Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
YCR040W (MATALPHA1)1.120ON1751759361e-131
YCL066W (HMLALPHA1)1.1ON1751759361e-131
Suva_3.1481.1ON1751757781e-106
Skud_3.1191.120ON1741757371e-100
Smik_92.1singletonON1561567231e-98
Skud_71.1singletonON1551566274e-84
Suva_69.2singletonON1451456041e-80
ZYRO0F18590g1.1ON2001842572e-27
ZYRO0F15840g1.120ON2001842572e-27
TDEL0C070101.1ON205702547e-27
Smik_3.1441.120ON54402201e-23
Kpol_2002.21.1ON209702312e-23
TBLA0A070401.120ON2011892242e-22
TBLA0A075901.1ON2011892242e-22
CAGL0B01243g1.120ON143891992e-19
NCAS0B091501.1ON1501451992e-19
CAGL0B00242g1.1ON184612022e-19
TPHA0E036201.120ON195681988e-19
TPHA0E040801.1ON195681988e-19
Suva_3.140singletonON31311755e-17
KLTH0F00374g1.1ON2491711642e-13
KNAG0C001501.1ON145521531e-12
Ecym_10031.1ON263951581e-12
Ecym_11141.120ON263951581e-12
Kwal_33.matalpha1singletonOFF2441711528e-12
Kwal_33.12992singletonOFF2441711528e-12
Kwal_YGOB_matalpha11.120ON2441711528e-12
Kwal_YGOB_HMalpha11.1ON2441711528e-12
KLLA0C00352g1.1ON261731475e-11
NDAI0A001001.1ON1351051303e-09
KAFR0D007101.120ON172471304e-09
Smik_88.1singletonON35211129e-08
Suva_3.791.120ON35201111e-07
Skud_80.1singletonON32211102e-07
Ecym_12173.512ON60753710.77
KNAG0J008503.279ON16272652.7
SAKL0D12914g1.519ON105192654.7
ZYRO0G06820g8.187ON301107637.4
ABR152C7.491ON63052637.8
Skud_16.4897.542ON72047629.6
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= YCL066W
         (175 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

YCR040W Chr3 (200442..200969) [528 bp, 175 aa] {ON}  MATALPHA1Tr...   365   e-131
YCL066W Chr3 (13282..13809) [528 bp, 175 aa] {ON}  HMLALPHA1Sile...   365   e-131
Suva_3.148 Chr3 (222811..223338) [528 bp, 175 aa] {ON} YCL066W (...   304   e-106
Skud_3.119 Chr3 (184941..185465) [525 bp, 174 aa] {ON} YCR040W (...   288   e-100
Smik_92.1 Chr92 complement(3..470) [468 bp, 156 aa] {ON} YCR040W...   283   1e-98
Skud_71.1 Chr71 complement(3..467) [465 bp, 155 aa] {ON} YCR040W...   246   4e-84
Suva_69.2 Chr69 (369..803) [435 bp, 145 aa] {ON} YCL066W (REAL)       237   1e-80
ZYRO0F18590g Chr6 (1533781..1534383) [603 bp, 200 aa] {ON} simil...   103   2e-27
ZYRO0F15840g Chr6 (1303842..1304444) [603 bp, 200 aa] {ON} simil...   103   2e-27
TDEL0C07010 Chr3 (1274648..1275265) [618 bp, 205 aa] {ON} Anc_1....   102   7e-27
Smik_3.144 Chr3 (198300..198334,198763..198892) [165 bp, 54 aa] ...    89   1e-23
Kpol_2002.2 s2002 complement(3611..4240) [630 bp, 209 aa] {ON} c...    94   2e-23
TBLA0A07040 Chr1 complement(1727988..1728593) [606 bp, 201 aa] {...    91   2e-22
TBLA0A07590 Chr1 complement(1881757..1882362) [606 bp, 201 aa] {...    91   2e-22
CAGL0B01243g Chr2 complement(112831..113262) [432 bp, 143 aa] {O...    81   2e-19
NCAS0B09150 Chr2 (1755595..1756047) [453 bp, 150 aa] {ON} Anc_1.1      81   2e-19
CAGL0B00242g Chr2 complement(10582..11136) [555 bp, 184 aa] {ON}...    82   2e-19
TPHA0E03620 Chr5 (766068..766655) [588 bp, 195 aa] {ON} Anc_1.12...    81   8e-19
TPHA0E04080 Chr5 (850045..850632) [588 bp, 195 aa] {ON}   silenc...    81   8e-19
Suva_3.140 Chr3 (212396..212488) [93 bp, 31 aa] {ON} YCR040W (REAL)    72   5e-17
KLTH0F00374g Chr6 complement(30927..31676) [750 bp, 249 aa] {ON}...    68   2e-13
KNAG0C00150 Chr3 complement(24902..25339) [438 bp, 145 aa] {ON} ...    64   1e-12
Ecym_1003 Chr1 (6314..7105) [792 bp, 263 aa] {ON} similar to Sac...    65   1e-12
Ecym_1114 Chr1 complement(236238..237029) [792 bp, 263 aa] {ON} ...    65   1e-12
Kwal_33.matalpha1 s33 complement(283160..283894) [735 bp, 244 aa...    63   8e-12
Kwal_33.12992 s33 complement(31018..31752) [735 bp, 244 aa] {OFF...    63   8e-12
Kwal_YGOB_matalpha1 s33 complement(283160..283894) [735 bp, 244 ...    63   8e-12
Kwal_YGOB_HMalpha1 s33 complement(31018..31752) [735 bp, 244 aa]...    63   8e-12
KLLA0C00352g Chr3 complement(24124..24909) [786 bp, 261 aa] {ON}...    61   5e-11
NDAI0A00100 Chr1 complement(783..1190) [408 bp, 135 aa] {ON} Anc...    55   3e-09
KAFR0D00710 Chr4 complement(127819..128337) [519 bp, 172 aa] {ON...    55   4e-09
Smik_88.1 Chr88 complement(3..72,501..535) [105 bp, 35 aa] {ON} ...    48   9e-08
Suva_3.79 Chr3 (114117..114221) [105 bp, 35 aa] {ON} YCR040W (REAL)    47   1e-07
Skud_80.1 Chr80 complement(3..98) [96 bp, 32 aa] {ON} YCR040W (R...    47   2e-07
Ecym_1217 Chr1 complement(441461..443284) [1824 bp, 607 aa] {ON}...    32   0.77 
KNAG0J00850 Chr10 complement(146187..146675) [489 bp, 162 aa] {O...    30   2.7  
SAKL0D12914g Chr4 complement(1080337..1083492) [3156 bp, 1051 aa...    30   4.7  
ZYRO0G06820g Chr7 complement(546927..547832) [906 bp, 301 aa] {O...    29   7.4  
ABR152C Chr2 complement(685052..686920,686970..686993) [1893 bp,...    29   7.8  
Skud_16.489 Chr16 (849572..851734) [2163 bp, 720 aa] {ON} YPR185...    28   9.6  

>YCR040W Chr3 (200442..200969) [528 bp, 175 aa] {ON}
           MATALPHA1Transcriptional co-activator involved in
           regulation of mating-type-specific gene expression;
           targets the transcription factor Mcm1p to the promoters
           of alpha-specific genes; one of two genes encoded by the
           MATalpha mating type cassette
          Length = 175

 Score =  365 bits (936), Expect = e-131,   Method: Compositional matrix adjust.
 Identities = 175/175 (100%), Positives = 175/175 (100%)

Query: 1   MFTSKPAFKIKNKASKSYRNTAVSKKLKEKRLAEHVRPSCFNIIRPLKKDIQIPVPSSRF 60
           MFTSKPAFKIKNKASKSYRNTAVSKKLKEKRLAEHVRPSCFNIIRPLKKDIQIPVPSSRF
Sbjct: 1   MFTSKPAFKIKNKASKSYRNTAVSKKLKEKRLAEHVRPSCFNIIRPLKKDIQIPVPSSRF 60

Query: 61  LNKIQIHRIASGSQNTQFRQFNKTSIKSSKKYLNSFMAFRAYYSQFGSGVKQNVLSSLLA 120
           LNKIQIHRIASGSQNTQFRQFNKTSIKSSKKYLNSFMAFRAYYSQFGSGVKQNVLSSLLA
Sbjct: 61  LNKIQIHRIASGSQNTQFRQFNKTSIKSSKKYLNSFMAFRAYYSQFGSGVKQNVLSSLLA 120

Query: 121 EEWHADKMQHGIWDYFAQQYNFINPGFGFVEWLTNNYAEVRGDGYWEDVFVHLAL 175
           EEWHADKMQHGIWDYFAQQYNFINPGFGFVEWLTNNYAEVRGDGYWEDVFVHLAL
Sbjct: 121 EEWHADKMQHGIWDYFAQQYNFINPGFGFVEWLTNNYAEVRGDGYWEDVFVHLAL 175

>YCL066W Chr3 (13282..13809) [528 bp, 175 aa] {ON}
           HMLALPHA1Silenced copy of ALPHA1 at HML, encoding a
           transcriptional coactivator involved in the regulation
           of mating-type alpha-specific gene expression
          Length = 175

 Score =  365 bits (936), Expect = e-131,   Method: Compositional matrix adjust.
 Identities = 175/175 (100%), Positives = 175/175 (100%)

Query: 1   MFTSKPAFKIKNKASKSYRNTAVSKKLKEKRLAEHVRPSCFNIIRPLKKDIQIPVPSSRF 60
           MFTSKPAFKIKNKASKSYRNTAVSKKLKEKRLAEHVRPSCFNIIRPLKKDIQIPVPSSRF
Sbjct: 1   MFTSKPAFKIKNKASKSYRNTAVSKKLKEKRLAEHVRPSCFNIIRPLKKDIQIPVPSSRF 60

Query: 61  LNKIQIHRIASGSQNTQFRQFNKTSIKSSKKYLNSFMAFRAYYSQFGSGVKQNVLSSLLA 120
           LNKIQIHRIASGSQNTQFRQFNKTSIKSSKKYLNSFMAFRAYYSQFGSGVKQNVLSSLLA
Sbjct: 61  LNKIQIHRIASGSQNTQFRQFNKTSIKSSKKYLNSFMAFRAYYSQFGSGVKQNVLSSLLA 120

Query: 121 EEWHADKMQHGIWDYFAQQYNFINPGFGFVEWLTNNYAEVRGDGYWEDVFVHLAL 175
           EEWHADKMQHGIWDYFAQQYNFINPGFGFVEWLTNNYAEVRGDGYWEDVFVHLAL
Sbjct: 121 EEWHADKMQHGIWDYFAQQYNFINPGFGFVEWLTNNYAEVRGDGYWEDVFVHLAL 175

>Suva_3.148 Chr3 (222811..223338) [528 bp, 175 aa] {ON} YCL066W
           (REAL)
          Length = 175

 Score =  304 bits (778), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 142/175 (81%), Positives = 158/175 (90%)

Query: 1   MFTSKPAFKIKNKASKSYRNTAVSKKLKEKRLAEHVRPSCFNIIRPLKKDIQIPVPSSRF 60
           MFTSKPAF+IKNK SKS+R T ++KK++ KR+A+ + PSCFNIIRPLKK+IQIP PS  F
Sbjct: 1   MFTSKPAFRIKNKTSKSHRKTDIAKKVEGKRIAKLINPSCFNIIRPLKKNIQIPAPSPLF 60

Query: 61  LNKIQIHRIASGSQNTQFRQFNKTSIKSSKKYLNSFMAFRAYYSQFGSGVKQNVLSSLLA 120
           L KIQ++RIASG+QN Q RQ  K SI  SKKYLNSFMAFRAYYSQFG+GVKQN+LSSLL+
Sbjct: 61  LKKIQLYRIASGNQNIQCRQSRKASITPSKKYLNSFMAFRAYYSQFGAGVKQNILSSLLS 120

Query: 121 EEWHADKMQHGIWDYFAQQYNFINPGFGFVEWLTNNYAEVRGDGYWEDVFVHLAL 175
           EEWHADKMQHGIWDYFAQQYNFINPGFGFVEWLTNNYAEVRGDGYWEDVFVHLAL
Sbjct: 121 EEWHADKMQHGIWDYFAQQYNFINPGFGFVEWLTNNYAEVRGDGYWEDVFVHLAL 175

>Skud_3.119 Chr3 (184941..185465) [525 bp, 174 aa] {ON} YCR040W
           (REAL)
          Length = 174

 Score =  288 bits (737), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 142/175 (81%), Positives = 158/175 (90%), Gaps = 1/175 (0%)

Query: 1   MFTSKPAFKIKNKASKSYRNTAVSKKLKEKRLAEHVRPSCFNIIRPLKKDIQIPVPSSRF 60
           MFTSKPAF+IK K SKSYR T +SK ++   + + + PSCFN+IRPLKKDIQIP P+SRF
Sbjct: 1   MFTSKPAFRIKKKTSKSYRKTVISK-VEGNGIVKRISPSCFNVIRPLKKDIQIPAPASRF 59

Query: 61  LNKIQIHRIASGSQNTQFRQFNKTSIKSSKKYLNSFMAFRAYYSQFGSGVKQNVLSSLLA 120
           L KIQIHRI+SG+Q TQ RQ +K SIKSSKK++NSFMAFRAYYSQFGSGVKQN+LSSLL+
Sbjct: 60  LKKIQIHRISSGNQTTQCRQLSKASIKSSKKHINSFMAFRAYYSQFGSGVKQNILSSLLS 119

Query: 121 EEWHADKMQHGIWDYFAQQYNFINPGFGFVEWLTNNYAEVRGDGYWEDVFVHLAL 175
           EEWHADKMQHGIWDYFAQQYNFINPGFGFVEWLTNNYAEVRGDGYWEDVFVHLAL
Sbjct: 120 EEWHADKMQHGIWDYFAQQYNFINPGFGFVEWLTNNYAEVRGDGYWEDVFVHLAL 174

>Smik_92.1 Chr92 complement(3..470) [468 bp, 156 aa] {ON} YCR040W
           (REAL)
          Length = 156

 Score =  283 bits (723), Expect = 1e-98,   Method: Compositional matrix adjust.
 Identities = 131/156 (83%), Positives = 146/156 (93%)

Query: 1   MFTSKPAFKIKNKASKSYRNTAVSKKLKEKRLAEHVRPSCFNIIRPLKKDIQIPVPSSRF 60
           MFTSKPAF+I NK SKS+RN  VSKK+KE+R+ +HV+P+CFN+IRPLKKDIQIP+PSSRF
Sbjct: 1   MFTSKPAFRINNKISKSHRNPVVSKKIKERRITKHVKPNCFNVIRPLKKDIQIPIPSSRF 60

Query: 61  LNKIQIHRIASGSQNTQFRQFNKTSIKSSKKYLNSFMAFRAYYSQFGSGVKQNVLSSLLA 120
           L KIQIHRIASG+Q+ Q RQ NKTSIKS+KKYLNSFMAFRAYYSQFGSGVKQN+LSSLL+
Sbjct: 61  LKKIQIHRIASGNQHIQCRQLNKTSIKSTKKYLNSFMAFRAYYSQFGSGVKQNILSSLLS 120

Query: 121 EEWHADKMQHGIWDYFAQQYNFINPGFGFVEWLTNN 156
           EEWHADK QHGIWDYFAQQYNFINPGFGFVEWLTNN
Sbjct: 121 EEWHADKTQHGIWDYFAQQYNFINPGFGFVEWLTNN 156

>Skud_71.1 Chr71 complement(3..467) [465 bp, 155 aa] {ON} YCR040W
           (REAL)
          Length = 155

 Score =  246 bits (627), Expect = 4e-84,   Method: Compositional matrix adjust.
 Identities = 123/156 (78%), Positives = 139/156 (89%), Gaps = 1/156 (0%)

Query: 1   MFTSKPAFKIKNKASKSYRNTAVSKKLKEKRLAEHVRPSCFNIIRPLKKDIQIPVPSSRF 60
           MFTSKPAF+IK K SKSYR T +SK ++   + + + PSCFN+IRPLKKDIQIP P+SRF
Sbjct: 1   MFTSKPAFRIKKKTSKSYRKTVISK-VEGNGIVKRISPSCFNVIRPLKKDIQIPAPASRF 59

Query: 61  LNKIQIHRIASGSQNTQFRQFNKTSIKSSKKYLNSFMAFRAYYSQFGSGVKQNVLSSLLA 120
           L KIQIHRI+SG+Q TQ RQ +K SIKSSKK++NSFMAFRAYYSQFGSGVKQN+LSSLL+
Sbjct: 60  LKKIQIHRISSGNQTTQCRQLSKASIKSSKKHINSFMAFRAYYSQFGSGVKQNILSSLLS 119

Query: 121 EEWHADKMQHGIWDYFAQQYNFINPGFGFVEWLTNN 156
           EEWHADKMQHGIWDYFAQQYNFINPGFGFVEWLTNN
Sbjct: 120 EEWHADKMQHGIWDYFAQQYNFINPGFGFVEWLTNN 155

>Suva_69.2 Chr69 (369..803) [435 bp, 145 aa] {ON} YCL066W (REAL)
          Length = 145

 Score =  237 bits (604), Expect = 1e-80,   Method: Compositional matrix adjust.
 Identities = 112/145 (77%), Positives = 128/145 (88%)

Query: 1   MFTSKPAFKIKNKASKSYRNTAVSKKLKEKRLAEHVRPSCFNIIRPLKKDIQIPVPSSRF 60
           MFTSKPAF+IKNK SKS+R T ++KK++ KR+A+ + PSCFNIIRPLKK+IQIP PS  F
Sbjct: 1   MFTSKPAFRIKNKTSKSHRKTDIAKKVEGKRIAKLINPSCFNIIRPLKKNIQIPAPSPLF 60

Query: 61  LNKIQIHRIASGSQNTQFRQFNKTSIKSSKKYLNSFMAFRAYYSQFGSGVKQNVLSSLLA 120
           L KIQ++RIASG+QN Q RQ  K SI  SKKYLNSFMAFRAYYSQFG+GVKQN+LSSLL+
Sbjct: 61  LKKIQLYRIASGNQNIQCRQSRKASITPSKKYLNSFMAFRAYYSQFGAGVKQNILSSLLS 120

Query: 121 EEWHADKMQHGIWDYFAQQYNFINP 145
           EEWHADKMQHGIWDYFAQQYNFINP
Sbjct: 121 EEWHADKMQHGIWDYFAQQYNFINP 145

>ZYRO0F18590g Chr6 (1533781..1534383) [603 bp, 200 aa] {ON} similar
           to uniprot|P01365 Saccharomyces cerevisiae YCR040W
           MATALPHA1 Transcriptional co-activator involved in
           regulation of mating-type-specific gene expression
           targets the transcription factor Mcm1p to the promoters
           of alpha- specific genes one of two genes encoded by the
           alpha mating type cassette
          Length = 200

 Score =  103 bits (257), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 69/184 (37%), Positives = 91/184 (49%), Gaps = 29/184 (15%)

Query: 3   TSKPAFKIK-NKASKSYRNTAVSKKLKEKRLA-EHVRPSCFNIIRPLKKDIQIPVPSSRF 60
           +++P FK+K  K  +S R T        K +A + +     N+   + K I+IP P    
Sbjct: 11  SNQPLFKVKVEKKGRSKRPTLQDTTQTSKCIAGKCIEDQQVNVFMTVSKLIKIPSPPEVL 70

Query: 61  LNKIQ--IHRIASGSQNTQ--------------------FRQFNKTSIKSSKK-----YL 93
           L KI+   H++     N                          N  S K S+K      L
Sbjct: 71  LRKIEEEKHKLKKDDFNMDNILLWDPYVYWGEGYFFSIADSSLNNLSTKGSRKGCSEKPL 130

Query: 94  NSFMAFRAYYSQFGSGVKQNVLSSLLAEEWHADKMQHGIWDYFAQQYNFINPGFGFVEWL 153
           NSFMAFRAY SQFG+G+KQN+LSSLLA  WH+   Q  IWD FAQQ+NF+ P  GFVEW+
Sbjct: 131 NSFMAFRAYNSQFGNGLKQNILSSLLAAAWHSHPEQQKIWDTFAQQFNFVKPKCGFVEWV 190

Query: 154 TNNY 157
              Y
Sbjct: 191 DQRY 194

>ZYRO0F15840g Chr6 (1303842..1304444) [603 bp, 200 aa] {ON} similar
           to uniprot|P01365 Saccharomyces cerevisiae YCR040W
           MATALPHA1 Transcriptional co-activator involved in
           regulation of mating-type-specific gene expression
           targets the transcription factor Mcm1p to the promoters
           of alpha- specific genes one of two genes encoded by the
           alpha mating type cassette
          Length = 200

 Score =  103 bits (257), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 69/184 (37%), Positives = 91/184 (49%), Gaps = 29/184 (15%)

Query: 3   TSKPAFKIK-NKASKSYRNTAVSKKLKEKRLA-EHVRPSCFNIIRPLKKDIQIPVPSSRF 60
           +++P FK+K  K  +S R T        K +A + +     N+   + K I+IP P    
Sbjct: 11  SNQPLFKVKVEKKGRSKRPTLQDTTQTSKCIAGKCIEDQQVNVFMTVSKLIKIPSPPEVL 70

Query: 61  LNKIQ--IHRIASGSQNTQ--------------------FRQFNKTSIKSSKK-----YL 93
           L KI+   H++     N                          N  S K S+K      L
Sbjct: 71  LRKIEEEKHKLKKDDFNMDNILLWDPYVYWGEGYFFSIADSSLNNLSTKGSRKGCSEKPL 130

Query: 94  NSFMAFRAYYSQFGSGVKQNVLSSLLAEEWHADKMQHGIWDYFAQQYNFINPGFGFVEWL 153
           NSFMAFRAY SQFG+G+KQN+LSSLLA  WH+   Q  IWD FAQQ+NF+ P  GFVEW+
Sbjct: 131 NSFMAFRAYNSQFGNGLKQNILSSLLAAAWHSHPEQQKIWDTFAQQFNFVKPKCGFVEWV 190

Query: 154 TNNY 157
              Y
Sbjct: 191 DQRY 194

>TDEL0C07010 Chr3 (1274648..1275265) [618 bp, 205 aa] {ON} Anc_1.121
           YCR040W silenced copy of alpha1 gene at T. delbrueckii
           HML locus
          Length = 205

 Score =  102 bits (254), Expect = 7e-27,   Method: Compositional matrix adjust.
 Identities = 46/70 (65%), Positives = 53/70 (75%)

Query: 88  SSKKYLNSFMAFRAYYSQFGSGVKQNVLSSLLAEEWHADKMQHGIWDYFAQQYNFINPGF 147
           +S K LNSFMAFRAY SQFG G+KQN+LSSLLA  WH+   Q GIWD FAQQ+NF+ P  
Sbjct: 132 ASNKPLNSFMAFRAYNSQFGYGLKQNILSSLLASAWHSHPEQQGIWDTFAQQFNFVKPKC 191

Query: 148 GFVEWLTNNY 157
           GFVEW+   Y
Sbjct: 192 GFVEWVDQRY 201

>Smik_3.144 Chr3 (198300..198334,198763..198892) [165 bp, 54 aa]
           {ON} YCR040W (REAL)
          Length = 54

 Score = 89.4 bits (220), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 39/40 (97%), Positives = 39/40 (97%)

Query: 136 FAQQYNFINPGFGFVEWLTNNYAEVRGDGYWEDVFVHLAL 175
           F QQYNFINPGFGFVEWLTNNYAEVRGDGYWEDVFVHLAL
Sbjct: 15  FPQQYNFINPGFGFVEWLTNNYAEVRGDGYWEDVFVHLAL 54

>Kpol_2002.2 s2002 complement(3611..4240) [630 bp, 209 aa] {ON}
           complement(3611..4240) [630 nt, 210 aa]
          Length = 209

 Score = 93.6 bits (231), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 42/70 (60%), Positives = 50/70 (71%)

Query: 88  SSKKYLNSFMAFRAYYSQFGSGVKQNVLSSLLAEEWHADKMQHGIWDYFAQQYNFINPGF 147
           SSKK LN FMAFRAY SQFG G+KQ +LSSLL+E WH+D  Q   W   +QQ+NF+ P  
Sbjct: 132 SSKKSLNGFMAFRAYNSQFGYGLKQEILSSLLSEAWHSDPEQQKKWTVLSQQFNFVKPKC 191

Query: 148 GFVEWLTNNY 157
           GFVEW+   Y
Sbjct: 192 GFVEWVGQTY 201

>TBLA0A07040 Chr1 complement(1727988..1728593) [606 bp, 201 aa] {ON}
            MATalpha1 gene at MAT locus
          Length = 201

 Score = 90.9 bits (224), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 58/189 (30%), Positives = 89/189 (47%), Gaps = 38/189 (20%)

Query: 3   TSKPAFKIKNKASKSYRNTAVSKKLKEKRLAEHVRPSCFNIIRPLKKDIQIPVPSSRFLN 62
           T K  FK+  K +K+ R    SK ++ K           +I+     +I+IP P +  L 
Sbjct: 9   TKKALFKVNLKLNKNIRMKTNSKSMRNK----FNETRGISILLYKNHNIKIPFPPTTLLY 64

Query: 63  KIQIHR---IASGSQNTQFRQFNKTSIKSS------------------------------ 89
            I++ +   I++     ++   N  +  S                               
Sbjct: 65  NIEVEKQKIISTQHMLNEYTMDNDDNYLSDLFYEDEYNDNNSLFDNGFPNNVNSNPNPVN 124

Query: 90  -KKYLNSFMAFRAYYSQFGSGVKQNVLSSLLAEEWHADKMQHGIWDYFAQQYNFINPGFG 148
            ++ LN F+AFRAY SQFG G+KQN+LSSLL+  WH +  Q  +W++F+Q+YNF+ P  G
Sbjct: 125 SERVLNGFIAFRAYNSQFGYGLKQNILSSLLSTAWHENPNQQNVWNFFSQEYNFVKPKCG 184

Query: 149 FVEWLTNNY 157
           FVEWL   Y
Sbjct: 185 FVEWLGQTY 193

>TBLA0A07590 Chr1 complement(1881757..1882362) [606 bp, 201 aa] {ON}
           Anc_1.1 YCL066W silenced copy of alpha1 gene at HML
           locus
          Length = 201

 Score = 90.9 bits (224), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 58/189 (30%), Positives = 89/189 (47%), Gaps = 38/189 (20%)

Query: 3   TSKPAFKIKNKASKSYRNTAVSKKLKEKRLAEHVRPSCFNIIRPLKKDIQIPVPSSRFLN 62
           T K  FK+  K +K+ R    SK ++ K           +I+     +I+IP P +  L 
Sbjct: 9   TKKALFKVNLKLNKNIRMKTNSKSMRNK----FNETRGISILLYKNHNIKIPFPPTTLLY 64

Query: 63  KIQIHR---IASGSQNTQFRQFNKTSIKSS------------------------------ 89
            I++ +   I++     ++   N  +  S                               
Sbjct: 65  NIEVEKQKIISTQHMLNEYTMDNDDNYLSDLFYEDEYNDNNSLFDNGFPNNVNSNPNPVN 124

Query: 90  -KKYLNSFMAFRAYYSQFGSGVKQNVLSSLLAEEWHADKMQHGIWDYFAQQYNFINPGFG 148
            ++ LN F+AFRAY SQFG G+KQN+LSSLL+  WH +  Q  +W++F+Q+YNF+ P  G
Sbjct: 125 SERVLNGFIAFRAYNSQFGYGLKQNILSSLLSTAWHENPNQQNVWNFFSQEYNFVKPKCG 184

Query: 149 FVEWLTNNY 157
           FVEWL   Y
Sbjct: 185 FVEWLGQTY 193

>CAGL0B01243g Chr2 complement(112831..113262) [432 bp, 143 aa] {ON}
           some similarities with uniprot|P01365 Saccharomyces
           cerevisiae YCR040w MATALPHA1 expressed copy at MAT locus
           or uniprot|P01365 Saccharomyces cerevisiae YCL066w
           HMLALPHA1 silenced copy at HML
          Length = 143

 Score = 81.3 bits (199), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 40/89 (44%), Positives = 57/89 (64%)

Query: 65  QIHRIASGSQNTQFRQFNKTSIKSSKKYLNSFMAFRAYYSQFGSGVKQNVLSSLLAEEWH 124
           +I +  S   NT      K+   S K+ +N+FMAFR YY+Q G+G+KQN LS +L+E W+
Sbjct: 47  EIDKFISHHFNTSIGNVLKSKSSSKKRPMNAFMAFRTYYAQLGTGLKQNTLSVILSEAWN 106

Query: 125 ADKMQHGIWDYFAQQYNFINPGFGFVEWL 153
           A +    IWD FAQQ+NF +P  GFV ++
Sbjct: 107 APETDQNIWDIFAQQFNFASPRCGFVNYI 135

>NCAS0B09150 Chr2 (1755595..1756047) [453 bp, 150 aa] {ON} Anc_1.1
          Length = 150

 Score = 81.3 bits (199), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 50/145 (34%), Positives = 76/145 (52%), Gaps = 7/145 (4%)

Query: 4   SKPAFKIKNKASKSYRNTAVSKKLKEKRLAEHVRPSCFNIIRPLKKDIQIPVPSSRFLNK 63
           +KP FK+     +  RN    + LK K +      +CFNI     K+I IP P +  L +
Sbjct: 10  NKPLFKVN--IPRRVRNRNSKQPLKPKPVTYD---TCFNIFLKDPKNITIPQPPNWVLQE 64

Query: 64  IQIHRIASGSQNTQFRQFNKTSIKSSKKYLNSFMAFRAYYSQFGSGVKQNVLSSLLAEEW 123
           ++  RI   S+  Q  +  K    +  K +N F+ FR+YYS++G G+KQ +LS LLA+ W
Sbjct: 65  LETIRIIYPSK--QKPKPRKQVTSNPSKPINGFILFRSYYSRWGYGIKQTMLSQLLAKFW 122

Query: 124 HADKMQHGIWDYFAQQYNFINPGFG 148
            +      +WDYFA QY+ +    G
Sbjct: 123 KSSDTDQALWDYFALQYSTVGCEMG 147

>CAGL0B00242g Chr2 complement(10582..11136) [555 bp, 184 aa] {ON}
           some similarities with uniprot|P01365 Saccharomyces
           cerevisiae YCR040w MATALPHA1 mating type regulatory
           protein or uniprot|P01365 Saccharomyces cerevisiae
           YCL066w HMLALPHA1
          Length = 184

 Score = 82.4 bits (202), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 33/61 (54%), Positives = 46/61 (75%)

Query: 93  LNSFMAFRAYYSQFGSGVKQNVLSSLLAEEWHADKMQHGIWDYFAQQYNFINPGFGFVEW 152
           +N+FMAFR YY+Q G+G+KQN LS +L+E W+A +    IWD FAQQ+NF +P  GFV +
Sbjct: 116 MNAFMAFRTYYAQLGTGLKQNTLSVILSEAWNAPETDQNIWDIFAQQFNFASPRCGFVNY 175

Query: 153 L 153
           +
Sbjct: 176 I 176

>TPHA0E03620 Chr5 (766068..766655) [588 bp, 195 aa] {ON} Anc_1.121
           YCR040W MATalpha1 gene at MAT locus
          Length = 195

 Score = 80.9 bits (198), Expect = 8e-19,   Method: Compositional matrix adjust.
 Identities = 39/68 (57%), Positives = 51/68 (75%)

Query: 90  KKYLNSFMAFRAYYSQFGSGVKQNVLSSLLAEEWHADKMQHGIWDYFAQQYNFINPGFGF 149
           KK LNSF+AFRAY +QFG+G+ Q++LS LL+  WH+   QH +WD FAQQ+NF+ P  GF
Sbjct: 121 KKSLNSFIAFRAYNAQFGNGLNQHLLSHLLSLAWHSAPEQHHVWDVFAQQFNFVKPKCGF 180

Query: 150 VEWLTNNY 157
           VEW+   Y
Sbjct: 181 VEWVGQTY 188

>TPHA0E04080 Chr5 (850045..850632) [588 bp, 195 aa] {ON}   silenced
           copy of alpha1 at HMLalpha locus
          Length = 195

 Score = 80.9 bits (198), Expect = 8e-19,   Method: Compositional matrix adjust.
 Identities = 39/68 (57%), Positives = 51/68 (75%)

Query: 90  KKYLNSFMAFRAYYSQFGSGVKQNVLSSLLAEEWHADKMQHGIWDYFAQQYNFINPGFGF 149
           KK LNSF+AFRAY +QFG+G+ Q++LS LL+  WH+   QH +WD FAQQ+NF+ P  GF
Sbjct: 121 KKSLNSFIAFRAYNAQFGNGLNQHLLSHLLSLAWHSAPEQHHVWDVFAQQFNFVKPKCGF 180

Query: 150 VEWLTNNY 157
           VEW+   Y
Sbjct: 181 VEWVGQTY 188

>Suva_3.140 Chr3 (212396..212488) [93 bp, 31 aa] {ON} YCR040W (REAL)
          Length = 31

 Score = 72.0 bits (175), Expect = 5e-17,   Method: Composition-based stats.
 Identities = 31/31 (100%), Positives = 31/31 (100%)

Query: 138 QQYNFINPGFGFVEWLTNNYAEVRGDGYWED 168
           QQYNFINPGFGFVEWLTNNYAEVRGDGYWED
Sbjct: 1   QQYNFINPGFGFVEWLTNNYAEVRGDGYWED 31

>KLTH0F00374g Chr6 complement(30927..31676) [750 bp, 249 aa] {ON}
           weakly similar to uniprot|P01365 Saccharomyces
           cerevisiae YCR040W MATALPHA1 Transcriptional
           co-activator involved in regulation of
           mating-type-specific gene expression targets the
           transcription factor Mcm1p to the promoters of
           alpha-specific genes one of two genes encoded by the
           alpha mating type cassette
          Length = 249

 Score = 67.8 bits (164), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 48/171 (28%), Positives = 83/171 (48%), Gaps = 18/171 (10%)

Query: 1   MFTSKPAFKIKNKASKSYRNTAVSKKLKEKRLAEHVRPSCFNIIRPLKKDIQIPVPSSRF 60
           M ++KP+FK+  K     +   ++++LK    ++  R +  N+     K   IP P +  
Sbjct: 1   MNSTKPSFKVLIKK----KGKTLNRRLKNS--SKSYRENGANLYMSYSKPQAIPKPPNTL 54

Query: 61  LNKIQIHRIASGSQNTQFRQF-------NKTSIKSS----KKYLNSFMAFRAYYSQFGSG 109
           +N ++  + +  S+      +        K SI S+    KK +N F+ FR+YY++F  G
Sbjct: 55  INLVRSKKTSQSSRKCLKNDYILKELDVKKLSIYSNNTVLKKKINPFIGFRSYYAKFAKG 114

Query: 110 -VKQNVLSSLLAEEWHADKMQHGIWDYFAQQYNFINPGFGFVEWLTNNYAE 159
            V+Q  LS +L+E W  +   H +W++F Q YN       F  WL  NY +
Sbjct: 115 RVRQQELSKILSEYWTKNSKIHSVWEFFTQHYNREVTSMCFTLWLEENYQQ 165

>KNAG0C00150 Chr3 complement(24902..25339) [438 bp, 145 aa] {ON}
           Anc_1.1 YCL066W silent copy of mating type alpha1 gene
           at HML locus
          Length = 145

 Score = 63.5 bits (153), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 27/52 (51%), Positives = 38/52 (73%)

Query: 93  LNSFMAFRAYYSQFGSGVKQNVLSSLLAEEWHADKMQHGIWDYFAQQYNFIN 144
           LNSF+AFRAYYSQF +G+ QN LSS+L++ W +++ Q   WD   +QY  I+
Sbjct: 92  LNSFIAFRAYYSQFANGINQNKLSSILSKFWKSNQSQQTFWDRLTEQYKQID 143

>Ecym_1003 Chr1 (6314..7105) [792 bp, 263 aa] {ON} similar to
           Saccharomyces cerevisiae YCL066W HMLALPHA1
          Length = 263

 Score = 65.5 bits (158), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 35/95 (36%), Positives = 46/95 (48%), Gaps = 1/95 (1%)

Query: 65  QIHRIASGSQNTQFRQFNKTSIKSSKKYLNSFMAFRAYYSQFGSG-VKQNVLSSLLAEEW 123
           +   I   + N       +T I   +K +N FMAFR+YYS+F  G V Q  LS +LA+ W
Sbjct: 85  EFEDIKQSNNNKSIAYSEETDIPKKRKKINEFMAFRSYYSRFFRGIVPQLELSRILAQLW 144

Query: 124 HADKMQHGIWDYFAQQYNFINPGFGFVEWLTNNYA 158
           H        W+ FA+ YN   P   F EWL   Y 
Sbjct: 145 HEKPKMKRTWEMFAEHYNMEQPDQSFPEWLEKTYT 179

>Ecym_1114 Chr1 complement(236238..237029) [792 bp, 263 aa] {ON}
           similar to YCL066W HMLALPHA1
          Length = 263

 Score = 65.5 bits (158), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 35/95 (36%), Positives = 46/95 (48%), Gaps = 1/95 (1%)

Query: 65  QIHRIASGSQNTQFRQFNKTSIKSSKKYLNSFMAFRAYYSQFGSG-VKQNVLSSLLAEEW 123
           +   I   + N       +T I   +K +N FMAFR+YYS+F  G V Q  LS +LA+ W
Sbjct: 85  EFEDIKQSNNNKSIAYSEETDIPKKRKKINEFMAFRSYYSRFFRGIVPQLELSRILAQLW 144

Query: 124 HADKMQHGIWDYFAQQYNFINPGFGFVEWLTNNYA 158
           H        W+ FA+ YN   P   F EWL   Y 
Sbjct: 145 HEKPKMKRTWEMFAEHYNMEQPDQSFPEWLEKTYT 179

>Kwal_33.matalpha1 s33 complement(283160..283894) [735 bp, 244 aa]
           {OFF} (matalpha1) - mating type alpha1 protein [contig
           MAT] FULL
          Length = 244

 Score = 63.2 bits (152), Expect = 8e-12,   Method: Compositional matrix adjust.
 Identities = 51/171 (29%), Positives = 81/171 (47%), Gaps = 17/171 (9%)

Query: 4   SKPAFKIK-NKASKSYRNTAVSKK-LKEKRLAEHVRPSCFNIIRPLKKDIQIPVPSSRFL 61
           +KP+FK+  NK   +     +SKK LK   ++E V     N+     K   IP P    +
Sbjct: 4   TKPSFKVSVNKRHGAKLKPKISKKSLKRNYVSEGV-----NLYMSYSKQELIPKPPKAVM 58

Query: 62  NKIQIHR-------IASGSQNTQFRQ-FNKTSIKSSKKYLNSFMAFRAYYSQFGSG-VKQ 112
             +           ++ G    Q  Q F  +   +SKK +N F+ FR+YY++   G ++Q
Sbjct: 59  KILGSDHGKGLSKGLSKGIHKDQKSQTFLGSGKCTSKKKINPFIGFRSYYARIVKGRIRQ 118

Query: 113 NVLSSLLAEEWHADKMQHGIWDYFAQQYNFINPGFGFVEWLTNNY-AEVRG 162
             LS++L++ W +    H  W++F + YN  N    F EWL  NY  E+ G
Sbjct: 119 QELSTILSQYWLSHHQVHKTWEFFTEHYNRDNTVMCFTEWLEKNYKPEIEG 169

>Kwal_33.12992 s33 complement(31018..31752) [735 bp, 244 aa] {OFF}
           YCR040W (MATALPHA1) - transcription factor involved in
           the regulation of alpha-specific genes [contig 123] FULL
          Length = 244

 Score = 63.2 bits (152), Expect = 8e-12,   Method: Compositional matrix adjust.
 Identities = 51/171 (29%), Positives = 81/171 (47%), Gaps = 17/171 (9%)

Query: 4   SKPAFKIK-NKASKSYRNTAVSKK-LKEKRLAEHVRPSCFNIIRPLKKDIQIPVPSSRFL 61
           +KP+FK+  NK   +     +SKK LK   ++E V     N+     K   IP P    +
Sbjct: 4   TKPSFKVSVNKRHGAKLKPKISKKSLKRNYVSEGV-----NLYMSYSKQELIPKPPKAVM 58

Query: 62  NKIQIHR-------IASGSQNTQFRQ-FNKTSIKSSKKYLNSFMAFRAYYSQFGSG-VKQ 112
             +           ++ G    Q  Q F  +   +SKK +N F+ FR+YY++   G ++Q
Sbjct: 59  KILGSDHGKGLSKGLSKGIHKDQKSQTFLGSGKCTSKKKINPFIGFRSYYARIVKGRIRQ 118

Query: 113 NVLSSLLAEEWHADKMQHGIWDYFAQQYNFINPGFGFVEWLTNNY-AEVRG 162
             LS++L++ W +    H  W++F + YN  N    F EWL  NY  E+ G
Sbjct: 119 QELSTILSQYWLSHHQVHKTWEFFTEHYNRDNTVMCFTEWLEKNYKPEIEG 169

>Kwal_YGOB_matalpha1 s33 complement(283160..283894) [735 bp, 244 aa]
           {ON} (matalpha1) - mating type alpha1 protein [contig
           MAT] FULL
          Length = 244

 Score = 63.2 bits (152), Expect = 8e-12,   Method: Compositional matrix adjust.
 Identities = 51/171 (29%), Positives = 81/171 (47%), Gaps = 17/171 (9%)

Query: 4   SKPAFKIK-NKASKSYRNTAVSKK-LKEKRLAEHVRPSCFNIIRPLKKDIQIPVPSSRFL 61
           +KP+FK+  NK   +     +SKK LK   ++E V     N+     K   IP P    +
Sbjct: 4   TKPSFKVSVNKRHGAKLKPKISKKSLKRNYVSEGV-----NLYMSYSKQELIPKPPKAVM 58

Query: 62  NKIQIHR-------IASGSQNTQFRQ-FNKTSIKSSKKYLNSFMAFRAYYSQFGSG-VKQ 112
             +           ++ G    Q  Q F  +   +SKK +N F+ FR+YY++   G ++Q
Sbjct: 59  KILGSDHGKGLSKGLSKGIHKDQKSQTFLGSGKCTSKKKINPFIGFRSYYARIVKGRIRQ 118

Query: 113 NVLSSLLAEEWHADKMQHGIWDYFAQQYNFINPGFGFVEWLTNNY-AEVRG 162
             LS++L++ W +    H  W++F + YN  N    F EWL  NY  E+ G
Sbjct: 119 QELSTILSQYWLSHHQVHKTWEFFTEHYNRDNTVMCFTEWLEKNYKPEIEG 169

>Kwal_YGOB_HMalpha1 s33 complement(31018..31752) [735 bp, 244 aa]
           {ON} ANNOTATED BY YGOB - This is Kwal_33.12992
          Length = 244

 Score = 63.2 bits (152), Expect = 8e-12,   Method: Compositional matrix adjust.
 Identities = 51/171 (29%), Positives = 81/171 (47%), Gaps = 17/171 (9%)

Query: 4   SKPAFKIK-NKASKSYRNTAVSKK-LKEKRLAEHVRPSCFNIIRPLKKDIQIPVPSSRFL 61
           +KP+FK+  NK   +     +SKK LK   ++E V     N+     K   IP P    +
Sbjct: 4   TKPSFKVSVNKRHGAKLKPKISKKSLKRNYVSEGV-----NLYMSYSKQELIPKPPKAVM 58

Query: 62  NKIQIHR-------IASGSQNTQFRQ-FNKTSIKSSKKYLNSFMAFRAYYSQFGSG-VKQ 112
             +           ++ G    Q  Q F  +   +SKK +N F+ FR+YY++   G ++Q
Sbjct: 59  KILGSDHGKGLSKGLSKGIHKDQKSQTFLGSGKCTSKKKINPFIGFRSYYARIVKGRIRQ 118

Query: 113 NVLSSLLAEEWHADKMQHGIWDYFAQQYNFINPGFGFVEWLTNNY-AEVRG 162
             LS++L++ W +    H  W++F + YN  N    F EWL  NY  E+ G
Sbjct: 119 QELSTILSQYWLSHHQVHKTWEFFTEHYNRDNTVMCFTEWLEKNYKPEIEG 169

>KLLA0C00352g Chr3 complement(24124..24909) [786 bp, 261 aa] {ON}
           uniprot|Q08398 Kluyveromyces lactis HMLAPLHA1 Mating-
           type protein ALPHA1
          Length = 261

 Score = 61.2 bits (147), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 29/73 (39%), Positives = 43/73 (58%), Gaps = 1/73 (1%)

Query: 87  KSSKKYLNSFMAFRAYYSQFGSGV-KQNVLSSLLAEEWHADKMQHGIWDYFAQQYNFINP 145
           K+ KK +N F+AFR+YYS+  +G+  Q  LS+++++ W  DK     W+  AQ+YN    
Sbjct: 100 KTKKKQINDFIAFRSYYSRLLNGILTQTELSTIISKHWTVDKQTRKNWELIAQEYNCDAS 159

Query: 146 GFGFVEWLTNNYA 158
           G  F  WL  NY 
Sbjct: 160 GKHFFNWLEVNYG 172

>NDAI0A00100 Chr1 complement(783..1190) [408 bp, 135 aa] {ON}
           Anc_1.1  silent copy of MATalpha1 gene at HMLalpha
           possible pseudogene; contains 2 copies of a 20 bp direct
           repeat, causing a frameshft; synthetic translation made
           by ignoring one copy.
          Length = 135

 Score = 54.7 bits (130), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 40/105 (38%), Positives = 56/105 (53%), Gaps = 10/105 (9%)

Query: 53  IPVPSSRFLNKIQIHRIASGSQNTQFRQFNKTSI------KSSKKYLNSFMAFRAYYSQF 106
           +P P   FL+ I        +  T+   F K SI      +   K +N FM FR+YYSQ+
Sbjct: 21  VPPPPKWFLDSINFEH----NPTTRLTYFQKESILRPYQSRCYAKSINGFMLFRSYYSQY 76

Query: 107 GSGVKQNVLSSLLAEEWHADKMQHGIWDYFAQQYNFINPGFGFVE 151
           G G+KQ++LS LL++ W+A +    +WD FAQQ N I    G  E
Sbjct: 77  GKGLKQSLLSPLLSKLWNAHETDQLLWDQFAQQCNAIGHEGGICE 121

>KAFR0D00710 Chr4 complement(127819..128337) [519 bp, 172 aa] {ON}
           mating type gene MATalpha1
          Length = 172

 Score = 54.7 bits (130), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 23/47 (48%), Positives = 31/47 (65%)

Query: 93  LNSFMAFRAYYSQFGSGVKQNVLSSLLAEEWHADKMQHGIWDYFAQQ 139
           LN FMAFR+YYSQ+  G+KQ  LS +LA+ WH+D  +   W    Q+
Sbjct: 121 LNPFMAFRSYYSQYAQGLKQIELSEVLAKAWHSDTKEQNYWISLTQK 167

>Smik_88.1 Chr88 complement(3..72,501..535) [105 bp, 35 aa] {ON}
           YCL066W (REAL)
          Length = 35

 Score = 47.8 bits (112), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 20/21 (95%), Positives = 20/21 (95%)

Query: 136 FAQQYNFINPGFGFVEWLTNN 156
           F QQYNFINPGFGFVEWLTNN
Sbjct: 15  FPQQYNFINPGFGFVEWLTNN 35

>Suva_3.79 Chr3 (114117..114221) [105 bp, 35 aa] {ON} YCR040W (REAL)
          Length = 35

 Score = 47.4 bits (111), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 20/20 (100%), Positives = 20/20 (100%)

Query: 137 AQQYNFINPGFGFVEWLTNN 156
           AQQYNFINPGFGFVEWLTNN
Sbjct: 16  AQQYNFINPGFGFVEWLTNN 35

>Skud_80.1 Chr80 complement(3..98) [96 bp, 32 aa] {ON} YCR040W
           (REAL)
          Length = 32

 Score = 47.0 bits (110), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 20/21 (95%), Positives = 20/21 (95%)

Query: 136 FAQQYNFINPGFGFVEWLTNN 156
           F QQYNFINPGFGFVEWLTNN
Sbjct: 12  FPQQYNFINPGFGFVEWLTNN 32

>Ecym_1217 Chr1 complement(441461..443284) [1824 bp, 607 aa] {ON}
           similar to Ashbya gossypii AFR549W
          Length = 607

 Score = 32.0 bits (71), Expect = 0.77,   Method: Compositional matrix adjust.
 Identities = 17/53 (32%), Positives = 27/53 (50%), Gaps = 7/53 (13%)

Query: 95  SFMAFRAYYSQFGSGVK-------QNVLSSLLAEEWHADKMQHGIWDYFAQQY 140
           SF+    YYS FG+ V        +NV +  +  E   D ++ GI D+ A++Y
Sbjct: 535 SFVGVTVYYSMFGTQVPNILRRSHENVDAGKVVTECFEDDIELGITDFSAEEY 587

>KNAG0J00850 Chr10 complement(146187..146675) [489 bp, 162 aa] {ON}
           Anc_3.279 YBR062C
          Length = 162

 Score = 29.6 bits (65), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 18/72 (25%), Positives = 30/72 (41%), Gaps = 10/72 (13%)

Query: 75  NTQFRQFNKTSIKSSKKYLNSFMAFRAYYSQFGSG----------VKQNVLSSLLAEEWH 124
           NT+       + + S++   S   F+  + QFG            + QN+LS LL  +WH
Sbjct: 3   NTEEHNIETANAEDSEERRESRAQFQELFEQFGRNNPQFNPELIELFQNMLSPLLQSQWH 62

Query: 125 ADKMQHGIWDYF 136
            +  + G    F
Sbjct: 63  PEDREKGCSQEF 74

>SAKL0D12914g Chr4 complement(1080337..1083492) [3156 bp, 1051 aa]
           {ON} highly similar to uniprot|Q753A0 Ashbya gossypii
           AFR424C AFR424Cp and similar to YKL205W uniprot|P33418
           Saccharomyces cerevisiae YKL205W LOS1 Nuclear pore
           protein involved in nuclear export of pre-tRNA
          Length = 1051

 Score = 29.6 bits (65), Expect = 4.7,   Method: Compositional matrix adjust.
 Identities = 25/92 (27%), Positives = 40/92 (43%), Gaps = 9/92 (9%)

Query: 35  HVRPSCFNIIRPLKKDIQIPVPSSRFLNKIQIHR-----IASGSQNTQFRQFNKTSIKSS 89
           H   +C+ ++  L      PV    F   IQ+ +      +SGS  T  +  N  ++  +
Sbjct: 798 HTDDNCYQLLNNLLT----PVIKKVFDLIIQMDQESTVETSSGSAATSAKVSNGKNVVVT 853

Query: 90  KKYLNSFMAFRAYYSQFGSGVKQNVLSSLLAE 121
             + +  M  +AYYS   S +  NV S LL E
Sbjct: 854 DSFRDKVMLKKAYYSFLQSFITNNVTSLLLTE 885

>ZYRO0G06820g Chr7 complement(546927..547832) [906 bp, 301 aa] {ON}
           similar to uniprot|P54858 Saccharomyces cerevisiae
           YDR068W DOS2 Protein of unknown function green
           fluorescent protein (GFP)-fusion protein localizes to
           the cytoplasm
          Length = 301

 Score = 28.9 bits (63), Expect = 7.4,   Method: Compositional matrix adjust.
 Identities = 27/107 (25%), Positives = 44/107 (41%), Gaps = 26/107 (24%)

Query: 67  HRIASGSQNTQFRQFNKTSIKSSKKYLNSFMAFRAYYSQFGSGVKQNV------------ 114
           H+     + T+ + FNK   + SK+Y  +  AF+ + ++   GVK N+            
Sbjct: 15  HKTEDHDEKTE-KVFNKLEDEVSKRYDETAKAFKGFVAEAEDGVKLNLPLDPAVSEKTQR 73

Query: 115 -LSSLLAEEWHADKMQHGIWDYFAQQYNFINPGFGFVEW--LTNNYA 158
            L  L +   + +K   G W   +      NPGF    W  +TNN  
Sbjct: 74  YLGQLDSNLQNVEKFAQGYWTKVS------NPGF----WSNVTNNLG 110

>ABR152C Chr2 complement(685052..686920,686970..686993) [1893 bp,
           630 aa] {ON} Syntenic homolog of Saccharomyces
           cerevisiae YJR110W; 1-intron
          Length = 630

 Score = 28.9 bits (63), Expect = 7.8,   Method: Compositional matrix adjust.
 Identities = 15/52 (28%), Positives = 26/52 (50%), Gaps = 4/52 (7%)

Query: 97  MAFRAYYSQFGSGVKQNVLSSLLAEEWHADKMQHGIWDYF-AQQYNFINPGF 147
           + +  Y  Q+G+ +  N    +L E   A K+   +WDYF ++   F NP +
Sbjct: 504 LVYHLYSCQYGTFIFDNEQERVLRE---ASKVTRSVWDYFRSRPREFTNPAY 552

>Skud_16.489 Chr16 (849572..851734) [2163 bp, 720 aa] {ON} YPR185W
           (REAL)
          Length = 720

 Score = 28.5 bits (62), Expect = 9.6,   Method: Compositional matrix adjust.
 Identities = 16/47 (34%), Positives = 24/47 (51%)

Query: 58  SRFLNKIQIHRIASGSQNTQFRQFNKTSIKSSKKYLNSFMAFRAYYS 104
           S F N++ IHR +  S +        TS+ S+ KY +SF   R + S
Sbjct: 375 SSFFNQLPIHRPSISSNSGPQMNIEGTSVGSTSKYSSSFGNIRRHSS 421

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.321    0.133    0.405 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 18,974,176
Number of extensions: 774375
Number of successful extensions: 2278
Number of sequences better than 10.0: 63
Number of HSP's gapped: 2297
Number of HSP's successfully gapped: 63
Length of query: 175
Length of database: 53,481,399
Length adjustment: 102
Effective length of query: 73
Effective length of database: 41,785,467
Effective search space: 3050339091
Effective search space used: 3050339091
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 62 (28.5 bits)