin- F-box ubiquitin protein ligases (SCF)
           required for Gic2p Far1p Sic1p and Cln2p degradation may
           tether Cdc34p (a ubiquitin conjugating enzyme or E2) and
           Cdc53p (a cullin) subunits of SCF
          Length = 138

 Score = 43.5 bits (101), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 23/67 (34%), Positives = 31/67 (46%), Gaps = 8/67 (11%)

Query: 41  CGICRASYNGTCPSCKFPG-----DQCPLVIGLCHHNFHDHCIYRWLDTPTSKGLCPMCR 95
           C ICR      C  C+        ++C    G C+H FH HCI +WL T   +  CP+  
Sbjct: 72  CAICRNHIMEPCIQCQPTAMTDTDNECVAAWGTCNHAFHLHCINKWLQT---RNACPLDN 128

Query: 96  QTFQLQK 102
           Q +Q  K
Sbjct: 129 QPWQFAK 135

>Ecym_2029 Chr2 (47083..47427) [345 bp, 114 aa] {ON} similar to
           Ashbya gossypii ADL181W
          Length = 114

 Score = 43.1 bits (100), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 30/106 (28%), Positives = 43/106 (40%), Gaps = 26/106 (24%)

Query: 2   KVKINEVHSVFAWSWHIPSTSDEDAANNDPIGNDEDEDVCGICRASYNGTCPSCKFPG-- 59
           K +I +  +V  WSW I   +                  C ICR      C  C+     
Sbjct: 27  KFQIKKWTAVAFWSWDIAVEN------------------CAICRNHIMEPCIQCQPNAMT 68

Query: 60  ---DQCPLVIGLCHHNFHDHCIYRWLDTPTSKGLCPMCRQTFQLQK 102
              ++C    G C+H FH HCI +WL T   +  CP+  +T+Q  K
Sbjct: 69  DTDNECVAAWGTCNHAFHLHCINKWLLT---RNACPLDNKTWQFAK 111

>ZYRO0C03058g Chr3 complement(236925..237275) [351 bp, 116 aa] {ON}
           highly similar to uniprot|Q08273 Saccharomyces
           cerevisiae YOL133W HRT1 RING finger containing subunit
           of Skp1-Cullin-F-box ubiquitin protein ligases (SCF)
           required for Gic2p Far1p Sic1p and Cln2p degradation may
           tether Cdc34p (a ubiquitin conjugating enzyme or E2) and
           Cdc53p (a cullin) subunits of SCF
          Length = 116

 Score = 43.1 bits (100), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 30/106 (28%), Positives = 44/106 (41%), Gaps = 26/106 (24%)

Query: 2   KVKINEVHSVFAWSWHIPSTSDEDAANNDPIGNDEDEDVCGICRASYNGTCPSCKFPG-- 59
           K +I +  +V  WSW I                    D C ICR      C  C+     
Sbjct: 29  KFEIKKWTAVAFWSWDIAV------------------DNCAICRNHIMEPCIECQPMAMT 70

Query: 60  ---DQCPLVIGLCHHNFHDHCIYRWLDTPTSKGLCPMCRQTFQLQK 102
              ++C    G+C+H FH HCI +W+ T   +  CP+  Q +QL +
Sbjct: 71  DTDNECVAAWGVCNHAFHLHCINKWIKT---RDACPLDNQPWQLAR 113

>KNAG0A01280 Chr1 (27372..27716) [345 bp, 114 aa] {ON} Anc_3.28
           YOL133W
          Length = 114

 Score = 42.4 bits (98), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 30/106 (28%), Positives = 42/106 (39%), Gaps = 26/106 (24%)

Query: 2   KVKINEVHSVFAWSWHIPSTSDEDAANNDPIGNDEDEDVCGICRASYNGTCPSCKFPG-- 59
           K +I +  +V  WSW I                    D C ICR      C  C+     
Sbjct: 27  KFQIKKWTAVAFWSWDIAV------------------DNCAICRNHIMEPCIECQPKAMT 68

Query: 60  ---DQCPLVIGLCHHNFHDHCIYRWLDTPTSKGLCPMCRQTFQLQK 102
              ++C    G C H FH HCI +W+ T   +  CP+  Q +QL +
Sbjct: 69  DTDNECVAAWGACGHAFHLHCINKWIKT---RDACPLDNQPWQLAR 111

>Kpol_1014.16 s1014 complement(29615..29938) [324 bp, 107 aa] {ON}
           complement(29615..29938) [324 nt, 108 aa]
          Length = 107

 Score = 42.0 bits (97), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 23/69 (33%), Positives = 33/69 (47%), Gaps = 8/69 (11%)

Query: 39  DVCGICRASYNGTCPSCKFPG-----DQCPLVIGLCHHNFHDHCIYRWLDTPTSKGLCPM 93
           D C ICR      C  C+        ++C    G C+H FH HCI +W+ T   +  CP+
Sbjct: 39  DNCAICRNHIMEPCIECQPNAMTETDNECVAAWGTCNHAFHLHCINKWIKT---RDACPL 95

Query: 94  CRQTFQLQK 102
             Q +QL +
Sbjct: 96  DNQPWQLAR 104

>KLLA0C14344g Chr3 (1245226..1249782) [4557 bp, 1518 aa] {ON} similar
            to uniprot|Q04781 Saccharomyces cerevisiae YMR247C
            Hypothetical ORF
          Length = 1518

 Score = 43.1 bits (100), Expect = 1e-04,   Method: Composition-based stats.
 Identities = 17/47 (36%), Positives = 25/47 (53%), Gaps = 5/47 (10%)

Query: 56   KFPGDQCPLVIGLCHHNFHDHCIYRWLDTPTSKGLCPMCRQTFQLQK 102
            K P   CP     C++ FH  C+Y+W  + +    CP+CR  F L+K
Sbjct: 1477 KLPTKVCPT----CNNRFHGACLYKWFKS-SGNNTCPLCRGEFNLRK 1518

>ADL181W Chr4 (379682..380008) [327 bp, 108 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YOL133W (HRT1)
          Length = 108

 Score = 41.2 bits (95), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 23/67 (34%), Positives = 32/67 (47%), Gaps = 8/67 (11%)

Query: 41  CGICRASYNGTCPSCKFPG-----DQCPLVIGLCHHNFHDHCIYRWLDTPTSKGLCPMCR 95
           C ICR      C  C+        ++C    G C+H FH HCI +WL T   +  CP+  
Sbjct: 42  CAICRNHIMEPCIQCQPNAMTDTENECVAAWGTCNHAFHLHCINKWLLT---RNACPLDN 98

Query: 96  QTFQLQK 102
           +T+Q  K
Sbjct: 99  KTWQFAK 105

>TPHA0I00590 Chr9 (117658..122433) [4776 bp, 1591 aa] {ON} Anc_8.799
            YMR247C
          Length = 1591

 Score = 43.1 bits (100), Expect = 1e-04,   Method: Composition-based stats.
 Identities = 18/62 (29%), Positives = 31/62 (50%), Gaps = 7/62 (11%)

Query: 41   CGICRASYNGTCPSCKFPGDQCPLVIGLCHHNFHDHCIYRWLDTPTSKGLCPMCRQTFQL 100
            C IC ++ +      K P   CP     C++ FH  C+Y+W  + ++   CP+CR    L
Sbjct: 1537 CAICYSTLHAV--DRKLPTKVCPT----CNNKFHGSCLYKWFRS-SNNNTCPLCRSEIAL 1589

Query: 101  QK 102
            ++
Sbjct: 1590 RR 1591

>Kwal_55.22054 s55 complement(1091138..1091473) [336 bp, 111 aa]
           {ON} YOL133W (HRT1) - subunit of Skp1-Cullin-F-box
           ubiquitin protein ligase (SCF) [contig 124] FULL
          Length = 111

 Score = 40.8 bits (94), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 22/67 (32%), Positives = 30/67 (44%), Gaps = 8/67 (11%)

Query: 41  CGICRASYNGTCPSCKFPG-----DQCPLVIGLCHHNFHDHCIYRWLDTPTSKGLCPMCR 95
           C ICR      C  C+        ++C    G C+H FH HCI +WL T   +  CP+  
Sbjct: 45  CAICRNHIMEPCIQCQPTAMTDTDNECVAAWGTCNHAFHLHCINKWLQT---RNACPLDN 101

Query: 96  QTFQLQK 102
           Q +   K
Sbjct: 102 QPWSFAK 108

>CAGL0E01567g Chr5 (148425..148733) [309 bp, 102 aa] {ON} similar to
           uniprot|Q08273 Saccharomyces cerevisiae YOL133w HRT1
           RING-box protein
          Length = 102

 Score = 40.4 bits (93), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 29/106 (27%), Positives = 42/106 (39%), Gaps = 26/106 (24%)

Query: 2   KVKINEVHSVFAWSWHIPSTSDEDAANNDPIGNDEDEDVCGICRASYNGTCPSCKFPG-- 59
           K +I +  +V  WSW I                    D C ICR      C  C+     
Sbjct: 15  KFQIKKWTAVAFWSWDIAV------------------DNCAICRNHIMEPCIECQPKAMT 56

Query: 60  ---DQCPLVIGLCHHNFHDHCIYRWLDTPTSKGLCPMCRQTFQLQK 102
              ++C    G C+H FH HCI +W+ T   +  CP+  Q + L +
Sbjct: 57  DTDNECVAAWGTCNHAFHLHCINKWIKT---RDACPLDNQPWHLAR 99

>KLLA0E07151g Chr5 (651474..651806) [333 bp, 110 aa] {ON} similar to
           uniprot|Q08273 Saccharomyces cerevisiae YOL133W HRT1
           RING finger containing subunit of Skp1-Cullin- F-box
           ubiquitin protein ligases (SCF) required for Gic2p Far1p
           Sic1p and Cln2p degradation may tether Cdc34p (a
           ubiquitin conjugating enzyme or E2) and Cdc53p (a
           cullin) subunits of SCF
          Length = 110

 Score = 40.4 bits (93), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 23/73 (31%), Positives = 36/73 (49%), Gaps = 8/73 (10%)

Query: 35  DEDEDVCGICRASYNGTCPSCKFPGD-----QCPLVIGLCHHNFHDHCIYRWLDTPTSKG 89
           D D D C ICR      C +C+         +C    G C+H FH HCI +W+    S+ 
Sbjct: 38  DIDVDNCAICRNHIMEPCVNCQQEATFNSEHECVAAWGECNHAFHLHCITQWIK---SRN 94

Query: 90  LCPMCRQTFQLQK 102
           +CP+  + ++L +
Sbjct: 95  VCPLDNKPWKLAR 107

>TPHA0P01470 Chr16 complement(301305..301640) [336 bp, 111 aa] {ON}
           Anc_3.28 YOL133W
          Length = 111

 Score = 40.0 bits (92), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 22/69 (31%), Positives = 33/69 (47%), Gaps = 8/69 (11%)

Query: 39  DVCGICRASYNGTCPSCKFPG-----DQCPLVIGLCHHNFHDHCIYRWLDTPTSKGLCPM 93
           D C ICR      C  C+        ++C +    C+H FH HCI +W+ T   +  CP+
Sbjct: 43  DNCAICRNHIMEPCIECQPMAMTETDNECVVAWAACNHAFHLHCINKWIKT---RDACPL 99

Query: 94  CRQTFQLQK 102
             Q +QL +
Sbjct: 100 DNQPWQLAR 108

>NDAI0K00710 Chr11 (155351..160126) [4776 bp, 1591 aa] {ON} Anc_8.799
            YMR247C
          Length = 1591

 Score = 41.6 bits (96), Expect = 4e-04,   Method: Composition-based stats.
 Identities = 18/62 (29%), Positives = 28/62 (45%), Gaps = 7/62 (11%)

Query: 41   CGICRASYNGTCPSCKFPGDQCPLVIGLCHHNFHDHCIYRWLDTPTSKGLCPMCRQTFQL 100
            C IC +  +      K P   CP     C + FH  C+Y+W  + +    CP+CR    L
Sbjct: 1537 CAICYSVLHAV--DRKLPTKTCPT----CKNKFHGACLYKWFKS-SGNNTCPLCRSEIAL 1589

Query: 101  QK 102
            ++
Sbjct: 1590 RR 1591

>TDEL0A00470 Chr1 (82852..83208) [357 bp, 118 aa] {ON} Anc_3.28
           YOL133W
          Length = 118

 Score = 39.7 bits (91), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 22/69 (31%), Positives = 32/69 (46%), Gaps = 8/69 (11%)

Query: 39  DVCGICRASYNGTCPSCKFPG-----DQCPLVIGLCHHNFHDHCIYRWLDTPTSKGLCPM 93
           D C ICR      C  C+        ++C    G C+H FH HCI +W+ T   +  CP+
Sbjct: 50  DNCAICRNHIMEPCIECQPLAMTDTDNECVAAWGTCNHAFHLHCINKWIKT---RDACPL 106

Query: 94  CRQTFQLQK 102
             Q + L +
Sbjct: 107 DNQPWHLAR 115

>Kpol_480.25 s480 (57636..62351) [4716 bp, 1571 aa] {ON}
            (57636..62351) [4716 nt, 1572 aa]
          Length = 1571

 Score = 41.2 bits (95), Expect = 5e-04,   Method: Composition-based stats.
 Identities = 18/62 (29%), Positives = 28/62 (45%), Gaps = 7/62 (11%)

Query: 41   CGICRASYNGTCPSCKFPGDQCPLVIGLCHHNFHDHCIYRWLDTPTSKGLCPMCRQTFQL 100
            C IC +  +      K P   CP     C + FH  C+Y+W  + +    CPMCR    +
Sbjct: 1517 CAICYSILHAV--DRKLPTKTCPT----CRNKFHGACLYKWFRS-SGNNTCPMCRSEIAI 1569

Query: 101  QK 102
            ++
Sbjct: 1570 RR 1571

>TBLA0B08710 Chr2 complement(2075746..2076114) [369 bp, 122 aa] {ON}
           Anc_3.28 YOL133W
          Length = 122

 Score = 39.3 bits (90), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 23/69 (33%), Positives = 31/69 (44%), Gaps = 8/69 (11%)

Query: 39  DVCGICRASYNGTCPSCKFPG-----DQCPLVIGLCHHNFHDHCIYRWLDTPTSKGLCPM 93
           D C ICR      C  C+          C    G C+H FH HCI +W+ T   +  CP+
Sbjct: 54  DNCAICRNHIMEPCIECQPKAMTDTDTDCVAAWGTCNHAFHLHCINKWIKT---REACPL 110

Query: 94  CRQTFQLQK 102
             Q +QL +
Sbjct: 111 DNQPWQLAR 119

>SAKL0B06226g Chr2 (524855..529528) [4674 bp, 1557 aa] {ON} similar to
            uniprot|Q04781 Saccharomyces cerevisiae YMR247C
            Hypothetical ORF
          Length = 1557

 Score = 40.8 bits (94), Expect = 7e-04,   Method: Composition-based stats.
 Identities = 18/62 (29%), Positives = 27/62 (43%), Gaps = 7/62 (11%)

Query: 41   CGICRASYNGTCPSCKFPGDQCPLVIGLCHHNFHDHCIYRWLDTPTSKGLCPMCRQTFQL 100
            C IC +  +      K P   CP     C++ FH  C+Y+W  + +    CPMCR     
Sbjct: 1503 CAICYSILHAV--DRKLPTKTCPT----CNNKFHGACLYKWFRS-SGNNTCPMCRSEIPF 1555

Query: 101  QK 102
             +
Sbjct: 1556 NR 1557

>TDEL0B00980 Chr2 (181064..185743) [4680 bp, 1559 aa] {ON} Anc_8.799
            YMR247C
          Length = 1559

 Score = 40.8 bits (94), Expect = 7e-04,   Method: Composition-based stats.
 Identities = 18/62 (29%), Positives = 28/62 (45%), Gaps = 7/62 (11%)

Query: 41   CGICRASYNGTCPSCKFPGDQCPLVIGLCHHNFHDHCIYRWLDTPTSKGLCPMCRQTFQL 100
            C IC +  +      K P   CP     C++ FH  C+Y+W  + +    CP+CR     
Sbjct: 1505 CAICYSILHAV--DRKLPTKTCPT----CNNKFHGACLYKWFRS-SGNNTCPLCRSEIPF 1557

Query: 101  QK 102
            +K
Sbjct: 1558 RK 1559

>TBLA0D00650 Chr4 (172839..177545) [4707 bp, 1568 aa] {ON} Anc_8.799
            YMR247C
          Length = 1568

 Score = 40.4 bits (93), Expect = 0.001,   Method: Composition-based stats.
 Identities = 17/62 (27%), Positives = 28/62 (45%), Gaps = 7/62 (11%)

Query: 41   CGICRASYNGTCPSCKFPGDQCPLVIGLCHHNFHDHCIYRWLDTPTSKGLCPMCRQTFQL 100
            C IC +  +      K P   CP     C++ +H  C+Y+W  + +    CPMCR     
Sbjct: 1514 CAICYSILHAV--DRKLPSKTCPT----CNNKYHGACLYKWFRS-SGNNTCPMCRSEIPF 1566

Query: 101  QK 102
            ++
Sbjct: 1567 RR 1568

>KAFR0B03620 Chr2 complement(752307..756989) [4683 bp, 1560 aa] {ON}
            Anc_8.799 YMR247C
          Length = 1560

 Score = 40.4 bits (93), Expect = 0.001,   Method: Composition-based stats.
 Identities = 18/62 (29%), Positives = 27/62 (43%), Gaps = 7/62 (11%)

Query: 41   CGICRASYNGTCPSCKFPGDQCPLVIGLCHHNFHDHCIYRWLDTPTSKGLCPMCRQTFQL 100
            C IC +  +      K P   CP     C + FH  C+Y+W  + +    CP+CR     
Sbjct: 1506 CAICYSILHAI--DRKLPSKTCPT----CKNRFHGACLYKWFRS-SGNNTCPLCRSEIPF 1558

Query: 101  QK 102
            +K
Sbjct: 1559 RK 1560

>NCAS0C00680 Chr3 (109845..114539) [4695 bp, 1564 aa] {ON} Anc_8.799
            YMR247C
          Length = 1564

 Score = 40.0 bits (92), Expect = 0.001,   Method: Composition-based stats.
 Identities = 18/62 (29%), Positives = 27/62 (43%), Gaps = 7/62 (11%)

Query: 41   CGICRASYNGTCPSCKFPGDQCPLVIGLCHHNFHDHCIYRWLDTPTSKGLCPMCRQTFQL 100
            C IC +  +      K P   CP     C + FH  C+Y+W  + +    CP+CR    L
Sbjct: 1510 CAICYSILHAV--DRKLPTKTCPT----CKNKFHGACLYKWFRS-SGNNTCPLCRSEIPL 1562

Query: 101  QK 102
             +
Sbjct: 1563 HR 1564

>NCAS0A08280 Chr1 (1636423..1636779) [357 bp, 118 aa] {ON} Anc_3.279
           YBR062C
          Length = 118

 Score = 38.5 bits (88), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 28/93 (30%), Positives = 42/93 (45%), Gaps = 15/93 (16%)

Query: 22  SDEDAANNDPIGNDEDEDVCGICRASYNGTCPSCKFPGDQCPLVIGL--CHHNFHDHCIY 79
           S+E  A+   + +    D C IC          CKF  D+ PL++ L  C+H F   CI 
Sbjct: 30  SEEFIASLPRVKSKHKNDECPIC---------CCKFSEDKYPLIVELPRCNHRFDLECIS 80

Query: 80  RWLDTPTSKGLCPMCRQTFQLQKGLAINDAHVQ 112
            WL    +   CP+CR    L+  L I+ +  +
Sbjct: 81  VWLSKSVT---CPLCRDNV-LEHKLNIDTSKTE 109

>YMR247C Chr13 complement(763351..768039) [4689 bp, 1562 aa] {ON}
            RKR1RING domain E3 ubiquitin ligase; involved in the
            ubiquitin-mediated degradation of non-stop proteins;
            functional connections to chromatin modification; nuclear
            protein that also co-localizes with ribosomes; homolog of
            mouse Listerin, whose mutation has been reported to cause
            neurodegeneration in mice
          Length = 1562

 Score = 39.7 bits (91), Expect = 0.002,   Method: Composition-based stats.
 Identities = 17/62 (27%), Positives = 27/62 (43%), Gaps = 7/62 (11%)

Query: 41   CGICRASYNGTCPSCKFPGDQCPLVIGLCHHNFHDHCIYRWLDTPTSKGLCPMCRQTFQL 100
            C IC +  +      K P   CP     C + FH  C+Y+W  + +    CP+CR     
Sbjct: 1508 CAICYSILHAV--DRKLPSKTCPT----CKNKFHGACLYKWFRS-SGNNTCPLCRSEIPF 1560

Query: 101  QK 102
            ++
Sbjct: 1561 RR 1562

>Skud_13.419 Chr13 complement(738148..742842) [4695 bp, 1564 aa] {ON}
            YMR247C (REAL)
          Length = 1564

 Score = 39.7 bits (91), Expect = 0.002,   Method: Composition-based stats.
 Identities = 17/62 (27%), Positives = 27/62 (43%), Gaps = 7/62 (11%)

Query: 41   CGICRASYNGTCPSCKFPGDQCPLVIGLCHHNFHDHCIYRWLDTPTSKGLCPMCRQTFQL 100
            C IC +  +      K P   CP     C + FH  C+Y+W  + +    CP+CR     
Sbjct: 1510 CAICYSILHAV--DRKLPSKTCPT----CKNKFHGACLYKWFRS-SGNNTCPLCRSEIPF 1562

Query: 101  QK 102
            ++
Sbjct: 1563 RR 1564

>Smik_13.460 Chr13 complement(747753..752453) [4701 bp, 1566 aa] {ON}
            YMR247C (REAL)
          Length = 1566

 Score = 39.7 bits (91), Expect = 0.002,   Method: Composition-based stats.
 Identities = 17/62 (27%), Positives = 27/62 (43%), Gaps = 7/62 (11%)

Query: 41   CGICRASYNGTCPSCKFPGDQCPLVIGLCHHNFHDHCIYRWLDTPTSKGLCPMCRQTFQL 100
            C IC +  +      K P   CP     C + FH  C+Y+W  + +    CP+CR     
Sbjct: 1512 CAICYSILHAV--DRKLPSKTCPT----CKNRFHGACLYKWFRS-SGNNTCPLCRSEIPF 1564

Query: 101  QK 102
            ++
Sbjct: 1565 RR 1566

>KNAG0J00540 Chr10 (86360..91045) [4686 bp, 1561 aa] {ON} Anc_8.799
            YMR247C
          Length = 1561

 Score = 39.7 bits (91), Expect = 0.002,   Method: Composition-based stats.
 Identities = 17/62 (27%), Positives = 27/62 (43%), Gaps = 7/62 (11%)

Query: 41   CGICRASYNGTCPSCKFPGDQCPLVIGLCHHNFHDHCIYRWLDTPTSKGLCPMCRQTFQL 100
            C IC +  +      K P   CP     C + FH  C+Y+W  + +    CP+CR     
Sbjct: 1507 CAICYSILHAV--DRKLPNKTCPT----CKNRFHGACLYKWFRS-SGNNTCPLCRNEIPF 1559

Query: 101  QK 102
            ++
Sbjct: 1560 RR 1561

>KLTH0E13992g Chr5 (1234550..1239202) [4653 bp, 1550 aa] {ON} similar
            to uniprot|Q04781 Saccharomyces cerevisiae YMR247C
            Hypothetical ORF
          Length = 1550

 Score = 39.7 bits (91), Expect = 0.002,   Method: Composition-based stats.
 Identities = 17/62 (27%), Positives = 28/62 (45%), Gaps = 7/62 (11%)

Query: 41   CGICRASYNGTCPSCKFPGDQCPLVIGLCHHNFHDHCIYRWLDTPTSKGLCPMCRQTFQL 100
            C IC +  +      K P   CP     C++ FH  C+Y+W  + +    CP+CR     
Sbjct: 1496 CAICYSILHAV--DRKLPSKVCPT----CNNRFHGACLYKWFRS-SGNNTCPLCRSEIPF 1548

Query: 101  QK 102
            ++
Sbjct: 1549 RR 1550

>Suva_13.432 Chr13 complement(744705..749384) [4680 bp, 1559 aa] {ON}
            YMR247C (REAL)
          Length = 1559

 Score = 39.7 bits (91), Expect = 0.002,   Method: Composition-based stats.
 Identities = 17/62 (27%), Positives = 27/62 (43%), Gaps = 7/62 (11%)

Query: 41   CGICRASYNGTCPSCKFPGDQCPLVIGLCHHNFHDHCIYRWLDTPTSKGLCPMCRQTFQL 100
            C IC +  +      K P   CP     C + FH  C+Y+W  + +    CP+CR     
Sbjct: 1505 CAICYSILHAV--DRKLPSKTCPT----CKNKFHGACLYKWFRS-SGNNTCPLCRSEIPF 1557

Query: 101  QK 102
            ++
Sbjct: 1558 RR 1559

>CAGL0H10274g Chr8 complement(1003801..1004312,1004468..1004483)
           [528 bp, 175 aa] {ON} similar to uniprot|P38239
           Saccharomyces cerevisiae YBR062c
          Length = 175

 Score = 38.5 bits (88), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 24/58 (41%), Positives = 28/58 (48%), Gaps = 7/58 (12%)

Query: 51  TCPSC--KFPGDQCPLVIGL--CHHNFHDHCIYRWLDTPTSKGLCPMCRQTFQLQKGL 104
           TCP C   F  D+ PLV+ L  C H F   C+  WL   T    CPMCR     +K L
Sbjct: 103 TCPICCSNFIADEYPLVVELPHCGHKFDFECVSMWL---TKNTTCPMCRDDVTHKKEL 157

>ZYRO0F12760g Chr6 complement(1037460..1042127) [4668 bp, 1555 aa]
            {ON} similar to uniprot|Q04781 Saccharomyces cerevisiae
            YMR247C Hypothetical ORF
          Length = 1555

 Score = 39.7 bits (91), Expect = 0.002,   Method: Composition-based stats.
 Identities = 17/55 (30%), Positives = 26/55 (47%), Gaps = 7/55 (12%)

Query: 41   CGICRASYNGTCPSCKFPGDQCPLVIGLCHHNFHDHCIYRWLDTPTSKGLCPMCR 95
            C IC +  +      K P   CP     C++ FH  C+Y+W  + +    CP+CR
Sbjct: 1501 CAICYSILHAV--DRKLPTKTCPT----CNNKFHGSCLYKWFRS-SGNNTCPLCR 1548

>Kwal_27.12327 s27 (1178866..1183590) [4725 bp, 1574 aa] {ON} YMR247C
            - Hypothetical ORF [contig 20] FULL
          Length = 1574

 Score = 39.3 bits (90), Expect = 0.002,   Method: Composition-based stats.
 Identities = 17/62 (27%), Positives = 28/62 (45%), Gaps = 7/62 (11%)

Query: 41   CGICRASYNGTCPSCKFPGDQCPLVIGLCHHNFHDHCIYRWLDTPTSKGLCPMCRQTFQL 100
            C IC +  +      K P   CP     C++ FH  C+Y+W  + +    CP+CR     
Sbjct: 1520 CAICYSILHAV--DRKLPSKVCPT----CNNRFHGACLYKWFRS-SGNNTCPLCRSEIPF 1572

Query: 101  QK 102
            ++
Sbjct: 1573 RR 1574

>Ecym_2658 Chr2 (1270952..1271431) [480 bp, 159 aa] {ON} similar to
           Ashbya gossypii AGR034W
          Length = 159

 Score = 37.7 bits (86), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 22/60 (36%), Positives = 28/60 (46%), Gaps = 14/60 (23%)

Query: 38  EDVCGICRASYNGTCPSCKFPGDQCPLVIGL--CHHNFHDHCIYRWLDTPTSKGLCPMCR 95
           +D C IC          C +  D  PLV+ L  C+H F   CI  WL   ++   CPMCR
Sbjct: 87  DDTCAIC---------CCVYLEDSYPLVVKLPNCNHKFDLQCITLWLSKSST---CPMCR 134

>KLTH0F18502g Chr6 (1496235..1497038) [804 bp, 267 aa] {ON}
           conserved hypothetical protein
          Length = 267

 Score = 38.1 bits (87), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 23/79 (29%), Positives = 39/79 (49%), Gaps = 12/79 (15%)

Query: 35  DEDEDVCGICRASYNGTCPSCKFPGDQCPLVIGLCHHNFHDHCIYRWLDTPTSKGLCPMC 94
            ++E+ C IC+  +N               V+G C H FH HCI RW+    +   CP+C
Sbjct: 104 SDEEESCVICQEQFNEL---------NNIRVLG-CSHIFHSHCIDRWI--CRNSACCPLC 151

Query: 95  RQTFQLQKGLAINDAHVQK 113
           ++++ L  G     A+++K
Sbjct: 152 KRSYSLPVGSCHVIAYIEK 170

>Smik_2.196 Chr2 complement(347806..348363) [558 bp, 185 aa] {ON}
           YBR062C (REAL)
          Length = 185

 Score = 37.7 bits (86), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 22/59 (37%), Positives = 28/59 (47%), Gaps = 14/59 (23%)

Query: 39  DVCGICRASYNGTCPSCKFPGDQCPLVIGL--CHHNFHDHCIYRWLDTPTSKGLCPMCR 95
           D C IC  +Y           D+ PLV+ L  CHH F   C+  WL   T+   CP+CR
Sbjct: 112 DNCSICYTNY---------LEDEYPLVVELPHCHHKFDLECLSVWLSRSTT---CPLCR 158

>ABL058C Chr2 complement(288353..292993) [4641 bp, 1546 aa] {ON}
            Syntenic homolog of Saccharomyces cerevisiae YMR247C
          Length = 1546

 Score = 38.5 bits (88), Expect = 0.005,   Method: Composition-based stats.
 Identities = 18/59 (30%), Positives = 27/59 (45%), Gaps = 7/59 (11%)

Query: 37   DEDVCGICRASYNGTCPSCKFPGDQCPLVIGLCHHNFHDHCIYRWLDTPTSKGLCPMCR 95
            D + C IC +  +      K P   CP     C + FH  C+Y+W  + +    CP+CR
Sbjct: 1488 DFEECAICYSILH--VVDRKLPSKVCPT----CSNRFHGACLYKWFKS-SGNNTCPLCR 1539

>AGL079C Chr7 complement(557422..558942) [1521 bp, 506 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YHL010C
          Length = 506

 Score = 38.1 bits (87), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 18/49 (36%), Positives = 24/49 (48%), Gaps = 7/49 (14%)

Query: 51  TCPSC--KFPGDQCPLVIGLCHHNFHDHCIYRWLDTPTSKGLCPMCRQT 97
           TCP C  +   D   L+   C H FH  C+ +W D     G CP+CR +
Sbjct: 211 TCPVCLERMDSDTTGLITTACQHTFHCQCLDKWKD-----GRCPVCRYS 254

>YBR062C Chr2 complement(365976..366502,366585..366600) [543 bp, 180
           aa] {ON} Protein of unknown function that interacts with
           Msb2p; may play a role in activation of the filamentous
           growth pathway.
          Length = 180

 Score = 37.4 bits (85), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 22/59 (37%), Positives = 28/59 (47%), Gaps = 14/59 (23%)

Query: 39  DVCGICRASYNGTCPSCKFPGDQCPLVIGL--CHHNFHDHCIYRWLDTPTSKGLCPMCR 95
           D C IC  +Y           D+ PLV+ L  CHH F   C+  WL   T+   CP+CR
Sbjct: 107 DNCSICYTNY---------LEDEYPLVVELPHCHHKFDLECLSVWLSRSTT---CPLCR 153

>KAFR0B04600 Chr2 complement(956458..957684) [1227 bp, 408 aa] {ON}
           Anc_2.157 YHR115C
          Length = 408

 Score = 37.7 bits (86), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 24/97 (24%), Positives = 42/97 (43%), Gaps = 16/97 (16%)

Query: 15  SWHIPSTSDEDAANNDPIGNDEDEDVCGIC---RASYNGTCPSCKFPGDQCPLVIGLCHH 71
           SW + +   E   N   + N +D+++C IC    + Y G             + +  C H
Sbjct: 320 SWKLKTKPLEGIINTISLENSQDKELCSICLEKMSPYQG-------------VFVSPCCH 366

Query: 72  NFHDHCIYRWLDTPTSKGLCPMCRQTFQLQKGLAIND 108
            +H +CI R +     + +CP CR T  L+  + + D
Sbjct: 367 LWHYNCIRRVITQHYPQFVCPNCRYTSDLESPIGLPD 403

>KLLA0F18458g Chr6 complement(1697871..1698293) [423 bp, 140 aa]
           {ON} similar to uniprot|P38239 Saccharomyces cerevisiae
           YBR062C Hypothetical ORF
          Length = 140

 Score = 37.0 bits (84), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 23/67 (34%), Positives = 30/67 (44%), Gaps = 14/67 (20%)

Query: 38  EDVCGICRASYNGTCPSCKFPGDQCPLVIGL--CHHNFHDHCIYRWLDTPTSKGLCPMCR 95
           ED C IC+         C F  D  PLV  +  C+H F   C+  WL    +   CPMCR
Sbjct: 68  EDTCAICQ---------CNFLDDPYPLVAKVPRCNHKFDLECLSIWL---QNNHTCPMCR 115

Query: 96  QTFQLQK 102
              + +K
Sbjct: 116 DDLRSKK 122

>ZYRO0E06996g Chr5 complement(530578..531080,531138..531153) [519
           bp, 172 aa] {ON} similar to uniprot|P38239 Saccharomyces
           cerevisiae YBR062C Hypothetical ORF
          Length = 172

 Score = 37.0 bits (84), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 24/67 (35%), Positives = 30/67 (44%), Gaps = 14/67 (20%)

Query: 31  PIGNDEDEDVCGICRASYNGTCPSCKFPGDQCPLVIGL--CHHNFHDHCIYRWLDTPTSK 88
           P    +++D C IC          C +  D  PLV  L  C+H F   CI  WL   TS 
Sbjct: 93  PASKIKEDDSCPIC---------CCTYKEDDHPLVAELPHCNHKFDLECISVWLSKSTS- 142

Query: 89  GLCPMCR 95
             CP+CR
Sbjct: 143 --CPLCR 147

>Ecym_7418 Chr7 (853469..858112) [4644 bp, 1547 aa] {ON} similar to
            Ashbya gossypii ABL058C
          Length = 1547

 Score = 37.7 bits (86), Expect = 0.008,   Method: Composition-based stats.
 Identities = 19/63 (30%), Positives = 29/63 (46%), Gaps = 9/63 (14%)

Query: 41   CGICRASYNGTCP-SCKFPGDQCPLVIGLCHHNFHDHCIYRWLDTPTSKGLCPMCRQTFQ 99
            C IC   Y+   P   K P   CP     C++ FH  C+Y+W  + +    CP+CR    
Sbjct: 1493 CAIC---YSILHPVDRKLPTKVCPT----CNNRFHGACLYKWFRS-SGNNSCPLCRSEIP 1544

Query: 100  LQK 102
             ++
Sbjct: 1545 FRR 1547

>Suva_4.302 Chr4 complement(532902..533210,533286..533429) [453 bp,
           150 aa] {ON} YBR062C (REAL)
          Length = 150

 Score = 36.6 bits (83), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 22/59 (37%), Positives = 28/59 (47%), Gaps = 14/59 (23%)

Query: 39  DVCGICRASYNGTCPSCKFPGDQCPLVIGL--CHHNFHDHCIYRWLDTPTSKGLCPMCR 95
           D C IC  +Y           D+ PLV+ L  CHH F   C+  WL   T+   CP+CR
Sbjct: 77  DNCSICYTNY---------LEDKYPLVVELPHCHHKFDLECLSVWLSRSTT---CPLCR 123

>AGR034W Chr7 (772766..773245) [480 bp, 159 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YBR062C
          Length = 159

 Score = 36.6 bits (83), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 23/66 (34%), Positives = 30/66 (45%), Gaps = 14/66 (21%)

Query: 39  DVCGICRASYNGTCPSCKFPGDQCPLVIGL--CHHNFHDHCIYRWLDTPTSKGLCPMCRQ 96
           D C IC          C +  D+ PLV+ L  C H F   C+  WL   T+   CPMCR 
Sbjct: 88  DNCAIC---------CCGYLEDEYPLVVELPNCGHTFDLQCVSVWLSRSTT---CPMCRS 135

Query: 97  TFQLQK 102
              ++K
Sbjct: 136 DVLVRK 141

>KNAG0A07430 Chr1 complement(1165740..1166048) [309 bp, 102 aa]
          {ON} Anc_3.405 YPR093C
          Length = 102

 Score = 35.4 bits (80), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 15/31 (48%), Positives = 18/31 (58%), Gaps = 3/31 (9%)

Query: 69 CHHNFHDHCIYRWLDTPTS---KGLCPMCRQ 96
          CHH FH  CI +W  T T    + LCP CR+
Sbjct: 29 CHHKFHSDCIRKWHTTTTGEIRRPLCPFCRE 59

>KAFR0C00460 Chr3 complement(94989..95446,95522..95537) [474 bp, 157
           aa] {ON} Anc_3.279 YBR062C
          Length = 157

 Score = 36.2 bits (82), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 25/76 (32%), Positives = 32/76 (42%), Gaps = 14/76 (18%)

Query: 39  DVCGICRASYNGTCPSCKFPGDQCPLVIGL--CHHNFHDHCIYRWLDTPTSKGLCPMCRQ 96
           D+C IC  +         F  D+ PLVI L  C H F   CI  WL   +S   CP+CR 
Sbjct: 85  DLCSICFEN---------FREDEYPLVIELPHCSHKFDLQCISVWL---SSNSTCPVCRD 132

Query: 97  TFQLQKGLAINDAHVQ 112
                  L I+    +
Sbjct: 133 KVNHNAKLDIDTTEAE 148

>TDEL0C02770 Chr3 complement(486107..486733) [627 bp, 208 aa] {ON}
           Anc_7.416 YER116C
          Length = 208

 Score = 36.2 bits (82), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 21/74 (28%), Positives = 37/74 (50%), Gaps = 7/74 (9%)

Query: 45  RASYNGTCPSCKFPGDQCPLVIGLCHHNFHDHCIYRWLDT---PTSKGLCPMCRQTFQLQ 101
           +A  +  CP C  P +    VI  C H F   C+++ L++   P   GLC +CR++  ++
Sbjct: 132 KAVRDYQCPICFDPPENS--VITPCGHTFCVSCLFQMLNSSRGPKKNGLCALCRKSVAIR 189

Query: 102 --KGLAINDAHVQK 113
             K + +    V+K
Sbjct: 190 DIKMIKLKKKRVRK 203

>TBLA0G02310 Chr7 (598514..600538) [2025 bp, 674 aa] {ON} Anc_2.542
           YHL010C
          Length = 674

 Score = 36.6 bits (83), Expect = 0.017,   Method: Composition-based stats.
 Identities = 19/64 (29%), Positives = 30/64 (46%), Gaps = 8/64 (12%)

Query: 51  TCPSC--KFPGDQCPLVIGLCHHNFHDHCIYRWLDTPTSKGLCPMCR-QTFQLQKGLAIN 107
           +CP C  +       L+   C H FH  C+ +W ++      CP+CR  T ++ + L IN
Sbjct: 282 SCPVCLERMDSSITGLITIPCQHTFHCQCLNKWKNSK-----CPICRFSTLRISRDLVIN 336

Query: 108 DAHV 111
              V
Sbjct: 337 KKQV 340

>CAGL0H02651g Chr8 (238495..243129) [4635 bp, 1544 aa] {ON} similar to
            uniprot|Q04781 Saccharomyces cerevisiae YMR247c
          Length = 1544

 Score = 36.6 bits (83), Expect = 0.023,   Method: Composition-based stats.
 Identities = 16/62 (25%), Positives = 26/62 (41%), Gaps = 7/62 (11%)

Query: 41   CGICRASYNGTCPSCKFPGDQCPLVIGLCHHNFHDHCIYRWLDTPTSKGLCPMCRQTFQL 100
            C IC +  +      K P   C      C + FH  C+Y+W  + +    CP+CR     
Sbjct: 1490 CAICYSILHAV--DRKLPTKTC----STCKNKFHGACLYKWFRS-SGNNTCPLCRSEINF 1542

Query: 101  QK 102
            ++
Sbjct: 1543 RR 1544

>TPHA0C04250 Chr3 (915632..917302) [1671 bp, 556 aa] {ON} Anc_2.542
           YHL010C
          Length = 556

 Score = 36.2 bits (82), Expect = 0.024,   Method: Composition-based stats.
 Identities = 23/64 (35%), Positives = 30/64 (46%), Gaps = 12/64 (18%)

Query: 51  TCPSCKFPGDQCPLVIGL----CHHNFHDHCIYRWLDTPTSKGLCPMCRQT-FQLQKGLA 105
           TCP C    D   LV GL    C H FH  C+ +W ++      CP+CR T   + + L 
Sbjct: 240 TCPVCLEKMDS--LVTGLITIPCSHTFHCQCLDKWKNSK-----CPVCRHTNLNISRKLL 292

Query: 106 INDA 109
           I  A
Sbjct: 293 IEQA 296

>ZYRO0B02244g Chr2 (186386..188077) [1692 bp, 563 aa] {ON} similar
           to uniprot|P38748 YHL010C Saccharomyces cerevisiae
           Hypothetical ORF
          Length = 563

 Score = 36.2 bits (82), Expect = 0.027,   Method: Compositional matrix adjust.
 Identities = 19/62 (30%), Positives = 30/62 (48%), Gaps = 8/62 (12%)

Query: 51  TCPSC--KFPGDQCPLVIGLCHHNFHDHCIYRWLDTPTSKGLCPMCR-QTFQLQKGLAIN 107
           TCP C  +   D   L+   C H FH  C+ +W ++      CP+CR  + +L +   + 
Sbjct: 233 TCPVCLERMDSDTTGLITIPCQHTFHCQCLDKWKNSK-----CPVCRYSSLRLSRDSLLR 287

Query: 108 DA 109
           DA
Sbjct: 288 DA 289

>Kwal_27.10546 s27 complement(386744..387058) [315 bp, 104 aa]
          {ON} YBR062C - Hypothetical ORF [contig 35] FULL
          Length = 104

 Score = 34.3 bits (77), Expect = 0.030,   Method: Compositional matrix adjust.
 Identities = 21/65 (32%), Positives = 30/65 (46%), Gaps = 14/65 (21%)

Query: 33 GNDEDEDVCGICRASYNGTCPSCKFPGDQCPLVIGL--CHHNFHDHCIYRWLDTPTSKGL 90
          G  +D + C IC          C +  D+ PLV+ L  C+H F   C+  WL   +    
Sbjct: 27 GKLKDAEACSIC---------CCNYRDDKYPLVVELPHCNHRFDLECVAVWL---SKSRT 74

Query: 91 CPMCR 95
          CP+CR
Sbjct: 75 CPLCR 79

>KAFR0I02090 Chr9 complement(427023..431423) [4401 bp, 1466 aa] {ON}
            Anc_1.389 YLR247C
          Length = 1466

 Score = 35.8 bits (81), Expect = 0.036,   Method: Composition-based stats.
 Identities = 13/29 (44%), Positives = 19/29 (65%), Gaps = 3/29 (10%)

Query: 69   CHHNFHDHCIYRWLDTPTSKGLCPMCRQT 97
            C H F  HCI+ WL    +K +CP+C++T
Sbjct: 1166 CGHFFCKHCIFSWL---KNKSVCPICKKT 1191

>Kpol_1052.19 s1052 (60008..60319) [312 bp, 103 aa] {ON}
           (60008..60319) [312 nt, 104 aa]
          Length = 103

 Score = 34.3 bits (77), Expect = 0.037,   Method: Compositional matrix adjust.
 Identities = 25/75 (33%), Positives = 30/75 (40%), Gaps = 19/75 (25%)

Query: 30  DPIGNDEDEDVCGICRASYNGTCPSCKFPGDQCPLVIGL--CHHNFHDHCIYRWLDTPTS 87
           DPI      D C IC          C +  D+ PL+  L  C HNF   C+  WL   + 
Sbjct: 28  DPIN-----DSCSIC---------CCTYADDKYPLISKLPHCGHNFDYECLSIWL---SK 70

Query: 88  KGLCPMCRQTFQLQK 102
              CPMCR      K
Sbjct: 71  NKTCPMCRDDITSHK 85

>NDAI0A07450 Chr1 complement(1699546..1700051,1700150..1700165) [522
           bp, 173 aa] {ON} Anc_3.279 YBR062C
          Length = 173

 Score = 35.0 bits (79), Expect = 0.037,   Method: Compositional matrix adjust.
 Identities = 19/45 (42%), Positives = 23/45 (51%), Gaps = 5/45 (11%)

Query: 55  CKFPGDQCPLVIGL--CHHNFHDHCIYRWLDTPTSKGLCPMCRQT 97
           CKF  D+ PLV  L  C H F   CI  WL   +    CP+CR +
Sbjct: 109 CKFLEDKYPLVAELPHCGHRFDLECISVWL---SKSDTCPLCRDS 150

>Ecym_7244 Chr7 complement(512748..514346) [1599 bp, 532 aa] {ON}
           similar to Ashbya gossypii AGL079C
          Length = 532

 Score = 35.8 bits (81), Expect = 0.039,   Method: Compositional matrix adjust.
 Identities = 17/49 (34%), Positives = 23/49 (46%), Gaps = 7/49 (14%)

Query: 51  TCPSC--KFPGDQCPLVIGLCHHNFHDHCIYRWLDTPTSKGLCPMCRQT 97
           TCP C  +   D   L+   C H FH  C+ +W       G CP+CR +
Sbjct: 234 TCPVCLERMDSDTTGLITTACQHTFHCQCLDQW-----KGGRCPVCRYS 277

>TPHA0A03990 Chr1 (887214..887741) [528 bp, 175 aa] {ON} Anc_3.279
           YBR062C
          Length = 175

 Score = 35.0 bits (79), Expect = 0.044,   Method: Compositional matrix adjust.
 Identities = 27/87 (31%), Positives = 35/87 (40%), Gaps = 11/87 (12%)

Query: 18  IPSTSDEDAANNDPIGNDEDEDVCGICRASYNGTCPSCKFPGDQCPLVIGL--CHHNFHD 75
           +P  S  D    + I N E      I  A  N +   CK+  D  PL+  L  C H+F  
Sbjct: 80  LPRVSINDILKQEIIRNPE------IKAAHLNCSICYCKYTDDDYPLIAQLPHCGHHFDF 133

Query: 76  HCIYRWLDTPTSKGLCPMCRQTFQLQK 102
            CI  WL   +    CP+CR      K
Sbjct: 134 ECISIWL---SKNETCPICRDNLTSHK 157

>AGL217W Chr7 (290043..291287) [1245 bp, 414 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YOL054W (PSH1)
          Length = 414

 Score = 35.4 bits (80), Expect = 0.049,   Method: Compositional matrix adjust.
 Identities = 19/66 (28%), Positives = 33/66 (50%), Gaps = 3/66 (4%)

Query: 63  PLVIGLCHHNFHDHCIYRWLDTPTSKGL-CPMCRQTFQLQKGLAIN-DAHVQKFVEIVSR 120
           P++ G C HN+   CI  WL+  +S  L CP CR +      L +    ++   +E++ +
Sbjct: 48  PVMTG-CGHNYCYFCISNWLNNTSSTELNCPQCRSSITSMPSLNVTLQQNLDALIEVLDK 106

Query: 121 RREEMI 126
              E+I
Sbjct: 107 AEPEVI 112

>Kpol_1023.32 s1023 complement(68737..72273) [3537 bp, 1178 aa] {ON}
           complement(68737..72273) [3537 nt, 1179 aa]
          Length = 1178

 Score = 35.4 bits (80), Expect = 0.053,   Method: Composition-based stats.
 Identities = 20/65 (30%), Positives = 28/65 (43%), Gaps = 4/65 (6%)

Query: 52  CPSCKF-PGDQCPLVIGLCHHNFHDHCIYRWLDTPTSKGL---CPMCRQTFQLQKGLAIN 107
           CP C   P D   ++   C H F + C+  + D    K L   CP CRQ     + L +N
Sbjct: 925 CPICTTEPIDANNIIFTECGHCFCESCLQEYFDFQVQKKLETKCPNCRQIISTNRVLKLN 984

Query: 108 DAHVQ 112
              V+
Sbjct: 985 HDTVE 989

>Skud_2.186 Chr2 complement(334347..334867,334953..334968) [537 bp,
           178 aa] {ON} YBR062C (REAL)
          Length = 178

 Score = 34.3 bits (77), Expect = 0.062,   Method: Compositional matrix adjust.
 Identities = 21/59 (35%), Positives = 28/59 (47%), Gaps = 14/59 (23%)

Query: 39  DVCGICRASYNGTCPSCKFPGDQCPLVIGL--CHHNFHDHCIYRWLDTPTSKGLCPMCR 95
           D C IC  +Y           D+ PLV+ L  C+H F   C+  WL   T+   CP+CR
Sbjct: 105 DNCSICYTNY---------LEDEYPLVVELPHCNHRFDLECLSVWLSRSTT---CPLCR 151

>TBLA0F03280 Chr6 complement(805882..807549) [1668 bp, 555 aa] {ON}
           Anc_3.405 YPR093C
          Length = 555

 Score = 34.7 bits (78), Expect = 0.086,   Method: Compositional matrix adjust.
 Identities = 19/42 (45%), Positives = 26/42 (61%), Gaps = 5/42 (11%)

Query: 66  IGLCHHNFHDHCIYRWLDTPTSKGL-CPMCRQT--FQLQKGL 104
           + +C HNFH +CI +W    TSK L CP+CR+     +QK L
Sbjct: 19  LKVCQHNFHFNCIRQW--HLTSKSLECPVCRRVSNIVIQKTL 58

>TDEL0A03180 Chr1 (569298..571001) [1704 bp, 567 aa] {ON} Anc_2.542
           YHL010C
          Length = 567

 Score = 34.7 bits (78), Expect = 0.094,   Method: Compositional matrix adjust.
 Identities = 18/59 (30%), Positives = 29/59 (49%), Gaps = 8/59 (13%)

Query: 51  TCPSC--KFPGDQCPLVIGLCHHNFHDHCIYRWLDTPTSKGLCPMCR-QTFQLQKGLAI 106
           TCP C  +   D   L+   C H FH  C+ +W ++      CP+CR  + +L +  A+
Sbjct: 233 TCPVCLERMDSDTTGLITIPCQHTFHCQCLDKWKNSR-----CPVCRYSSIRLSRNSAV 286

>KLLA0E07019g Chr5 (641391..642230) [840 bp, 279 aa] {ON} some
           similarities with uniprot|P40072 Saccharomyces
           cerevisiae YER116C SLX8 Protein containing a RING finger
           domain that forms a complex with Hex3p mutant phenotypes
           and genetic interactions suggest a possible role in
           resolving recombination intermediates during DNA
           replication or repair
          Length = 279

 Score = 34.3 bits (77), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 23/83 (27%), Positives = 36/83 (43%), Gaps = 7/83 (8%)

Query: 23  DEDAANNDPIGNDEDEDVCGICRASYNGTCPSCKFPGDQCPLVIGLCHHNFHDHCIYRWL 82
           DED       G D  E      +A+ +  CP C  P +    ++  C H F   C+Y  +
Sbjct: 184 DEDETEGHKSGKDMSETPLETKKAA-DYVCPICMEPPEAA--LVTKCGHVFCTTCLYGMV 240

Query: 83  DTPTSKG----LCPMCRQTFQLQ 101
           ++    G    LC +CR+  +LQ
Sbjct: 241 NSSKGNGRRNGLCALCRENVKLQ 263

>Skud_8.35 Chr8 complement(70011..71768) [1758 bp, 585 aa] {ON}
           YHL010C (REAL)
          Length = 585

 Score = 34.3 bits (77), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 16/49 (32%), Positives = 24/49 (48%), Gaps = 7/49 (14%)

Query: 51  TCPSC--KFPGDQCPLVIGLCHHNFHDHCIYRWLDTPTSKGLCPMCRQT 97
           TCP C  +   +   LV   C H FH  C+ +W ++      CP+CR +
Sbjct: 239 TCPVCLERMDSETTGLVTIPCQHTFHCQCLNKWKNSR-----CPVCRHS 282

>YHL010C Chr8 complement(81964..83721) [1758 bp, 585 aa] {ON}
           ETP1Putative protein of unknown function that is
           required for growth on ethanol; contains a zinc finger
           region and has homology to human BRAP2, which is a
           cytoplasmic protein that binds nuclear localization
           sequences
          Length = 585

 Score = 34.3 bits (77), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 16/49 (32%), Positives = 24/49 (48%), Gaps = 7/49 (14%)

Query: 51  TCPSC--KFPGDQCPLVIGLCHHNFHDHCIYRWLDTPTSKGLCPMCRQT 97
           TCP C  +   +   LV   C H FH  C+ +W ++      CP+CR +
Sbjct: 239 TCPVCLERMDSETTGLVTIPCQHTFHCQCLNKWKNSR-----CPVCRHS 282

>KLTH0D07150g Chr4 (627115..628737) [1623 bp, 540 aa] {ON} similar
           to uniprot|P38748 Saccharomyces cerevisiae YHL010C
           Hypothetical ORF
          Length = 540

 Score = 34.3 bits (77), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 24/82 (29%), Positives = 34/82 (41%), Gaps = 15/82 (18%)

Query: 19  PSTSDEDAANNDPI-GNDEDEDVCGICRASYNGTCPSC--KFPGDQCPLVIGLCHHNFHD 75
           P ++      NDP  G+ E  DV          TCP C  +   +   L    C H FH 
Sbjct: 220 PQSAGSQFLMNDPFTGHKETGDV-------ELPTCPVCLERLDSEVTGLATIPCQHTFHC 272

Query: 76  HCIYRWLDTPTSKGLCPMCRQT 97
            C+ +W D+      CP+CR +
Sbjct: 273 QCLNKWKDSR-----CPVCRYS 289

>TPHA0C04260 Chr3 complement(917526..919799) [2274 bp, 757 aa] {ON}
           Anc_2.545 YKL034W
          Length = 757

 Score = 34.3 bits (77), Expect = 0.11,   Method: Composition-based stats.
 Identities = 26/87 (29%), Positives = 37/87 (42%), Gaps = 12/87 (13%)

Query: 13  AWSWHIPSTSDEDAANNDPIGNDEDEDV-CGICRAS---YNGTCPSCKFPGDQCPLVIGL 68
            +S+H P  S E   +    G  E+  V C IC +    Y    P      DQ   ++  
Sbjct: 673 GYSYHKPVLSQELLEH----GASENHTVDCAICMSEVPVYVKDIPETH-AVDQQSYMVTP 727

Query: 69  CHHNFHDHCIYRWLDTPTSKGLCPMCR 95
           C+H FH  C+  W+     K  CP+CR
Sbjct: 728 CNHIFHTACLENWMGY---KLQCPVCR 751

>Smik_8.32 Chr8 complement(65542..67299) [1758 bp, 585 aa] {ON}
           YHL010C (REAL)
          Length = 585

 Score = 34.3 bits (77), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 16/49 (32%), Positives = 24/49 (48%), Gaps = 7/49 (14%)

Query: 51  TCPSC--KFPGDQCPLVIGLCHHNFHDHCIYRWLDTPTSKGLCPMCRQT 97
           TCP C  +   +   LV   C H FH  C+ +W ++      CP+CR +
Sbjct: 239 TCPVCLERMDSETTGLVTIPCQHTFHCQCLNKWKNSR-----CPVCRHS 282

>Kwal_55.21206 s55 complement(730534..731361) [828 bp, 275 aa] {ON}
           [contig 295] FULL
          Length = 275

 Score = 33.9 bits (76), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 17/63 (26%), Positives = 32/63 (50%), Gaps = 12/63 (19%)

Query: 40  VCGICRASYNGTCPSCKFPGDQCPLVIGLCHHNFHDHCIYRWLDTPTSKGLCPMCRQTFQ 99
            C IC+  +N     C         ++G C+H FH +CI +W+    +   CP+C++++ 
Sbjct: 119 TCAICQEDFNKLNNVC---------LLG-CNHVFHTYCIDQWI--CRNSACCPLCKRSYS 166

Query: 100 LQK 102
           L +
Sbjct: 167 LPR 169

>Suva_8.42 Chr8 complement(84493..86250) [1758 bp, 585 aa] {ON}
           YHL010C (REAL)
          Length = 585

 Score = 34.3 bits (77), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 16/49 (32%), Positives = 24/49 (48%), Gaps = 7/49 (14%)

Query: 51  TCPSC--KFPGDQCPLVIGLCHHNFHDHCIYRWLDTPTSKGLCPMCRQT 97
           TCP C  +   +   LV   C H FH  C+ +W ++      CP+CR +
Sbjct: 239 TCPVCLERMDSETSGLVTIPCQHTFHCQCLNKWKNSR-----CPVCRHS 282

>CAGL0K02563g Chr11 complement(231812..233572) [1761 bp, 586 aa]
           {ON} similar to uniprot|P38748 Saccharomyces cerevisiae
           YHL010c
          Length = 586

 Score = 34.3 bits (77), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 17/55 (30%), Positives = 28/55 (50%), Gaps = 8/55 (14%)

Query: 51  TCPSC--KFPGDQCPLVIGLCHHNFHDHCIYRWLDTPTSKGLCPMCR-QTFQLQK 102
           TCP C  +   +   L+   C H FH  C+ +W ++      CP+CR  +F+L +
Sbjct: 246 TCPVCLERMDSETTGLITIPCQHTFHCQCLDKWKNSK-----CPVCRLSSFRLSR 295

>CAGL0G03553g Chr7 complement(345057..345689) [633 bp, 210 aa] {ON}
           weakly similar to uniprot|P40072 Saccharomyces
           cerevisiae YER116c YEU6
          Length = 210

 Score = 33.5 bits (75), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 19/65 (29%), Positives = 33/65 (50%), Gaps = 5/65 (7%)

Query: 52  CPSCKFPGDQCPLVIGLCHHNFHDHCIYRWLD---TPTSKGLCPMCRQTFQLQKGLAIND 108
           CP C  P D    ++  C H F   C+++ ++   TP   G+C +CR+T  +++   +  
Sbjct: 146 CPICFEPPDVA--IMTPCGHVFCCECLFQMVNNSRTPRKGGVCALCRKTINMKQIKMLVL 203

Query: 109 AHVQK 113
             VQK
Sbjct: 204 RKVQK 208

>KLLA0F25740g Chr6 complement(2389226..2390779) [1554 bp, 517 aa]
           {ON} similar to uniprot|P38748 YHL010C Saccharomyces
           cerevisiae Hypothetical ORF
          Length = 517

 Score = 33.9 bits (76), Expect = 0.13,   Method: Composition-based stats.
 Identities = 17/46 (36%), Positives = 21/46 (45%), Gaps = 7/46 (15%)

Query: 52  CPSC--KFPGDQCPLVIGLCHHNFHDHCIYRWLDTPTSKGLCPMCR 95
           CP C  K   +   LV   C H FH  C+ +W       G CP+CR
Sbjct: 215 CPVCLEKLDSEVTGLVTTPCQHTFHCKCLDQW-----KNGNCPVCR 255

>SAKL0A09746g Chr1 (858392..860038) [1647 bp, 548 aa] {ON} similar
           to uniprot|P38748 Saccharomyces cerevisiae YHL010C
           Hypothetical ORF
          Length = 548

 Score = 33.9 bits (76), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 18/56 (32%), Positives = 28/56 (50%), Gaps = 8/56 (14%)

Query: 51  TCPSC--KFPGDQCPLVIGLCHHNFHDHCIYRWLDTPTSKGLCPMCRQT-FQLQKG 103
           +CP C  +   D   L+   C H FH  C+ +W D+      CP+CR +  +L +G
Sbjct: 236 SCPVCLERMDSDITGLITIPCQHTFHCQCLDKWKDSR-----CPVCRYSNLKLTRG 286

>SAKL0D03058g Chr4 complement(252198..252649,252717..252732) [468
           bp, 155 aa] {ON} similar to uniprot|P38239 Saccharomyces
           cerevisiae YBR062C Hypothetical ORF
          Length = 155

 Score = 33.1 bits (74), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 21/59 (35%), Positives = 25/59 (42%), Gaps = 14/59 (23%)

Query: 39  DVCGICRASYNGTCPSCKFPGDQCPLVIGL--CHHNFHDHCIYRWLDTPTSKGLCPMCR 95
           D C IC + YN          D  PLV+ L  C H F   C+  WL        CP+CR
Sbjct: 84  DECSICCSKYNE---------DDYPLVVELPHCSHRFDLECLTPWL---LKNSTCPLCR 130

>KNAG0C05660 Chr3 complement(1091851..1093374) [1524 bp, 507 aa]
           {ON} Anc_2.542 YHL010C
          Length = 507

 Score = 33.9 bits (76), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 17/55 (30%), Positives = 27/55 (49%), Gaps = 8/55 (14%)

Query: 51  TCPSC--KFPGDQCPLVIGLCHHNFHDHCIYRWLDTPTSKGLCPMCR-QTFQLQK 102
            CP C  +   +   L+   C H FH  C+ RW ++      CP+CR  +F+L +
Sbjct: 170 ACPVCLERMDSETTGLITIPCQHTFHCQCLNRWKNSK-----CPVCRYSSFRLSR 219

>Kpol_1056.27 s1056 complement(62728..63555) [828 bp, 275 aa] {ON}
           complement(62728..63555) [828 nt, 276 aa]
          Length = 275

 Score = 33.5 bits (75), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 18/78 (23%), Positives = 31/78 (39%), Gaps = 1/78 (1%)

Query: 5   INEVHSVFAWSWHIPSTSDEDAANNDPIGNDEDEDVCGICRASYNGTCPSCKFPGDQCPL 64
           ++ +   F + W  P     D+   D   ND +ED   +   S   TCP      ++ P+
Sbjct: 140 VDRILRAFPYIWKDPKCILPDSLLGDGFNNDANEDEIEMAGGSIELTCPITTLIYEE-PM 198

Query: 65  VIGLCHHNFHDHCIYRWL 82
           +   C H F    +  +L
Sbjct: 199 ISKKCQHTFDKSGLTEYL 216

>Kpol_505.18 s505 complement(48530..50287) [1758 bp, 585 aa] {ON}
           complement(48530..50287) [1758 nt, 586 aa]
          Length = 585

 Score = 33.5 bits (75), Expect = 0.18,   Method: Composition-based stats.
 Identities = 20/65 (30%), Positives = 31/65 (47%), Gaps = 11/65 (16%)

Query: 36  EDEDVCGICRASYNGTCPSCKFPGDQCPLVIGLCHHNFHDHCIYRWLDTPTSKGLCPMCR 95
           E+ED C IC ++       C+       + I  C H++H HCI R +     + +CP CR
Sbjct: 498 EEED-CSICLSAIK----PCQ------AIFISPCSHSWHFHCIRRLVMMSYPQFVCPNCR 546

Query: 96  QTFQL 100
            +  L
Sbjct: 547 SSCDL 551

>Kwal_27.10419 s27 (337699..338601) [903 bp, 300 aa] {ON} YOL054W -
           Hypothetical ORF [contig 36] FULL
          Length = 300

 Score = 33.5 bits (75), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 18/55 (32%), Positives = 27/55 (49%), Gaps = 4/55 (7%)

Query: 65  VIGLCHHNFHDHCIYRWLDTPTSKGL-CPMCRQTFQLQKGLAINDAHVQKFVEIV 118
           V+  C HN+   CI  WL +  +  L CP CR   + Q  L   ++ +Q  +E V
Sbjct: 5   VMTTCGHNYCYDCISNWLVSNNANELTCPQCRSPLKEQPSL---NSALQNLLEFV 56

>TPHA0B03650 Chr2 complement(857083..861813) [4731 bp, 1576 aa] {ON}
            Anc_1.389 YLR247C
          Length = 1576

 Score = 33.5 bits (75), Expect = 0.19,   Method: Composition-based stats.
 Identities = 18/49 (36%), Positives = 26/49 (53%), Gaps = 12/49 (24%)

Query: 62   CPLVIGL--------CHHNFHDHCIYRWLDTPTSKGLCPMC-RQTFQLQ 101
            CP+ +GL        C H F ++CI+ WL   ++   CP+C R T Q Q
Sbjct: 1271 CPICLGLIHTGSMISCGHFFCNNCIFSWLKLNSN---CPLCKRDTTQSQ 1316

>NDAI0B01820 Chr2 (433938..435815) [1878 bp, 625 aa] {ON} Anc_2.542
          Length = 625

 Score = 33.5 bits (75), Expect = 0.22,   Method: Compositional matrix adjust.
 Identities = 16/47 (34%), Positives = 23/47 (48%), Gaps = 7/47 (14%)

Query: 51  TCPSC--KFPGDQCPLVIGLCHHNFHDHCIYRWLDTPTSKGLCPMCR 95
           TCP C  +   +   L+   C H FH  C+ +W D+      CP+CR
Sbjct: 267 TCPVCLERMDSETTGLITIPCQHTFHCSCLDKWNDSR-----CPVCR 308

>TPHA0F01840 Chr6 complement(422396..423961) [1566 bp, 521 aa] {ON}
           Anc_2.157 YHR115C
          Length = 521

 Score = 33.5 bits (75), Expect = 0.22,   Method: Compositional matrix adjust.
 Identities = 14/41 (34%), Positives = 22/41 (53%)

Query: 64  LVIGLCHHNFHDHCIYRWLDTPTSKGLCPMCRQTFQLQKGL 104
           + I  C H++H HCI R +     + +CP CR +  L+  L
Sbjct: 426 IFISPCSHSWHFHCIRRLVMMSYPQFVCPNCRSSCDLEASL 466

>NCAS0A04680 Chr1 complement(932306..933130) [825 bp, 274 aa] {ON} 
          Length = 274

 Score = 33.1 bits (74), Expect = 0.23,   Method: Compositional matrix adjust.
 Identities = 24/67 (35%), Positives = 30/67 (44%), Gaps = 18/67 (26%)

Query: 32  IGNDEDEDVCGICRASYNG---TCPSCKFPGDQCPLVIGLCHHNFHDHCIYRWLDTPTSK 88
           + N  DE  C ICR +Y+    T  +C  P          C H+FH  CI  WL      
Sbjct: 203 LSNSSDE--CPICRIAYSDDFETEITC-LPN---------CSHHFHFECIKLWLQ---KN 247

Query: 89  GLCPMCR 95
            LCP+CR
Sbjct: 248 SLCPLCR 254

>NCAS0G02520 Chr7 (451683..453239) [1557 bp, 518 aa] {ON} Anc_2.157
           YHR115C
          Length = 518

 Score = 33.1 bits (74), Expect = 0.24,   Method: Compositional matrix adjust.
 Identities = 21/72 (29%), Positives = 33/72 (45%), Gaps = 11/72 (15%)

Query: 33  GNDEDEDVCGICRASYNGTCPSCKFPGDQCPLVIGLCHHNFHDHCIYRWLDTPTSKGLCP 92
           G +++ED C IC +        C+       + I  C H++H HCI R +     + +CP
Sbjct: 422 GTEQEED-CSICLSKIR----PCQ------AIFISPCAHSWHFHCIRRLVMLSYPQFVCP 470

Query: 93  MCRQTFQLQKGL 104
            CR    L+  L
Sbjct: 471 NCRSACDLEAAL 482

>NDAI0G05200 Chr7 (1261661..1266421) [4761 bp, 1586 aa] {ON} Anc_1.389
          Length = 1586

 Score = 33.5 bits (75), Expect = 0.24,   Method: Composition-based stats.
 Identities = 14/32 (43%), Positives = 18/32 (56%), Gaps = 3/32 (9%)

Query: 69   CHHNFHDHCIYRWLDTPTSKGLCPMCRQTFQL 100
            C H F + CIY WL T T   +CP+C+    L
Sbjct: 1282 CGHFFCEDCIYDWLQTRT---ICPICKHKASL 1310

>CAGL0L03960g Chr12 complement(463751..465562) [1812 bp, 603 aa]
           {ON} similar to uniprot|P53924 Saccharomyces cerevisiae
           YNL116w
          Length = 603

 Score = 33.1 bits (74), Expect = 0.24,   Method: Composition-based stats.
 Identities = 20/76 (26%), Positives = 33/76 (43%), Gaps = 10/76 (13%)

Query: 37  DEDVCGICRASYNGTCPSCKFPGDQCPLVIGLCHHNFHDHCIYRWLDTPTSKGLCPMCRQ 96
           DE+ C IC +        C+       + I  C H +H  C+ R +     + +CP CR 
Sbjct: 511 DEEDCSICLSKIK----PCQ------AIFISPCAHTWHFRCVRRLVMLAYPQFVCPNCRS 560

Query: 97  TFQLQKGLAINDAHVQ 112
           T  L+  L  +D+  +
Sbjct: 561 TCDLEASLDNSDSESE 576

>Ecym_4250 Chr4 complement(517592..519560,519632..519636) [1974 bp,
           657 aa] {ON} similar to Ashbya gossypii AGL191W 1-intron
          Length = 657

 Score = 33.1 bits (74), Expect = 0.28,   Method: Composition-based stats.
 Identities = 20/53 (37%), Positives = 26/53 (49%), Gaps = 6/53 (11%)

Query: 61  QCPLVIGLCHHNFHDHCIYRWLDTPTSKGLCPMCRQTFQLQKGL--AINDAHV 111
            CP  +  C H F   CI++W     S   CP+CR      +GL  AIND+ V
Sbjct: 274 HCPTELP-CGHIFGRDCIFKWTKEHNS---CPICRSRIVEDEGLNHAINDSPV 322

>KAFR0F00740 Chr6 (144375..145907) [1533 bp, 510 aa] {ON} Anc_2.157
           YHR115C
          Length = 510

 Score = 33.1 bits (74), Expect = 0.29,   Method: Compositional matrix adjust.
 Identities = 21/76 (27%), Positives = 33/76 (43%), Gaps = 10/76 (13%)

Query: 34  NDEDEDVCGICRASYNGTCPSCKFPGDQCPLVIGLCHHNFHDHCIYRWLDTPTSKGLCPM 93
           N  D++ C IC +        C+       + I  C H++H HCI R +     + +CP 
Sbjct: 396 NGMDQEDCSICLSK----IKPCQ------AIFISPCSHSWHFHCIRRLVMVSYPQFVCPN 445

Query: 94  CRQTFQLQKGLAINDA 109
           CR +  L+  L   D 
Sbjct: 446 CRASCDLEATLESEDG 461

>SAKL0E04488g Chr5 (359434..362817) [3384 bp, 1127 aa] {ON} similar
           to uniprot|P32849 Saccharomyces cerevisiae YLR032W RAD5
           Single-stranded DNA-dependent ATPase involved in
           postreplication repair contains RING finger domain
          Length = 1127

 Score = 33.1 bits (74), Expect = 0.30,   Method: Compositional matrix adjust.
 Identities = 14/43 (32%), Positives = 24/43 (55%), Gaps = 3/43 (6%)

Query: 69  CHHNFHDHCIYRWLDTPTSKGL---CPMCRQTFQLQKGLAIND 108
           C H F +HC+  ++D  T K L   CP CR++   ++ L + +
Sbjct: 893 CAHAFCEHCLLEYIDFQTQKKLELKCPNCRESIDPKRLLTLKE 935

>Ecym_2684 Chr2 complement(1321556..1322716) [1161 bp, 386 aa] {ON}
           similar to Ashbya gossypii AGL217W
          Length = 386

 Score = 32.7 bits (73), Expect = 0.35,   Method: Compositional matrix adjust.
 Identities = 15/44 (34%), Positives = 22/44 (50%), Gaps = 1/44 (2%)

Query: 65  VIGLCHHNFHDHCIYRWLDTPTSKGL-CPMCRQTFQLQKGLAIN 107
           V+  C HN+  +CI  WL+   +  L CP CR T      L ++
Sbjct: 5   VMTSCGHNYCYYCISNWLNNNNATELNCPQCRTTIGAMPALNVS 48

>KNAG0A07090 Chr1 complement(1110424..1112712) [2289 bp, 762 aa]
           {ON} Anc_2.545 YKL034W
          Length = 762

 Score = 32.7 bits (73), Expect = 0.37,   Method: Composition-based stats.
 Identities = 13/36 (36%), Positives = 20/36 (55%), Gaps = 3/36 (8%)

Query: 60  DQCPLVIGLCHHNFHDHCIYRWLDTPTSKGLCPMCR 95
           DQ   ++  C+H FH  C+  W+   + K  CP+CR
Sbjct: 724 DQYSYMVTPCNHIFHTECLENWM---SYKLQCPVCR 756

>KNAG0J00850 Chr10 complement(146187..146675) [489 bp, 162 aa] {ON}
           Anc_3.279 YBR062C
          Length = 162

 Score = 32.0 bits (71), Expect = 0.37,   Method: Compositional matrix adjust.
 Identities = 20/49 (40%), Positives = 25/49 (51%), Gaps = 7/49 (14%)

Query: 51  TCPSC--KFPGDQCPLVIGL--CHHNFHDHCIYRWLDTPTSKGLCPMCR 95
           TC  C  +F  D  PL+  L  C H F   CI  WL   +++  CPMCR
Sbjct: 91  TCSICFERFGNDNYPLLAQLPHCGHIFDLQCISMWL---SNQVTCPMCR 136

>TBLA0B01260 Chr2 (266584..269241) [2658 bp, 885 aa] {ON} Anc_2.157
           YHR115C
          Length = 885

 Score = 32.7 bits (73), Expect = 0.37,   Method: Composition-based stats.
 Identities = 13/34 (38%), Positives = 19/34 (55%)

Query: 64  LVIGLCHHNFHDHCIYRWLDTPTSKGLCPMCRQT 97
           + I  C H++H HCI R +     + +CP CR T
Sbjct: 782 IFISPCSHSWHFHCIRRLVMLQYPQFVCPNCRST 815

>ACR267C Chr3 complement(841323..842726) [1404 bp, 467 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YNL116W and
           YHR115C
          Length = 467

 Score = 32.7 bits (73), Expect = 0.39,   Method: Compositional matrix adjust.
 Identities = 28/107 (26%), Positives = 46/107 (42%), Gaps = 18/107 (16%)

Query: 1   MKVKINEVHSVFAWSWHIPSTSDEDAA---NNDPIGNDEDEDVCGICRASYNGTCPSCKF 57
           M+V++N+     +W     + + E  A   N   +    +E+ C IC          CK 
Sbjct: 330 MRVELNK-----SWKRRANAFNKEALARLRNLQKLTAGLEEEDCSICL---------CKI 375

Query: 58  PGDQCPLVIGLCHHNFHDHCIYRWLDTPTSKGLCPMCRQTFQLQKGL 104
              Q  + I  C H++H  CI R + T   + +CP CR +  L+  L
Sbjct: 376 KPCQA-IFISPCSHSWHYQCIRRLVMTQYPQFICPNCRSSCDLEASL 421

>KAFR0A01990 Chr1 (418279..419961) [1683 bp, 560 aa] {ON} Anc_2.542
           YHL010C
          Length = 560

 Score = 32.7 bits (73), Expect = 0.39,   Method: Compositional matrix adjust.
 Identities = 15/49 (30%), Positives = 24/49 (48%), Gaps = 7/49 (14%)

Query: 51  TCPSC--KFPGDQCPLVIGLCHHNFHDHCIYRWLDTPTSKGLCPMCRQT 97
           TCP C  +   +   L+   C H FH  C+ +W ++      CP+CR +
Sbjct: 240 TCPVCLERMDSETTGLITIPCQHTFHCQCLDKWKNSQ-----CPVCRYS 283

>KLTH0C05258g Chr3 complement(455688..456130,456190..456205) [459
           bp, 152 aa] {ON} similar to uniprot|P38239 Saccharomyces
           cerevisiae YBR062C Hypothetical ORF
          Length = 152

 Score = 32.0 bits (71), Expect = 0.40,   Method: Compositional matrix adjust.
 Identities = 20/59 (33%), Positives = 25/59 (42%), Gaps = 14/59 (23%)

Query: 39  DVCGICRASYNGTCPSCKFPGDQCPLVIGL--CHHNFHDHCIYRWLDTPTSKGLCPMCR 95
           D C IC          C +  D  PLV+ L  C H F   C+  WL    +   CP+CR
Sbjct: 81  DACSIC---------CCGYLDDTHPLVVKLPHCSHRFDLECVAVWLSKSRT---CPLCR 127

>KLLA0C05874g Chr3 complement(520079..521740) [1662 bp, 553 aa] {ON}
           weakly similar to uniprot|Q08109 Saccharomyces
           cerevisiae YOL013C HRD1 Ubiquitin-protein ligase
           required for endoplasmic reticulum-associated
           degradation (ERAD) of misfolded proteins genetically
           linked to the unfolded protein response (UPR) regulated
           through association with Hrd3p contains an H2 ring
           finger
          Length = 553

 Score = 32.3 bits (72), Expect = 0.42,   Method: Composition-based stats.
 Identities = 18/58 (31%), Positives = 27/58 (46%), Gaps = 8/58 (13%)

Query: 39  DVCGICRASYNGTCPSCKFPGDQCPLVIGLCHHNFHDHCIYRWL-DTPTSKGLCPMCR 95
           D+C +C   +    PS +   D   + I  C H  H  C+  W+  +PT    CP+CR
Sbjct: 351 DICIVCMEDF---LPSHQRKSDGKKVKILPCTHALHLSCLKNWIARSPT----CPICR 401

>KAFR0B01460 Chr2 (277155..279440) [2286 bp, 761 aa] {ON} Anc_2.545
           YKL034W
          Length = 761

 Score = 32.7 bits (73), Expect = 0.43,   Method: Composition-based stats.
 Identities = 13/36 (36%), Positives = 20/36 (55%), Gaps = 3/36 (8%)

Query: 60  DQCPLVIGLCHHNFHDHCIYRWLDTPTSKGLCPMCR 95
           DQ   ++  C+H FH  C+  W+   + K  CP+CR
Sbjct: 723 DQHSYMVTPCNHIFHTSCLENWM---SYKLQCPVCR 755

>Smik_11.213 Chr11 (358262..360541) [2280 bp, 759 aa] {ON} YKL034W
           (REAL)
          Length = 759

 Score = 32.7 bits (73), Expect = 0.43,   Method: Composition-based stats.
 Identities = 20/66 (30%), Positives = 29/66 (43%), Gaps = 7/66 (10%)

Query: 33  GNDEDEDVCGICRAS---YNGTCPSCKFPGDQCPLVIGLCHHNFHDHCIYRWLDTPTSKG 89
           G  E+   C IC +    Y    P      DQ   ++  C+H FH  C+  W+   + K 
Sbjct: 692 GTAENTVDCAICMSDVPIYIEEVPETH-KVDQHSYMVTPCNHVFHTPCLENWM---SYKL 747

Query: 90  LCPMCR 95
            CP+CR
Sbjct: 748 QCPVCR 753

>KNAG0A06030 Chr1 complement(909762..913214) [3453 bp, 1150 aa] {ON}
           Anc_2.411 YLR032W
          Length = 1150

 Score = 32.7 bits (73), Expect = 0.45,   Method: Composition-based stats.
 Identities = 23/84 (27%), Positives = 33/84 (39%), Gaps = 17/84 (20%)

Query: 24  EDAANNDPIGNDEDEDVCGICRASYNGTCPSCKFPGDQCPLVIGLCHHNFHDHCIYRWLD 83
           E   +N+ + N E    C IC             P D   L++  C H F D CI  ++ 
Sbjct: 881 EKYPDNNSLTNLE----CSICTTE----------PIDPHKLILTDCGHPFCDKCILEYIT 926

Query: 84  TPTSKGL---CPMCRQTFQLQKGL 104
               K L   CP+CR+      G+
Sbjct: 927 YQKEKKLDVKCPICREMLDDTSGM 950

>YKL034W Chr11 (371829..374105) [2277 bp, 758 aa] {ON}
           TUL1Golgi-localized RING-finger ubiquitin ligase (E3),
           involved in ubiquitinating and sorting membrane proteins
           that contain polar transmembrane domains to
           multivesicular bodies for delivery to the vacuole for
           quality control purposes
          Length = 758

 Score = 32.3 bits (72), Expect = 0.45,   Method: Composition-based stats.
 Identities = 13/36 (36%), Positives = 20/36 (55%), Gaps = 3/36 (8%)

Query: 60  DQCPLVIGLCHHNFHDHCIYRWLDTPTSKGLCPMCR 95
           DQ   ++  C+H FH  C+  W++    K  CP+CR
Sbjct: 720 DQHSYMVTPCNHVFHTSCLENWMNY---KLQCPVCR 752

>Suva_11.189 Chr11 (354713..356989) [2277 bp, 758 aa] {ON} YKL034W
           (REAL)
          Length = 758

 Score = 32.3 bits (72), Expect = 0.46,   Method: Composition-based stats.
 Identities = 13/36 (36%), Positives = 20/36 (55%), Gaps = 3/36 (8%)

Query: 60  DQCPLVIGLCHHNFHDHCIYRWLDTPTSKGLCPMCR 95
           DQ   ++  C+H FH  C+  W+   + K  CP+CR
Sbjct: 720 DQHSYMVTPCNHVFHTSCLENWM---SYKLQCPVCR 752

>NDAI0F02770 Chr6 complement(677011..678675) [1665 bp, 554 aa] {ON}
           Anc_2.157 YHR115C
          Length = 554

 Score = 32.3 bits (72), Expect = 0.48,   Method: Compositional matrix adjust.
 Identities = 20/61 (32%), Positives = 29/61 (47%), Gaps = 11/61 (18%)

Query: 35  DEDEDVCGICRASYNGTCPSCKFPGDQCPLVIGLCHHNFHDHCIYRWLDTPTSKGLCPMC 94
           +EDED C IC +        C+       + I  C H++H HCI R +     + +CP C
Sbjct: 466 NEDED-CSICLSKIKA----CQ------AIFISPCAHSWHFHCIRRLVMLTYPQFVCPNC 514

Query: 95  R 95
           R
Sbjct: 515 R 515

>SAKL0E10824g Chr5 complement(902623..904050) [1428 bp, 475 aa] {ON}
           similar to uniprot|Q75BK4 Ashbya gossypii ACR267C
           ACR267Cp and some similarites with YNL116W
           uniprot|P53924 Saccharomyces cerevisiae YNL116W DMA2
           Protein involved in regulating spindle position and
           orientation functionally redundant with Dma1p homolog of
           S. pombe Dma1 and H. sapiens Chfr
          Length = 475

 Score = 32.3 bits (72), Expect = 0.53,   Method: Compositional matrix adjust.
 Identities = 13/41 (31%), Positives = 22/41 (53%)

Query: 64  LVIGLCHHNFHDHCIYRWLDTPTSKGLCPMCRQTFQLQKGL 104
           + I  C H++H  C+ R + T   + +CP CR +  L+  L
Sbjct: 402 IFISPCSHSWHYQCVRRLVMTSYPQFVCPNCRSSCDLEASL 442

>Ecym_5445 Chr5 complement(920562..921527) [966 bp, 321 aa] {ON}
          similar to Ashbya gossypii ABR104W
          Length = 321

 Score = 32.0 bits (71), Expect = 0.54,   Method: Compositional matrix adjust.
 Identities = 12/27 (44%), Positives = 14/27 (51%)

Query: 69 CHHNFHDHCIYRWLDTPTSKGLCPMCR 95
          C H FH  CI +W  +  S   CP CR
Sbjct: 26 CQHEFHLSCIRKWYHSRISDRTCPNCR 52

>KLTH0E09834g Chr5 complement(885503..886942) [1440 bp, 479 aa] {ON}
           some similarities with uniprot|P53924 Saccharomyces
           cerevisiae YNL116W DMA2 Protein involved in regulating
           spindle position and orientation functionally redundant
           with Dma1p homolog of S. pombe Dma1 and H. sapiens Chfr
          Length = 479

 Score = 32.0 bits (71), Expect = 0.58,   Method: Compositional matrix adjust.
 Identities = 13/41 (31%), Positives = 22/41 (53%)

Query: 64  LVIGLCHHNFHDHCIYRWLDTPTSKGLCPMCRQTFQLQKGL 104
           + I  C H++H  C+ R + T   + +CP CR +  L+  L
Sbjct: 411 IFISPCSHSWHYQCVRRLVMTTYPQFVCPNCRSSCDLEASL 451

>Kwal_47.17904 s47 complement(602106..603518) [1413 bp, 470 aa] {ON}
           YNL116W - Hypothetical ORF [contig 204] FULL
          Length = 470

 Score = 32.0 bits (71), Expect = 0.69,   Method: Compositional matrix adjust.
 Identities = 13/41 (31%), Positives = 22/41 (53%)

Query: 64  LVIGLCHHNFHDHCIYRWLDTPTSKGLCPMCRQTFQLQKGL 104
           + I  C H++H  C+ R + T   + +CP CR +  L+  L
Sbjct: 402 IFISPCSHSWHYQCVRRLVMTTYPQFVCPNCRSSCDLEASL 442

>Kpol_1002.8 s1002 complement(21450..23126) [1677 bp, 558 aa] {ON}
           complement(21450..23126) [1677 nt, 559 aa]
          Length = 558

 Score = 32.0 bits (71), Expect = 0.73,   Method: Compositional matrix adjust.
 Identities = 15/47 (31%), Positives = 22/47 (46%), Gaps = 7/47 (14%)

Query: 51  TCPSC--KFPGDQCPLVIGLCHHNFHDHCIYRWLDTPTSKGLCPMCR 95
           TCP C  +       L+   C H FH  C+ +W ++      CP+CR
Sbjct: 234 TCPVCLERLDDGTTGLITIPCQHTFHCQCLDKWKNSK-----CPVCR 275

>Suva_1.69 Chr1 (120731..124546) [3816 bp, 1271 aa] {ON} YAL002W
            (REAL)
          Length = 1271

 Score = 32.0 bits (71), Expect = 0.74,   Method: Composition-based stats.
 Identities = 14/34 (41%), Positives = 18/34 (52%), Gaps = 1/34 (2%)

Query: 61   QCPLVIGLCHHNFHDHCIYRWLDTPTSKGLCPMC 94
            + PLVI  CHH FH  C+      P +K  C +C
Sbjct: 1232 ETPLVIFKCHHGFHQTCLENLAQKP-NKYTCLIC 1264

>TDEL0D03460 Chr4 (637921..638355) [435 bp, 144 aa] {ON} Anc_3.279
           YBR062C
          Length = 144

 Score = 30.8 bits (68), Expect = 0.77,   Method: Compositional matrix adjust.
 Identities = 16/41 (39%), Positives = 21/41 (51%), Gaps = 5/41 (12%)

Query: 57  FPGDQCPLVIGL--CHHNFHDHCIYRWLDTPTSKGLCPMCR 95
           +  D  PLV+ L  C H+F   C+  W    TS   CP+CR
Sbjct: 82  YLNDGYPLVVRLPHCGHDFDLECLSVWFSKSTS---CPLCR 119

>Suva_13.415 Chr13 (714887..717973) [3087 bp, 1028 aa] {ON} YMR231W
           (REAL)
          Length = 1028

 Score = 32.0 bits (71), Expect = 0.77,   Method: Composition-based stats.
 Identities = 18/49 (36%), Positives = 22/49 (44%), Gaps = 4/49 (8%)

Query: 49  NGTCPSCKFPGDQCPLVIGLCHHNFHDHCIYRWLDTPTSKG---LCPMC 94
           N TC  C    D  P+V   C H +H HC+    DT  S+     CP C
Sbjct: 923 NQTCFMCNLTLD-IPVVFFKCGHTYHQHCLNEEEDTLESERKLFKCPKC 970

>Kpol_1030.29 s1030 complement(56650..59700) [3051 bp, 1016 aa] {ON}
           complement(56650..59700) [3051 nt, 1017 aa]
          Length = 1016

 Score = 32.0 bits (71), Expect = 0.81,   Method: Composition-based stats.
 Identities = 20/73 (27%), Positives = 34/73 (46%), Gaps = 5/73 (6%)

Query: 49  NGTCPSCKFPGDQCPLVIGLCHHNFHDHCIYRWLDTPTSKGL---CPMCRQTFQLQKGLA 105
           N  C  C+  G + P+V+  C HN+H  C+    D  T   +   CP C    +  + LA
Sbjct: 914 NVNCCMCE-AGLELPIVVFKCTHNYHQRCLNE-EDKKTDGSIVYKCPKCIVDLESSERLA 971

Query: 106 INDAHVQKFVEIV 118
            +   V+  +++V
Sbjct: 972 KSQQEVKNNIKLV 984

>KNAG0H03510 Chr8 complement(654395..656050) [1656 bp, 551 aa] {ON}
           Anc_2.157 YHR115C
          Length = 551

 Score = 31.6 bits (70), Expect = 0.81,   Method: Compositional matrix adjust.
 Identities = 19/72 (26%), Positives = 33/72 (45%), Gaps = 10/72 (13%)

Query: 33  GNDEDEDVCGICRASYNGTCPSCKFPGDQCPLVIGLCHHNFHDHCIYRWLDTPTSKGLCP 92
           G +++E+ C IC +        C+       + I  C H++H HC+ R +     + +CP
Sbjct: 443 GVEQEEEDCSICLSKIK----PCQ------AIFISPCSHSWHFHCVRRLVMLSYPQFVCP 492

Query: 93  MCRQTFQLQKGL 104
            CR    L+  L
Sbjct: 493 NCRSACDLEATL 504

>Skud_11.192 Chr11 (351379..353655) [2277 bp, 758 aa] {ON} YKL034W
           (REAL)
          Length = 758

 Score = 31.6 bits (70), Expect = 0.83,   Method: Composition-based stats.
 Identities = 13/36 (36%), Positives = 19/36 (52%), Gaps = 3/36 (8%)

Query: 60  DQCPLVIGLCHHNFHDHCIYRWLDTPTSKGLCPMCR 95
           DQ   ++  C H FH  C+  W+   + K  CP+CR
Sbjct: 720 DQHSYMVTPCDHVFHTSCLENWM---SYKLQCPVCR 752

>ZYRO0B16258g Chr2 complement(1317605..1319344) [1740 bp, 579 aa]
           {ON} similar to uniprot|P53924 Saccharomyces cerevisiae
           YNL116W DMA2 Protein involved in regulating spindle
           position and orientation functionally redundant with
           Dma1p homolog of S. pombe Dma1 and H. sapiens Chfr
          Length = 579

 Score = 31.6 bits (70), Expect = 0.83,   Method: Composition-based stats.
 Identities = 19/60 (31%), Positives = 28/60 (46%), Gaps = 11/60 (18%)

Query: 36  EDEDVCGICRASYNGTCPSCKFPGDQCPLVIGLCHHNFHDHCIYRWLDTPTSKGLCPMCR 95
           E+ED C IC +        C+       + I  C H++H  CI R + T   + +CP CR
Sbjct: 489 EEED-CSICLSKIK----PCQ------AMFISPCSHSWHFQCIRRLVMTSYPQFVCPNCR 537

>CAGL0L01947g Chr12 (227996..230269) [2274 bp, 757 aa] {ON} similar
           to uniprot|P36096 Saccharomyces cerevisiae YKL034w
          Length = 757

 Score = 31.6 bits (70), Expect = 0.97,   Method: Composition-based stats.
 Identities = 22/67 (32%), Positives = 29/67 (43%), Gaps = 8/67 (11%)

Query: 33  GNDEDEDV-CGICRAS---YNGTCPSCKFPGDQCPLVIGLCHHNFHDHCIYRWLDTPTSK 88
           G  E+  V C IC A    Y    P      D+   +I  C H FH  C+  W+   + K
Sbjct: 689 GGSENHTVDCAICMAEFPVYVEELPETH-QVDKDSYMITPCDHMFHTSCLESWM---SYK 744

Query: 89  GLCPMCR 95
             CP+CR
Sbjct: 745 LQCPVCR 751

>YMR231W Chr13 (733545..736634) [3090 bp, 1029 aa] {ON}
           PEP5Component of CORVET tethering complex; peripheral
           vacuolar membrane protein required for protein
           trafficking and vacuole biogenesis; interacts with Pep7p
          Length = 1029

 Score = 31.6 bits (70), Expect = 1.0,   Method: Composition-based stats.
 Identities = 18/49 (36%), Positives = 23/49 (46%), Gaps = 4/49 (8%)

Query: 49  NGTCPSCKFPGDQCPLVIGLCHHNFHDHCIYRWLDTPTSKG---LCPMC 94
           N TC  C+   D  P+V   C H +H HC+    DT  S+     CP C
Sbjct: 925 NQTCFMCRLTLD-IPVVFFKCGHIYHQHCLNEEEDTLESERKLFKCPKC 972

>TDEL0B06340 Chr2 complement(1122797..1125085) [2289 bp, 762 aa]
           {ON} Anc_2.545 YKL034W
          Length = 762

 Score = 31.6 bits (70), Expect = 1.0,   Method: Composition-based stats.
 Identities = 22/86 (25%), Positives = 35/86 (40%), Gaps = 10/86 (11%)

Query: 13  AWSWHIPSTSDEDAANNDPIGNDEDEDVCGICRAS---YNGTCPSCKFPGDQCPLVIGLC 69
            +S+H P ++ E   +   + +  D   C IC +    Y    P       Q  +    C
Sbjct: 678 GYSYHKPMSAQELMEHGSSVDHTVD---CAICMSEVPVYVEDVPETHKVDLQTYMTTP-C 733

Query: 70  HHNFHDHCIYRWLDTPTSKGLCPMCR 95
            H FH  C+  W+   + K  CP+CR
Sbjct: 734 GHVFHTQCLENWM---SYKLQCPVCR 756

>Kpol_1036.66 s1036 complement(182540..184546) [2007 bp, 668 aa]
           {ON} complement(182540..184546) [2007 nt, 669 aa]
          Length = 668

 Score = 31.6 bits (70), Expect = 1.0,   Method: Composition-based stats.
 Identities = 11/28 (39%), Positives = 15/28 (53%), Gaps = 3/28 (10%)

Query: 69  CHHNFHDHCIYRWLDTPTSKGLCPMCRQ 96
           CHH F   C+Y+W      +  CP+CR 
Sbjct: 264 CHHIFGRECLYKW---TRHENTCPLCRH 288

>TDEL0F02870 Chr6 complement(518828..519610) [783 bp, 260 aa] {ON} 
          Length = 260

 Score = 31.2 bits (69), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 17/59 (28%), Positives = 30/59 (50%), Gaps = 12/59 (20%)

Query: 64  LVIGLCHHNFHDHCIYRWLDTPTSKG-----LCPMCR------QTFQLQKGLAINDAHV 111
           +V+  C H FH  C+  W  +P  +G     +CP+CR      + F ++ GL +++  V
Sbjct: 180 IVMIPCQHYFHAGCLKEWF-SPQRRGKRRPLVCPLCRMDIVKCKAFCMRLGLLMSELKV 237

>TDEL0B05200 Chr2 (914227..915801) [1575 bp, 524 aa] {ON} Anc_2.157
           YHR115C
          Length = 524

 Score = 31.2 bits (69), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 16/45 (35%), Positives = 23/45 (51%)

Query: 64  LVIGLCHHNFHDHCIYRWLDTPTSKGLCPMCRQTFQLQKGLAIND 108
           + I  C H +H  CI R + T   + +CP CR T  L+  L  +D
Sbjct: 449 MFISPCSHCWHFQCIRRLVMTSYPQFVCPNCRLTCDLEASLENSD 493

>Skud_8.176 Chr8 complement(313886..315127) [1242 bp, 413 aa] {ON}
           YHR115C (REAL)
          Length = 413

 Score = 31.2 bits (69), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 13/41 (31%), Positives = 21/41 (51%)

Query: 64  LVIGLCHHNFHDHCIYRWLDTPTSKGLCPMCRQTFQLQKGL 104
           + I  C H++H HC+ R +     + +CP CR    L+  L
Sbjct: 335 IFISPCAHSWHFHCVRRLVIMSYPQFMCPNCRSNCDLETTL 375

>Ecym_5428 Chr5 complement(881972..883396) [1425 bp, 474 aa] {ON}
           similar to Ashbya gossypii ACR267C
          Length = 474

 Score = 31.2 bits (69), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 25/101 (24%), Positives = 47/101 (46%), Gaps = 12/101 (11%)

Query: 1   MKVKINEVHSVFAWSWHIPSTSDEDAANNDPIGNDEDEDVCGICRASYNGTCPSCKFPGD 60
           M+V++N+   + A +++  + +         +G +E++  C IC          CK    
Sbjct: 339 MRVELNKSWKMRANAFNKEALARLRNLQKLTVGLEEED--CSICL---------CKIKPC 387

Query: 61  QCPLVIGLCHHNFHDHCIYRWLDTPTSKGLCPMCRQTFQLQ 101
           Q  + I  C H++H  CI R + T   + +CP CR +  L+
Sbjct: 388 QA-IFISPCSHSWHYQCIRRLVMTQYPQFVCPNCRSSCDLE 427

>KLLA0C15697g Chr3 (1360289..1361203) [915 bp, 304 aa] {ON}
          similar to uniprot|Q06834 Saccharomyces cerevisiae
          YPR093C ASR1 Protein involved in a putative alcohol-
          responsive signaling pathway accumulates in the nucleus
          under alcohol stress contains a Ring/PHD finger domain
          Length = 304

 Score = 30.8 bits (68), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 20/58 (34%), Positives = 28/58 (48%), Gaps = 11/58 (18%)

Query: 39 DVCGICRASYNGTCPSCKFPGDQCPLVIGLCHHNFHDHCIYRWLDTPTSKGLCPMCRQ 96
          ++CGIC  S N T        DQ  L+   C H +H  CI +W    ++   CP CR+
Sbjct: 3  EICGICLESMNET--------DQGELLP--CEHRYHVSCIRKW-HLYSNDFKCPTCRK 49

>YDR143C Chr4 complement(742042..743874) [1833 bp, 610 aa] {ON}
           SAN1Ubiquitin-protein ligase; involved in the
           proteasome-dependent degradation of aberrant nuclear
           proteins; targets substrates with regions of exposed
           hydrophobicity containing 5 or more contiguous
           hydrophobic residues; contains intrinsically disordered
           regions that contribute to substrate recognition
          Length = 610

 Score = 31.2 bits (69), Expect = 1.4,   Method: Composition-based stats.
 Identities = 16/51 (31%), Positives = 25/51 (49%), Gaps = 5/51 (9%)

Query: 69  CHHNFHDHCIYRWLDTPTSKGLCPMCRQTFQLQKGLAINDAHVQKFVEIVS 119
           C H F   CIY+W     S   CP+CRQ  ++ + + +  A  Q   E+ +
Sbjct: 257 CGHIFGRECIYKWSRLENS---CPLCRQ--KISESVGVQRAAQQDTDEVAA 302

>Kwal_26.8090 s26 complement(641408..642970) [1563 bp, 520 aa] {ON}
           YHL010C - Hypothetical ORF [contig 55] FULL
          Length = 520

 Score = 30.8 bits (68), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 16/47 (34%), Positives = 21/47 (44%), Gaps = 7/47 (14%)

Query: 51  TCPSC--KFPGDQCPLVIGLCHHNFHDHCIYRWLDTPTSKGLCPMCR 95
           TCP C  +   +   L    C H FH  C+ +W D       CP+CR
Sbjct: 226 TCPVCLERLDSEVTGLATIPCQHTFHCVCLNKWGDNR-----CPVCR 267

>Suva_15.311 Chr15 complement(542475..543284) [810 bp, 269 aa] {ON}
           YHR115C (REAL)
          Length = 269

 Score = 30.8 bits (68), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 13/42 (30%), Positives = 21/42 (50%)

Query: 63  PLVIGLCHHNFHDHCIYRWLDTPTSKGLCPMCRQTFQLQKGL 104
            + I  C H++H HC+ R +     + +CP CR    L+  L
Sbjct: 192 AIFISPCAHSWHFHCVRRLVILSYPQFMCPNCRSNCDLEATL 233

>Smik_1.66 Chr1 (126883..130701) [3819 bp, 1272 aa] {ON} YAL002W
            (REAL)
          Length = 1272

 Score = 31.2 bits (69), Expect = 1.5,   Method: Composition-based stats.
 Identities = 13/35 (37%), Positives = 19/35 (54%), Gaps = 1/35 (2%)

Query: 61   QCPLVIGLCHHNFHDHCIYRWLDTPTSKGLCPMCR 95
            + PLVI  CHH FH  C+      P ++  C +C+
Sbjct: 1233 KTPLVIFKCHHGFHQTCLENLAQRP-NEYFCLICQ 1266

>TDEL0F04440 Chr6 complement(833116..834780) [1665 bp, 554 aa] {ON}
           Anc_8.317 YDR143C
          Length = 554

 Score = 30.8 bits (68), Expect = 1.5,   Method: Composition-based stats.
 Identities = 23/85 (27%), Positives = 32/85 (37%), Gaps = 19/85 (22%)

Query: 69  CHHNFHDHCIYRWLDTPTSKGLCPMCRQTFQLQKGLAINDAHVQKFVEIVSRRREEMIEE 128
           C+H F   C+++W     S   CP+CR                 K VE  + +  E    
Sbjct: 218 CNHVFGRECLFKWSQLENS---CPLCR----------------HKIVEAAAGQSGEDSNG 258

Query: 129 GVAEEFVDFDEPIRQNTDNPIGRQQ 153
            VA +  +  E IRQ   NP    Q
Sbjct: 259 AVANQNAEAFERIRQALYNPSAPDQ 283

>KLTH0D07216g Chr4 complement(631219..633462) [2244 bp, 747 aa] {ON}
           similar to uniprot|P36096 Saccharomyces cerevisiae
           YKL034W TUL1 Transmembrane Ubiquitin Ligase
          Length = 747

 Score = 30.8 bits (68), Expect = 1.6,   Method: Composition-based stats.
 Identities = 13/36 (36%), Positives = 19/36 (52%), Gaps = 3/36 (8%)

Query: 60  DQCPLVIGLCHHNFHDHCIYRWLDTPTSKGLCPMCR 95
           D+   +I  C H FH  C+  W+   + K  CP+CR
Sbjct: 709 DKESYMITPCSHIFHTQCLESWM---SYKLQCPVCR 741

>Kpol_1072.55 s1072 (126281..127543) [1263 bp, 420 aa] {ON}
           (126281..127543) [1263 nt, 421 aa]
          Length = 420

 Score = 30.8 bits (68), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 22/84 (26%), Positives = 34/84 (40%), Gaps = 13/84 (15%)

Query: 15  SWH---IPSTSDEDAANNDPIGNDEDEDVCGICRASYNGTCPSCKFPGDQCPLVIGLCHH 71
           SW    I  T  +    N  +   ++E++C IC  +             Q P+ I  C H
Sbjct: 315 SWKRNKIVPTRTQSIIKNSNLPYLQNEEICSICLNNI----------AIQQPVFISHCFH 364

Query: 72  NFHDHCIYRWLDTPTSKGLCPMCR 95
            +H +CI   + T   +  CP CR
Sbjct: 365 FWHFNCIMPIIQTTYPQFNCPNCR 388

>Skud_1.60 Chr1 (118757..122584) [3828 bp, 1275 aa] {ON} YAL002W
            (REAL)
          Length = 1275

 Score = 30.8 bits (68), Expect = 1.6,   Method: Composition-based stats.
 Identities = 13/34 (38%), Positives = 16/34 (47%), Gaps = 2/34 (5%)

Query: 61   QCPLVIGLCHHNFHDHCIYRWLDTPTSKG--LCP 92
            + PLVI  CHH FH  C+      P      +CP
Sbjct: 1233 EMPLVIFKCHHGFHQTCLENLAQKPNEYSCLICP 1266

>NCAS0A12550 Chr1 (2476209..2477927) [1719 bp, 572 aa] {ON}
           Anc_2.542
          Length = 572

 Score = 30.8 bits (68), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 15/47 (31%), Positives = 23/47 (48%), Gaps = 7/47 (14%)

Query: 51  TCPSC--KFPGDQCPLVIGLCHHNFHDHCIYRWLDTPTSKGLCPMCR 95
           TCP C  +   +   L+   C H FH  C+ +W ++      CP+CR
Sbjct: 237 TCPVCLEQLDCETTGLITIPCQHTFHCQCLDKWKNSR-----CPVCR 278

>TDEL0B06170 Chr2 (1088912..1093324) [4413 bp, 1470 aa] {ON} Anc_1.389
            YLR247C
          Length = 1470

 Score = 30.8 bits (68), Expect = 1.7,   Method: Composition-based stats.
 Identities = 15/44 (34%), Positives = 20/44 (45%), Gaps = 11/44 (25%)

Query: 62   CPLVIGL--------CHHNFHDHCIYRWLDTPTSKGLCPMCRQT 97
            CP+ +G         C H F   CI+ WL    S   CPMC+ +
Sbjct: 1154 CPICLGKITMGAIIKCGHFFCRSCIHSWLKNHNS---CPMCKTS 1194

>Skud_12.99 Chr12 (196796..200311) [3516 bp, 1171 aa] {ON} YLR032W
           (REAL)
          Length = 1171

 Score = 30.8 bits (68), Expect = 1.7,   Method: Composition-based stats.
 Identities = 19/69 (27%), Positives = 29/69 (42%), Gaps = 13/69 (18%)

Query: 41  CGICRASYNGTCPSCKFPGDQCPLVIGLCHHNFHDHCIYRWLDTPTSKGL---CPMCRQT 97
           C IC A           P D    +   C H+F + C++ ++D    K L   CP CR +
Sbjct: 916 CSICTAE----------PIDLNKALFTECGHSFCEKCLFEYIDFQNGKKLCLKCPNCRDS 965

Query: 98  FQLQKGLAI 106
               + LA+
Sbjct: 966 IDGGRLLAL 974

>SAKL0H15686g Chr8 (1367935..1367948,1368042..1369827) [1800 bp, 599
           aa] {ON} some similarities with uniprot|P22470
           Saccharomyces cerevisiae YDR143C SAN1 Ubiquitin-protein
           ligase controls turnover of a specific class of unstable
           nuclear proteins including Sir4p but not Sir2p or Sir3p
           san1 mutations suppress sir4 spt16 and cdc68 mutations
           suggesting a role in chromatin silencing
          Length = 599

 Score = 30.8 bits (68), Expect = 1.8,   Method: Composition-based stats.
 Identities = 14/36 (38%), Positives = 18/36 (50%), Gaps = 3/36 (8%)

Query: 69  CHHNFHDHCIYRWLDTPTSKGLCPMCRQTFQLQKGL 104
           C H F   CIY+W     S   CP+CR     ++GL
Sbjct: 247 CGHRFGRMCIYQWTKEHNS---CPICRAEIVGREGL 279

>Kpol_1002.7 s1002 (19006..21270) [2265 bp, 754 aa] {ON}
           (19006..21270) [2265 nt, 755 aa]
          Length = 754

 Score = 30.8 bits (68), Expect = 1.8,   Method: Composition-based stats.
 Identities = 21/67 (31%), Positives = 28/67 (41%), Gaps = 8/67 (11%)

Query: 33  GNDEDEDV-CGICRAS---YNGTCPSCKFPGDQCPLVIGLCHHNFHDHCIYRWLDTPTSK 88
           G   D  V C IC +    Y    P+     D    +I  C+H FH  C+  W+     K
Sbjct: 686 GASSDHTVDCAICMSEVPVYVDDVPTTH-KVDLDSFMITPCNHVFHTQCLENWMGY---K 741

Query: 89  GLCPMCR 95
             CP+CR
Sbjct: 742 LQCPVCR 748

>Skud_4.402 Chr4 complement(713711..715549) [1839 bp, 612 aa] {ON}
           YDR143C (REAL)
          Length = 612

 Score = 30.8 bits (68), Expect = 1.8,   Method: Composition-based stats.
 Identities = 13/36 (36%), Positives = 16/36 (44%), Gaps = 3/36 (8%)

Query: 69  CHHNFHDHCIYRWLDTPTSKGLCPMCRQTFQLQKGL 104
           C H F   CIY+W     S   CP+CR       G+
Sbjct: 256 CGHIFGRECIYKWSKLENS---CPLCRHKISESAGI 288

>SAKL0D02354g Chr4 (188524..189519) [996 bp, 331 aa] {ON} weakly
           similar to uniprot|Q12161 Saccharomyces cerevisiae
           YOL054W PSH1 Nuclear protein putative RNA polymerase II
           elongation factor isolated as Pob3p/Spt16p- binding
           protein
          Length = 331

 Score = 30.4 bits (67), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 16/55 (29%), Positives = 27/55 (49%), Gaps = 4/55 (7%)

Query: 65  VIGLCHHNFHDHCIYRWLDTPTSKGL-CPMCRQTFQLQKGLAINDAHVQKFVEIV 118
           V+  C HN+   CI  WL+   +  L CP CR +  +   L ++   +Q+ V  +
Sbjct: 5   VMTSCGHNYCYDCISNWLNNNNATELTCPQCRTSVSVPPVLNVS---LQQLVNTL 56

>CAGL0E02299g Chr5 complement(219246..220883) [1638 bp, 545 aa] {ON}
           similar to uniprot|Q08109 Saccharomyces cerevisiae
           YOL013c HRD1
          Length = 545

 Score = 30.4 bits (67), Expect = 1.9,   Method: Composition-based stats.
 Identities = 20/78 (25%), Positives = 34/78 (43%), Gaps = 9/78 (11%)

Query: 18  IPSTSDEDAANNDPIGNDEDEDVCGICRASYNGTCPSCKFPGDQCPLVIGLCHHNFHDHC 77
           +P+ + +D  NNDP      ++VC +C        P       + P  +  C H  H  C
Sbjct: 332 LPTMTSDDL-NNDP----NFDNVCIVCMDELVSENPHHHQSDGKKPKKLP-CGHVLHLSC 385

Query: 78  IYRWLDTPTSKGLCPMCR 95
           +  W++   +   CP+CR
Sbjct: 386 LKNWMERSQT---CPICR 400

>TBLA0I01490 Chr9 (322980..325232) [2253 bp, 750 aa] {ON} Anc_2.545
           YKL034W
          Length = 750

 Score = 30.8 bits (68), Expect = 1.9,   Method: Composition-based stats.
 Identities = 13/36 (36%), Positives = 20/36 (55%), Gaps = 3/36 (8%)

Query: 60  DQCPLVIGLCHHNFHDHCIYRWLDTPTSKGLCPMCR 95
           D+   +I  C+H FH  C+  W+   + K  CP+CR
Sbjct: 712 DKDTYMITPCNHIFHTTCLENWM---SYKLQCPVCR 744

>Kwal_26.8099 s26 complement(645436..647688) [2253 bp, 750 aa] {ON}
           YKL034W (TUL1) -  [contig 55] FULL
          Length = 750

 Score = 30.4 bits (67), Expect = 2.0,   Method: Composition-based stats.
 Identities = 13/36 (36%), Positives = 19/36 (52%), Gaps = 3/36 (8%)

Query: 60  DQCPLVIGLCHHNFHDHCIYRWLDTPTSKGLCPMCR 95
           D+   +I  C H FH  C+  W+   + K  CP+CR
Sbjct: 712 DKDDYMITPCSHIFHTQCLESWM---SYKLQCPVCR 744

>Kwal_56.23543 s56 complement(591514..594411) [2898 bp, 965 aa] {ON}
           YDR103W (STE5) - scaffold protein for MAP kinase cascade
           [contig 176] FULL
          Length = 965

 Score = 30.4 bits (67), Expect = 2.1,   Method: Composition-based stats.
 Identities = 17/47 (36%), Positives = 25/47 (53%), Gaps = 7/47 (14%)

Query: 54  SCKFPGDQCPLVIGL-CHHNFHDHCIYRWLDTPTS---KGLCPMCRQ 96
           SC+  G++   V+ L C H  H+ C+  + + PTS     L P CRQ
Sbjct: 170 SCRTVGEK---VVSLECGHLVHEECLMTYFENPTSCHIDELFPFCRQ 213

>ZYRO0E05632g Chr5 complement(434758..437055) [2298 bp, 765 aa] {ON}
           similar to uniprot|P36096 Saccharomyces cerevisiae
           YKL034W TUL1 Transmembrane Ubiquitin Ligase
          Length = 765

 Score = 30.4 bits (67), Expect = 2.2,   Method: Composition-based stats.
 Identities = 12/36 (33%), Positives = 19/36 (52%), Gaps = 3/36 (8%)

Query: 60  DQCPLVIGLCHHNFHDHCIYRWLDTPTSKGLCPMCR 95
           D+   ++  C H FH  C+  W+   + K  CP+CR
Sbjct: 727 DEQTYMVTPCAHIFHTQCLENWM---SYKLQCPVCR 759

>ZYRO0G13376g Chr7 complement(1066321..1067658) [1338 bp, 445 aa]
           {ON} some similarities with uniprot|Q12161 Saccharomyces
           cerevisiae YOL054W PSH1 Nuclear protein putative RNA
           polymerase II elongation factor isolated as
           Pob3p/Spt16p- binding protein
          Length = 445

 Score = 30.4 bits (67), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 15/54 (27%), Positives = 27/54 (50%), Gaps = 2/54 (3%)

Query: 65  VIGLCHHNFHDHCIYRWLDTPTSKGLCPMCRQTFQLQKGLAINDAHVQKFVEIV 118
           V+  C HN+   C+  W D+ +++  CP CR +  +    ++N    Q  V I+
Sbjct: 41  VMTQCGHNYCYDCLSSWFDSNSNELSCPQCRAS--ISDPPSLNSVLQQWLVHII 92

>Kwal_55.22076 s55 (1098857..1102717) [3861 bp, 1286 aa] {ON} YOL138C
            - Hypothetical ORF [contig 124] FULL
          Length = 1286

 Score = 30.4 bits (67), Expect = 2.2,   Method: Composition-based stats.
 Identities = 17/53 (32%), Positives = 24/53 (45%), Gaps = 4/53 (7%)

Query: 41   CGICRASYNGTCPSCKFPGDQCPLVIGLCHHNFHDHCIYRW-LDTPTSKGLCP 92
            C +C +  N  C  C+ P  +  + I  C H  H  C  RW +D   S+  CP
Sbjct: 1228 CDLC-SRMNTLCALCERPLKKLTMCILSCGHEGHPECFQRWFMDEEMSE--CP 1277

>NCAS0B00990 Chr2 complement(154925..156103) [1179 bp, 392 aa] {ON}
           Anc_8.808 YOL054W
          Length = 392

 Score = 30.4 bits (67), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 23/92 (25%), Positives = 42/92 (45%), Gaps = 27/92 (29%)

Query: 65  VIGLCHHNFHDHCIYRWLDTPTSKGL-CPMCR--------------QTFQL--------Q 101
           ++  C HN+   C+  W+ T + K L CP CR              QT QL        +
Sbjct: 41  MMTSCGHNYCYGCLKSWISTNSKKELACPQCRSDITDTPNLNPFIQQTLQLIIDTINEKK 100

Query: 102 KGLAINDAHVQKFVEIVSRRREEMIEEGVAEE 133
           K ++ N    ++F +I+  ++ E++E  + +E
Sbjct: 101 KKVSEN----EEFKKILETQKAELLEYSLDKE 128

>CAGL0K08052g Chr11 complement(800991..801908) [918 bp, 305 aa] {ON}
           weakly similar to uniprot|Q06834 Saccharomyces
           cerevisiae YPR093c
          Length = 305

 Score = 30.0 bits (66), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 23/85 (27%), Positives = 29/85 (34%), Gaps = 33/85 (38%)

Query: 38  EDVCGICRASYNGTCPSCKFPGDQCPLVIGLCHHNFHDHCIYRWLDTPTSKGLCPMCR-- 95
           ED+CG    SY                 +  C H +H  CI +W         CPMCR  
Sbjct: 11  EDICGKSSTSY-----------------LKPCGHEYHSDCIRKWHGHAEDLK-CPMCRID 52

Query: 96  -------------QTFQLQKGLAIN 107
                        +   LQKG A+N
Sbjct: 53  AEELVVKLYGCAEKIIDLQKGFAVN 77

>YHR115C Chr8 complement(340109..341359) [1251 bp, 416 aa] {ON}
           DMA1Ubiquitin-protein ligase (E3); controls septin
           dynamics and the spindle position checkpoint (SPOC)
           along with functionally redundant ligase Dma2p by
           regulating the recruitment of Elm1p to the bud neck;
           regulates levels of the translation initiation factor
           eIF2 subunit Gcd11p, as well as abundance, localization,
           and ubiquitination of Cdk inhibitory kinase Swe1p;
           ortholog of human RNF8 protein, with sequence similarity
           to human Chfr; contains FHA and RING finger domains
          Length = 416

 Score = 30.4 bits (67), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 13/41 (31%), Positives = 21/41 (51%)

Query: 64  LVIGLCHHNFHDHCIYRWLDTPTSKGLCPMCRQTFQLQKGL 104
           + I  C H++H HC+ R +     + +CP CR    L+  L
Sbjct: 340 IFISPCAHSWHFHCVRRLVIMNYPQFMCPNCRTNCDLETTL 380

>NCAS0A04760 Chr1 (948786..951071) [2286 bp, 761 aa] {ON} Anc_2.545
           YKL034W
          Length = 761

 Score = 30.4 bits (67), Expect = 2.3,   Method: Composition-based stats.
 Identities = 13/36 (36%), Positives = 18/36 (50%), Gaps = 3/36 (8%)

Query: 60  DQCPLVIGLCHHNFHDHCIYRWLDTPTSKGLCPMCR 95
           DQ   ++  C H FH  C+  W+     K  CP+CR
Sbjct: 723 DQHSYMVTPCDHIFHTDCLENWMGY---KLQCPVCR 755

>Kpol_538.5 s538 (7029..8036) [1008 bp, 335 aa] {ON} (7029..8036)
          [1008 nt, 336 aa]
          Length = 335

 Score = 30.0 bits (66), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 18/46 (39%), Positives = 21/46 (45%), Gaps = 5/46 (10%)

Query: 52 CPSC--KFPGDQCPLVIGLCHHNFHDHCIYRWLDTPTSKGLCPMCR 95
          C  C  +F  D+C L    CHH FH  CI  W  +      CP CR
Sbjct: 6  CAICFEEFKEDRCAL--NPCHHTFHLECIRIW-HSYADDLKCPTCR 48

>Suva_15.22 Chr15 complement(39171..43181) [4011 bp, 1336 aa] {ON}
            YOL138C (REAL)
          Length = 1336

 Score = 30.4 bits (67), Expect = 2.4,   Method: Composition-based stats.
 Identities = 20/74 (27%), Positives = 29/74 (39%), Gaps = 4/74 (5%)

Query: 22   SDEDAANNDPIGNDEDEDVCGICRASYNGTCPSCKFPGDQCPLVIGLCHHNFHDHCIYRW 81
            ++   ANN  I +      C  C+   N  C  C+ P  +  +V+  C H  H  CI  W
Sbjct: 1259 AEAQQANNKKIMDKFGYWYCDSCKKR-NSLCVLCERPLKKLTMVLLPCGHEGHFQCIQEW 1317

Query: 82   LDTPTSK---GLCP 92
                  +   G CP
Sbjct: 1318 FLNEKERECPGGCP 1331

>NCAS0B06990 Chr2 complement(1330221..1331786) [1566 bp, 521 aa]
           {ON} Anc_2.157 YHR115C
          Length = 521

 Score = 30.0 bits (66), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 25/107 (23%), Positives = 41/107 (38%), Gaps = 23/107 (21%)

Query: 1   MKVKINEVHSVFAWSWHIPST--SDEDAANNDPIGNDEDE----DVCGICRASYNGTCPS 54
           MK+++N+       SW +P T  S     N   +    DE    D C +C +        
Sbjct: 306 MKIELND-------SWKLPKTQFSTNAFKNVKKVLFSGDEPNATDNCSLCLSKIT----- 353

Query: 55  CKFPGDQCPLVIGLCHHNFHDHCIYRWLDTPTSKGLCPMCRQTFQLQ 101
                +  P+ I  C H++H  C+   +        CP C+  F L+
Sbjct: 354 -----EGKPIFISPCSHHWHYKCVKDLITVEYPFFFCPTCKNQFDLE 395

>Suva_16.420 Chr16 complement(726959..727831) [873 bp, 290 aa] {ON}
           YPR093C (REAL)
          Length = 290

 Score = 30.0 bits (66), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 23/64 (35%), Positives = 29/64 (45%), Gaps = 6/64 (9%)

Query: 52  CPSCKFPGDQCPLVIG---LCHHNFHDHCIYRWLDTPTSKGLCPMCR-QTFQLQKGLAIN 107
           CP C F GDQ     G   +C H FH +CI  W         CP+CR ++  L+ G   N
Sbjct: 4   CPIC-FEGDQDGEQFGCLEVCRHEFHLNCIREWHKYSIDLK-CPICRTESSHLKVGEGQN 61

Query: 108 DAHV 111
              V
Sbjct: 62  AVSV 65

>TPHA0J01570 Chr10 (360114..363170) [3057 bp, 1018 aa] {ON}
           Anc_8.761 YMR231W
          Length = 1018

 Score = 30.4 bits (67), Expect = 2.5,   Method: Composition-based stats.
 Identities = 14/48 (29%), Positives = 23/48 (47%), Gaps = 3/48 (6%)

Query: 49  NGTCPSCKFPGDQCPLVIGLCHHNFHDHCIYRWLDTPTSKG--LCPMC 94
           N  C  CK    + P++   C H +H+ C+ + LD  +     +CP C
Sbjct: 915 NEKCDYCK-ANLEIPIIYFQCGHTYHERCLNKELDQNSGDEVYVCPKC 961

>Suva_2.304 Chr2 complement(537292..539166) [1875 bp, 624 aa] {ON}
           YDR143C (REAL)
          Length = 624

 Score = 30.0 bits (66), Expect = 2.7,   Method: Composition-based stats.
 Identities = 24/89 (26%), Positives = 33/89 (37%), Gaps = 22/89 (24%)

Query: 19  PSTSDEDAANNDP-IGNDEDEDVCGICRASYNGTCPSCKFPGDQCPLVIGLCHHNFHDHC 77
           P+ S     +N P   NDE+             T PS K    + P     C H F   C
Sbjct: 242 PNPSSTPLESNQPHTANDEE-------------TNPSYKHSPIRLP-----CGHVFGREC 283

Query: 78  IYRWLDTPTSKGLCPMCRQTFQLQKGLAI 106
           +Y+W     S   CP+CR       G+ +
Sbjct: 284 LYKWSRLENS---CPLCRHKISESAGVPV 309

>YAL002W Chr1 (143707..147531) [3825 bp, 1274 aa] {ON}
            VPS8Membrane-binding component of the CORVET complex;
            involved in endosomal vesicle tethering and fusion in the
            endosome to vacuole protein targeting pathway; interacts
            with Vps21p; contains RING finger motif
          Length = 1274

 Score = 30.4 bits (67), Expect = 2.7,   Method: Composition-based stats.
 Identities = 13/35 (37%), Positives = 17/35 (48%), Gaps = 1/35 (2%)

Query: 61   QCPLVIGLCHHNFHDHCIYRWLDTPTSKGLCPMCR 95
            + PLVI  CHH FH  C+      P     C +C+
Sbjct: 1233 KTPLVIFKCHHGFHQTCLENLAQKPDEYS-CLICQ 1266

>YOL138C Chr15 complement(61325..65350) [4026 bp, 1341 aa] {ON}
            RTC1Subunit of the SEA (Seh1-associated) complex, a
            coatomer-related complex that associates dynamically with
            the vacuole; null mutation suppresses cdc13-1 temperature
            sensitivity; has N-terminal WD-40 repeats and a
            C-terminal RING motif
          Length = 1341

 Score = 30.4 bits (67), Expect = 2.7,   Method: Composition-based stats.
 Identities = 17/55 (30%), Positives = 23/55 (41%), Gaps = 4/55 (7%)

Query: 41   CGICRASYNGTCPSCKFPGDQCPLVIGLCHHNFHDHCIYRWL---DTPTSKGLCP 92
            C  C+   N +C  C+ P  +  +VI  C H  H  CI  W    +     G CP
Sbjct: 1283 CDSCKKK-NTSCVLCERPLKKLTMVILPCGHEGHFQCIQEWFLDENEQECPGGCP 1336

>NDAI0K01810 Chr11 (405118..407406) [2289 bp, 762 aa] {ON} Anc_2.545
           YKL034W
          Length = 762

 Score = 30.0 bits (66), Expect = 2.7,   Method: Composition-based stats.
 Identities = 11/30 (36%), Positives = 16/30 (53%), Gaps = 3/30 (10%)

Query: 69  CHHNFHDHCIYRWLDTPTSKGLCPMCRQTF 98
           C+H FH  C+  W+     K  CP+CR + 
Sbjct: 733 CNHIFHTECLENWMGY---KLQCPVCRSSL 759

>YLR032W Chr12 (204991..208500) [3510 bp, 1169 aa] {ON}  RAD5DNA
           helicase proposed to promote replication fork regression
           during postreplication repair by template switching;
           RING finger containing ubiquitin ligase; stimulates the
           synthesis of free and PCNA-bound polyubiquitin chains by
           Ubc13p-Mms2p
          Length = 1169

 Score = 30.0 bits (66), Expect = 2.8,   Method: Composition-based stats.
 Identities = 13/41 (31%), Positives = 22/41 (53%), Gaps = 3/41 (7%)

Query: 69  CHHNFHDHCIYRWLDTPTSKGL---CPMCRQTFQLQKGLAI 106
           C H+F + C++ +++   SK L   CP CR      + LA+
Sbjct: 932 CGHSFCEKCLFEYIEFQNSKNLGLKCPNCRNQIDACRLLAL 972

>KAFR0B03420 Chr2 (713034..716144) [3111 bp, 1036 aa] {ON} Anc_8.761
           YMR231W
          Length = 1036

 Score = 30.0 bits (66), Expect = 2.8,   Method: Composition-based stats.
 Identities = 16/48 (33%), Positives = 23/48 (47%), Gaps = 3/48 (6%)

Query: 49  NGTCPSCKFPGDQCPLVIGLCHHNFHDHCIYRWLDTPTSKGL--CPMC 94
           N TC  CK P    P+V   C H +H +C+     T  ++ +  CP C
Sbjct: 933 NQTCFMCKLPM-HLPMVYFKCGHIYHQNCMDEEYSTEENELIFKCPKC 979

>Ecym_2490 Chr2 (961218..962615) [1398 bp, 465 aa] {ON} similar to
           Ashbya gossypii AAR049C
          Length = 465

 Score = 30.0 bits (66), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 20/67 (29%), Positives = 33/67 (49%), Gaps = 6/67 (8%)

Query: 61  QCPLVIGLCHHNFHDHCIYRWLDTPTSKGLCPMCRQTFQLQKGLAINDAHVQKFVEIVSR 120
           Q P V+G C H F   CI  +L+    +  CP+C    +L++ +   +  + + V   SR
Sbjct: 41  QTP-VLGHCGHTFCSLCIRTYLN---KEARCPLC--LVELRQNMLQKEFLLGEIVASYSR 94

Query: 121 RREEMIE 127
            R  M+E
Sbjct: 95  IRGRMLE 101

>AGL349C Chr7 complement(53004..56282) [3279 bp, 1092 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YMR308C
           (PSE1)
          Length = 1092

 Score = 30.0 bits (66), Expect = 3.3,   Method: Composition-based stats.
 Identities = 24/78 (30%), Positives = 33/78 (42%), Gaps = 11/78 (14%)

Query: 86  TSKGLCPMCRQTFQLQKGLAINDAHVQKFVEIVSRRREEMIEEGVAEEFVDFDEPIRQNT 145
           T KG C  C     L  G     AH QK +E+    + E          VD D+PI+   
Sbjct: 554 TLKGKCMECATLIALAVGKDKFSAHSQKLIELFISYQNEG---------VDDDDPIKTYL 604

Query: 146 DNPIGRQQVDTILDEDFL 163
           +   G  ++  IL EDF+
Sbjct: 605 EQ--GWSRICRILREDFV 620

>Smik_8.193 Chr8 complement(316475..317725) [1251 bp, 416 aa] {ON}
           YHR115C (REAL)
          Length = 416

 Score = 29.6 bits (65), Expect = 3.4,   Method: Compositional matrix adjust.
 Identities = 11/33 (33%), Positives = 18/33 (54%)

Query: 64  LVIGLCHHNFHDHCIYRWLDTPTSKGLCPMCRQ 96
           + I  C H++H HC+ R +     + +CP CR 
Sbjct: 340 IFISPCAHSWHFHCVRRLVIMSYPQFMCPNCRS 372

>KLLA0F25674g Chr6 (2384293..2386566) [2274 bp, 757 aa] {ON} similar
           to uniprot|P36096 Saccharomyces cerevisiae YKL034W TUL1
           Transmembrane Ubiquitin Ligase
          Length = 757

 Score = 29.6 bits (65), Expect = 3.6,   Method: Composition-based stats.
 Identities = 13/36 (36%), Positives = 18/36 (50%), Gaps = 3/36 (8%)

Query: 60  DQCPLVIGLCHHNFHDHCIYRWLDTPTSKGLCPMCR 95
           D    +I  C H FH  C+  W+   + K  CP+CR
Sbjct: 719 DAQSYMITPCSHIFHTECLENWM---SYKLQCPVCR 751

>Ecym_7241 Chr7 (507764..510040) [2277 bp, 758 aa] {ON} similar to
           Ashbya gossypii AFR275W
          Length = 758

 Score = 29.6 bits (65), Expect = 3.7,   Method: Composition-based stats.
 Identities = 11/27 (40%), Positives = 15/27 (55%), Gaps = 3/27 (11%)

Query: 69  CHHNFHDHCIYRWLDTPTSKGLCPMCR 95
           C H FH  C+  W+   + K  CP+CR
Sbjct: 729 CAHVFHTECLENWM---SYKLQCPVCR 752

>Smik_4.387 Chr4 complement(702765..704669) [1905 bp, 634 aa] {ON}
           YDR143C (REAL)
          Length = 634

 Score = 29.6 bits (65), Expect = 3.8,   Method: Composition-based stats.
 Identities = 13/36 (36%), Positives = 16/36 (44%), Gaps = 3/36 (8%)

Query: 69  CHHNFHDHCIYRWLDTPTSKGLCPMCRQTFQLQKGL 104
           C H F   CIY+W     S   CP+CR       G+
Sbjct: 267 CGHIFGRECIYKWSRLENS---CPLCRHKISENAGV 299

>KNAG0M01560 Chr13 (276011..278863) [2853 bp, 950 aa] {ON}
          Anc_5.322 YHR056C
          Length = 950

 Score = 29.6 bits (65), Expect = 4.0,   Method: Composition-based stats.
 Identities = 13/29 (44%), Positives = 16/29 (55%), Gaps = 3/29 (10%)

Query: 32 IGNDEDEDVCGICRASYNGTCPSCKFPGD 60
          IG D  + +CG CR    G  P+C FP D
Sbjct: 23 IGCDRVKPICGNCR---KGNKPNCSFPSD 48

>Ecym_4325 Chr4 complement(699162..701096) [1935 bp, 644 aa] {ON}
          similar to Ashbya gossypii ADL064W
          Length = 644

 Score = 29.6 bits (65), Expect = 4.2,   Method: Composition-based stats.
 Identities = 17/65 (26%), Positives = 27/65 (41%), Gaps = 9/65 (13%)

Query: 34 NDEDEDVCGICRASYNGTCPSCKFPGDQCPLVIGLCHHNFHDHCIYRWLDTPTSKGLCPM 93
          +D++ED C +C  + + T  + K     CP     C +     C       P   G CP 
Sbjct: 26 SDDEEDYCPLCMEALDITDKNFK----PCP-----CGYQICQFCYNNIRQNPELNGRCPA 76

Query: 94 CRQTF 98
          CR+ +
Sbjct: 77 CRRKY 81

>Smik_13.439 Chr13 (717478..720570) [3093 bp, 1030 aa] {ON} YMR231W
           (REAL)
          Length = 1030

 Score = 29.6 bits (65), Expect = 4.5,   Method: Composition-based stats.
 Identities = 17/49 (34%), Positives = 22/49 (44%), Gaps = 4/49 (8%)

Query: 49  NGTCPSCKFPGDQCPLVIGLCHHNFHDHCIYRWLDTPTSKG---LCPMC 94
           N TC  C    D  P+V   C H +H HC+    DT  ++     CP C
Sbjct: 926 NQTCFMCNLTLD-VPVVFFKCGHIYHQHCLNEEEDTLKNERKLFKCPKC 973

>Suva_10.112 Chr10 (211443..214946) [3504 bp, 1167 aa] {ON} YLR032W
           (REAL)
          Length = 1167

 Score = 29.6 bits (65), Expect = 4.7,   Method: Composition-based stats.
 Identities = 19/69 (27%), Positives = 29/69 (42%), Gaps = 13/69 (18%)

Query: 41  CGICRASYNGTCPSCKFPGDQCPLVIGLCHHNFHDHCIYRWLDTPTSKGL---CPMCRQT 97
           C IC A           P D    V   C H+F + C++ +++    K L   CP CR+ 
Sbjct: 914 CSICTAE----------PIDLDNAVFTECGHSFCEKCLFEYIEFQNGKQLSLKCPNCREP 963

Query: 98  FQLQKGLAI 106
               + LA+
Sbjct: 964 IDGGRLLAL 972

>TBLA0E01300 Chr5 (285940..290262) [4323 bp, 1440 aa] {ON} Anc_4.129
            YAL002W
          Length = 1440

 Score = 29.6 bits (65), Expect = 4.8,   Method: Composition-based stats.
 Identities = 16/46 (34%), Positives = 23/46 (50%), Gaps = 3/46 (6%)

Query: 52   CPSCKFPGDQCPLVIGLCHHNFHDHCIYRWLDTPTSKGLCPMCRQT 97
            C   KF  ++  L++  CHH FH +C+ R L    S   C  C +T
Sbjct: 1398 CLKAKFNNEK--LIVFKCHHGFHANCL-RNLGQKGSAYSCLTCNKT 1440

>KLLA0D02024g Chr4 complement(173877..175547) [1671 bp, 556 aa] {ON}
           similar to uniprot|P40357 Saccharomyces cerevisiae
           YGR009C SEC9 t-SNARE protein important for fusion of
           secretory vesicles with the plasma membrane
          Length = 556

 Score = 29.3 bits (64), Expect = 5.4,   Method: Composition-based stats.
 Identities = 16/44 (36%), Positives = 22/44 (50%)

Query: 119 SRRREEMIEEGVAEEFVDFDEPIRQNTDNPIGRQQVDTILDEDF 162
           S  RE   E   A++ +D +E IR   DNP G Q+     D+D 
Sbjct: 249 SNDREFNFERSGADDEIDLNETIRPEIDNPKGVQRNGNGDDDDL 292

>NCAS0C03310 Chr3 (649744..651456) [1713 bp, 570 aa] {ON} Anc_8.317
          Length = 570

 Score = 29.3 bits (64), Expect = 5.5,   Method: Composition-based stats.
 Identities = 11/28 (39%), Positives = 14/28 (50%), Gaps = 3/28 (10%)

Query: 69  CHHNFHDHCIYRWLDTPTSKGLCPMCRQ 96
           C H F   C+YRW     +   CP+CR 
Sbjct: 235 CGHIFGRECLYRWCKLENT---CPLCRH 259

>KLTH0C04664g Chr3 (405366..406286) [921 bp, 306 aa] {ON} some
           similarities with uniprot|Q12161 Saccharomyces
           cerevisiae YOL054W PSH1 Nuclear protein putative RNA
           polymerase II elongation factor isolated as
           Pob3p/Spt16p- binding protein
          Length = 306

 Score = 28.9 bits (63), Expect = 5.5,   Method: Compositional matrix adjust.
 Identities = 15/52 (28%), Positives = 24/52 (46%), Gaps = 1/52 (1%)

Query: 65  VIGLCHHNFHDHCIYRWLDTPTSKGL-CPMCRQTFQLQKGLAINDAHVQKFV 115
           V+  C HN+   CI  WL +  +  L CP CR   +    L +   ++  +V
Sbjct: 5   VMTSCGHNYCYECISNWLVSNNANELTCPQCRSPLKEPPALNVALQNLLNYV 56

>ABR104W Chr2 (574068..575054) [987 bp, 328 aa] {ON} Syntenic
          homolog of Saccharomyces cerevisiae YPR093C
          Length = 328

 Score = 28.9 bits (63), Expect = 5.6,   Method: Compositional matrix adjust.
 Identities = 10/27 (37%), Positives = 14/27 (51%)

Query: 69 CHHNFHDHCIYRWLDTPTSKGLCPMCR 95
          C H +H  CI +W    +    CP+CR
Sbjct: 35 CGHEYHLACIRKWFHLHSGNRSCPVCR 61

>Smik_15.16 Chr15 complement(29410..33390) [3981 bp, 1326 aa] {ON}
            YOL138C (REAL)
          Length = 1326

 Score = 29.3 bits (64), Expect = 5.8,   Method: Composition-based stats.
 Identities = 17/55 (30%), Positives = 22/55 (40%), Gaps = 4/55 (7%)

Query: 41   CGICRASYNGTCPSCKFPGDQCPLVIGLCHHNFHDHCIYRWL---DTPTSKGLCP 92
            C  C+   N  C  C+ P  +  +VI  C H  H  CI  W    +     G CP
Sbjct: 1268 CDSCKKK-NTLCVLCERPLKKLTMVILPCGHEGHFQCIQEWFLNENEHECPGGCP 1321

>TDEL0C05420 Chr3 complement(972821..973102) [282 bp, 93 aa] {ON}
          Anc_3.405 YPR093C
          Length = 93

 Score = 27.7 bits (60), Expect = 6.1,   Method: Compositional matrix adjust.
 Identities = 13/27 (48%), Positives = 13/27 (48%), Gaps = 1/27 (3%)

Query: 69 CHHNFHDHCIYRWLDTPTSKGLCPMCR 95
          C H FH  CI RW  T      CP CR
Sbjct: 26 CRHKFHKECIRRW-HTGAIDLKCPTCR 51

>NDAI0G02630 Chr7 (602238..604223) [1986 bp, 661 aa] {ON} Anc_8.317
          Length = 661

 Score = 28.9 bits (63), Expect = 6.4,   Method: Composition-based stats.
 Identities = 11/28 (39%), Positives = 14/28 (50%), Gaps = 3/28 (10%)

Query: 69  CHHNFHDHCIYRWLDTPTSKGLCPMCRQ 96
           C H F   C+Y+W     S   CP+CR 
Sbjct: 246 CDHIFGRECLYKWSKLENS---CPLCRH 270

>KLTH0A04532g Chr1 (378016..379851) [1836 bp, 611 aa] {ON} similar
          to uniprot|P34909 Saccharomyces cerevisiae YER068W MOT2
          Component of the CCR4-NOT transcription regulatory
          complex which represses transcription at least in part
          by inhibiting functional TBP-DNA interactions and also
          aids in transcription elongation interacts with C-
          terminal region of Not1p
          Length = 611

 Score = 28.9 bits (63), Expect = 6.4,   Method: Composition-based stats.
 Identities = 17/65 (26%), Positives = 27/65 (41%), Gaps = 9/65 (13%)

Query: 34 NDEDEDVCGICRASYNGTCPSCKFPGDQCPLVIGLCHHNFHDHCIYRWLDTPTSKGLCPM 93
          +D++ED C +C  + + T  + K     CP     C +     C       P   G CP 
Sbjct: 26 SDDEEDYCPLCIETLDITDKNFK----PCP-----CGYQICQFCYNNIRQNPELNGRCPA 76

Query: 94 CRQTF 98
          CR+ +
Sbjct: 77 CRRKY 81

>Kwal_23.5859 s23 (1345113..1346972) [1860 bp, 619 aa] {ON}
          YER068W (MOT2) - putative zinc finger protein [contig
          11] FULL
          Length = 619

 Score = 28.9 bits (63), Expect = 6.5,   Method: Composition-based stats.
 Identities = 17/65 (26%), Positives = 27/65 (41%), Gaps = 9/65 (13%)

Query: 34 NDEDEDVCGICRASYNGTCPSCKFPGDQCPLVIGLCHHNFHDHCIYRWLDTPTSKGLCPM 93
          +D++ED C +C  + + T  + K     CP     C +     C       P   G CP 
Sbjct: 26 SDDEEDYCPLCIETLDITDKNFK----PCP-----CGYQICQFCYNNIRQNPELNGRCPA 76

Query: 94 CRQTF 98
          CR+ +
Sbjct: 77 CRRKY 81

>Kpol_1048.73 s1048 (207883..212532) [4650 bp, 1549 aa] {ON}
            (207883..212532) [4650 nt, 1550 aa]
          Length = 1549

 Score = 28.9 bits (63), Expect = 6.8,   Method: Composition-based stats.
 Identities = 21/97 (21%), Positives = 40/97 (41%), Gaps = 6/97 (6%)

Query: 69   CHHNFHDHCIYRWLDTPTSKGLCPMCRQTFQLQK--GLAINDAHVQKFVEIVSRRREEMI 126
            C H F   CI  WL    S   CP+C+    L +       +   +        + +E+ 
Sbjct: 1241 CGHFFCKKCIQSWLKNKNS---CPLCKTETGLSEIYNFKFKEEDTEYSSYGSQPKSKEIS 1297

Query: 127  EEGVAEEFVDFDEPIRQNTDNPIGRQQVDTILDEDFL 163
            +E    + +  DE +++  D  +  +  D+I +E F+
Sbjct: 1298 DECYENDRITDDEMVKKE-DELMNSRDSDSIFNEKFV 1333

>Suva_14.223 Chr14 (404941..406683) [1743 bp, 580 aa] {ON} YNL116W
           (REAL)
          Length = 580

 Score = 28.9 bits (63), Expect = 6.8,   Method: Compositional matrix adjust.
 Identities = 26/106 (24%), Positives = 43/106 (40%), Gaps = 22/106 (20%)

Query: 1   MKVKINEVHSVFAWSWHIPSTSDEDAA-----NNDPIGNDEDEDVCGICRASYNGTCPSC 55
           M+V++N        SW + + S    A     N   +    +E+ C IC          C
Sbjct: 453 MRVELNR-------SWKLKANSFNKEALQRLQNLQKLTTGVEEEDCSICL---------C 496

Query: 56  KFPGDQCPLVIGLCHHNFHDHCIYRWLDTPTSKGLCPMCRQTFQLQ 101
           K    Q  + I  C H++H  C+ R +     + +CP CR +  L+
Sbjct: 497 KIKPCQA-IFISPCAHSWHFRCVRRLVMLSYPQFICPNCRSSCDLE 541

>SAKL0H17116g Chr8 complement(1512627..1514261) [1635 bp, 544 aa]
           {ON} weakly similar to uniprot|P22470 Saccharomyces
           cerevisiae YDR143C SAN1 Ubiquitin-protein ligase
           controls turnover of a specific class of unstable
           nuclear proteins including Sir4p but not Sir2p or Sir3p
           san1 mutations suppress sir4 spt16 and cdc68 mutations
           suggesting a role in chromatin silencing
          Length = 544

 Score = 28.9 bits (63), Expect = 7.0,   Method: Compositional matrix adjust.
 Identities = 14/36 (38%), Positives = 18/36 (50%), Gaps = 3/36 (8%)

Query: 69  CHHNFHDHCIYRWLDTPTSKGLCPMCRQTFQLQKGL 104
           C H F   CIY+W     S   CP+CR     ++GL
Sbjct: 231 CGHVFGRVCIYQWTKENNS---CPICRANIVGREGL 263

>KNAG0I02090 Chr9 complement(407893..409176) [1284 bp, 427 aa] {ON}
           Anc_2.157 YHR115C
          Length = 427

 Score = 28.9 bits (63), Expect = 7.2,   Method: Compositional matrix adjust.
 Identities = 30/106 (28%), Positives = 42/106 (39%), Gaps = 23/106 (21%)

Query: 1   MKVKINEVHSVFAWSW-HIPSTSD---EDAANNDPIGNDEDEDVCGICRASYNGTCPSCK 56
           MKV++N+       SW H P       E+  NN  +  D   ++C IC          CK
Sbjct: 304 MKVELND-------SWKHDPVKFGKVLEERMNN--LTEDTRHELCSICLEE-------CK 347

Query: 57  FPGDQCPLVIGLCHHNFHDHCIYRWLDTPTSKGLCPMCRQTFQLQK 102
               Q  L    C H +H  CI  +++       CP CR  F L +
Sbjct: 348 L---QHRLFFAPCSHCWHSACIQPYMNKDVPLFTCPNCRCIFDLSE 390

>KLTH0F11044g Chr6 (937668..938543) [876 bp, 291 aa] {ON} weakly
          similar to uniprot|Q06834 Saccharomyces cerevisiae
          YPR093C ASR1 Protein involved in a putative
          alcohol-responsive signaling pathway accumulates in the
          nucleus under alcohol stress contains a Ring/PHD finger
          domain
          Length = 291

 Score = 28.5 bits (62), Expect = 8.2,   Method: Compositional matrix adjust.
 Identities = 20/48 (41%), Positives = 23/48 (47%), Gaps = 7/48 (14%)

Query: 51 TCPSC--KFPGDQCPLVIGLCHHNFHDHCIYRWLDTPTSKGL-CPMCR 95
          +CP C        C LV   C H +H +CI RW     SK L CP CR
Sbjct: 3  SCPICFESLSKGACRLV--ECGHKYHFNCIRRW--HYHSKNLQCPTCR 46

>Smik_12.94 Chr12 (191768..195304) [3537 bp, 1178 aa] {ON} YLR032W
           (REAL)
          Length = 1178

 Score = 28.9 bits (63), Expect = 8.3,   Method: Composition-based stats.
 Identities = 16/59 (27%), Positives = 26/59 (44%), Gaps = 13/59 (22%)

Query: 41  CGICRASYNGTCPSCKFPGDQCPLVIGLCHHNFHDHCIYRWLDTPTSKGL---CPMCRQ 96
           C IC A           P D   ++   C H+F + C++ +++    K L   CP CR+
Sbjct: 923 CSICTAE----------PIDIDKVLFTECGHSFCEKCLFEYIEFQKGKNLCLKCPNCRK 971

>Kpol_478.8 s478 complement(33393..38306,38308..39462) [6069 bp, 2022
            aa] {ON} complement(33393..38306,38308..39462) [6069 nt,
            2023 aa]
          Length = 2022

 Score = 28.9 bits (63), Expect = 8.4,   Method: Compositional matrix adjust.
 Identities = 22/69 (31%), Positives = 32/69 (46%), Gaps = 6/69 (8%)

Query: 33   GNDEDEDVCGICRASYNGTCPSCKFPGDQCPLVIGLCHHNFHDHCIYRWL---DTPTSKG 89
            G D+ E  C   RA   GT    +   +Q   V   C+H FH  C+ R+L       +  
Sbjct: 1303 GFDDKEINCKESRAGDLGT--DWEIVKEQGKKVFVSCNHKFHLKCVDRYLAKKKFKFAAF 1360

Query: 90   LCPMCRQTF 98
            +CP+C QT+
Sbjct: 1361 ICPLC-QTY 1368

>NDAI0E00440 Chr5 (80965..82215) [1251 bp, 416 aa] {ON} Anc_8.808
          YOL054W
          Length = 416

 Score = 28.5 bits (62), Expect = 8.6,   Method: Compositional matrix adjust.
 Identities = 15/32 (46%), Positives = 17/32 (53%), Gaps = 2/32 (6%)

Query: 69 CHHNFHDHCIYRWLDTPTSKGL-CPMCRQTFQ 99
          C HNF   C+  W+ T  SK L CP CR T  
Sbjct: 45 CGHNFCYGCLNNWI-TGGSKDLNCPQCRSTIN 75

>YGL131C Chr7 complement(261648..265859) [4212 bp, 1403 aa] {ON}
            SNT2DNA binding protein with similarity to the S. pombe
            Snt2 protein; computational analysis suggests that Snt2p
            is a transcription factor with a role in regulation of
            expression of genes encoding amine transporters
          Length = 1403

 Score = 28.5 bits (62), Expect = 8.8,   Method: Composition-based stats.
 Identities = 19/66 (28%), Positives = 27/66 (40%), Gaps = 9/66 (13%)

Query: 34   NDEDEDVCGICRASYNGTCPSCKFPGDQCPLVIGLCHHNFHDHCIYRWLDTPTSKGLCPM 93
            ND  E VCG C  + +  C + K P D              +   ++WL  P S  L P+
Sbjct: 1051 NDNYEVVCGNCGLTVHYFCYAIKLPKDM---------KKNTNLKTFKWLCDPCSNDLNPI 1101

Query: 94   CRQTFQ 99
               T+Q
Sbjct: 1102 ISTTYQ 1107

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.322    0.139    0.453 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 20,159,354
Number of extensions: 882474
Number of successful extensions: 3265
Number of sequences better than 10.0: 258
Number of HSP's gapped: 3218
Number of HSP's successfully gapped: 258
Length of query: 165
Length of database: 53,481,399
Length adjustment: 101
Effective length of query: 64
Effective length of database: 41,900,133
Effective search space: 2681608512
Effective search space used: 2681608512
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 61 (28.1 bits)