Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Suva_3.1471.2ON2102109301e-129
YCR039C (MATALPHA2)1.121ON2102109301e-129
YCL067C (HMLALPHA2)1.2ON2102109301e-129
Skud_3.1181.121ON2102109261e-128
Skud_102.1singletonON1851858041e-110
Smik_95.1singletonON1851858041e-110
Smik_3.1421.121ON2281858071e-110
Suva_3.135singletonON1191196241e-83
Suva_3.74singletonON1191196241e-83
Suva_3.751.121ON1191196241e-83
YCR096C (HMRA2)singletonOFF1191196241e-83
Kpol_2002.31.2ON2232164143e-50
KAFR0D007201.121ON2062024021e-48
NDAI0A001101.2ON2112083447e-40
ZYRO0F15818g1.121ON2252153431e-39
ZYRO0F18568g1.2ON2252153431e-39
TPHA0E040701.2ON2312243327e-38
TPHA0E036101.121ON2312243327e-38
KNAG0C001601.2ON2032033291e-37
NCAS0B091401.2ON2052043109e-35
CAGL0B01265g1.121ON1862132975e-33
CAGL0B00264g1.2ON2102122891e-31
Ecym_11151.121ON230932734e-29
Ecym_10021.2ON230932734e-29
TBLA0A070501.121ON2612522712e-28
TBLA0A076001.2ON2302362658e-28
Skud_71.2singletonON45452255e-24
TDEL0C070001.2ON237742047e-19
Suva_3.136singletonON48481873e-18
KLLA0C00374g1.2ON2231121905e-17
Suva_69.1singletonON34341742e-16
KLTH0F00396g1.2ON108571214e-08
Kwal_YGOB_matalpha21.121ON110451153e-07
Kwal_33.12995singletonOFF110451153e-07
Kwal_YGOB_HMalpha21.2ON110451153e-07
Kwal_33.matalpha2singletonOFF110451153e-07
NDAI0F021706.170ON383711171e-06
Skud_80.3singletonOFF58341062e-06
KLTH0H05236g6.170ON234511108e-06
CAGL0C01551g6.170ON221871072e-05
ZYRO0G22044g6.170ON201701062e-05
AFL049C6.170ON257811063e-05
Kpol_1036.566.170ON265521046e-05
KAFR0G036506.170ON177501017e-05
Skud_7.1816.170ON274601029e-05
YPL177C (CUP9)6.170ON306891021e-04
NDAI0I013206.170ON409471021e-04
KAFR0A043706.170ON409501021e-04
TPHA0B025806.170ON264521011e-04
Ecym_22476.170ON349631012e-04
NCAS0H011306.170ON280501002e-04
Skud_16.1036.170ON295551002e-04
Smik_7.1816.170ON27450992e-04
TDEL0F018106.170ON25651992e-04
TBLA0C037406.170ON29350993e-04
Smik_6.3746.170ON29455993e-04
Suva_16.1326.170ON29255983e-04
KNAG0M005006.170ON29850984e-04
KLLA0B10450g6.170ON38952975e-04
YGL096W (TOS8)6.170ON27650965e-04
Suva_7.1726.170ON27047966e-04
Kwal_27.110926.170ON22960956e-04
SAKL0A05610g6.170ON32052966e-04
CAGL0H02959g6.170ON25950958e-04
KNAG0F022106.170ON32450900.003
NCAS0D035706.170ON25750900.004
NDAI0A006701.122ON9552740.11
NDAI0H00100na 1ON9552740.11
Kpol_1053.13.213ON10976661.9
NCAS0B025808.467ON57353664.8
Suva_2.4385.637ON27432655.2
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= YCL067C
         (210 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Suva_3.147 Chr3 complement(221912..222544) [633 bp, 210 aa] {ON}...   362   e-129
YCR039C Chr3 complement(199546..200178) [633 bp, 210 aa] {ON}  M...   362   e-129
YCL067C Chr3 complement(12386..13018) [633 bp, 210 aa] {ON}  HML...   362   e-129
Skud_3.118 Chr3 complement(184042..184674) [633 bp, 210 aa] {ON}...   361   e-128
Skud_102.1 Chr102 (1..558) [558 bp, 185 aa] {ON} YCR039C (REAL)       314   e-110
Smik_95.1 Chr95 (1..558) [558 bp, 185 aa] {ON} YCR039C (REAL)         314   e-110
Smik_3.142 Chr3 complement(197575..198261) [687 bp, 228 aa] {ON}...   315   e-110
Suva_3.135 Chr3 complement(211196..211555) [360 bp, 119 aa] {ON}...   244   1e-83
Suva_3.74 Chr3 complement(112965..113324) [360 bp, 119 aa] {ON} ...   244   1e-83
Suva_3.75 Chr3 complement(112965..113324) [360 bp, 119 aa] {ON} ...   244   1e-83
YCR096C Chr3 complement(293179..293538) [360 bp, 119 aa] {OFF}  ...   244   1e-83
Kpol_2002.3 s2002 (4682..5353) [672 bp, 223 aa] {ON} (4682..5353...   164   3e-50
KAFR0D00720 Chr4 (128684..129304) [621 bp, 206 aa] {ON}  mating ...   159   1e-48
NDAI0A00110 Chr1 (1584..2219) [636 bp, 211 aa] {ON} Anc_1.2  sil...   137   7e-40
ZYRO0F15818g Chr6 complement(1302816..1303493) [678 bp, 225 aa] ...   136   1e-39
ZYRO0F18568g Chr6 complement(1532755..1533432) [678 bp, 225 aa] ...   136   1e-39
TPHA0E04070 Chr5 complement(848980..849613,849670..849731) [696 ...   132   7e-38
TPHA0E03610 Chr5 complement(765003..765636,765693..765754) [696 ...   132   7e-38
KNAG0C00160 Chr3 (25548..26159) [612 bp, 203 aa] {ON} Anc_1.2 YC...   131   1e-37
NCAS0B09140 Chr2 complement(1754708..1755325) [618 bp, 205 aa] {...   124   9e-35
CAGL0B01265g Chr2 (113719..114279) [561 bp, 186 aa] {ON} similar...   119   5e-33
CAGL0B00264g Chr2 (11470..12102) [633 bp, 210 aa] {ON} highly si...   115   1e-31
Ecym_1115 Chr1 (237261..237485,237542..238009) [693 bp, 230 aa] ...   109   4e-29
Ecym_1002 Chr1 complement(5334..5801,5858..6082) [693 bp, 230 aa...   109   4e-29
TBLA0A07050 Chr1 (1728941..1729002,1729096..1729189,1729249..172...   108   2e-28
TBLA0A07600 Chr1 (1882710..1882771,1882865..1882958,1883018..188...   106   8e-28
Skud_71.2 Chr71 (734..868) [135 bp, 45 aa] {ON} YCL067C (REAL)         91   5e-24
TDEL0C07000 Chr3 complement(1273613..1274326) [714 bp, 237 aa] {...    83   7e-19
Suva_3.136 Chr3 complement(211610..211753) [144 bp, 48 aa] {ON} ...    77   3e-18
KLLA0C00374g Chr3 (25132..25803) [672 bp, 223 aa] {ON} uniprot|Q...    78   5e-17
Suva_69.1 Chr69 complement(1..102) [102 bp, 34 aa] {ON} YCR039C ...    72   2e-16
KLTH0F00396g Chr6 (31990..32051,32348..32612) [327 bp, 108 aa] {...    51   4e-08
Kwal_YGOB_matalpha2 s33 (284511..284843) [333 bp, 110 aa] {ON} (...    49   3e-07
Kwal_33.12995 s33 (32369..32701) [333 bp, 110 aa] {OFF} YCR096C ...    49   3e-07
Kwal_YGOB_HMalpha2 s33 (32369..32701) [333 bp, 110 aa] {ON} ANNO...    49   3e-07
Kwal_33.matalpha2 s33 (284511..284843) [333 bp, 110 aa] {OFF} (m...    49   3e-07
NDAI0F02170 Chr6 (527340..528491) [1152 bp, 383 aa] {ON} Anc_6.1...    50   1e-06
Skud_80.3 Chr80 (593..766) [174 bp, 58 aa] {OFF} YCL067C (HSP)         45   2e-06
KLTH0H05236g Chr8 complement(465998..466702) [705 bp, 234 aa] {O...    47   8e-06
CAGL0C01551g Chr3 complement(169232..169897) [666 bp, 221 aa] {O...    46   2e-05
ZYRO0G22044g Chr7 (1814345..1814950) [606 bp, 201 aa] {ON} some ...    45   2e-05
AFL049C Chr6 complement(346546..347319) [774 bp, 257 aa] {ON} Sy...    45   3e-05
Kpol_1036.56 s1036 (153997..154794) [798 bp, 265 aa] {ON} (15399...    45   6e-05
KAFR0G03650 Chr7 (752766..753299) [534 bp, 177 aa] {ON} Anc_6.17...    44   7e-05
Skud_7.181 Chr7 (328628..329449) [822 bp, 274 aa] {ON} YGL096W (...    44   9e-05
YPL177C Chr16 complement(213042..213962) [921 bp, 306 aa] {ON}  ...    44   1e-04
NDAI0I01320 Chr9 complement(318160..319389) [1230 bp, 409 aa] {O...    44   1e-04
KAFR0A04370 Chr1 complement(870590..871819) [1230 bp, 409 aa] {O...    44   1e-04
TPHA0B02580 Chr2 (592073..592867) [795 bp, 264 aa] {ON} Anc_6.17...    44   1e-04
Ecym_2247 Chr2 complement(486469..487518) [1050 bp, 349 aa] {ON}...    44   2e-04
NCAS0H01130 Chr8 complement(216012..216854) [843 bp, 280 aa] {ON...    43   2e-04
Skud_16.103 Chr16 complement(185398..186285) [888 bp, 295 aa] {O...    43   2e-04
Smik_7.181 Chr7 (319819..320643) [825 bp, 274 aa] {ON} YGL096W (...    43   2e-04
TDEL0F01810 Chr6 complement(338066..338836) [771 bp, 256 aa] {ON...    43   2e-04
TBLA0C03740 Chr3 complement(892360..893241) [882 bp, 293 aa] {ON...    43   3e-04
Smik_6.374 Chr6 (610093..610977) [885 bp, 294 aa] {ON} YPL177C (...    43   3e-04
Suva_16.132 Chr16 complement(222346..223224) [879 bp, 292 aa] {O...    42   3e-04
KNAG0M00500 Chr13 complement(79067..79963) [897 bp, 298 aa] {ON}...    42   4e-04
KLLA0B10450g Chr2 (912877..914046) [1170 bp, 389 aa] {ON} some s...    42   5e-04
YGL096W Chr7 (325331..326161) [831 bp, 276 aa] {ON}  TOS8Homeodo...    42   5e-04
Suva_7.172 Chr7 (319317..320129) [813 bp, 270 aa] {ON} YGL096W (...    42   6e-04
Kwal_27.11092 s27 (635052..635741) [690 bp, 229 aa] {ON} YPL177C...    41   6e-04
SAKL0A05610g Chr1 complement(506437..507399) [963 bp, 320 aa] {O...    42   6e-04
CAGL0H02959g Chr8 (277540..278319) [780 bp, 259 aa] {ON} some si...    41   8e-04
KNAG0F02210 Chr6 complement(423243..424217) [975 bp, 324 aa] {ON...    39   0.003
NCAS0D03570 Chr4 (664388..665161) [774 bp, 257 aa] {ON} Anc_6.17...    39   0.004
NDAI0A00670 Chr1 complement(124998..125033,125093..125308,125369...    33   0.11 
NDAI0H00100 Chr8 complement(758..793,853..1068,1129..1164) [288 ...    33   0.11 
Kpol_1053.1 s1053 (1..330) [330 bp, 109 aa] {ON} (1..330) [330 n...    30   1.9  
NCAS0B02580 Chr2 complement(431287..433008) [1722 bp, 573 aa] {O...    30   4.8  
Suva_2.438 Chr2 (775678..776502) [825 bp, 274 aa] {ON} YDR272W (...    30   5.2  

>Suva_3.147 Chr3 complement(221912..222544) [633 bp, 210 aa] {ON}
           (REAL)
          Length = 210

 Score =  362 bits (930), Expect = e-129,   Method: Compositional matrix adjust.
 Identities = 194/210 (92%), Positives = 194/210 (92%)

Query: 1   MNKIPIKDLLNPQITDEFKSSILDINKKLFSICCNLPKLPESVTTEEEVELRDILGFLSR 60
           MNKIPIKDLLNPQITDEFKSSILDINKKLFSICCNLPKLPESVTTEEEVELRDILGFLSR
Sbjct: 1   MNKIPIKDLLNPQITDEFKSSILDINKKLFSICCNLPKLPESVTTEEEVELRDILGFLSR 60

Query: 61  ANKNRKISDEEKKXXXXXXXXXXXXXXXXKEMRSIENDRSNYQLTQKNKSADGLVFNVVT 120
           ANKNRKISDEEKK                KEMRSIENDRSNYQLTQKNKSADGLVFNVVT
Sbjct: 61  ANKNRKISDEEKKLLQTTSQLTTTITVLLKEMRSIENDRSNYQLTQKNKSADGLVFNVVT 120

Query: 121 QDMINKSTKPYRGHRFTKENVRILESWFAKNIENPYLDTKGLENLMKNTSLSRIQIKNWV 180
           QDMINKSTKPYRGHRFTKENVRILESWFAKNIENPYLDTKGLENLMKNTSLSRIQIKNWV
Sbjct: 121 QDMINKSTKPYRGHRFTKENVRILESWFAKNIENPYLDTKGLENLMKNTSLSRIQIKNWV 180

Query: 181 SNRRRKEKTITIAPELADLLSGEPLAKKKE 210
           SNRRRKEKTITIAPELADLLSGEPLAKKKE
Sbjct: 181 SNRRRKEKTITIAPELADLLSGEPLAKKKE 210

>YCR039C Chr3 complement(199546..200178) [633 bp, 210 aa] {ON}
           MATALPHA2Homeobox-domain protein that, with Mcm1p,
           represses a-specific genes in haploids; acts with A1p to
           repress transcription of haploid-specific genes in
           diploids; one of two genes encoded by the MATalpha
           mating type cassette
          Length = 210

 Score =  362 bits (930), Expect = e-129,   Method: Compositional matrix adjust.
 Identities = 194/210 (92%), Positives = 194/210 (92%)

Query: 1   MNKIPIKDLLNPQITDEFKSSILDINKKLFSICCNLPKLPESVTTEEEVELRDILGFLSR 60
           MNKIPIKDLLNPQITDEFKSSILDINKKLFSICCNLPKLPESVTTEEEVELRDILGFLSR
Sbjct: 1   MNKIPIKDLLNPQITDEFKSSILDINKKLFSICCNLPKLPESVTTEEEVELRDILGFLSR 60

Query: 61  ANKNRKISDEEKKXXXXXXXXXXXXXXXXKEMRSIENDRSNYQLTQKNKSADGLVFNVVT 120
           ANKNRKISDEEKK                KEMRSIENDRSNYQLTQKNKSADGLVFNVVT
Sbjct: 61  ANKNRKISDEEKKLLQTTSQLTTTITVLLKEMRSIENDRSNYQLTQKNKSADGLVFNVVT 120

Query: 121 QDMINKSTKPYRGHRFTKENVRILESWFAKNIENPYLDTKGLENLMKNTSLSRIQIKNWV 180
           QDMINKSTKPYRGHRFTKENVRILESWFAKNIENPYLDTKGLENLMKNTSLSRIQIKNWV
Sbjct: 121 QDMINKSTKPYRGHRFTKENVRILESWFAKNIENPYLDTKGLENLMKNTSLSRIQIKNWV 180

Query: 181 SNRRRKEKTITIAPELADLLSGEPLAKKKE 210
           SNRRRKEKTITIAPELADLLSGEPLAKKKE
Sbjct: 181 SNRRRKEKTITIAPELADLLSGEPLAKKKE 210

>YCL067C Chr3 complement(12386..13018) [633 bp, 210 aa] {ON}
           HMLALPHA2Silenced copy of ALPHA2 at HML; homeobox-domain
           protein that associates with Mcm1p in haploid cells to
           repress a-specific gene expression and interacts with
           a1p in diploid cells to repress haploid-specific gene
           expression
          Length = 210

 Score =  362 bits (930), Expect = e-129,   Method: Compositional matrix adjust.
 Identities = 194/210 (92%), Positives = 194/210 (92%)

Query: 1   MNKIPIKDLLNPQITDEFKSSILDINKKLFSICCNLPKLPESVTTEEEVELRDILGFLSR 60
           MNKIPIKDLLNPQITDEFKSSILDINKKLFSICCNLPKLPESVTTEEEVELRDILGFLSR
Sbjct: 1   MNKIPIKDLLNPQITDEFKSSILDINKKLFSICCNLPKLPESVTTEEEVELRDILGFLSR 60

Query: 61  ANKNRKISDEEKKXXXXXXXXXXXXXXXXKEMRSIENDRSNYQLTQKNKSADGLVFNVVT 120
           ANKNRKISDEEKK                KEMRSIENDRSNYQLTQKNKSADGLVFNVVT
Sbjct: 61  ANKNRKISDEEKKLLQTTSQLTTTITVLLKEMRSIENDRSNYQLTQKNKSADGLVFNVVT 120

Query: 121 QDMINKSTKPYRGHRFTKENVRILESWFAKNIENPYLDTKGLENLMKNTSLSRIQIKNWV 180
           QDMINKSTKPYRGHRFTKENVRILESWFAKNIENPYLDTKGLENLMKNTSLSRIQIKNWV
Sbjct: 121 QDMINKSTKPYRGHRFTKENVRILESWFAKNIENPYLDTKGLENLMKNTSLSRIQIKNWV 180

Query: 181 SNRRRKEKTITIAPELADLLSGEPLAKKKE 210
           SNRRRKEKTITIAPELADLLSGEPLAKKKE
Sbjct: 181 SNRRRKEKTITIAPELADLLSGEPLAKKKE 210

>Skud_3.118 Chr3 complement(184042..184674) [633 bp, 210 aa] {ON}
           YCR039C (REAL)
          Length = 210

 Score =  361 bits (926), Expect = e-128,   Method: Compositional matrix adjust.
 Identities = 193/210 (91%), Positives = 194/210 (92%)

Query: 1   MNKIPIKDLLNPQITDEFKSSILDINKKLFSICCNLPKLPESVTTEEEVELRDILGFLSR 60
           MNKIPIKDLLNPQITDEFKS+ILDINKKLFSICCNLPKLPESVTTEEEVELRDILGFLSR
Sbjct: 1   MNKIPIKDLLNPQITDEFKSNILDINKKLFSICCNLPKLPESVTTEEEVELRDILGFLSR 60

Query: 61  ANKNRKISDEEKKXXXXXXXXXXXXXXXXKEMRSIENDRSNYQLTQKNKSADGLVFNVVT 120
           ANKNRKISDEEKK                KEMRSIENDRSNYQLTQKNKSADGLVFNVVT
Sbjct: 61  ANKNRKISDEEKKLLQTTSQLTTTITVLLKEMRSIENDRSNYQLTQKNKSADGLVFNVVT 120

Query: 121 QDMINKSTKPYRGHRFTKENVRILESWFAKNIENPYLDTKGLENLMKNTSLSRIQIKNWV 180
           QDMINKSTKPYRGHRFTKENVRILESWFAKNIENPYLDTKGLENLMKNTSLSRIQIKNWV
Sbjct: 121 QDMINKSTKPYRGHRFTKENVRILESWFAKNIENPYLDTKGLENLMKNTSLSRIQIKNWV 180

Query: 181 SNRRRKEKTITIAPELADLLSGEPLAKKKE 210
           SNRRRKEKTITIAPELADLLSGEPLAKKKE
Sbjct: 181 SNRRRKEKTITIAPELADLLSGEPLAKKKE 210

>Skud_102.1 Chr102 (1..558) [558 bp, 185 aa] {ON} YCR039C (REAL)
          Length = 185

 Score =  314 bits (804), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 169/185 (91%), Positives = 169/185 (91%)

Query: 26  NKKLFSICCNLPKLPESVTTEEEVELRDILGFLSRANKNRKISDEEKKXXXXXXXXXXXX 85
           NKKLFSICCNLPKLPESVTTEEEVELRDILGFLSRANKNRKISDEEKK            
Sbjct: 1   NKKLFSICCNLPKLPESVTTEEEVELRDILGFLSRANKNRKISDEEKKLLQTTSQLTTTI 60

Query: 86  XXXXKEMRSIENDRSNYQLTQKNKSADGLVFNVVTQDMINKSTKPYRGHRFTKENVRILE 145
               KEMRSIENDRSNYQLTQKNKSADGLVFNVVTQDMINKSTKPYRGHRFTKENVRILE
Sbjct: 61  TVLLKEMRSIENDRSNYQLTQKNKSADGLVFNVVTQDMINKSTKPYRGHRFTKENVRILE 120

Query: 146 SWFAKNIENPYLDTKGLENLMKNTSLSRIQIKNWVSNRRRKEKTITIAPELADLLSGEPL 205
           SWFAKNIENPYLDTKGLENLMKNTSLSRIQIKNWVSNRRRKEKTITIAPELADLLSGEPL
Sbjct: 121 SWFAKNIENPYLDTKGLENLMKNTSLSRIQIKNWVSNRRRKEKTITIAPELADLLSGEPL 180

Query: 206 AKKKE 210
           AKKKE
Sbjct: 181 AKKKE 185

>Smik_95.1 Chr95 (1..558) [558 bp, 185 aa] {ON} YCR039C (REAL)
          Length = 185

 Score =  314 bits (804), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 169/185 (91%), Positives = 169/185 (91%)

Query: 26  NKKLFSICCNLPKLPESVTTEEEVELRDILGFLSRANKNRKISDEEKKXXXXXXXXXXXX 85
           NKKLFSICCNLPKLPESVTTEEEVELRDILGFLSRANKNRKISDEEKK            
Sbjct: 1   NKKLFSICCNLPKLPESVTTEEEVELRDILGFLSRANKNRKISDEEKKLLQTTSQLTTTI 60

Query: 86  XXXXKEMRSIENDRSNYQLTQKNKSADGLVFNVVTQDMINKSTKPYRGHRFTKENVRILE 145
               KEMRSIENDRSNYQLTQKNKSADGLVFNVVTQDMINKSTKPYRGHRFTKENVRILE
Sbjct: 61  TVLLKEMRSIENDRSNYQLTQKNKSADGLVFNVVTQDMINKSTKPYRGHRFTKENVRILE 120

Query: 146 SWFAKNIENPYLDTKGLENLMKNTSLSRIQIKNWVSNRRRKEKTITIAPELADLLSGEPL 205
           SWFAKNIENPYLDTKGLENLMKNTSLSRIQIKNWVSNRRRKEKTITIAPELADLLSGEPL
Sbjct: 121 SWFAKNIENPYLDTKGLENLMKNTSLSRIQIKNWVSNRRRKEKTITIAPELADLLSGEPL 180

Query: 206 AKKKE 210
           AKKKE
Sbjct: 181 AKKKE 185

>Smik_3.142 Chr3 complement(197575..198261) [687 bp, 228 aa] {ON}
           YCL067C (REAL)
          Length = 228

 Score =  315 bits (807), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 169/185 (91%), Positives = 169/185 (91%)

Query: 26  NKKLFSICCNLPKLPESVTTEEEVELRDILGFLSRANKNRKISDEEKKXXXXXXXXXXXX 85
           NKKLFSICCNLPKLPESVTTEEEVELRDILGFLSRANKNRKISDEEKK            
Sbjct: 44  NKKLFSICCNLPKLPESVTTEEEVELRDILGFLSRANKNRKISDEEKKLLQTTSQLTTTI 103

Query: 86  XXXXKEMRSIENDRSNYQLTQKNKSADGLVFNVVTQDMINKSTKPYRGHRFTKENVRILE 145
               KEMRSIENDRSNYQLTQKNKSADGLVFNVVTQDMINKSTKPYRGHRFTKENVRILE
Sbjct: 104 TVLLKEMRSIENDRSNYQLTQKNKSADGLVFNVVTQDMINKSTKPYRGHRFTKENVRILE 163

Query: 146 SWFAKNIENPYLDTKGLENLMKNTSLSRIQIKNWVSNRRRKEKTITIAPELADLLSGEPL 205
           SWFAKNIENPYLDTKGLENLMKNTSLSRIQIKNWVSNRRRKEKTITIAPELADLLSGEPL
Sbjct: 164 SWFAKNIENPYLDTKGLENLMKNTSLSRIQIKNWVSNRRRKEKTITIAPELADLLSGEPL 223

Query: 206 AKKKE 210
           AKKKE
Sbjct: 224 AKKKE 228

>Suva_3.135 Chr3 complement(211196..211555) [360 bp, 119 aa] {ON}
           YCR096C (REAL)
          Length = 119

 Score =  244 bits (624), Expect = 1e-83,   Method: Compositional matrix adjust.
 Identities = 119/119 (100%), Positives = 119/119 (100%)

Query: 92  MRSIENDRSNYQLTQKNKSADGLVFNVVTQDMINKSTKPYRGHRFTKENVRILESWFAKN 151
           MRSIENDRSNYQLTQKNKSADGLVFNVVTQDMINKSTKPYRGHRFTKENVRILESWFAKN
Sbjct: 1   MRSIENDRSNYQLTQKNKSADGLVFNVVTQDMINKSTKPYRGHRFTKENVRILESWFAKN 60

Query: 152 IENPYLDTKGLENLMKNTSLSRIQIKNWVSNRRRKEKTITIAPELADLLSGEPLAKKKE 210
           IENPYLDTKGLENLMKNTSLSRIQIKNWVSNRRRKEKTITIAPELADLLSGEPLAKKKE
Sbjct: 61  IENPYLDTKGLENLMKNTSLSRIQIKNWVSNRRRKEKTITIAPELADLLSGEPLAKKKE 119

>Suva_3.74 Chr3 complement(112965..113324) [360 bp, 119 aa] {ON}
           YCR039C (REAL)
          Length = 119

 Score =  244 bits (624), Expect = 1e-83,   Method: Compositional matrix adjust.
 Identities = 119/119 (100%), Positives = 119/119 (100%)

Query: 92  MRSIENDRSNYQLTQKNKSADGLVFNVVTQDMINKSTKPYRGHRFTKENVRILESWFAKN 151
           MRSIENDRSNYQLTQKNKSADGLVFNVVTQDMINKSTKPYRGHRFTKENVRILESWFAKN
Sbjct: 1   MRSIENDRSNYQLTQKNKSADGLVFNVVTQDMINKSTKPYRGHRFTKENVRILESWFAKN 60

Query: 152 IENPYLDTKGLENLMKNTSLSRIQIKNWVSNRRRKEKTITIAPELADLLSGEPLAKKKE 210
           IENPYLDTKGLENLMKNTSLSRIQIKNWVSNRRRKEKTITIAPELADLLSGEPLAKKKE
Sbjct: 61  IENPYLDTKGLENLMKNTSLSRIQIKNWVSNRRRKEKTITIAPELADLLSGEPLAKKKE 119

>Suva_3.75 Chr3 complement(112965..113324) [360 bp, 119 aa] {ON}
           YCL067C (REAL)
          Length = 119

 Score =  244 bits (624), Expect = 1e-83,   Method: Compositional matrix adjust.
 Identities = 119/119 (100%), Positives = 119/119 (100%)

Query: 92  MRSIENDRSNYQLTQKNKSADGLVFNVVTQDMINKSTKPYRGHRFTKENVRILESWFAKN 151
           MRSIENDRSNYQLTQKNKSADGLVFNVVTQDMINKSTKPYRGHRFTKENVRILESWFAKN
Sbjct: 1   MRSIENDRSNYQLTQKNKSADGLVFNVVTQDMINKSTKPYRGHRFTKENVRILESWFAKN 60

Query: 152 IENPYLDTKGLENLMKNTSLSRIQIKNWVSNRRRKEKTITIAPELADLLSGEPLAKKKE 210
           IENPYLDTKGLENLMKNTSLSRIQIKNWVSNRRRKEKTITIAPELADLLSGEPLAKKKE
Sbjct: 61  IENPYLDTKGLENLMKNTSLSRIQIKNWVSNRRRKEKTITIAPELADLLSGEPLAKKKE 119

>YCR096C Chr3 complement(293179..293538) [360 bp, 119 aa] {OFF}
           HMRA2Silenced copy of a2 at HMR; similarity to Alpha2p;
           required along with a1p for inhibiting expression of the
           HO endonuclease in a/alpha HO/HO diploid cells with an
           active mating-type interconversion system
          Length = 119

 Score =  244 bits (624), Expect = 1e-83,   Method: Compositional matrix adjust.
 Identities = 119/119 (100%), Positives = 119/119 (100%)

Query: 92  MRSIENDRSNYQLTQKNKSADGLVFNVVTQDMINKSTKPYRGHRFTKENVRILESWFAKN 151
           MRSIENDRSNYQLTQKNKSADGLVFNVVTQDMINKSTKPYRGHRFTKENVRILESWFAKN
Sbjct: 1   MRSIENDRSNYQLTQKNKSADGLVFNVVTQDMINKSTKPYRGHRFTKENVRILESWFAKN 60

Query: 152 IENPYLDTKGLENLMKNTSLSRIQIKNWVSNRRRKEKTITIAPELADLLSGEPLAKKKE 210
           IENPYLDTKGLENLMKNTSLSRIQIKNWVSNRRRKEKTITIAPELADLLSGEPLAKKKE
Sbjct: 61  IENPYLDTKGLENLMKNTSLSRIQIKNWVSNRRRKEKTITIAPELADLLSGEPLAKKKE 119

>Kpol_2002.3 s2002 (4682..5353) [672 bp, 223 aa] {ON} (4682..5353)
           [672 nt, 224 aa]
          Length = 223

 Score =  164 bits (414), Expect = 3e-50,   Method: Compositional matrix adjust.
 Identities = 94/216 (43%), Positives = 129/216 (59%), Gaps = 17/216 (7%)

Query: 1   MNKIPIKDLLNPQITDEFKSSILDINKKLFSICCNLPKLPESVTTEEEVELRDILGFLSR 60
           MNKIPI  LLNP   +  K  +  IN KL S+C  +P     +  E+ +EL+ IL FL+ 
Sbjct: 1   MNKIPINILLNPSHQENLKDKLQQINDKLTSLCSKIPGNTSGLEQEDHLELQRILLFLTT 60

Query: 61  ANKNRKISDEEKKXXXXXXXXXXXXXXXXKEMRSIENDRSNYQLTQKNK--------SAD 112
             KN K+ ++E                  K +R + N+    Q +++N         S+D
Sbjct: 61  VVKNEKLDNDEIMLVRTTYQLSTTLSIMVKSLR-MANENYESQTSKENSEEELTSPSSSD 119

Query: 113 G-----LVFNVVTQDMINK---STKPYRGHRFTKENVRILESWFAKNIENPYLDTKGLEN 164
                  VFN+VTQDM+NK   + K YRGHR  K+NV++LE W+ +N+ENPYLD K +  
Sbjct: 120 SNDRNEFVFNIVTQDMMNKKKMNIKSYRGHRLPKQNVKLLERWYIQNVENPYLDDKSISE 179

Query: 165 LMKNTSLSRIQIKNWVSNRRRKEKTITIAPELADLL 200
           LMK TSLS++QIKNWVSNRRRKEK+ITI+PE++ LL
Sbjct: 180 LMKITSLSKVQIKNWVSNRRRKEKSITISPEVSRLL 215

>KAFR0D00720 Chr4 (128684..129304) [621 bp, 206 aa] {ON}  mating
           type gene MATalpha2
          Length = 206

 Score =  159 bits (402), Expect = 1e-48,   Method: Compositional matrix adjust.
 Identities = 87/202 (43%), Positives = 121/202 (59%), Gaps = 2/202 (0%)

Query: 1   MNKIPIKDLLNPQITDEFKSSILDINKKLFSICCNLPKLPESVTTEEEVELRDILGFLSR 60
           MNKI I+DLLN     + K  + DIN KLF++C  LP     +  E  +ELRDI+  LS+
Sbjct: 1   MNKIQIQDLLNSPRDVDTKQELRDINDKLFALCSKLPSSEALLEAEFHLELRDIMLNLSK 60

Query: 61  ANKNRKISDEEKKXXXXXXXXXXXXXXXXKEMRSIENDRSNYQLTQKNKSADGLVFNVVT 120
                ++  EEK                 K M++      +   + K++S D  VFNVVT
Sbjct: 61  LQDTSRMGSEEKHLAYTAHQLTCTMITLIKGMKNFHGTGGHSYSSSKSESDDKTVFNVVT 120

Query: 121 QDM--INKSTKPYRGHRFTKENVRILESWFAKNIENPYLDTKGLENLMKNTSLSRIQIKN 178
           QDM  +N++   YRGHRF+KENV++LE W+  +I+ PYL+ +  E L+  T LSR+QIKN
Sbjct: 121 QDMMNLNRTGISYRGHRFSKENVKVLERWYTAHIDRPYLNRQSTEYLISKTGLSRVQIKN 180

Query: 179 WVSNRRRKEKTITIAPELADLL 200
           WVSNRRRKEK++ ++PEL  LL
Sbjct: 181 WVSNRRRKEKSVHVSPELIQLL 202

>NDAI0A00110 Chr1 (1584..2219) [636 bp, 211 aa] {ON} Anc_1.2  silent
           copy of MATalpha2 gene at HMLalpha
          Length = 211

 Score =  137 bits (344), Expect = 7e-40,   Method: Compositional matrix adjust.
 Identities = 75/208 (36%), Positives = 118/208 (56%), Gaps = 5/208 (2%)

Query: 1   MNKIPIKDLLNPQITDEFKSSILDINKKLFSICCNLPKLPESVTTEEEVELRDILGFLSR 60
           MNKI I DLLNP       S++  IN +L +IC   P   E+V    +++L +I+ FLS 
Sbjct: 1   MNKIAISDLLNPPTAGPVTSNLDSINNQLVTICSKFPTAKENVDGSYQIQLHNIVSFLST 60

Query: 61  ANKNRKISDEEKKXXXXXXXXXXXXXXXXKEMRSIENDRSNYQLTQKN----KSADGLVF 116
             ++  ++ ++                  K+M  +       +   K     ++    VF
Sbjct: 61  LTQSTNLTSKDCSNIQLTYELSSMLGKVLKDMVLLNGTEEVEKKKVKEEEELETNSKYVF 120

Query: 117 NVVTQDM-INKSTKPYRGHRFTKENVRILESWFAKNIENPYLDTKGLENLMKNTSLSRIQ 175
           NV+TQDM I +  KP+RGHR  KE V  LE W+  +I+ PYLD+K L+ LM+ T LS++Q
Sbjct: 121 NVITQDMMIPEKNKPHRGHRLPKEKVNRLEHWYLAHIQKPYLDSKNLKVLMEETKLSKVQ 180

Query: 176 IKNWVSNRRRKEKTITIAPELADLLSGE 203
           IKNW+SNRRRKEK ++I+P++ ++++ +
Sbjct: 181 IKNWISNRRRKEKLLSISPDIVEIINTQ 208

>ZYRO0F15818g Chr6 complement(1302816..1303493) [678 bp, 225 aa]
           {ON} similar to uniprot|Q6B2C0 Saccharomyces cerevisiae
           YCR039C MATALPHA2 Homeobox-domain containing protein
           which in haploid cells acts with Mcm1p to repress
           a-specific genes in diploid cells Alpha2p acts together
           with A1p to repress transcription of haploid-specific
           genes
          Length = 225

 Score =  136 bits (343), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 87/215 (40%), Positives = 120/215 (55%), Gaps = 17/215 (7%)

Query: 1   MNKIPIKDLLNPQITDEFKSSIL-DINKKLFSICCNLPKLPESVTTEEEVELRDILGFLS 59
           MNKIPI+ LLNP +  EF    L +IN KL ++C  LP   E    +++ EL  IL  L+
Sbjct: 1   MNKIPIERLLNP-VHQEFPHEKLKNINNKLLALCSKLPSENEQFE-KDKAELEKILPSLN 58

Query: 60  RANKNRKISDEEKKXXXXXXXXXXXXXXXXKEMRSIENDRSN-----------YQLTQKN 108
              +    S E++K                 E+  +++ RS            Y     N
Sbjct: 59  ILIRECGSSKEDQKMVHRIHQLSSVFSLLLNEVSELKSKRSQFLRSKPKYHLPYAAALGN 118

Query: 109 KSADGLVFNVVTQDMIN---KSTKPYRGHRFTKENVRILESWFAKNIENPYLDTKGLENL 165
              +G+VFN+VTQD +N   +S K YRGHR  K   R+LESWF +NIE+PYL T  ++ L
Sbjct: 119 TGKEGMVFNIVTQDTLNSARRSNKTYRGHRLPKHITRLLESWFNRNIEHPYLQTSSMKEL 178

Query: 166 MKNTSLSRIQIKNWVSNRRRKEKTITIAPELADLL 200
           M  T LS  QIKNWVSNRRRKEK++TI+ E+++L+
Sbjct: 179 MVETKLSGPQIKNWVSNRRRKEKSLTISFEVSELV 213

>ZYRO0F18568g Chr6 complement(1532755..1533432) [678 bp, 225 aa]
           {ON} similar to uniprot|Q6B2C0 Saccharomyces cerevisiae
           YCR039C MATALPHA2 Homeobox-domain containing protein
           which in haploid cells acts with Mcm1p to repress
           a-specific genes in diploid cells Alpha2p acts together
           with A1p to repress transcription of haploid-specific
           genes
          Length = 225

 Score =  136 bits (343), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 87/215 (40%), Positives = 120/215 (55%), Gaps = 17/215 (7%)

Query: 1   MNKIPIKDLLNPQITDEFKSSIL-DINKKLFSICCNLPKLPESVTTEEEVELRDILGFLS 59
           MNKIPI+ LLNP +  EF    L +IN KL ++C  LP   E    +++ EL  IL  L+
Sbjct: 1   MNKIPIERLLNP-VHQEFPHEKLKNINNKLLALCSKLPSENEQFE-KDKAELEKILPSLN 58

Query: 60  RANKNRKISDEEKKXXXXXXXXXXXXXXXXKEMRSIENDRSN-----------YQLTQKN 108
              +    S E++K                 E+  +++ RS            Y     N
Sbjct: 59  ILIRECGSSKEDQKMVHRIHQLSSVFSLLLNEVSELKSKRSQFLRSKPKYHLPYAAALGN 118

Query: 109 KSADGLVFNVVTQDMIN---KSTKPYRGHRFTKENVRILESWFAKNIENPYLDTKGLENL 165
              +G+VFN+VTQD +N   +S K YRGHR  K   R+LESWF +NIE+PYL T  ++ L
Sbjct: 119 TGKEGMVFNIVTQDTLNSARRSNKTYRGHRLPKHITRLLESWFNRNIEHPYLQTSSMKEL 178

Query: 166 MKNTSLSRIQIKNWVSNRRRKEKTITIAPELADLL 200
           M  T LS  QIKNWVSNRRRKEK++TI+ E+++L+
Sbjct: 179 MVETKLSGPQIKNWVSNRRRKEKSLTISFEVSELV 213

>TPHA0E04070 Chr5 complement(848980..849613,849670..849731) [696 bp,
           231 aa] {ON}   silenced copy of alpha2 at HMLalpha locus
          Length = 231

 Score =  132 bits (332), Expect = 7e-38,   Method: Compositional matrix adjust.
 Identities = 87/224 (38%), Positives = 121/224 (54%), Gaps = 25/224 (11%)

Query: 1   MNKIPIKDLLNPQITDEFKSSILDINKKLFSICCNLPKLPESVTTEEEVELRDILGFLSR 60
           MNKIPI  LLNP         +  IN  L ++C  LP     +T  +  EL+DIL +L+ 
Sbjct: 1   MNKIPINKLLNPSQHYNLTEKLQQINITLSNLCTKLPDTITDLTEADHRELQDILLYLTT 60

Query: 61  ANKNRKISDEEKKXXXXXXXXXXXXXXXXKEMRSIENDRSN-------YQL-----TQKN 108
             K +++  EE                  K  +  END+ N       Y+      ++ N
Sbjct: 61  VVKQQELKKEEIMLVKTTYQLCTTLTLMVKSCKQ-ENDKENKENEIIKYESGTSDNSETN 119

Query: 109 KSADG---------LVFNVVTQDMINKSTK---PYRGHRFTKENVRILESWFAKNIENPY 156
            S +          LVFNV+TQDM+N + K    YRGHR  K+NV+ LE W+  + +NPY
Sbjct: 120 SSCNSSDNEDKNSILVFNVITQDMMNNNKKNNKSYRGHRLPKKNVQYLEDWYMDHRKNPY 179

Query: 157 LDTKGLENLMKNTSLSRIQIKNWVSNRRRKEKTITIAPELADLL 200
           L+   ++ LM  TSLSRIQ+KNW+SNRRRKEK+ITI+PE++ LL
Sbjct: 180 LNEINIKLLMSKTSLSRIQVKNWISNRRRKEKSITISPEVSALL 223

>TPHA0E03610 Chr5 complement(765003..765636,765693..765754) [696 bp,
           231 aa] {ON} Anc_1.122 YCR039C MATalpha2 gene at MAT
           locus
          Length = 231

 Score =  132 bits (332), Expect = 7e-38,   Method: Compositional matrix adjust.
 Identities = 87/224 (38%), Positives = 121/224 (54%), Gaps = 25/224 (11%)

Query: 1   MNKIPIKDLLNPQITDEFKSSILDINKKLFSICCNLPKLPESVTTEEEVELRDILGFLSR 60
           MNKIPI  LLNP         +  IN  L ++C  LP     +T  +  EL+DIL +L+ 
Sbjct: 1   MNKIPINKLLNPSQHYNLTEKLQQINITLSNLCTKLPDTITDLTEADHRELQDILLYLTT 60

Query: 61  ANKNRKISDEEKKXXXXXXXXXXXXXXXXKEMRSIENDRSN-------YQL-----TQKN 108
             K +++  EE                  K  +  END+ N       Y+      ++ N
Sbjct: 61  VVKQQELKKEEIMLVKTTYQLCTTLTLMVKSCKQ-ENDKENKENEIIKYESGTSDNSETN 119

Query: 109 KSADG---------LVFNVVTQDMINKSTK---PYRGHRFTKENVRILESWFAKNIENPY 156
            S +          LVFNV+TQDM+N + K    YRGHR  K+NV+ LE W+  + +NPY
Sbjct: 120 SSCNSSDNEDKNSILVFNVITQDMMNNNKKNNKSYRGHRLPKKNVQYLEDWYMDHRKNPY 179

Query: 157 LDTKGLENLMKNTSLSRIQIKNWVSNRRRKEKTITIAPELADLL 200
           L+   ++ LM  TSLSRIQ+KNW+SNRRRKEK+ITI+PE++ LL
Sbjct: 180 LNEINIKLLMSKTSLSRIQVKNWISNRRRKEKSITISPEVSALL 223

>KNAG0C00160 Chr3 (25548..26159) [612 bp, 203 aa] {ON} Anc_1.2
           YCL067C silent copy of mating type alpha2 gene at HML
           locus
          Length = 203

 Score =  131 bits (329), Expect = 1e-37,   Method: Compositional matrix adjust.
 Identities = 79/203 (38%), Positives = 107/203 (52%), Gaps = 5/203 (2%)

Query: 1   MNKIPIKDLLNPQITDEFKSSILDINKKLFSICCNLPKLPESVTTEEEVELRDILGFLSR 60
           MN+I I+DLLN Q          +IN +L  IC N PK   S   E +++L+ IL FL++
Sbjct: 1   MNRIEIQDLLNNQDCSSLDKDFKNINSQLLEICSNFPKELLSNHGELQMQLQGILLFLTK 60

Query: 61  ANKNRKISDEEKKXXXXXXXXXXXXXXXXKEMRSIENDRSNYQLTQKNKSADGLVFNVVT 120
                 +S   K                 K       +R  Y       S +  VF+VVT
Sbjct: 61  LVGKNDLSVTLKNEARMTYQFSKIIASLLKSFEDFFFERKEY--NDPATSENEFVFSVVT 118

Query: 121 QDMINK---STKPYRGHRFTKENVRILESWFAKNIENPYLDTKGLENLMKNTSLSRIQIK 177
           QDM+NK   S +P RGHRF+  +   LE W+ K+ E PYLD + L  L   T LS++QI+
Sbjct: 119 QDMMNKRKESMRPCRGHRFSSNSTETLEDWYKKHHEKPYLDKRSLHELEFKTKLSKMQIR 178

Query: 178 NWVSNRRRKEKTITIAPELADLL 200
           NWVSNRRRKEK+I ++P + DLL
Sbjct: 179 NWVSNRRRKEKSIHVSPVIQDLL 201

>NCAS0B09140 Chr2 complement(1754708..1755325) [618 bp, 205 aa] {ON}
           Anc_1.2
          Length = 205

 Score =  124 bits (310), Expect = 9e-35,   Method: Compositional matrix adjust.
 Identities = 75/204 (36%), Positives = 111/204 (54%), Gaps = 1/204 (0%)

Query: 1   MNKIPIKDLLNPQITDEFKSSILDINKKLFSICCNLPKLPESVTTEEEVELRDILGFLSR 60
           MNKI I DLLNP  T +    +  IN +L +IC   P          + +LR+I   LS 
Sbjct: 1   MNKIAIHDLLNPPNTTKTHEQLESINTQLNTICSVFPTTENLDFKTYQEQLRNIAVTLSS 60

Query: 61  ANKNRKISDEEKKXXXXXXXXXXXXXXXXKEMRSIENDRSNYQLTQKNKSADGLVFNVVT 120
                ++S E K                  E    ++         +++    LVFN++T
Sbjct: 61  LTNQNELSSENKNVLRVTYQISSVLLKLLGENAHNKDQPKTPTSGSESERNPKLVFNILT 120

Query: 121 QD-MINKSTKPYRGHRFTKENVRILESWFAKNIENPYLDTKGLENLMKNTSLSRIQIKNW 179
           +  M   S +P RGHR  KE V +LE W+ ++++NPYL+   L+ LM+ TSLS++QIKNW
Sbjct: 121 KKRMSPTSNEPRRGHRLAKEKVDLLEHWYIQHMDNPYLNKASLQMLMQETSLSKMQIKNW 180

Query: 180 VSNRRRKEKTITIAPELADLLSGE 203
           VSNRRRKEK+++IAPE+ D+L+ +
Sbjct: 181 VSNRRRKEKSLSIAPEIVDILNKQ 204

>CAGL0B01265g Chr2 (113719..114279) [561 bp, 186 aa] {ON} similar to
           uniprot|P01367 Saccharomyces cerevisiae YCR039c or
           uniprot|P01367 Saccharomyces cerevisiae YCL067c HMLALP2
           mating type regulatory protein
          Length = 186

 Score =  119 bits (297), Expect = 5e-33,   Method: Compositional matrix adjust.
 Identities = 80/213 (37%), Positives = 114/213 (53%), Gaps = 42/213 (19%)

Query: 2   NKIPIKDLLNPQITDEFKSSILDINKKLFSICCNLPK---LPESVTTEEEVELRDILGFL 58
           ++I I  LLNP   +  K  + +IN +L S+C +LPK   LP   +        DIL FL
Sbjct: 5   SRISITHLLNPIQEENLKEKLQEINNQLISLCSSLPKRQSLPGPSS--------DILRFL 56

Query: 59  SRANKNRKISDEEKKXXXXXXXXXXXXXXXXKEMRSIENDRSNYQLTQKNKSADGLVFNV 118
           SR N +                         +E+  I+       L  K +  + +VFNV
Sbjct: 57  SRNNLD------------------------PQEIGLIKTTYRLSTLLSKLREHE-IVFNV 91

Query: 119 VTQDMINKSTKP------YRGHRFTKENVRILESWFAKNIENPYLDTKGLENLMKNTSLS 172
           VT+D + K   P      YRGHRFT+ENV+ILE+W+  +I+NPYLD    + L + T+LS
Sbjct: 92  VTKDHLLKKGVPNHYAASYRGHRFTRENVQILETWYRNHIDNPYLDHNSQQYLAQKTNLS 151

Query: 173 RIQIKNWVSNRRRKEKTITIAPELADLLSGEPL 205
           +IQIKNWV+NRRRK+K+I I+P    L++   L
Sbjct: 152 KIQIKNWVANRRRKQKSIYISPFRPTLMAQNSL 184

>CAGL0B00264g Chr2 (11470..12102) [633 bp, 210 aa] {ON} highly
           similar to uniprot|P01367 Saccharomyces cerevisiae
           YCR039c or uniprot|P01367 Saccharomyces cerevisiae
           YCL067c HMLALP 2 mating type regulatory protein
          Length = 210

 Score =  115 bits (289), Expect = 1e-31,   Method: Compositional matrix adjust.
 Identities = 80/212 (37%), Positives = 116/212 (54%), Gaps = 43/212 (20%)

Query: 2   NKIPIKDLLNPQITDEFKSSILDINKKLFSICCNLPK---LPESVTTEEEVELRDILGFL 58
           ++I I  LLNP   +  K  + +IN +L S+C +LPK   LP   +        DIL FL
Sbjct: 5   SRISITHLLNPIQEENLKEKLQEINNQLISLCSSLPKRQSLPGPSS--------DILRFL 56

Query: 59  SRANKNRKISDEEKKXXXXXXXXXXXXXXXXKEMRSIENDRSNYQLTQKNKSADGLVFNV 118
           SR N +                         +E+  I+       L  K +  + +VFNV
Sbjct: 57  SRNNLD------------------------PQEIGLIKTTYRLSTLLSKLREHE-IVFNV 91

Query: 119 VTQDMINKSTKP------YRGHRFTKENVRILESWFAKNIENPYLDTKGLENLMKNTSLS 172
           VT+D + K   P      YRGHRFT+ENV+ILE+W+  +I+NPYLD    + L + T+LS
Sbjct: 92  VTKDHLLKKGVPNHYAASYRGHRFTRENVQILETWYRNHIDNPYLDHNSQQYLAQKTNLS 151

Query: 173 RIQIKNWVSNRRRKEKTITIAP-ELADLLSGE 203
           +IQIKNWV+NRRRK+K+I I+  ++ ++ SGE
Sbjct: 152 KIQIKNWVANRRRKQKSIYISLFDIHNIESGE 183

>Ecym_1115 Chr1 (237261..237485,237542..238009) [693 bp, 230 aa]
           {ON} similar to YCL067C HMLALPHA2, 1-intron
          Length = 230

 Score =  109 bits (273), Expect = 4e-29,   Method: Compositional matrix adjust.
 Identities = 50/93 (53%), Positives = 69/93 (74%), Gaps = 4/93 (4%)

Query: 113 GLVFNVVTQDMINKSTK----PYRGHRFTKENVRILESWFAKNIENPYLDTKGLENLMKN 168
           G++FNVVTQDM+    K     Y+GHR  K++V++LESW+  NIENPYL+   +  LM+ 
Sbjct: 137 GIIFNVVTQDMMENGRKGGSSSYKGHRLPKKHVQLLESWYKNNIENPYLNDTDIRILMRE 196

Query: 169 TSLSRIQIKNWVSNRRRKEKTITIAPELADLLS 201
           T  SR Q+KNWV+N+RRK+K  TI+PEL+DLL+
Sbjct: 197 TGFSRSQVKNWVANKRRKDKHSTISPELSDLLA 229

>Ecym_1002 Chr1 complement(5334..5801,5858..6082) [693 bp, 230 aa]
           {ON} similar to Saccharomyces cerevisiae YCL067C
           HMLALPHA2; 1-intron
          Length = 230

 Score =  109 bits (273), Expect = 4e-29,   Method: Compositional matrix adjust.
 Identities = 50/93 (53%), Positives = 69/93 (74%), Gaps = 4/93 (4%)

Query: 113 GLVFNVVTQDMINKSTK----PYRGHRFTKENVRILESWFAKNIENPYLDTKGLENLMKN 168
           G++FNVVTQDM+    K     Y+GHR  K++V++LESW+  NIENPYL+   +  LM+ 
Sbjct: 137 GIIFNVVTQDMMENGRKGGSSSYKGHRLPKKHVQLLESWYKNNIENPYLNDTDIRILMRE 196

Query: 169 TSLSRIQIKNWVSNRRRKEKTITIAPELADLLS 201
           T  SR Q+KNWV+N+RRK+K  TI+PEL+DLL+
Sbjct: 197 TGFSRSQVKNWVANKRRKDKHSTISPELSDLLA 229

>TBLA0A07050 Chr1
           (1728941..1729002,1729096..1729189,1729249..1729878)
           [786 bp, 261 aa] {ON}  MATalpha2 gene at MAT locus
          Length = 261

 Score =  108 bits (271), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 77/252 (30%), Positives = 112/252 (44%), Gaps = 59/252 (23%)

Query: 1   MNKIPIKDLLNPQITDEFKSSILDINKKLFSICCNLPKLPESVTTEEEVELRDILGFLSR 60
           MNKIPI  LLNP  ++  K  + ++NK+L S+C  LP    S  + EE +L +IL FL++
Sbjct: 1   MNKIPIDTLLNPTNSENIKEQLQNLNKELLSMCSRLP----SAKSMEETQLSEILKFLTK 56

Query: 61  ANKNRKISDEEKKXXXXXXXXXXXXXXXXKEMRSIENDRSNYQLTQKNKSADGLVFNVVT 120
             K+  +  EE +                KE R +      ++L     + +  VFNV+T
Sbjct: 57  TIKHEPLGKEETELVTTTVQLSTVLSSLVKEARQL------HRLHHSQSTHNPRVFNVLT 110

Query: 121 QDM---------------------INKSTKP---------------------------YR 132
           Q M                       KST P                           +R
Sbjct: 111 QHMMSNSNSTSTSPHSNSLPNSPSTKKSTTPLTNPSPPYYYSSSSPKSLSPPLQHTPSHR 170

Query: 133 GHRFTKENVRILESWFAKNIENPYLDTKGLENLMKNTSLSRIQIKNWVSNRRRKEK-TIT 191
           GHR  K  +  LE WF  N  +PYL    L+ L   +SLS+ Q+KNW+SNRRRKE+ ++ 
Sbjct: 171 GHRLPKHTLIPLEKWFLHNKSHPYLHNSDLQALTTQSSLSKTQVKNWISNRRRKERHSLK 230

Query: 192 IAPELADLLSGE 203
           I+  +A LL  +
Sbjct: 231 ISNNIASLLQND 242

>TBLA0A07600 Chr1
           (1882710..1882771,1882865..1882958,1883018..1883554)
           [693 bp, 230 aa] {ON} Anc_1.2 YCL067C silenced copy of
           alpha2 gene at HML locus
          Length = 230

 Score =  106 bits (265), Expect = 8e-28,   Method: Compositional matrix adjust.
 Identities = 73/236 (30%), Positives = 103/236 (43%), Gaps = 58/236 (24%)

Query: 1   MNKIPIKDLLNPQITDEFKSSILDINKKLFSICCNLPKLPESVTTEEEVELRDILGFLSR 60
           MNKIPI  LLNP  ++  K  + ++NK+L S+C  LP    S  + EE +L +IL FL++
Sbjct: 1   MNKIPIDTLLNPTNSENIKEQLQNLNKELLSMCSRLP----SAKSMEETQLSEILKFLTK 56

Query: 61  ANKNRKISDEEKKXXXXXXXXXXXXXXXXKEMRSIENDRSNYQLTQKNKSADGLVFNVVT 120
             K+  +  EE +                KE R +      ++L     + +  VFNV+T
Sbjct: 57  TIKHEPLGKEETELVTTTVQLSTVLSSLVKEARQL------HRLHHSQSTHNPRVFNVLT 110

Query: 121 QDM---------------------INKSTKP---------------------------YR 132
           Q M                       KST P                           +R
Sbjct: 111 QHMMSNSNSTSTSPHSNSLPNSPSTKKSTTPLTNPSPPYYYSSSSPKSLSPPLQHTPSHR 170

Query: 133 GHRFTKENVRILESWFAKNIENPYLDTKGLENLMKNTSLSRIQIKNWVSNRRRKEK 188
           GHR  K  +  LE WF  N  +PYL    L+ L   +SLS+ Q+KNW+SNRRRKE+
Sbjct: 171 GHRLPKHTLIPLEKWFLHNKSHPYLHNSDLQALTTQSSLSKTQVKNWISNRRRKER 226

>Skud_71.2 Chr71 (734..868) [135 bp, 45 aa] {ON} YCL067C (REAL)
          Length = 45

 Score = 91.3 bits (225), Expect = 5e-24,   Method: Compositional matrix adjust.
 Identities = 44/45 (97%), Positives = 45/45 (100%)

Query: 1  MNKIPIKDLLNPQITDEFKSSILDINKKLFSICCNLPKLPESVTT 45
          MNKIPIKDLLNPQITDEFKS+ILDINKKLFSICCNLPKLPESVTT
Sbjct: 1  MNKIPIKDLLNPQITDEFKSNILDINKKLFSICCNLPKLPESVTT 45

>TDEL0C07000 Chr3 complement(1273613..1274326) [714 bp, 237 aa] {ON}
           Anc_1.122 YCR039C silenced copy of alpha2 gene at T.
           delbrueckii HML locus
          Length = 237

 Score = 83.2 bits (204), Expect = 7e-19,   Method: Compositional matrix adjust.
 Identities = 40/74 (54%), Positives = 51/74 (68%)

Query: 127 STKPYRGHRFTKENVRILESWFAKNIENPYLDTKGLENLMKNTSLSRIQIKNWVSNRRRK 186
           + K +RGHR   E V  LE WF +NI  PYL+ + L  L+  TSLS IQIKNW+SNRRRK
Sbjct: 152 TGKRHRGHRLPSEKVEKLELWFNQNISKPYLNQRALRTLVHETSLSPIQIKNWLSNRRRK 211

Query: 187 EKTITIAPELADLL 200
           +K+  IA  ++DLL
Sbjct: 212 KKSAGIADTISDLL 225

>Suva_3.136 Chr3 complement(211610..211753) [144 bp, 48 aa] {ON}
          YCL067C (REAL)
          Length = 48

 Score = 76.6 bits (187), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 48/48 (100%), Positives = 48/48 (100%)

Query: 26 NKKLFSICCNLPKLPESVTTEEEVELRDILGFLSRANKNRKISDEEKK 73
          NKKLFSICCNLPKLPESVTTEEEVELRDILGFLSRANKNRKISDEEKK
Sbjct: 1  NKKLFSICCNLPKLPESVTTEEEVELRDILGFLSRANKNRKISDEEKK 48

>KLLA0C00374g Chr3 (25132..25803) [672 bp, 223 aa] {ON}
           uniprot|Q9HDS5 Kluyveromyces lactis HMLALPHA2 Mating-
           type protein ALPHA2
          Length = 223

 Score = 77.8 bits (190), Expect = 5e-17,   Method: Compositional matrix adjust.
 Identities = 39/112 (34%), Positives = 72/112 (64%), Gaps = 7/112 (6%)

Query: 90  KEMRSIENDRSNYQLTQKNKSADGLVFNVVTQDMINKSTKPYR-GHRFTKENVRILESWF 148
           KE+R I   R      Q +K+ + +   ++TQD+++ +   ++ G RF K ++++LE+W+
Sbjct: 117 KEVRKINKYR------QSSKNFESVNIKILTQDLMHSNNNEFKKGKRFPKSHIQLLENWY 170

Query: 149 AKNIENPYLDTKGLENLMKNTSLSRIQIKNWVSNRRRKEKTITIAPELADLL 200
           + N  NPYL    L  + KNT+L++ QIKNW++NRRRK+K   ++ ++ ++L
Sbjct: 171 SMNRRNPYLAENDLAYISKNTTLTKTQIKNWLANRRRKDKITEVSSDIRNIL 222

>Suva_69.1 Chr69 complement(1..102) [102 bp, 34 aa] {ON} YCR039C
          (REAL)
          Length = 34

 Score = 71.6 bits (174), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 34/34 (100%), Positives = 34/34 (100%)

Query: 1  MNKIPIKDLLNPQITDEFKSSILDINKKLFSICC 34
          MNKIPIKDLLNPQITDEFKSSILDINKKLFSICC
Sbjct: 1  MNKIPIKDLLNPQITDEFKSSILDINKKLFSICC 34

>KLTH0F00396g Chr6 (31990..32051,32348..32612) [327 bp, 108 aa] {ON}
           conserved hypothetical protein
          Length = 108

 Score = 51.2 bits (121), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 27/57 (47%), Positives = 37/57 (64%)

Query: 144 LESWFAKNIENPYLDTKGLENLMKNTSLSRIQIKNWVSNRRRKEKTITIAPELADLL 200
           LE WF  NI+ PY +   + +L KNT+LS  QI+NW+SNRRRK +  +I   L  +L
Sbjct: 50  LERWFCSNIQYPYPNKIQILSLSKNTNLSIKQIQNWMSNRRRKSRKESIDSLLEPIL 106

>Kwal_YGOB_matalpha2 s33 (284511..284843) [333 bp, 110 aa] {ON}
           (matalpha2) - mating type alpha2 protein [contig MAT]
           FULL
          Length = 110

 Score = 48.9 bits (115), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 24/45 (53%), Positives = 31/45 (68%)

Query: 144 LESWFAKNIENPYLDTKGLENLMKNTSLSRIQIKNWVSNRRRKEK 188
           LE+WF  N  +PYL  K +  L + T+LS  QI+NW+SNRRRK K
Sbjct: 47  LENWFHLNSSHPYLTRKQISLLSERTNLSSKQIRNWMSNRRRKSK 91

>Kwal_33.12995 s33 (32369..32701) [333 bp, 110 aa] {OFF} YCR096C
           (HMRA2) - Regulatory protein MATa2p (no known function);
           sequence is the same as the last 119 residues of
           MATalpha2p [contig 123] FULL
          Length = 110

 Score = 48.9 bits (115), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 24/45 (53%), Positives = 31/45 (68%)

Query: 144 LESWFAKNIENPYLDTKGLENLMKNTSLSRIQIKNWVSNRRRKEK 188
           LE+WF  N  +PYL  K +  L + T+LS  QI+NW+SNRRRK K
Sbjct: 47  LENWFHLNSSHPYLTRKQISLLSERTNLSSKQIRNWMSNRRRKSK 91

>Kwal_YGOB_HMalpha2 s33 (32369..32701) [333 bp, 110 aa] {ON}
           ANNOTATED BY YGOB - This is Kwal_33.12995
          Length = 110

 Score = 48.9 bits (115), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 24/45 (53%), Positives = 31/45 (68%)

Query: 144 LESWFAKNIENPYLDTKGLENLMKNTSLSRIQIKNWVSNRRRKEK 188
           LE+WF  N  +PYL  K +  L + T+LS  QI+NW+SNRRRK K
Sbjct: 47  LENWFHLNSSHPYLTRKQISLLSERTNLSSKQIRNWMSNRRRKSK 91

>Kwal_33.matalpha2 s33 (284511..284843) [333 bp, 110 aa] {OFF}
           (matalpha2) - mating type alpha2 protein [contig MAT]
           FULL
          Length = 110

 Score = 48.9 bits (115), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 24/45 (53%), Positives = 31/45 (68%)

Query: 144 LESWFAKNIENPYLDTKGLENLMKNTSLSRIQIKNWVSNRRRKEK 188
           LE+WF  N  +PYL  K +  L + T+LS  QI+NW+SNRRRK K
Sbjct: 47  LENWFHLNSSHPYLTRKQISLLSERTNLSSKQIRNWMSNRRRKSK 91

>NDAI0F02170 Chr6 (527340..528491) [1152 bp, 383 aa] {ON} Anc_6.170
           YGL096W
          Length = 383

 Score = 49.7 bits (117), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 24/71 (33%), Positives = 42/71 (59%), Gaps = 2/71 (2%)

Query: 119 VTQDMINKSTKPYRGHR--FTKENVRILESWFAKNIENPYLDTKGLENLMKNTSLSRIQI 176
           V+ D++ + T    G R    KE +RIL SW   +++NPY  ++   +L+  T L+++Q+
Sbjct: 251 VSSDVVEELTSLQHGRRSNLPKETIRILNSWLLNHLQNPYPTSQEKRDLLIKTGLTKVQL 310

Query: 177 KNWVSNRRRKE 187
            NW  N RR++
Sbjct: 311 SNWFINVRRRK 321

>Skud_80.3 Chr80 (593..766) [174 bp, 58 aa] {OFF} YCL067C (HSP)
          Length = 58

 Score = 45.4 bits (106), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 25/34 (73%), Positives = 27/34 (79%), Gaps = 7/34 (20%)

Query: 12 PQITDEFKSSILDINKKLFSICCNLPKLPESVTT 45
          P+IT +FK      NKKLFSICCNLPKLPESVTT
Sbjct: 32 PEIT-KFK------NKKLFSICCNLPKLPESVTT 58

>KLTH0H05236g Chr8 complement(465998..466702) [705 bp, 234 aa] {ON}
           some similarities with uniprot|P41817 Saccharomyces
           cerevisiae YPL177C CUP9 Homeodomain-containing
           transcriptional repressor of PTR2 which encodes a major
           peptide transporter imported peptides activate
           ubiquitin- dependent proteolysis resulting in
           degradation of Cup9p and de-repression of PTR2
           transcription
          Length = 234

 Score = 47.0 bits (110), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 20/51 (39%), Positives = 29/51 (56%)

Query: 136 FTKENVRILESWFAKNIENPYLDTKGLENLMKNTSLSRIQIKNWVSNRRRK 186
             KE V IL +W A ++ NPY   +    L+  T LS++Q+ NW  N RR+
Sbjct: 109 LPKETVEILNAWLASHLNNPYPSPQEKRELLVQTGLSKVQLSNWFINVRRR 159

>CAGL0C01551g Chr3 complement(169232..169897) [666 bp, 221 aa] {ON}
           similar to uniprot|P41817 Saccharomyces cerevisiae
           YPL177c CUP9
          Length = 221

 Score = 45.8 bits (107), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 27/87 (31%), Positives = 42/87 (48%), Gaps = 7/87 (8%)

Query: 124 INKSTKPYRGHRFTKENVRILESWFAKNIENPYLDTKGLENLMKNTSLSRIQIKNWVSNR 183
           IN   K  R     K+ ++IL  W   +I NPY   +   +L+  T L++IQ+ NW  N 
Sbjct: 70  INMMKKSKRRSNLPKDTIQILNQWLLDHIHNPYPTQQEKRDLLIKTGLTKIQLSNWFINV 129

Query: 184 RRKE-------KTITIAPELADLLSGE 203
           RR++        T  + PEL   +S +
Sbjct: 130 RRRKIFNDYYALTSNLPPELLQSMSSQ 156

>ZYRO0G22044g Chr7 (1814345..1814950) [606 bp, 201 aa] {ON} some
           similarities with uniprot|P41817 Saccharomyces
           cerevisiae YPL177C CUP9 Homeodomain-containing
           transcriptional repressor of PTR2 which encodes a major
           peptide transporter imported peptides activate
           ubiquitin- dependent proteolysis resulting in
           degradation of Cup9p and de-repression of PTR2
           transcription
          Length = 201

 Score = 45.4 bits (106), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 23/70 (32%), Positives = 37/70 (52%)

Query: 117 NVVTQDMINKSTKPYRGHRFTKENVRILESWFAKNIENPYLDTKGLENLMKNTSLSRIQI 176
            VV+    +K ++  R     KE V+IL  W   ++ NPY   +   +L+  T L++IQ+
Sbjct: 65  GVVSSGKNHKGSRSGRRSNLPKETVQILNRWLLDHLGNPYPTPQEKRDLLIKTGLTKIQL 124

Query: 177 KNWVSNRRRK 186
            NW  N RR+
Sbjct: 125 SNWFINVRRR 134

>AFL049C Chr6 complement(346546..347319) [774 bp, 257 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YPL177C
           (CUP9) and YGL096W (TOS8)
          Length = 257

 Score = 45.4 bits (106), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 25/81 (30%), Positives = 41/81 (50%), Gaps = 6/81 (7%)

Query: 106 QKNKSADGLVFNVVTQDMINKSTKPYRGHRFTKENVRILESWFAKNIENPYLDTKGLENL 165
           Q+  + DG      T+  + ++ K +R     KE V IL  W   + +NPY   +  + L
Sbjct: 114 QQEPAPDG------TKGKLKETKKQHRRSNLPKETVDILNEWLRNHYDNPYPSPQEKKEL 167

Query: 166 MKNTSLSRIQIKNWVSNRRRK 186
           +K T L+ +Q+ NW  N RR+
Sbjct: 168 LKQTGLNPVQLSNWFINVRRR 188

>Kpol_1036.56 s1036 (153997..154794) [798 bp, 265 aa] {ON}
           (153997..154794) [798 nt, 266 aa]
          Length = 265

 Score = 44.7 bits (104), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 19/52 (36%), Positives = 32/52 (61%)

Query: 136 FTKENVRILESWFAKNIENPYLDTKGLENLMKNTSLSRIQIKNWVSNRRRKE 187
             K +V+IL  W   +++NPY   +  + L+K T L++IQ+ NW  N RR++
Sbjct: 163 LPKNSVQILNQWLLNHLQNPYPTPQEKKELLKQTGLTKIQLSNWFINVRRRK 214

>KAFR0G03650 Chr7 (752766..753299) [534 bp, 177 aa] {ON} Anc_6.170
           YPL177C
          Length = 177

 Score = 43.5 bits (101), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 18/50 (36%), Positives = 32/50 (64%)

Query: 138 KENVRILESWFAKNIENPYLDTKGLENLMKNTSLSRIQIKNWVSNRRRKE 187
           KE ++IL +W   ++ NPY  ++   +L+  T L++IQ+ NW  N RR++
Sbjct: 78  KETIQILNAWLLNHLHNPYPTSQEKRDLLIKTGLTKIQLSNWFINVRRRK 127

>Skud_7.181 Chr7 (328628..329449) [822 bp, 274 aa] {ON} YGL096W
           (REAL)
          Length = 274

 Score = 43.9 bits (102), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 21/60 (35%), Positives = 32/60 (53%), Gaps = 4/60 (6%)

Query: 132 RGH----RFTKENVRILESWFAKNIENPYLDTKGLENLMKNTSLSRIQIKNWVSNRRRKE 187
           +GH       K  V IL  W  ++I NPY   +   +L+  T L+++QI NW  N RR++
Sbjct: 191 KGHGKRSNLPKATVCILNQWLLEHIHNPYPTVQEKRDLLAKTGLTKLQISNWFINARRRK 250

>YPL177C Chr16 complement(213042..213962) [921 bp, 306 aa] {ON}
           CUP9Homeodomain-containing transcriptional repressor of
           PTR2, which encodes a major peptide transporter;
           imported peptides activate ubiquitin-dependent
           proteolysis, resulting in degradation of Cup9p and
           de-repression of PTR2 transcription
          Length = 306

 Score = 43.9 bits (102), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 29/89 (32%), Positives = 44/89 (49%), Gaps = 5/89 (5%)

Query: 102 YQLTQKNKSADGLVFNVVTQDMINKST--KPYRGHR--FTKENVRILESWFAKNIENPYL 157
           Y++  K K A G  +N    D +   +  K   G R    KE V+IL +W   ++ NPY 
Sbjct: 132 YEIINKEKDA-GAQYNRPFSDFVESKSRRKQNSGRRSNLPKETVQILNTWLLNHLNNPYP 190

Query: 158 DTKGLENLMKNTSLSRIQIKNWVSNRRRK 186
             +    L+  T L++IQ+ NW  N RR+
Sbjct: 191 TQQEKRELLIKTGLTKIQLSNWFINVRRR 219

>NDAI0I01320 Chr9 complement(318160..319389) [1230 bp, 409 aa] {ON}
           Anc_6.170 YGL096W
          Length = 409

 Score = 43.9 bits (102), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 19/47 (40%), Positives = 30/47 (63%)

Query: 141 VRILESWFAKNIENPYLDTKGLENLMKNTSLSRIQIKNWVSNRRRKE 187
           V+IL  W   ++ NPY  T+  + L+K T L++IQ+ NW  N RR++
Sbjct: 317 VQILNEWLLDHLTNPYPTTQEKKELLKQTGLTKIQLSNWFINVRRRK 363

>KAFR0A04370 Chr1 complement(870590..871819) [1230 bp, 409 aa] {ON}
           Anc_6.170 YPL177C
          Length = 409

 Score = 43.9 bits (102), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 20/50 (40%), Positives = 30/50 (60%)

Query: 138 KENVRILESWFAKNIENPYLDTKGLENLMKNTSLSRIQIKNWVSNRRRKE 187
           KE V+IL +W   ++ NPY        L+K T L++IQ+ NW  N RR++
Sbjct: 277 KETVQILNNWLVNHLGNPYPTAIEKNELLKQTGLTKIQLSNWFINVRRRK 326

>TPHA0B02580 Chr2 (592073..592867) [795 bp, 264 aa] {ON} Anc_6.170
           YPL177C
          Length = 264

 Score = 43.5 bits (101), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 20/52 (38%), Positives = 31/52 (59%)

Query: 136 FTKENVRILESWFAKNIENPYLDTKGLENLMKNTSLSRIQIKNWVSNRRRKE 187
             K++V +L  W   ++ NPY   K  E L++ T LS+IQ+ NW  N RR++
Sbjct: 160 LPKQSVDVLNKWLLNHLGNPYPTPKEKEELLELTGLSKIQLSNWFINVRRRK 211

>Ecym_2247 Chr2 complement(486469..487518) [1050 bp, 349 aa] {ON}
           similar to Ashbya gossypii AFL049C
          Length = 349

 Score = 43.5 bits (101), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 21/63 (33%), Positives = 33/63 (52%)

Query: 124 INKSTKPYRGHRFTKENVRILESWFAKNIENPYLDTKGLENLMKNTSLSRIQIKNWVSNR 183
           +  + K +R     KE V IL  W   + +NPY   +  + L+K T L+ +Q+ NW  N 
Sbjct: 218 VEHTKKQHRRSNLPKETVDILNEWLRDHYDNPYPSPQEKKELLKQTGLNPVQLSNWFINV 277

Query: 184 RRK 186
           RR+
Sbjct: 278 RRR 280

>NCAS0H01130 Chr8 complement(216012..216854) [843 bp, 280 aa] {ON}
           Anc_6.170 YGL096W
          Length = 280

 Score = 43.1 bits (100), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 18/50 (36%), Positives = 32/50 (64%)

Query: 138 KENVRILESWFAKNIENPYLDTKGLENLMKNTSLSRIQIKNWVSNRRRKE 187
           KE V+IL +W   +++NPY  ++    L+  T L+++Q+ NW  N RR++
Sbjct: 135 KEMVQILNTWLLNHLQNPYPTSQEKRELLIKTGLTKVQLSNWFINVRRRK 184

>Skud_16.103 Chr16 complement(185398..186285) [888 bp, 295 aa] {ON}
           YPL177C (REAL)
          Length = 295

 Score = 43.1 bits (100), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 20/55 (36%), Positives = 30/55 (54%)

Query: 132 RGHRFTKENVRILESWFAKNIENPYLDTKGLENLMKNTSLSRIQIKNWVSNRRRK 186
           R     KE V+IL +W   ++ NPY   +    L+  T L++IQ+ NW  N RR+
Sbjct: 154 RRSNLPKETVQILNTWLLNHLNNPYPTQQEKRELLIKTGLTKIQLSNWFINVRRR 208

>Smik_7.181 Chr7 (319819..320643) [825 bp, 274 aa] {ON} YGL096W
           (REAL)
          Length = 274

 Score = 42.7 bits (99), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 19/50 (38%), Positives = 28/50 (56%)

Query: 138 KENVRILESWFAKNIENPYLDTKGLENLMKNTSLSRIQIKNWVSNRRRKE 187
           K  V IL  W  ++I NPY   +    L+  T L+++QI NW  N RR++
Sbjct: 201 KATVSILNKWLLEHINNPYPTVQEKRELLAKTGLTKLQISNWFINARRRK 250

>TDEL0F01810 Chr6 complement(338066..338836) [771 bp, 256 aa] {ON}
           Anc_6.170 YPL177C
          Length = 256

 Score = 42.7 bits (99), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 19/51 (37%), Positives = 29/51 (56%)

Query: 136 FTKENVRILESWFAKNIENPYLDTKGLENLMKNTSLSRIQIKNWVSNRRRK 186
             KE V+IL +W   ++ NPY   +    L+  T L++IQ+ NW  N RR+
Sbjct: 136 LPKETVQILNTWLLDHLRNPYPTPQEKRELLIKTGLTKIQLSNWFINVRRR 186

>TBLA0C03740 Chr3 complement(892360..893241) [882 bp, 293 aa] {ON}
           Anc_6.170 YPL177C
          Length = 293

 Score = 42.7 bits (99), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 20/50 (40%), Positives = 29/50 (58%)

Query: 138 KENVRILESWFAKNIENPYLDTKGLENLMKNTSLSRIQIKNWVSNRRRKE 187
           KE V+IL  W   ++ NPY   K    L+  T L++IQ+ NW  N RR++
Sbjct: 184 KETVQILNDWLLNHLRNPYPTPKEKSELLVLTGLTKIQLSNWFINVRRRK 233

>Smik_6.374 Chr6 (610093..610977) [885 bp, 294 aa] {ON} YPL177C
           (REAL)
          Length = 294

 Score = 42.7 bits (99), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 20/55 (36%), Positives = 30/55 (54%)

Query: 132 RGHRFTKENVRILESWFAKNIENPYLDTKGLENLMKNTSLSRIQIKNWVSNRRRK 186
           R     KE V+IL +W   ++ NPY   +    L+  T L++IQ+ NW  N RR+
Sbjct: 153 RRSNLPKETVQILNTWLLNHLNNPYPTQQEKRELLIKTGLTKIQLSNWFINVRRR 207

>Suva_16.132 Chr16 complement(222346..223224) [879 bp, 292 aa] {ON}
           YPL177C (REAL)
          Length = 292

 Score = 42.4 bits (98), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 19/55 (34%), Positives = 30/55 (54%)

Query: 132 RGHRFTKENVRILESWFAKNIENPYLDTKGLENLMKNTSLSRIQIKNWVSNRRRK 186
           R     KE V++L +W   ++ NPY   +    L+  T L++IQ+ NW  N RR+
Sbjct: 151 RRSNLPKETVQVLNTWLLNHLNNPYPTQQEKRELLIKTGLTKIQLSNWFINVRRR 205

>KNAG0M00500 Chr13 complement(79067..79963) [897 bp, 298 aa] {ON}
           Anc_6.170 YPL177C
          Length = 298

 Score = 42.4 bits (98), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 19/50 (38%), Positives = 29/50 (58%)

Query: 138 KENVRILESWFAKNIENPYLDTKGLENLMKNTSLSRIQIKNWVSNRRRKE 187
           K+ V IL  W   ++ NPY  ++    L+  T LS+IQ+ NW  N RR++
Sbjct: 185 KDTVLILNRWLLDHLHNPYPTSQEKRELLIKTGLSKIQLSNWFINVRRRK 234

>KLLA0B10450g Chr2 (912877..914046) [1170 bp, 389 aa] {ON} some
           similarities with uniprot|P41817 Saccharomyces
           cerevisiae YPL177C CUP9 Homeodomain-containing
           transcriptional repressor of PTR2 which encodes a major
           peptide transporter imported peptides activate
           ubiquitin- dependent proteolysis resulting in
           degradation of Cup9p and de-repression of PTR2
           transcription
          Length = 389

 Score = 42.0 bits (97), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 18/52 (34%), Positives = 29/52 (55%)

Query: 136 FTKENVRILESWFAKNIENPYLDTKGLENLMKNTSLSRIQIKNWVSNRRRKE 187
             KE + +L  W  KN+ NPY   +    L++ T L+ +Q+ NW  N RR++
Sbjct: 256 LPKEVINVLNDWLLKNLHNPYPTPQVKRELLEKTGLNPVQLSNWFINVRRRK 307

>YGL096W Chr7 (325331..326161) [831 bp, 276 aa] {ON}
           TOS8Homeodomain-containing protein and putative
           transcription factor found associated with chromatin;
           target of SBF transcription factor; induced during
           meiosis and under cell-damaging conditions; similar to
           Cup9p transcription factor
          Length = 276

 Score = 41.6 bits (96), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 18/50 (36%), Positives = 28/50 (56%)

Query: 138 KENVRILESWFAKNIENPYLDTKGLENLMKNTSLSRIQIKNWVSNRRRKE 187
           K  V IL  W  +++ NPY   +    L+  T L+++QI NW  N RR++
Sbjct: 203 KATVSILNKWLHEHVNNPYPTVQEKRELLAKTGLTKLQISNWFINARRRK 252

>Suva_7.172 Chr7 (319317..320129) [813 bp, 270 aa] {ON} YGL096W
           (REAL)
          Length = 270

 Score = 41.6 bits (96), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 18/47 (38%), Positives = 27/47 (57%)

Query: 141 VRILESWFAKNIENPYLDTKGLENLMKNTSLSRIQIKNWVSNRRRKE 187
           V IL  W  ++I NPY   +    L+  T L+++QI NW  N RR++
Sbjct: 206 VHILNKWLLEHINNPYPTLQEKRELLAQTGLTKLQISNWFINARRRK 252

>Kwal_27.11092 s27 (635052..635741) [690 bp, 229 aa] {ON} YPL177C
           (CUP9) - putative DNA binding protein which shows
           similarity in homeobox domain to human proto-oncogene
           PBX1 [contig 31] FULL
          Length = 229

 Score = 41.2 bits (95), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 21/60 (35%), Positives = 33/60 (55%), Gaps = 1/60 (1%)

Query: 127 STKPYRGHRFTKENVRILESWFAKNIENPYLDTKGLENLMKNTSLSRIQIKNWVSNRRRK 186
           ++KP R +   KE V IL +W   ++  PY   +    L+  T LS++Q+ NW  N RR+
Sbjct: 117 TSKPRRTN-LPKETVDILNNWLLAHLNYPYPSPQEKRELLIKTGLSKVQLSNWFINVRRR 175

>SAKL0A05610g Chr1 complement(506437..507399) [963 bp, 320 aa] {ON}
           some similarities with uniprot|P41817 Saccharomyces
           cerevisiae YPL177C CUP9 Homeodomain-containing
           transcriptional repressor of PTR2 which encodes a major
           peptide transporter imported peptides activate
           ubiquitin- dependent proteolysis resulting in
           degradation of Cup9p and de-repression of PTR2
           transcription
          Length = 320

 Score = 41.6 bits (96), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 18/52 (34%), Positives = 29/52 (55%)

Query: 136 FTKENVRILESWFAKNIENPYLDTKGLENLMKNTSLSRIQIKNWVSNRRRKE 187
             KE V+IL +W   ++ NPY   +    L+  T L+ +Q+ NW  N RR++
Sbjct: 213 LPKETVQILNNWLLAHLHNPYPSPQEKRELLLKTGLNPVQLSNWFINVRRRK 264

>CAGL0H02959g Chr8 (277540..278319) [780 bp, 259 aa] {ON} some
           similarities with uniprot|P53147 Saccharomyces
           cerevisiae YGL096w TOS8
          Length = 259

 Score = 41.2 bits (95), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 20/50 (40%), Positives = 28/50 (56%)

Query: 138 KENVRILESWFAKNIENPYLDTKGLENLMKNTSLSRIQIKNWVSNRRRKE 187
           KE V+IL  W   +I NPY   +    L   T L++IQ+ NW  N RR++
Sbjct: 170 KETVKILNEWLYDHINNPYPTPQEKMELSLKTGLTKIQLSNWFINVRRRK 219

>KNAG0F02210 Chr6 complement(423243..424217) [975 bp, 324 aa] {ON}
           Anc_6.170 YPL177C
          Length = 324

 Score = 39.3 bits (90), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 16/50 (32%), Positives = 30/50 (60%)

Query: 138 KENVRILESWFAKNIENPYLDTKGLENLMKNTSLSRIQIKNWVSNRRRKE 187
           +E V++L +W   ++ +PY        L++ T L++IQ+ NW  N RR++
Sbjct: 248 RETVQMLNNWLLNHLHDPYPTPHEKLELLRQTGLTKIQLSNWFINVRRRK 297

>NCAS0D03570 Chr4 (664388..665161) [774 bp, 257 aa] {ON} Anc_6.170
           YGL096W
          Length = 257

 Score = 39.3 bits (90), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 15/50 (30%), Positives = 31/50 (62%)

Query: 138 KENVRILESWFAKNIENPYLDTKGLENLMKNTSLSRIQIKNWVSNRRRKE 187
           +  V +L  W  +++ NPY + +  + L++ T L+++Q+ NW  N RR++
Sbjct: 189 RGTVEVLNGWLLEHLNNPYPNVQEKKLLLELTGLTKVQLSNWFINVRRRK 238

>NDAI0A00670 Chr1
           complement(124998..125033,125093..125308,125369..125404)
           [288 bp, 95 aa] {ON}
          Length = 95

 Score = 33.1 bits (74), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 19/52 (36%), Positives = 32/52 (61%), Gaps = 3/52 (5%)

Query: 137 TKENVRILESWFAKNIENPYLDTKGLENLMKNTSLSRIQIKNWVSNRRRKEK 188
           +KEN  +LE+ F K    P+L+TK  E + K+  +S +Q++ W  N+R + K
Sbjct: 45  SKENKLLLENIFQKK---PWLNTKEREFVAKSCGMSALQVRVWFINKRMRTK 93

>NDAI0H00100 Chr8 complement(758..793,853..1068,1129..1164) [288 bp,
           95 aa] {ON} silent copy of MATa1 gene at HMRa
          Length = 95

 Score = 33.1 bits (74), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 19/52 (36%), Positives = 32/52 (61%), Gaps = 3/52 (5%)

Query: 137 TKENVRILESWFAKNIENPYLDTKGLENLMKNTSLSRIQIKNWVSNRRRKEK 188
           +KEN  +LE+ F K    P+L+TK  E + K+  +S +Q++ W  N+R + K
Sbjct: 45  SKENKLLLENIFQKK---PWLNTKEREFVAKSCGMSALQVRVWFINKRMRTK 93

>Kpol_1053.1 s1053 (1..330) [330 bp, 109 aa] {ON} (1..330) [330
          nt, 110 aa]
          Length = 109

 Score = 30.0 bits (66), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 22/76 (28%), Positives = 34/76 (44%), Gaps = 8/76 (10%)

Query: 2  NKIPIKDLLNPQITDEFKSSILDINKKLF---SICCNLPKLPESVTTEEEVEL-----RD 53
          N +PI + L P + + F+ S+    KK F         P    S+T+ E   L      +
Sbjct: 12 NHVPIVEQLTPGVIEIFEESVSSAPKKFFVSGGFASVQPDSTLSITSAEAFPLDSFSSEN 71

Query: 54 ILGFLSRANKNRKISD 69
          I   L+ ANKN+  +D
Sbjct: 72 IRNLLAEANKNKSSTD 87

>NCAS0B02580 Chr2 complement(431287..433008) [1722 bp, 573 aa] {ON}
           Anc_8.467
          Length = 573

 Score = 30.0 bits (66), Expect = 4.8,   Method: Compositional matrix adjust.
 Identities = 23/53 (43%), Positives = 29/53 (54%), Gaps = 1/53 (1%)

Query: 19  KSSILDINKKLFSICCNLPKLPESVTTEEEVELRDI-LGFLSRANKNRKISDE 70
            S ILD NK  +S    L  +P S+  +  VE  D  LG+LSRA K +K  DE
Sbjct: 125 HSKILDQNKYEYSTLPPLYGIPISLKDQCNVEGVDTTLGYLSRAFKPKKKEDE 177

>Suva_2.438 Chr2 (775678..776502) [825 bp, 274 aa] {ON} YDR272W
           (REAL)
          Length = 274

 Score = 29.6 bits (65), Expect = 5.2,   Method: Compositional matrix adjust.
 Identities = 14/32 (43%), Positives = 18/32 (56%)

Query: 128 TKPYRGHRFTKENVRILESWFAKNIENPYLDT 159
           TK Y GH +TK NV+ +   + K  EN  LD 
Sbjct: 182 TKVYPGHEYTKSNVKFVRKIYPKVGENKALDA 213

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.312    0.130    0.360 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 21,488,205
Number of extensions: 874727
Number of successful extensions: 2526
Number of sequences better than 10.0: 96
Number of HSP's gapped: 2494
Number of HSP's successfully gapped: 100
Length of query: 210
Length of database: 53,481,399
Length adjustment: 105
Effective length of query: 105
Effective length of database: 41,441,469
Effective search space: 4351354245
Effective search space used: 4351354245
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.9 bits)
S2: 63 (28.9 bits)