Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
YCL064C (CHA1)1.3ON36036017480.0
Smik_3.121.3ON36036015950.0
Skud_3.11.3ON36036015510.0
Suva_3.1501.3ON36135215100.0
NCAS0B091301.3ON36734212781e-176
KNAG0C001801.3ON35933912081e-166
NDAI0A001201.3ON37734812031e-165
KAFR0D001101.3ON36535411801e-162
TPHA0E040401.3ON35733611591e-159
Kpol_2002.61.3ON35034811271e-154
TBLA0A049201.3ON36033110951e-149
CAGL0B00286g1.3ON36035910841e-147
ZYRO0F15774gsingletonON41036010751e-145
KAFR0F04430singletonON34334310211e-138
KAFR0I00130singletonON34434210101e-136
NCAS0A15330singletonON34733710041e-135
SAKL0C00418g1.3ON3643429541e-127
NDAI0K02950singletonON3343289421e-126
ZYRO0F18524g1.3ON3353318661e-114
KNAG0D05380singletonON3343388361e-110
KLLA0C00440g1.3ON3773298231e-107
SAKL0C13904gsingletonON3393248171e-107
KLTH0F00440g1.3ON3413318141e-106
AFR747W1.3ON4263418141e-105
Smik_9.2na 1ON3383268031e-105
Ecym_10061.3ON3643508011e-104
Scer_YGOB_SDL1 (SDL1)na 1ON3373307901e-103
Skud_9.2na 1ON3393257731e-100
TDEL0D06540singletonON3373247452e-96
KLLA0E01805gsingletonON3223217191e-92
KNAG0A01150singletonON2312235537e-69
YIL167W (SDL1)singletonOFF2101965273e-65
YIL168WsingletonOFF1271202782e-29
SAKL0F11858g7.367ON5622661721e-12
KAFR0K017007.367ON5792501578e-11
Suva_5.1997.367ON5762721542e-10
NCAS0A142307.367ON5692641532e-10
CAGL0I05126g7.367ON5712641524e-10
NDAI0A018107.367ON5702501498e-10
YER086W (ILV1)7.367ON5762811498e-10
Skud_5.2057.367ON5762501499e-10
ZYRO0B02772g7.367ON5692591471e-09
Smik_5.2257.367ON5762811471e-09
TPHA0F031307.367ON5682641462e-09
Ecym_47087.367ON5702861452e-09
Kpol_530.167.367ON5662501452e-09
TDEL0C018007.367ON5692641434e-09
KLLA0E19779g7.367ON5672861435e-09
SAKL0A10626gsingletonON3203141415e-09
ACR232C7.367ON5602601391e-08
KNAG0C036907.367ON5772641382e-08
YKL218C (SRY1)na 2ON3263171352e-08
TBLA0C050707.367ON5752811363e-08
Kwal_33.148227.367ON5622681222e-06
Skud_11.2na 2ON3263141193e-06
KLTH0B04884g7.367ON5732711142e-05
KLLA0A11814g5.157ON30235731.4
NCAS0I011203.357ON15986658.4
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= YCL064C
         (360 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

YCL064C Chr3 complement(15798..16880) [1083 bp, 360 aa] {ON}  CH...   677   0.0  
Smik_3.12 Chr3 complement(17223..18305) [1083 bp, 360 aa] {ON} Y...   619   0.0  
Skud_3.1 Chr3 complement(3828..4910) [1083 bp, 360 aa] {ON} YCL0...   602   0.0  
Suva_3.150 Chr3 complement(225656..226741) [1086 bp, 361 aa] {ON...   586   0.0  
NCAS0B09130 Chr2 (1751219..1752322) [1104 bp, 367 aa] {ON} Anc_1.3    496   e-176
KNAG0C00180 Chr3 complement(27151..28230) [1080 bp, 359 aa] {ON}...   469   e-166
NDAI0A00120 Chr1 complement(4652..5785) [1134 bp, 377 aa] {ON} A...   468   e-165
KAFR0D00110 Chr4 complement(7211..8308) [1098 bp, 365 aa] {ON} A...   459   e-162
TPHA0E04040 Chr5 (846219..847292) [1074 bp, 357 aa] {ON} Anc_1.3...   451   e-159
Kpol_2002.6 s2002 complement(7840..8892) [1053 bp, 350 aa] {ON} ...   438   e-154
TBLA0A04920 Chr1 complement(1214344..1215426) [1083 bp, 360 aa] ...   426   e-149
CAGL0B00286g Chr2 complement(12803..13885) [1083 bp, 360 aa] {ON...   422   e-147
ZYRO0F15774g Chr6 (1300486..1301718) [1233 bp, 410 aa] {ON} simi...   418   e-145
KAFR0F04430 Chr6 (868691..869722) [1032 bp, 343 aa] {ON}              397   e-138
KAFR0I00130 Chr9 complement(26703..27737) [1035 bp, 344 aa] {ON}...   393   e-136
NCAS0A15330 Chr1 (3015596..3016639) [1044 bp, 347 aa] {ON}            391   e-135
SAKL0C00418g Chr3 complement(37529..38623) [1095 bp, 364 aa] {ON...   372   e-127
NDAI0K02950 Chr11 (671102..672106) [1005 bp, 334 aa] {ON}             367   e-126
ZYRO0F18524g Chr6 (1528741..1529748) [1008 bp, 335 aa] {ON} simi...   338   e-114
KNAG0D05380 Chr4 complement(986308..987312) [1005 bp, 334 aa] {O...   326   e-110
KLLA0C00440g Chr3 complement(32008..33141) [1134 bp, 377 aa] {ON...   321   e-107
SAKL0C13904g Chr3 (1223973..1224992) [1020 bp, 339 aa] {ON} simi...   319   e-107
KLTH0F00440g Chr6 complement(34215..35240) [1026 bp, 341 aa] {ON...   318   e-106
AFR747W Chr6 (1808016..1809296) [1281 bp, 426 aa] {ON} Syntenic ...   318   e-105
Smik_9.2 Chr9 (6779..7795) [1017 bp, 338 aa] {ON} YCL064C (REAL)      313   e-105
Ecym_1006 Chr1 complement(9635..10729) [1095 bp, 364 aa] {ON} si...   313   e-104
Scer_YGOB_SDL1 Chr9 (29032..29411,29415..30048) [1014 bp, 337 aa...   308   e-103
Skud_9.2 Chr9 (5919..6938) [1020 bp, 339 aa] {ON} YCL064C (REAL)      302   e-100
TDEL0D06540 Chr4 (1175562..1176575) [1014 bp, 337 aa] {ON}            291   2e-96
KLLA0E01805g Chr5 complement(173125..174093) [969 bp, 322 aa] {O...   281   1e-92
KNAG0A01150 Chr1 (6346..7041) [696 bp, 231 aa] {ON}                   217   7e-69
YIL167W Chr9 (29416..30048) [633 bp, 210 aa] {OFF}  SDL1Open rea...   207   3e-65
YIL168W Chr9 (29032..29415) [384 bp, 127 aa] {OFF} Open reading ...   111   2e-29
SAKL0F11858g Chr6 (920767..922455) [1689 bp, 562 aa] {ON} highly...    71   1e-12
KAFR0K01700 Chr11 (352943..354682) [1740 bp, 579 aa] {ON} Anc_7....    65   8e-11
Suva_5.199 Chr5 (303073..304803) [1731 bp, 576 aa] {ON} YER086W ...    64   2e-10
NCAS0A14230 Chr1 (2801647..2803356) [1710 bp, 569 aa] {ON} Anc_7...    64   2e-10
CAGL0I05126g Chr9 complement(481145..482860) [1716 bp, 571 aa] {...    63   4e-10
NDAI0A01810 Chr1 complement(400890..402602) [1713 bp, 570 aa] {O...    62   8e-10
YER086W Chr5 (328477..330207) [1731 bp, 576 aa] {ON}  ILV1Threon...    62   8e-10
Skud_5.205 Chr5 (322688..324418) [1731 bp, 576 aa] {ON} YER086W ...    62   9e-10
ZYRO0B02772g Chr2 (224426..226135) [1710 bp, 569 aa] {ON} highly...    61   1e-09
Smik_5.225 Chr5 (337064..338794) [1731 bp, 576 aa] {ON} YER086W ...    61   1e-09
TPHA0F03130 Chr6 complement(685292..686998) [1707 bp, 568 aa] {O...    61   2e-09
Ecym_4708 Chr4 (1386138..1387850) [1713 bp, 570 aa] {ON} similar...    60   2e-09
Kpol_530.16 s530 complement(41170..42870) [1701 bp, 566 aa] {ON}...    60   2e-09
TDEL0C01800 Chr3 complement(313699..315408) [1710 bp, 569 aa] {O...    60   4e-09
KLLA0E19779g Chr5 complement(1760800..1762503) [1704 bp, 567 aa]...    60   5e-09
SAKL0A10626g Chr1 complement(932879..933841) [963 bp, 320 aa] {O...    59   5e-09
ACR232C Chr3 complement(767330..769012) [1683 bp, 560 aa] {ON} S...    58   1e-08
KNAG0C03690 Chr3 complement(722238..723971) [1734 bp, 577 aa] {O...    58   2e-08
YKL218C Chr11 complement(17359..18339) [981 bp, 326 aa] {ON}  SR...    57   2e-08
TBLA0C05070 Chr3 (1230732..1232459) [1728 bp, 575 aa] {ON} Anc_7...    57   3e-08
Kwal_33.14822 s33 complement(830029..831717) [1689 bp, 562 aa] {...    52   2e-06
Skud_11.2 Chr11 complement(1812..2792) [981 bp, 326 aa] {ON} YKL...    50   3e-06
KLTH0B04884g Chr2 (400193..401914) [1722 bp, 573 aa] {ON} highly...    49   2e-05
KLLA0A11814g Chr1 (1021526..1022434) [909 bp, 302 aa] {ON} highl...    33   1.4  
NCAS0I01120 Chr9 complement(205511..205990) [480 bp, 159 aa] {ON...    30   8.4  

>YCL064C Chr3 complement(15798..16880) [1083 bp, 360 aa] {ON}
           CHA1Catabolic L-serine (L-threonine) deaminase,
           catalyzes the degradation of both L-serine and
           L-threonine; required to use serine or threonine as the
           sole nitrogen source, transcriptionally induced by
           serine and threonine
          Length = 360

 Score =  677 bits (1748), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 332/360 (92%), Positives = 332/360 (92%)

Query: 1   MSIVYNKTPLLRQFFPGKASAQFFLKYECLQPSGSFKSRGIGNLIMKSAIRIQKDGKRSP 60
           MSIVYNKTPLLRQFFPGKASAQFFLKYECLQPSGSFKSRGIGNLIMKSAIRIQKDGKRSP
Sbjct: 1   MSIVYNKTPLLRQFFPGKASAQFFLKYECLQPSGSFKSRGIGNLIMKSAIRIQKDGKRSP 60

Query: 61  QVXXXXXXXXXXXXXXXCQRLSLPCTVVVPTATKKRMVDKIRNTGAQVIVSGAYWKEADT 120
           QV               CQRLSLPCTVVVPTATKKRMVDKIRNTGAQVIVSGAYWKEADT
Sbjct: 61  QVFASSGGNAGFAAATACQRLSLPCTVVVPTATKKRMVDKIRNTGAQVIVSGAYWKEADT 120

Query: 121 FLKTNVMNKIDSQVIEPIYVHPFDNPDIWEGHSSMIDEIVQDLKSQHISVNKVKGIVCSV 180
           FLKTNVMNKIDSQVIEPIYVHPFDNPDIWEGHSSMIDEIVQDLKSQHISVNKVKGIVCSV
Sbjct: 121 FLKTNVMNKIDSQVIEPIYVHPFDNPDIWEGHSSMIDEIVQDLKSQHISVNKVKGIVCSV 180

Query: 181 XXXXXXXXXXXXXERYGLADRIPIVGVETNGCHVFNTSLKIGQPVQFKKITSIATSLGTA 240
                        ERYGLADRIPIVGVETNGCHVFNTSLKIGQPVQFKKITSIATSLGTA
Sbjct: 181 GGGGLYNGIIQGLERYGLADRIPIVGVETNGCHVFNTSLKIGQPVQFKKITSIATSLGTA 240

Query: 241 VISNQTFEYARKYNTRSVVIEDKDVIETCLKYTHQFNMVIEPACGAALHLGYNTKILENA 300
           VISNQTFEYARKYNTRSVVIEDKDVIETCLKYTHQFNMVIEPACGAALHLGYNTKILENA
Sbjct: 241 VISNQTFEYARKYNTRSVVIEDKDVIETCLKYTHQFNMVIEPACGAALHLGYNTKILENA 300

Query: 301 LGSKLAADDIVIIIACGGSSNTIKDLEEALDSMRKKDTPVIEVADNFIFPEKNIVNLKSA 360
           LGSKLAADDIVIIIACGGSSNTIKDLEEALDSMRKKDTPVIEVADNFIFPEKNIVNLKSA
Sbjct: 301 LGSKLAADDIVIIIACGGSSNTIKDLEEALDSMRKKDTPVIEVADNFIFPEKNIVNLKSA 360

>Smik_3.12 Chr3 complement(17223..18305) [1083 bp, 360 aa] {ON}
           YCL064C (REAL)
          Length = 360

 Score =  619 bits (1595), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 296/360 (82%), Positives = 315/360 (87%)

Query: 1   MSIVYNKTPLLRQFFPGKASAQFFLKYECLQPSGSFKSRGIGNLIMKSAIRIQKDGKRSP 60
           MSIVYNKTPLLRQFFPGK+ AQFFLKYECLQPSGSFKSRGIGNLIMKSAIRIQKDGK+SP
Sbjct: 1   MSIVYNKTPLLRQFFPGKSPAQFFLKYECLQPSGSFKSRGIGNLIMKSAIRIQKDGKKSP 60

Query: 61  QVXXXXXXXXXXXXXXXCQRLSLPCTVVVPTATKKRMVDKIRNTGAQVIVSGAYWKEADT 120
           Q+               CQRLSLPCTVVVPTATKKRMV+KIRNTGAQVIVSGAYWKEADT
Sbjct: 61  QIFASSGGNAGFAAATACQRLSLPCTVVVPTATKKRMVEKIRNTGAQVIVSGAYWKEADT 120

Query: 121 FLKTNVMNKIDSQVIEPIYVHPFDNPDIWEGHSSMIDEIVQDLKSQHISVNKVKGIVCSV 180
           FLK +VM KID+QV+EPIYVHPFDNPDIWEGHSSM+DE+VQDL+ Q IS+NKVKGIVCSV
Sbjct: 121 FLKADVMQKIDTQVVEPIYVHPFDNPDIWEGHSSMVDEMVQDLEFQRISMNKVKGIVCSV 180

Query: 181 XXXXXXXXXXXXXERYGLADRIPIVGVETNGCHVFNTSLKIGQPVQFKKITSIATSLGTA 240
                        ERYGLAD+IPIVGVETNGCHVFNTSL+IGQPVQFKKITSIATSLGTA
Sbjct: 181 GGGGLYNGIVQGLERYGLADKIPIVGVETNGCHVFNTSLRIGQPVQFKKITSIATSLGTA 240

Query: 241 VISNQTFEYARKYNTRSVVIEDKDVIETCLKYTHQFNMVIEPACGAALHLGYNTKILENA 300
           VISNQTF+YARKYNTRSVVIEDKDVI+TCLKYTHQFNMV+EPACGAALHLGYNT+ILE A
Sbjct: 241 VISNQTFDYARKYNTRSVVIEDKDVIDTCLKYTHQFNMVVEPACGAALHLGYNTEILERA 300

Query: 301 LGSKLAADDIVIIIACGGSSNTIKDLEEALDSMRKKDTPVIEVADNFIFPEKNIVNLKSA 360
           LGSKLAADDIVIIIACGGSSNTI+DLEEALD   K+  P IEV DNFIFPEK    LKSA
Sbjct: 301 LGSKLAADDIVIIIACGGSSNTIQDLEEALDHFNKRSAPAIEVTDNFIFPEKTTATLKSA 360

>Skud_3.1 Chr3 complement(3828..4910) [1083 bp, 360 aa] {ON} YCL064C
           (REAL)
          Length = 360

 Score =  602 bits (1551), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 290/360 (80%), Positives = 312/360 (86%)

Query: 1   MSIVYNKTPLLRQFFPGKASAQFFLKYECLQPSGSFKSRGIGNLIMKSAIRIQKDGKRSP 60
           MSIVYNKTPLLRQFFP K+ AQFFLKYECLQPSGSFKSRGIGNLI+K+AIRIQKDG+RSP
Sbjct: 1   MSIVYNKTPLLRQFFPSKSPAQFFLKYECLQPSGSFKSRGIGNLILKNAIRIQKDGRRSP 60

Query: 61  QVXXXXXXXXXXXXXXXCQRLSLPCTVVVPTATKKRMVDKIRNTGAQVIVSGAYWKEADT 120
           QV               CQRLSLPCTVVVPTATKKRMV+KIRNTGAQVIV+GAYWKEADT
Sbjct: 61  QVFASSGGNAGLAAATTCQRLSLPCTVVVPTATKKRMVEKIRNTGAQVIVNGAYWKEADT 120

Query: 121 FLKTNVMNKIDSQVIEPIYVHPFDNPDIWEGHSSMIDEIVQDLKSQHISVNKVKGIVCSV 180
           FLK N+MN+IDSQV+EPIYVHPFDNPDIWEGHSSM+DEIVQDLKSQ IS+NKVKGIVCSV
Sbjct: 121 FLKANIMNQIDSQVVEPIYVHPFDNPDIWEGHSSMVDEIVQDLKSQRISMNKVKGIVCSV 180

Query: 181 XXXXXXXXXXXXXERYGLADRIPIVGVETNGCHVFNTSLKIGQPVQFKKITSIATSLGTA 240
                        ERY LAD+IPIVGVETNGCHVFNTSL+IGQPVQFKKITSIATSLGTA
Sbjct: 181 GGGGLYNGIIQGLERYHLADKIPIVGVETNGCHVFNTSLRIGQPVQFKKITSIATSLGTA 240

Query: 241 VISNQTFEYARKYNTRSVVIEDKDVIETCLKYTHQFNMVIEPACGAALHLGYNTKILENA 300
           VISNQTFEYA KYNT+SVVIEDKDVIETCLKYTHQ NMV EPACGAALHLGY+T+ILE A
Sbjct: 241 VISNQTFEYAHKYNTKSVVIEDKDVIETCLKYTHQCNMVAEPACGAALHLGYHTEILEKA 300

Query: 301 LGSKLAADDIVIIIACGGSSNTIKDLEEALDSMRKKDTPVIEVADNFIFPEKNIVNLKSA 360
           LGSKLAADDIVIIIACGGSSNT++DLEE L+ ++K+  P IE ADNFIF EK    LKSA
Sbjct: 301 LGSKLAADDIVIIIACGGSSNTVQDLEETLEDLKKQGLPAIETADNFIFVEKTSTILKSA 360

>Suva_3.150 Chr3 complement(225656..226741) [1086 bp, 361 aa] {ON}
           YCL064C (REAL)
          Length = 361

 Score =  586 bits (1510), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 278/352 (78%), Positives = 306/352 (86%)

Query: 1   MSIVYNKTPLLRQFFPGKASAQFFLKYECLQPSGSFKSRGIGNLIMKSAIRIQKDGKRSP 60
           MSIVYNKTPLLRQFFPGK+ AQF+LKYECLQPSGSFKSRGIGNLI+K+AIRIQK+GKRSP
Sbjct: 1   MSIVYNKTPLLRQFFPGKSLAQFYLKYECLQPSGSFKSRGIGNLILKNAIRIQKNGKRSP 60

Query: 61  QVXXXXXXXXXXXXXXXCQRLSLPCTVVVPTATKKRMVDKIRNTGAQVIVSGAYWKEADT 120
           QV               CQRLSLPCTVVVPTATK+RMV+KIRNTGAQVIV+GA+WKEADT
Sbjct: 61  QVFASSGGNAGFAAATACQRLSLPCTVVVPTATKERMVEKIRNTGAQVIVNGAFWKEADT 120

Query: 121 FLKTNVMNKIDSQVIEPIYVHPFDNPDIWEGHSSMIDEIVQDLKSQHISVNKVKGIVCSV 180
           +LKTNVMN ID Q +EPIYVHPFDNPDIWEGHSSM+DEIVQDLKSQ + + KVKGIVCSV
Sbjct: 121 YLKTNVMNLIDHQAVEPIYVHPFDNPDIWEGHSSMVDEIVQDLKSQRVPMEKVKGIVCSV 180

Query: 181 XXXXXXXXXXXXXERYGLADRIPIVGVETNGCHVFNTSLKIGQPVQFKKITSIATSLGTA 240
                        ER+GLAD+IPIVGVET GCHVFNTSL+IGQPVQFKKITSIATSLGTA
Sbjct: 181 GGGGLYNGIIQGLERHGLADKIPIVGVETKGCHVFNTSLRIGQPVQFKKITSIATSLGTA 240

Query: 241 VISNQTFEYARKYNTRSVVIEDKDVIETCLKYTHQFNMVIEPACGAALHLGYNTKILENA 300
            ISNQTFEYARKYNT+SVV+EDKDVIETCLKY+HQFNMV EPACGAALHLGY+T ILE A
Sbjct: 241 NISNQTFEYARKYNTKSVVVEDKDVIETCLKYSHQFNMVTEPACGAALHLGYHTDILETA 300

Query: 301 LGSKLAADDIVIIIACGGSSNTIKDLEEALDSMRKKDTPVIEVADNFIFPEK 352
           L +KLAADDIV+IIACGGSSNT++DLEE L SM+K+  P IE+ADNFIFPEK
Sbjct: 301 LDTKLAADDIVLIIACGGSSNTVQDLEETLASMKKEGVPAIELADNFIFPEK 352

>NCAS0B09130 Chr2 (1751219..1752322) [1104 bp, 367 aa] {ON} Anc_1.3
          Length = 367

 Score =  496 bits (1278), Expect = e-176,   Method: Compositional matrix adjust.
 Identities = 236/342 (69%), Positives = 276/342 (80%), Gaps = 6/342 (1%)

Query: 1   MSIVYNKTPLLRQFFPGKAS------AQFFLKYECLQPSGSFKSRGIGNLIMKSAIRIQK 54
           MSIVYNKTPLLRQFFP  ++       QFFLKYECLQPSGSFKSRGIGNLIMK+AIRI+K
Sbjct: 1   MSIVYNKTPLLRQFFPAVSTKPSTSIPQFFLKYECLQPSGSFKSRGIGNLIMKNAIRIKK 60

Query: 55  DGKRSPQVXXXXXXXXXXXXXXXCQRLSLPCTVVVPTATKKRMVDKIRNTGAQVIVSGAY 114
            G +SPQV                QRLSLPCTVVVPTATK+RMV+KIR TGA VI++GA+
Sbjct: 61  SGNKSPQVFSSSGGNAGFAAATASQRLSLPCTVVVPTATKQRMVEKIRATGANVIINGAH 120

Query: 115 WKEADTFLKTNVMNKIDSQVIEPIYVHPFDNPDIWEGHSSMIDEIVQDLKSQHISVNKVK 174
           WKEADT+LK++VMN ID    EPIYVHPFDNPDIWEGHS+M+DEIV  L  Q+I++NK+K
Sbjct: 121 WKEADTYLKSSVMNSIDLNTTEPIYVHPFDNPDIWEGHSTMVDEIVDTLNEQNIALNKIK 180

Query: 175 GIVCSVXXXXXXXXXXXXXERYGLADRIPIVGVETNGCHVFNTSLKIGQPVQFKKITSIA 234
           GIVCSV             E++ LAD+IPIVGVET GCHVFNTSLK+G+ ++F KITSIA
Sbjct: 181 GIVCSVGGGGLYNGIIQGLEKHKLADKIPIVGVETKGCHVFNTSLKLGKQIEFSKITSIA 240

Query: 235 TSLGTAVISNQTFEYARKYNTRSVVIEDKDVIETCLKYTHQFNMVIEPACGAALHLGYNT 294
           TSLGTA IS+QTFEYA+KY+TRSVV+ED DVIETCLKYT  FNMV EPACGA+LHL YNT
Sbjct: 241 TSLGTASISSQTFEYAKKYHTRSVVVEDTDVIETCLKYTQDFNMVAEPACGASLHLAYNT 300

Query: 295 KILENALGSKLAADDIVIIIACGGSSNTIKDLEEALDSMRKK 336
            ILENALG KL++DDI+++IACGGSSNT++DLEE L  +R+K
Sbjct: 301 NILENALGHKLSSDDIILVIACGGSSNTVQDLEETLVRLREK 342

>KNAG0C00180 Chr3 complement(27151..28230) [1080 bp, 359 aa] {ON}
           Anc_1.3 YCL064C
          Length = 359

 Score =  469 bits (1208), Expect = e-166,   Method: Compositional matrix adjust.
 Identities = 222/339 (65%), Positives = 261/339 (76%)

Query: 1   MSIVYNKTPLLRQFFPGKASAQFFLKYECLQPSGSFKSRGIGNLIMKSAIRIQKDGKRSP 60
           MS+VYNKTPLLRQFFPGK   Q FLKYECLQPSGSFKSRGIGNLI+K+A+RIQK G+R  
Sbjct: 1   MSLVYNKTPLLRQFFPGKNLPQLFLKYECLQPSGSFKSRGIGNLILKNAMRIQKIGERRA 60

Query: 61  QVXXXXXXXXXXXXXXXCQRLSLPCTVVVPTATKKRMVDKIRNTGAQVIVSGAYWKEADT 120
            V               CQRLSLPCTVVVPTATK RMV+KIRNTGA+VIV+GA+WKEAD 
Sbjct: 61  HVFASSGGNAGFAAATACQRLSLPCTVVVPTATKTRMVEKIRNTGAKVIVNGAHWKEADQ 120

Query: 121 FLKTNVMNKIDSQVIEPIYVHPFDNPDIWEGHSSMIDEIVQDLKSQHISVNKVKGIVCSV 180
            LK  VM++ID +  EPIYVHPFDNPDIWEGH++++DEI++ L SQ I    VKGIVCSV
Sbjct: 121 HLKKTVMSQIDLKTTEPIYVHPFDNPDIWEGHATLVDEIMETLNSQKIQTENVKGIVCSV 180

Query: 181 XXXXXXXXXXXXXERYGLADRIPIVGVETNGCHVFNTSLKIGQPVQFKKITSIATSLGTA 240
                        E++GLA++IPIVGVET GCHV NTSL + + ++F+KITSIATSLGTA
Sbjct: 181 GGGGLYNGIMQGLEKHGLAEKIPIVGVETRGCHVLNTSLNLNKQIEFEKITSIATSLGTA 240

Query: 241 VISNQTFEYARKYNTRSVVIEDKDVIETCLKYTHQFNMVIEPACGAALHLGYNTKILENA 300
            IS QTFE A+KYNTRSVV++D  VIETCLKYT  FNMV EPACGAALHL YN  ILE A
Sbjct: 241 SISKQTFELAKKYNTRSVVVDDSKVIETCLKYTRDFNMVAEPACGAALHLAYNVDILEKA 300

Query: 301 LGSKLAADDIVIIIACGGSSNTIKDLEEALDSMRKKDTP 339
           LG  L  +D++++IACGGSSNT+KDLE+ L ++  K  P
Sbjct: 301 LGHSLTPNDVILVIACGGSSNTLKDLEDTLVTLNSKSIP 339

>NDAI0A00120 Chr1 complement(4652..5785) [1134 bp, 377 aa] {ON}
           Anc_1.3
          Length = 377

 Score =  468 bits (1203), Expect = e-165,   Method: Compositional matrix adjust.
 Identities = 222/348 (63%), Positives = 269/348 (77%), Gaps = 11/348 (3%)

Query: 1   MSIVYNKTPLLRQFFPGK-----------ASAQFFLKYECLQPSGSFKSRGIGNLIMKSA 49
           MS+VYNKTPLLRQFF              A+ QFF+KYECLQPSGSFKSRGIGNLI+KSA
Sbjct: 1   MSVVYNKTPLLRQFFQNSVAKSSATASVTATPQFFVKYECLQPSGSFKSRGIGNLILKSA 60

Query: 50  IRIQKDGKRSPQVXXXXXXXXXXXXXXXCQRLSLPCTVVVPTATKKRMVDKIRNTGAQVI 109
           + I K G+++PQV               CQRLSLPCTVVVPTATK+RMV+KI++TGA VI
Sbjct: 61  MNINKIGQKTPQVFASSGGNAGFAAATACQRLSLPCTVVVPTATKQRMVEKIKSTGANVI 120

Query: 110 VSGAYWKEADTFLKTNVMNKIDSQVIEPIYVHPFDNPDIWEGHSSMIDEIVQDLKSQHIS 169
           ++GA+WKEAD FLK ++MNKID+  IEPIYVHPFDNP IWEGH++M+DEI+  L  Q+I 
Sbjct: 121 INGAHWKEADMFLKNSIMNKIDTNHIEPIYVHPFDNPLIWEGHATMVDEIMDSLNDQNIP 180

Query: 170 VNKVKGIVCSVXXXXXXXXXXXXXERYGLADRIPIVGVETNGCHVFNTSLKIGQPVQFKK 229
           +NKVKGIVCSV             ++Y LAD+IPIVGVET GCHVFNTSLK+ + ++F K
Sbjct: 181 INKVKGIVCSVGGGGLYNGIIQGLQKYNLADKIPIVGVETKGCHVFNTSLKLNKQIEFSK 240

Query: 230 ITSIATSLGTAVISNQTFEYARKYNTRSVVIEDKDVIETCLKYTHQFNMVIEPACGAALH 289
           ITSIATSLGTA IS +TFEYA+KY TRSVVIEDK+VIETCLKYT  +NMV+EPACGA++H
Sbjct: 241 ITSIATSLGTANISKKTFEYAQKYKTRSVVIEDKNVIETCLKYTQDYNMVVEPACGASIH 300

Query: 290 LGYNTKILENALGSKLAADDIVIIIACGGSSNTIKDLEEALDSMRKKD 337
           L Y+T ILE +LG KL +DDI+++IACGGSSNT  DLE  L +M+  +
Sbjct: 301 LAYHTDILEKSLGHKLNSDDIILVIACGGSSNTTHDLESLLLNMKADE 348

>KAFR0D00110 Chr4 complement(7211..8308) [1098 bp, 365 aa] {ON}
           Anc_1.3 YCL064C
          Length = 365

 Score =  459 bits (1180), Expect = e-162,   Method: Compositional matrix adjust.
 Identities = 216/354 (61%), Positives = 267/354 (75%), Gaps = 6/354 (1%)

Query: 1   MSIVYNKTPLLRQFFPGKAS------AQFFLKYECLQPSGSFKSRGIGNLIMKSAIRIQK 54
           MS+VYNKTPLLRQFFPG  S       QFFLKYECLQPSGSFKSRGIGNLI+K A++I K
Sbjct: 1   MSVVYNKTPLLRQFFPGTKSRKSNSLPQFFLKYECLQPSGSFKSRGIGNLILKQAMQIHK 60

Query: 55  DGKRSPQVXXXXXXXXXXXXXXXCQRLSLPCTVVVPTATKKRMVDKIRNTGAQVIVSGAY 114
            G + P+V               CQRLSLPCTVVVPTATK+RM++KI++TGA VI+ GA+
Sbjct: 61  KGTKRPEVFASSGGNAGYAAAVACQRLSLPCTVVVPTATKQRMIEKIKDTGANVIIDGAF 120

Query: 115 WKEADTFLKTNVMNKIDSQVIEPIYVHPFDNPDIWEGHSSMIDEIVQDLKSQHISVNKVK 174
           WKEAD +LK +VMNKI+   I+PIYVHPFDNP IWEGHSS++DEI+  L+ Q +  + +K
Sbjct: 121 WKEADQYLKKSVMNKINKNEIDPIYVHPFDNPLIWEGHSSIVDEIMDTLREQKVQPSNIK 180

Query: 175 GIVCSVXXXXXXXXXXXXXERYGLADRIPIVGVETNGCHVFNTSLKIGQPVQFKKITSIA 234
           GIVCSV             ER+ L D+IP+VGVET GCHVFNTSLK+G+ V+F+KITSIA
Sbjct: 181 GIVCSVGGGGLYNGIIQGLERHKLVDKIPVVGVETEGCHVFNTSLKLGKQVEFEKITSIA 240

Query: 235 TSLGTAVISNQTFEYARKYNTRSVVIEDKDVIETCLKYTHQFNMVIEPACGAALHLGYNT 294
           TSL TA IS +TFE A KY TRSV+++D DVIETCLKYT  +NMV EPACGA++HL YN 
Sbjct: 241 TSLATASISAKTFENALKYGTRSVIVKDADVIETCLKYTKDYNMVTEPACGASIHLAYNI 300

Query: 295 KILENALGSKLAADDIVIIIACGGSSNTIKDLEEALDSMRKKDTPVIEVADNFI 348
            ILENALG+KL  DD V++IACGGSSNT++D+EE L  +R ++   + + + F+
Sbjct: 301 DILENALGTKLTKDDTVVVIACGGSSNTLQDMEETLLRLRSEENAAMTLPNPFL 354

>TPHA0E04040 Chr5 (846219..847292) [1074 bp, 357 aa] {ON} Anc_1.3
           YCL064C
          Length = 357

 Score =  451 bits (1159), Expect = e-159,   Method: Compositional matrix adjust.
 Identities = 213/336 (63%), Positives = 257/336 (76%)

Query: 1   MSIVYNKTPLLRQFFPGKASAQFFLKYECLQPSGSFKSRGIGNLIMKSAIRIQKDGKRSP 60
           MS VYNKTPLLR  FPGK   Q FLKYEC QPSGSFKSRGIGNLI  +++ IQK+ K+SP
Sbjct: 1   MSQVYNKTPLLRHLFPGKNLPQVFLKYECFQPSGSFKSRGIGNLIQSTSLEIQKNSKKSP 60

Query: 61  QVXXXXXXXXXXXXXXXCQRLSLPCTVVVPTATKKRMVDKIRNTGAQVIVSGAYWKEADT 120
           +V                + LSLPCTVVVPTATK RMV+KI+ TGA VIV G +WKEADT
Sbjct: 61  EVFSSSGGNAGLAAATASKMLSLPCTVVVPTATKLRMVEKIKATGANVIVKGNHWKEADT 120

Query: 121 FLKTNVMNKIDSQVIEPIYVHPFDNPDIWEGHSSMIDEIVQDLKSQHISVNKVKGIVCSV 180
           +LKTNV++ ID ++IEPIYVHPFDN  IWEGH++MIDEIV+    QHI + KVK IVCSV
Sbjct: 121 YLKTNVLSNIDKKLIEPIYVHPFDNKKIWEGHATMIDEIVETFGQQHIPIEKVKAIVCSV 180

Query: 181 XXXXXXXXXXXXXERYGLADRIPIVGVETNGCHVFNTSLKIGQPVQFKKITSIATSLGTA 240
                        E++ LA +IP+VGVET GCHVFNTSLK+G+ +QF+KI +IATSLGTA
Sbjct: 181 GGGGLYNGIIQGLEKHDLATKIPVVGVETLGCHVFNTSLKMGKVIQFEKINTIATSLGTA 240

Query: 241 VISNQTFEYARKYNTRSVVIEDKDVIETCLKYTHQFNMVIEPACGAALHLGYNTKILENA 300
            ISNQTFEYA+KYNT+S+V++D  V+ETCLK+T   NMV EPACGAALH+GYN  ILE +
Sbjct: 241 NISNQTFEYAKKYNTKSIVVDDLKVVETCLKFTRDSNMVAEPACGAALHMGYNMDILEKS 300

Query: 301 LGSKLAADDIVIIIACGGSSNTIKDLEEALDSMRKK 336
           LG KLA DDIV+IIACGGSSNT+++LE +L  ++ K
Sbjct: 301 LGKKLATDDIVLIIACGGSSNTVQELEASLTELKNK 336

>Kpol_2002.6 s2002 complement(7840..8892) [1053 bp, 350 aa] {ON}
           complement(7840..8892) [1053 nt, 351 aa]
          Length = 350

 Score =  438 bits (1127), Expect = e-154,   Method: Compositional matrix adjust.
 Identities = 218/348 (62%), Positives = 262/348 (75%)

Query: 1   MSIVYNKTPLLRQFFPGKASAQFFLKYECLQPSGSFKSRGIGNLIMKSAIRIQKDGKRSP 60
           MS+VYNKTPLL+ FFPGK   QF+LKYE LQPSGSFKSRGIGNLI+K+AIRI+K   + P
Sbjct: 1   MSLVYNKTPLLKHFFPGKNLPQFYLKYESLQPSGSFKSRGIGNLILKNAIRIKKINVKKP 60

Query: 61  QVXXXXXXXXXXXXXXXCQRLSLPCTVVVPTATKKRMVDKIRNTGAQVIVSGAYWKEADT 120
            V                QRLSLPCTVVVPTATK+RMV KIR TGA VI+ G +WKEAD 
Sbjct: 61  YVFSSSGGNAGLAAATASQRLSLPCTVVVPTATKERMVQKIRATGANVIIKGNHWKEADN 120

Query: 121 FLKTNVMNKIDSQVIEPIYVHPFDNPDIWEGHSSMIDEIVQDLKSQHISVNKVKGIVCSV 180
           FLK N+MN+I+   IEPIYVHPFDNP IWEGHS+M+DEI++    Q  ++  +K IVCSV
Sbjct: 121 FLKQNIMNEINKDKIEPIYVHPFDNPLIWEGHSTMVDEIMETFSQQKFNIKNLKAIVCSV 180

Query: 181 XXXXXXXXXXXXXERYGLADRIPIVGVETNGCHVFNTSLKIGQPVQFKKITSIATSLGTA 240
                        E+Y LAD+IP+VGVET GCHVFNTSLK+ +PV+F KI++IATSLGTA
Sbjct: 181 GGGGLYNGIIQGLEKYNLADKIPVVGVETQGCHVFNTSLKLNKPVEFTKISTIATSLGTA 240

Query: 241 VISNQTFEYARKYNTRSVVIEDKDVIETCLKYTHQFNMVIEPACGAALHLGYNTKILENA 300
            ISNQ F+YA+KYNT+SVV+EDKDV+ETCLK+TH  NMVIEPACGAA+HLGY+T +LE A
Sbjct: 241 NISNQMFDYAKKYNTKSVVVEDKDVVETCLKFTHDHNMVIEPACGAAIHLGYHTDLLETA 300

Query: 301 LGSKLAADDIVIIIACGGSSNTIKDLEEALDSMRKKDTPVIEVADNFI 348
           LG+KL  DD V+I+ACGGSSNT+K+LE AL  +  K         +FI
Sbjct: 301 LGTKLTCDDAVLIVACGGSSNTVKELETALLELNLKSQKASPTIPSFI 348

>TBLA0A04920 Chr1 complement(1214344..1215426) [1083 bp, 360 aa]
           {ON} Anc_1.3 YCL064C
          Length = 360

 Score =  426 bits (1095), Expect = e-149,   Method: Compositional matrix adjust.
 Identities = 204/331 (61%), Positives = 251/331 (75%), Gaps = 1/331 (0%)

Query: 1   MSIVYNKTPLLRQFFPGKASAQFFLKYECLQPSGSFKSRGIGNLIMKSAIRIQKDG-KRS 59
           MSIVYNKTPLLRQFF G    QFFLKYEC+QPSGSFKSRGIGNLI+KS  +I      + 
Sbjct: 1   MSIVYNKTPLLRQFFRGSPIPQFFLKYECMQPSGSFKSRGIGNLILKSIDKINSSNLNKR 60

Query: 60  PQVXXXXXXXXXXXXXXXCQRLSLPCTVVVPTATKKRMVDKIRNTGAQVIVSGAYWKEAD 119
           PQV                +RLS+PCTVVVPTATK+RMV+KI++TGA+VIV+G +W EAD
Sbjct: 61  PQVFSSSGGNAGLAAATASRRLSIPCTVVVPTATKERMVNKIKDTGAKVIVNGGHWSEAD 120

Query: 120 TFLKTNVMNKIDSQVIEPIYVHPFDNPDIWEGHSSMIDEIVQDLKSQHISVNKVKGIVCS 179
            +L+ +V+NKID   IEPIYVHPFDNP IWEGHS+MIDEI++ L  Q+I +  VK I CS
Sbjct: 121 DYLQNHVINKIDLNEIEPIYVHPFDNPLIWEGHSTMIDEIIESLNEQNIDIRNVKAITCS 180

Query: 180 VXXXXXXXXXXXXXERYGLADRIPIVGVETNGCHVFNTSLKIGQPVQFKKITSIATSLGT 239
           +             E+Y LA +IPI+GVETNGC VFNTSLK+ + V+F KI +IATSLGT
Sbjct: 181 IGGGGLYNGLIRGLEKYNLASKIPIIGVETNGCQVFNTSLKLKKLVKFPKINTIATSLGT 240

Query: 240 AVISNQTFEYARKYNTRSVVIEDKDVIETCLKYTHQFNMVIEPACGAALHLGYNTKILEN 299
           + IS +TFE A KYNT+SVV+++ DVI+TCL+YT+ FN V EPACGAALHL YNT ++EN
Sbjct: 241 STISAKTFENALKYNTKSVVVDNIDVIKTCLRYTYDFNQVAEPACGAALHLAYNTGLIEN 300

Query: 300 ALGSKLAADDIVIIIACGGSSNTIKDLEEAL 330
           AL + L  DDI+I+IACGGSSNT+++LEEAL
Sbjct: 301 ALDTTLTKDDIIIVIACGGSSNTVQELEEAL 331

>CAGL0B00286g Chr2 complement(12803..13885) [1083 bp, 360 aa] {ON}
           highly similar to uniprot|P25379 Saccharomyces
           cerevisiae YCL064c CHA1 L-serine/L-threonine deaminase
          Length = 360

 Score =  422 bits (1084), Expect = e-147,   Method: Compositional matrix adjust.
 Identities = 207/359 (57%), Positives = 267/359 (74%), Gaps = 9/359 (2%)

Query: 4   VYNKTPLLRQFFPGKASAQFFLKYECLQPSGSFKSRGIGNLIMKSAIRIQKDG-KRSPQV 62
           VYNKTPL+RQ FP  +  Q +LK+EC QPSGSFKSRGIG+LI K + RI  +G  + P V
Sbjct: 3   VYNKTPLIRQIFP--SIPQMYLKHECFQPSGSFKSRGIGHLISKQSQRILGNGLGKKPMV 60

Query: 63  XXXXXXXXXXXXXXXCQRLSLPCTVVVPTATKKRMVDKIRNTGAQVIVSGAYWKEADTFL 122
                           + L+LPCTVV+PTATK+RM DKIR TGA VIVSG +WKEAD +L
Sbjct: 61  FASSGGNAGLAAATAAKFLNLPCTVVIPTATKQRMADKIRATGANVIVSGNFWKEADNYL 120

Query: 123 KTNVMNKIDS--QVIEPIYVHPFDNPDIWEGHSSMIDEIVQDLKSQHISVNKVKGIVCSV 180
           K N+++K++   + +EPIYVHPFDNPDIWEGH+SM+DEIV+D K++ I +NK+K IVCSV
Sbjct: 121 KDNILSKLEELHKNVEPIYVHPFDNPDIWEGHASMVDEIVEDFKNKMIPLNKIKAIVCSV 180

Query: 181 XXXXXXXXXXXXXERYGLADRIPIVGVETNGCHVFNTSLKIGQPVQFKKITSIATSLGTA 240
                        E+Y LAD+IPIVGVET GCHVFNTSL++ + V FKKITSIATSLGTA
Sbjct: 181 GGGGLYNGIIQGLEKYNLADKIPIVGVETKGCHVFNTSLRMNKVVSFKKITSIATSLGTA 240

Query: 241 VISNQTFEYARKYNTRSVVIEDKDVIETCLKYTHQFNMVIEPACGAALHLGYNTKILENA 300
            IS + F+YA++Y T+SVV+ D+DV++TCL+YTH FNMVIEPACGAA+HL Y+T+ILE  
Sbjct: 241 DISTEAFKYAKRYGTKSVVLSDQDVVKTCLRYTHDFNMVIEPACGAAVHLAYHTEILEKE 300

Query: 301 LGSKLAADDIVIIIACGGSSNTIKDLEEALD--SMRKKDTPVIEVADNFI--FPEKNIV 355
           LG+KL ADDIV+++ACGGSSNT++D+E  L   S  + +  +  VA+N I   PE +++
Sbjct: 301 LGTKLNADDIVLVVACGGSSNTVEDMESILQRLSTEENNINIPNVAENIIVRMPEVSVL 359

>ZYRO0F15774g Chr6 (1300486..1301718) [1233 bp, 410 aa] {ON} similar
           to uniprot|P25379 Saccharomyces cerevisiae YCL064C CHA1
           catabolism of hydroxy amino acids catabolic serine
           (threonine) dehydratase
          Length = 410

 Score =  418 bits (1075), Expect = e-145,   Method: Compositional matrix adjust.
 Identities = 194/360 (53%), Positives = 263/360 (73%), Gaps = 9/360 (2%)

Query: 1   MSIVYNKTPLLRQFFPGKASAQFFLKYECLQPSGSFKSRGIGNLIMKSAIRIQKDGKRSP 60
           M  +YNKTPLL+Q F    SAQ F+KYECLQPSGSFKSRGIG+LI K A  IQ DG++SP
Sbjct: 47  MPSIYNKTPLLKQIFNHATSAQVFVKYECLQPSGSFKSRGIGHLISKRAKDIQGDGRKSP 106

Query: 61  QVXXXXXXXXXXXXXXXCQRLSLPCTVVVPTATKKRMVDKIRNTGAQVIVSGAYWKEADT 120
            V                Q+L+LPCTVV+PT TK+RM DKIR  GA V+V G++WKEAD+
Sbjct: 107 HVFSSSGGNAGYAAAVAAQKLNLPCTVVIPTTTKQRMADKIRGCGANVVVQGSHWKEADS 166

Query: 121 FLKTNVMNKIDSQVIEPIYVHPFDNPDIWEGHSSMIDEIVQDLKSQHISVNKVKGIVCSV 180
            LK  + N+++  ++EPIYVHPFDNP IWEGH+S++DEI+  LK+++ ++N+VKGIVCSV
Sbjct: 167 HLKNILQNQVNMAILEPIYVHPFDNPTIWEGHASIVDEIISSLKNENTALNRVKGIVCSV 226

Query: 181 XXXXXXXXXXXXXERYGLADRIPIVGVETNGCHVFNTSLKIGQPVQFKKITSIATSLGTA 240
                        E+Y LA++IP++ VET GCHV NTSL++GQ V+F K+ S+ATSL T+
Sbjct: 227 GGGGLYNGIIQGLEKYNLANKIPLLAVETKGCHVLNTSLQVGQCVEFNKMNSVATSLCTS 286

Query: 241 VISNQTFEYARKYNTRSVVIEDKDVIETCLKYTHQFNMVIEPACGAALHLGYNTKILENA 300
            IS++T +Y +KY ++S+V+EDK+V++TCLKY   FNM+ EPACGA+LHLGY+ +++E A
Sbjct: 287 QISSRTLDYVQKYGSKSIVLEDKEVLQTCLKYAENFNMITEPACGASLHLGYHPQLIERA 346

Query: 301 LGSKLAADDIVIIIACGGSSNTIKDLEEALD--------SMRKKDTPVIEVADNFIFPEK 352
           LG  L  DD++I+IACGGSSNTI DLEE+L         S+R+  TP +E  +N I+P++
Sbjct: 347 LGKNLDKDDVIIVIACGGSSNTILDLEESLAKLEEAPHLSIRRNATPSLE-HENIIYPKR 405

>KAFR0F04430 Chr6 (868691..869722) [1032 bp, 343 aa] {ON} 
          Length = 343

 Score =  397 bits (1021), Expect = e-138,   Method: Compositional matrix adjust.
 Identities = 182/343 (53%), Positives = 255/343 (74%), Gaps = 6/343 (1%)

Query: 1   MSIVYNKTPLLRQFF------PGKASAQFFLKYECLQPSGSFKSRGIGNLIMKSAIRIQK 54
           M  VYNKTPLLR +F         +S Q F KYE  QP  SFKSRGIGNLI+K+A ++++
Sbjct: 1   MPTVYNKTPLLRPYFLEANRGTSDSSPQVFFKYESFQPGCSFKSRGIGNLILKNAKKVEE 60

Query: 55  DGKRSPQVXXXXXXXXXXXXXXXCQRLSLPCTVVVPTATKKRMVDKIRNTGAQVIVSGAY 114
           +G ++ +V               C+ LS+PCTVVVP++TK RMV+KIR+TGAQVIVSG +
Sbjct: 61  EGIKTLEVFSSSGGNAGYAAAVACRELSIPCTVVVPSSTKVRMVEKIRSTGAQVIVSGNF 120

Query: 115 WKEADTFLKTNVMNKIDSQVIEPIYVHPFDNPDIWEGHSSMIDEIVQDLKSQHISVNKVK 174
           WKEAD +L+ +V+NK+DS  +EP+YVHPFD+P IWEGHS++IDEIV+ L  +++  +KVK
Sbjct: 121 WKEADEYLRNSVINKVDSSKVEPLYVHPFDDPLIWEGHSTIIDEIVESLNDENVHTSKVK 180

Query: 175 GIVCSVXXXXXXXXXXXXXERYGLADRIPIVGVETNGCHVFNTSLKIGQPVQFKKITSIA 234
           G+VCS+             ER+ LAD+IP++ VET GCHVFNT L++G+ V+F+KI+SIA
Sbjct: 181 GVVCSIGGGGLYNGIIEGLERHALADKIPVIAVETEGCHVFNTCLELGKHVEFEKISSIA 240

Query: 235 TSLGTAVISNQTFEYARKYNTRSVVIEDKDVIETCLKYTHQFNMVIEPACGAALHLGYNT 294
           TSLG+  IS +TFEYA+KY+++ VV++D DV+ETCL+Y+   NM+IEPAC A++HL YN 
Sbjct: 241 TSLGSPSISTKTFEYAQKYHSKGVVLQDIDVLETCLRYSEDSNMIIEPACAASVHLAYNV 300

Query: 295 KILENALGSKLAADDIVIIIACGGSSNTIKDLEEALDSMRKKD 337
            ILE AL  KL+ DD++IIIACGGS+ T++D++++L  ++ K+
Sbjct: 301 DILEEALNKKLSKDDVIIIIACGGSATTLQDIKDSLAKLKIKN 343

>KAFR0I00130 Chr9 complement(26703..27737) [1035 bp, 344 aa] {ON}
           Anc_1.3 YCL064C
          Length = 344

 Score =  393 bits (1010), Expect = e-136,   Method: Compositional matrix adjust.
 Identities = 183/342 (53%), Positives = 250/342 (73%), Gaps = 6/342 (1%)

Query: 1   MSIVYNKTPLLRQFFPG------KASAQFFLKYECLQPSGSFKSRGIGNLIMKSAIRIQK 54
           M IVYNKTPL+ Q FPG       +  Q  +KYE LQPSGSFKSRGIGNL+ + A++IQK
Sbjct: 1   MPIVYNKTPLVPQSFPGTEIRSSDSLPQVLIKYEYLQPSGSFKSRGIGNLVYQKALQIQK 60

Query: 55  DGKRSPQVXXXXXXXXXXXXXXXCQRLSLPCTVVVPTATKKRMVDKIRNTGAQVIVSGAY 114
           +  ++P+V                Q+LSLPCTVVVP ATK+RM++KIR+TGA+V + G +
Sbjct: 61  NSTKNPEVFSSSGGNAGYAAAVVAQKLSLPCTVVVPAATKQRMIEKIRSTGAKVTIHGTF 120

Query: 115 WKEADTFLKTNVMNKIDSQVIEPIYVHPFDNPDIWEGHSSMIDEIVQDLKSQHISVNKVK 174
           WK AD ++K +V+N+I+++ +EPIYVHP D+P IWEG+S ++DE+++ L+ Q I  +KVK
Sbjct: 121 WKGADKYMKNSVLNEINTEKVEPIYVHPSDDPLIWEGNSMIVDELMESLQEQKIDPSKVK 180

Query: 175 GIVCSVXXXXXXXXXXXXXERYGLADRIPIVGVETNGCHVFNTSLKIGQPVQFKKITSIA 234
            IVCSV             ERY LAD+IPIVGVET+G HVFNT LK G+ ++F+KI+++A
Sbjct: 181 AIVCSVGGGGLYNGLMQGLERYKLADKIPIVGVETDGSHVFNTCLKSGKHIEFEKISTVA 240

Query: 235 TSLGTAVISNQTFEYARKYNTRSVVIEDKDVIETCLKYTHQFNMVIEPACGAALHLGYNT 294
           TSLG+A I+ +TFEYA KY  R V+++D +V+ETCL+YT  +NM+ EPACGAA+HL Y+ 
Sbjct: 241 TSLGSASITKKTFEYAMKYRPRGVIVKDIEVLETCLRYTQDYNMITEPACGAAIHLAYHV 300

Query: 295 KILENALGSKLAADDIVIIIACGGSSNTIKDLEEALDSMRKK 336
            ILE AL ++L  DD+VIIIACGGSSN++ D+EE L  M+ +
Sbjct: 301 DILEKALDTRLDGDDVVIIIACGGSSNSLHDMEETLKKMKSE 342

>NCAS0A15330 Chr1 (3015596..3016639) [1044 bp, 347 aa] {ON} 
          Length = 347

 Score =  391 bits (1004), Expect = e-135,   Method: Compositional matrix adjust.
 Identities = 181/337 (53%), Positives = 247/337 (73%), Gaps = 5/337 (1%)

Query: 1   MSIVYNKTPLLRQFFPG----KASAQFFLKYECLQPSGSFKSRGIGNLIMKSAIRIQKDG 56
           MS+VYNKTPLLR+ FP      ++ Q ++KYE LQPSGSFKSRGIG+LIMK+A+R+Q+ G
Sbjct: 1   MSLVYNKTPLLRRVFPTGLKVPSAPQLYVKYESLQPSGSFKSRGIGHLIMKNALRVQQLG 60

Query: 57  KRSPQVXXXXXXXXXXXXXXXCQRLSLPCTVVVPTATKKRMVDKIRNTGAQVIVSGAYWK 116
            +S  V                Q L LPCTVVVPT+TK RMV+KIRN G +VIV G++WK
Sbjct: 61  GKSLHVFSSSGGNAGLAAATASQSLKLPCTVVVPTSTKSRMVEKIRNVGTEVIVKGSHWK 120

Query: 117 EADTFLKTNVMNKIDSQVIEPIYVHPFDNPDIWEGHSSMIDEIVQDLKSQHISVNKVKGI 176
           EAD+FLK +V+  +D ++ EPIYVHPFD+PD+WEGHS+M+DEIV   +SQ++S+NKVK I
Sbjct: 121 EADSFLKNSVIPSVD-RIEEPIYVHPFDHPDVWEGHSTMVDEIVDTFRSQNVSLNKVKAI 179

Query: 177 VCSVXXXXXXXXXXXXXERYGLADRIPIVGVETNGCHVFNTSLKIGQPVQFKKITSIATS 236
           VCSV             E+Y LAD+IP++ +ET+GC+ FN  LK  + V+  KITS+ATS
Sbjct: 180 VCSVGGGGLYNGIIHGLEKYHLADKIPVIAMETDGCNSFNACLKAKKQVELPKITSVATS 239

Query: 237 LGTAVISNQTFEYARKYNTRSVVIEDKDVIETCLKYTHQFNMVIEPACGAALHLGYNTKI 296
           LG   ++ + FE  ++Y + SVV++D DV+ TCLKY + FN++ EPACGA+LH+ YNTK+
Sbjct: 240 LGATGVATKAFENGQRYQSPSVVLQDIDVVNTCLKYANDFNIITEPACGASLHMAYNTKL 299

Query: 297 LENALGSKLAADDIVIIIACGGSSNTIKDLEEALDSM 333
           +E ALG KL +DDI++IIACGGS+NT++DL+ +   +
Sbjct: 300 IEKALGKKLDSDDIIVIIACGGSANTMEDLQNSYKQL 336

>SAKL0C00418g Chr3 complement(37529..38623) [1095 bp, 364 aa] {ON}
           similar to uniprot|P25379 Saccharomyces cerevisiae
           YCL064C CHA1 catabolism of hydroxy amino acids catabolic
           serine (threonine) dehydratase
          Length = 364

 Score =  372 bits (954), Expect = e-127,   Method: Compositional matrix adjust.
 Identities = 179/342 (52%), Positives = 230/342 (67%), Gaps = 3/342 (0%)

Query: 1   MSIVYNKTPLLRQFFPGK---ASAQFFLKYECLQPSGSFKSRGIGNLIMKSAIRIQKDGK 57
           M+  Y+KTPLLR+ FP     A+ QF +KYE  QPSGSFKSRGIG+LI +SA RI+ +G 
Sbjct: 1   MTSFYSKTPLLRRIFPSSVLSATPQFLVKYEVFQPSGSFKSRGIGHLITQSAARIESEGN 60

Query: 58  RSPQVXXXXXXXXXXXXXXXCQRLSLPCTVVVPTATKKRMVDKIRNTGAQVIVSGAYWKE 117
           ++  V               C+  SLPCTVVVPT T  RMV KIR TGA VIV G +W +
Sbjct: 61  KTAHVFASSGGNAGLAAATACRAFSLPCTVVVPTTTNLRMVAKIRQTGADVIVHGNHWGD 120

Query: 118 ADTFLKTNVMNKIDSQVIEPIYVHPFDNPDIWEGHSSMIDEIVQDLKSQHISVNKVKGIV 177
           AD +L  +VM  ID+   EP+Y HPFDNP IWEGHS+++DEIV+ L+ Q I  ++VKGIV
Sbjct: 121 ADQYLHRSVMPCIDTTKFEPVYAHPFDNPVIWEGHSTIVDEIVESLERQRIPASQVKGIV 180

Query: 178 CSVXXXXXXXXXXXXXERYGLADRIPIVGVETNGCHVFNTSLKIGQPVQFKKITSIATSL 237
           CS+             E++ LA  IPI+GVET GC VF+ SLK G+P+ F KITS+ATSL
Sbjct: 181 CSIGGGGLYNGIIEGLEKHDLATTIPIIGVETKGCEVFHQSLKAGKPLVFDKITSVATSL 240

Query: 238 GTAVISNQTFEYARKYNTRSVVIEDKDVIETCLKYTHQFNMVIEPACGAALHLGYNTKIL 297
           GTA I  +T E A KYNT+SVV+ D DV+ TCL +    N+V EPACGA+LH GYN  +L
Sbjct: 241 GTATICKKTLENALKYNTKSVVLSDADVVRTCLDFADDTNIVPEPACGASLHFGYNPHLL 300

Query: 298 ENALGSKLAADDIVIIIACGGSSNTIKDLEEALDSMRKKDTP 339
           E+ LG  L  +DI+I+IACGGSS T++DL++    + +  TP
Sbjct: 301 EDTLGGSLGPEDIIIVIACGGSSTTVQDLQQMQVRLGRPLTP 342

>NDAI0K02950 Chr11 (671102..672106) [1005 bp, 334 aa] {ON} 
          Length = 334

 Score =  367 bits (942), Expect = e-126,   Method: Compositional matrix adjust.
 Identities = 178/328 (54%), Positives = 231/328 (70%), Gaps = 2/328 (0%)

Query: 1   MSIVYNKTPLLRQFF-PGKASAQFFLKYECLQPSGSFKSRGIGNLIMKSAIRIQKDGKRS 59
           MS +YNKTPLLRQ F   K   + FLKYE LQPSGSFKSRGIG LI++   ++++DG ++
Sbjct: 1   MSFIYNKTPLLRQTFDSAKIGPRIFLKYENLQPSGSFKSRGIGCLILQHINKLKQDGNKT 60

Query: 60  PQVXXXXXXXXXXXXXXXCQRLSLPCTVVVPTATKKRMVDKIRNTGAQVIVSGAYWKEAD 119
             V                + L +PCTVVVP +TK+RMV+KIR TGA V++ G +WKEAD
Sbjct: 61  AHVFSSSGGNAGLAAATASRSLQVPCTVVVPKSTKERMVNKIRKTGASVLIKGDHWKEAD 120

Query: 120 TFLKTNVMNKIDSQVIEPIYVHPFDNPDIWEGHSSMIDEIVQDLKSQHISVNKVKGIVCS 179
            FL+ + M ++D+   +PIYVHPFD+P IWEGHS++IDEIVQ L+++ IS+ KVKGI+CS
Sbjct: 121 DFLRKS-MKEMDNTQEQPIYVHPFDDPVIWEGHSTIIDEIVQTLQTEKISIEKVKGIICS 179

Query: 180 VXXXXXXXXXXXXXERYGLADRIPIVGVETNGCHVFNTSLKIGQPVQFKKITSIATSLGT 239
           V             ER+ LA  IP++ VET GC V N SLK G PVQ  KITS+ATSLG+
Sbjct: 180 VGGGGLFNGIIKGLERHNLAQSIPVIAVETKGCDVLNKSLKNGTPVQLPKITSVATSLGS 239

Query: 240 AVISNQTFEYARKYNTRSVVIEDKDVIETCLKYTHQFNMVIEPACGAALHLGYNTKILEN 299
             IS+  FE A KYN+RS+ + DKDV+ETCLKY   F+M +EPACGA++HL YN  I+E+
Sbjct: 240 TYISSTAFENAMKYNSRSITLNDKDVLETCLKYNDDFSMTLEPACGASVHLAYNPGIVES 299

Query: 300 ALGSKLAADDIVIIIACGGSSNTIKDLE 327
           ALG+ L+  DIVI++ CGGSS T+ DLE
Sbjct: 300 ALGTALSNHDIVIVVLCGGSSCTLHDLE 327

>ZYRO0F18524g Chr6 (1528741..1529748) [1008 bp, 335 aa] {ON} similar
           to uniprot|P25379 Saccharomyces cerevisiae YCL064C CHA1
           catabolism of hydroxy amino acids catabolic serine
           (threonine) dehydratase
          Length = 335

 Score =  338 bits (866), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 167/331 (50%), Positives = 223/331 (67%), Gaps = 11/331 (3%)

Query: 1   MSIVYNKTPLLRQFFPGKASA---QFFLKYECLQPSGSFKSRGIGNLI-MKSAIRIQKDG 56
           M+  Y KTPLLRQ    K +    Q F+KYE LQP GSFKSRGIGNLI +KS     ++G
Sbjct: 1   MNNWYYKTPLLRQILNWKTTTELPQIFIKYENLQPGGSFKSRGIGNLISLKS-----ENG 55

Query: 57  KRSPQVXXXXXXXXXXXXXXXCQRLSLPCTVVVPTATKKRMVDKIRNTGAQVIVSGAYWK 116
                V                +++ LPCTVVVPT+TK+RMV KI+N+GA+VI+ G++WK
Sbjct: 56  LVKSHVLSSSGGNAGLAAAIASKQMELPCTVVVPTSTKQRMVQKIKNSGAEVIIRGSHWK 115

Query: 117 EADTFLKTNVMNKI-DSQVIEPIYVHPFDNPDIWEGHSSMIDEIVQDLKSQHISVNKVKG 175
           EAD +L+ N +    +    +P+YVHPFD+P +WEGHS+M+ EI+ +L+ Q+ISV  V+G
Sbjct: 116 EADNYLQQNYIQSFRNDGTSKPLYVHPFDDPKVWEGHSTMVHEIIDNLREQNISVENVRG 175

Query: 176 IVCSVXXXXXXXXXXXXXERYGLADRIPIVGVETNGCHVFNTSLKIGQPVQFKKITSIAT 235
           IVCSV             E +GLAD+IP++ VET GC+V N SL  G+PV   KITS+AT
Sbjct: 176 IVCSVGGGGLFNGIIKGLEDHGLADKIPVIAVETYGCNVLNASLNAGRPVMLDKITSLAT 235

Query: 236 SLGTAVISNQTFEYARKYNTRSVVIEDKDVIETCLKYTHQFNMVIEPACGAALHLGYNTK 295
           SLG+  I    FE A +Y  +S+V+EDKDVIETCL+Y   F  ++EPACGA+LH+GY+ +
Sbjct: 236 SLGSTYIPQGVFENAVRYGAKSLVLEDKDVIETCLRYVSDFGQIVEPACGASLHIGYHPE 295

Query: 296 ILENALGSKLAADDIVIIIACGGSSNTIKDL 326
           +LEN LG   + DDI++IIACGGS+ T KDL
Sbjct: 296 LLENFLGG-FSKDDIIVIIACGGSTTTFKDL 325

>KNAG0D05380 Chr4 complement(986308..987312) [1005 bp, 334 aa] {ON} 
          Length = 334

 Score =  326 bits (836), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 166/338 (49%), Positives = 213/338 (63%), Gaps = 5/338 (1%)

Query: 1   MSIVYNKTPLLRQFFPGKASAQFFLKYECLQPSGSFKSRGIGNLIMKSAIRIQKDGKRSP 60
           M  +YNKTPLL +   G     F  KYE +QP GSFK RG+ +LI K   +I+ +GK+ P
Sbjct: 1   MPALYNKTPLLPKNLSGGDGPTFLFKYENMQPGGSFKIRGVSHLIEKRVEQIKSEGKKPP 60

Query: 61  QVXXXXXXXXXXXXXXXCQRLSLPCTVVVPTATKKRMVDKIRNTGAQVIVSGAYWKEADT 120
            V               C  LS+PCTVVVPT TK RMV+KIR   A+VIV G+ WKEAD 
Sbjct: 61  HVFSSSGGNAGLAAATACHILSIPCTVVVPTLTKPRMVEKIRKANAEVIVKGSNWKEADD 120

Query: 121 FLKTNVMNKIDSQVIEPIYVHPFDNPDIWEGHSSMIDEIVQDLKSQHISVNKVKGIVCSV 180
           +L+  V+    +  ++PIYV+PFD+P +WEGHS+MIDEI+  L  ++I ++ VKGIVCSV
Sbjct: 121 YLRGTVI--ASNNAVQPIYVNPFDDPLLWEGHSTMIDEILNALNQENIKLDAVKGIVCSV 178

Query: 181 XXXXXXXXXXXXXERYGLADRIPIVGVETNGCHVFNTSLKIGQPVQFKKITSIATSLGTA 240
                        E + LA  IP+V VET GC V   SL   +PV+  KI SIATSLG++
Sbjct: 179 GGGGLFNGIVHGLENHQLACTIPVVAVETKGCDVLGLSLAAEKPVRLNKIDSIATSLGSS 238

Query: 241 VISNQTFEYARKYNTRSVVIEDKDVIETCLKYTHQFNMVIEPACGAALHLGYNTKILENA 300
            +S Q F+ A K+ +RSVV+ D DV+ TC +Y   FN ++EPACGA +H  Y+ KILE A
Sbjct: 239 YVSCQAFDNAVKFKSRSVVLHDSDVLNTCYRYLDDFNAIVEPACGATIHTAYHYKILEKA 298

Query: 301 LGSKLAADDIVIIIACGGSSNTIKDLEEALDSMRKKDT 338
           LG KL   DI+III CGGS  TI+DLE A    RK DT
Sbjct: 299 LGQKLTPSDIIIIIVCGGSCVTIQDLENA---KRKLDT 333

>KLLA0C00440g Chr3 complement(32008..33141) [1134 bp, 377 aa] {ON}
           similar to uniprot|P25379 Saccharomyces cerevisiae
           YCL064C CHA1 catabolism of hydroxy amino acids catabolic
           serine (threonine) dehydratase
          Length = 377

 Score =  321 bits (823), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 159/329 (48%), Positives = 217/329 (65%), Gaps = 7/329 (2%)

Query: 4   VYNKTPLLRQFFPGKASAQFFLKYECLQPSGSFKSRGIGNLIMKSAIRIQKDGKRSPQ-- 61
           +++KTPLL+  F      Q  LKYE LQPSGSFKSRGIG+LI   + ++++  K SP+  
Sbjct: 24  LFSKTPLLKHQFKRSKGPQVLLKYEFLQPSGSFKSRGIGHLI---STKVEEIKKSSPEKI 80

Query: 62  --VXXXXXXXXXXXXXXXCQRLSLPCTVVVPTATKKRMVDKIRNTGAQVIVSGAYWKEAD 119
             V                  L++PCTVVV  AT+ R+++KIR+ GA V+V G +WKEAD
Sbjct: 81  GHVFASSGGNAGLAAAVASLELNVPCTVVVSNATRPRIIEKIRSYGADVVVHGNHWKEAD 140

Query: 120 TFLKTNVMNKIDSQVIEPIYVHPFDNPDIWEGHSSMIDEIVQDLKSQHISVNKVKGIVCS 179
           +F+K ++M K+DS   EPIY HPFDNP IWEGHS M+DEI+  L S  I + K+KGIVCS
Sbjct: 141 SFMKEHLMKKLDSFKYEPIYSHPFDNPLIWEGHSFMVDEIMDVLASSKIPITKIKGIVCS 200

Query: 180 VXXXXXXXXXXXXXERYGLADRIPIVGVETNGCHVFNTSLKIGQPVQFKKITSIATSLGT 239
                         +RY LAD+IPIV VET G  V + SL++G PV+F+KI+S ATSLGT
Sbjct: 201 FGGGGLYNGLILGLQRYNLADKIPIVCVETKGTDVLSASLRVGAPVEFEKISSCATSLGT 260

Query: 240 AVISNQTFEYARKYNTRSVVIEDKDVIETCLKYTHQFNMVIEPACGAALHLGYNTKILEN 299
           A IS   ++  +++ ++S VI D +VI TCL++++  N+V EP CGA L+ GYN   L+N
Sbjct: 261 ATISTTAYQNVKRHGSKSAVISDTEVISTCLQFSNDTNIVAEPGCGATLYFGYNIDKLQN 320

Query: 300 ALGSKLAADDIVIIIACGGSSNTIKDLEE 328
            LGS +  DD VI+I CGGSS +++DL+E
Sbjct: 321 ILGSDIKDDDYVILIGCGGSSTSLEDLKE 349

>SAKL0C13904g Chr3 (1223973..1224992) [1020 bp, 339 aa] {ON} similar
           to uniprot|P25379 Saccharomyces cerevisiae YCL064C CHA1
           catabolism of hydroxy amino acids catabolic serine
           (threonine) dehydratase
          Length = 339

 Score =  319 bits (817), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 155/324 (47%), Positives = 213/324 (65%), Gaps = 1/324 (0%)

Query: 5   YNKTPLL-RQFFPGKASAQFFLKYECLQPSGSFKSRGIGNLIMKSAIRIQKDGKRSPQVX 63
           YNKTPLL R       + +FFLKYE LQP GSFKSRGIG L+ KS  + ++DG +S  V 
Sbjct: 8   YNKTPLLPRVLTTTDGAPRFFLKYEFLQPGGSFKSRGIGYLVKKSYEKARRDGGKSLAVF 67

Query: 64  XXXXXXXXXXXXXXCQRLSLPCTVVVPTATKKRMVDKIRNTGAQVIVSGAYWKEADTFLK 123
                          Q  S+ CTVVVP  TK RMV+KIR TGA+V+V G +W  AD +L+
Sbjct: 68  SSSGGNAGLAAAIAAQTFSINCTVVVPRTTKSRMVEKIRKTGAEVLVYGKHWGMADEYLR 127

Query: 124 TNVMNKIDSQVIEPIYVHPFDNPDIWEGHSSMIDEIVQDLKSQHISVNKVKGIVCSVXXX 183
             VM ++D   + P+YVHPFDNP IW+GHS+++DE+V  LK +++S++KVK IVCSV   
Sbjct: 128 EVVMKEVDVSKVVPLYVHPFDNPIIWQGHSTIVDEVVAQLKEENVSIDKVKAIVCSVGGG 187

Query: 184 XXXXXXXXXXERYGLADRIPIVGVETNGCHVFNTSLKIGQPVQFKKITSIATSLGTAVIS 243
                     E + LADRIPI+ +ET GC V N SL  G PV  + +TS+A+SL +  IS
Sbjct: 188 GLYNGIVKGLETHQLADRIPILAIETKGCDVLNKSLNSGNPVVLESLTSVASSLASPYIS 247

Query: 244 NQTFEYARKYNTRSVVIEDKDVIETCLKYTHQFNMVIEPACGAALHLGYNTKILENALGS 303
            + FE ARKY ++S++++D  VIETCL +     +V+EPACGA+L+  Y+ ++L   +G 
Sbjct: 248 EKAFENARKYESKSILLKDSQVIETCLNFADDAGIVVEPACGASLYSCYHPELLPLYIGK 307

Query: 304 KLAADDIVIIIACGGSSNTIKDLE 327
           +L  DD++++IACGGS+ T KDLE
Sbjct: 308 ELTEDDVIVVIACGGSAVTYKDLE 331

>KLTH0F00440g Chr6 complement(34215..35240) [1026 bp, 341 aa] {ON}
           similar to uniprot|P25379 Saccharomyces cerevisiae
           YCL064C CHA1 catabolism of hydroxy amino acids catabolic
           serine (threonine) dehydratase
          Length = 341

 Score =  318 bits (814), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 157/331 (47%), Positives = 212/331 (64%), Gaps = 5/331 (1%)

Query: 1   MSIVYNKTPLLRQFFPGKAS-----AQFFLKYECLQPSGSFKSRGIGNLIMKSAIRIQKD 55
           M   + KTPLL  +F   ++      QF LK E LQPSGSFKSRGIG +I K AI+I+ +
Sbjct: 1   MKSAFVKTPLLAHYFAASSNRLPNQPQFMLKCEFLQPSGSFKSRGIGYMITKQAIKIRSE 60

Query: 56  GKRSPQVXXXXXXXXXXXXXXXCQRLSLPCTVVVPTATKKRMVDKIRNTGAQVIVSGAYW 115
           G + P V                + LS+PC+VVVP +T  RMV KI N GA+V V G  W
Sbjct: 61  GNKLPHVFASSGGNAGLAAATTSRALSIPCSVVVPESTSNRMVQKIWNLGAEVHVYGRNW 120

Query: 116 KEADTFLKTNVMNKIDSQVIEPIYVHPFDNPDIWEGHSSMIDEIVQDLKSQHISVNKVKG 175
           KEAD FLK ++++  +    + IY HPFD+P IWEGHSS++DEI+  LK Q I +  +K 
Sbjct: 121 KEADKFLKESIISGHNPSRTQVIYAHPFDHPLIWEGHSSIVDEIIDSLKEQKIDLKNIKA 180

Query: 176 IVCSVXXXXXXXXXXXXXERYGLADRIPIVGVETNGCHVFNTSLKIGQPVQFKKITSIAT 235
           IVCSV              R+ L  +IPI+GVE+ GC VFN+SLK+G+  +F+ ITSIAT
Sbjct: 181 IVCSVGGGGLYNGIIEGLSRHKLVHKIPIIGVESKGCEVFNSSLKLGKLTEFEDITSIAT 240

Query: 236 SLGTAVISNQTFEYARKYNTRSVVIEDKDVIETCLKYTHQFNMVIEPACGAALHLGYNTK 295
           S+GT  IS +T E A +Y+T+SVV+ D+++I TCL++  + N++ EPACGAALHLGY   
Sbjct: 241 SIGTNSISKKTLENALRYHTKSVVLTDQEIISTCLRFADETNIIPEPACGAALHLGYYPD 300

Query: 296 ILENALGSKLAADDIVIIIACGGSSNTIKDL 326
           IL  AL S    +D++I+I CGGS+ +  DL
Sbjct: 301 ILYQALNSDFTPEDVIIMIGCGGSATSYNDL 331

>AFR747W Chr6 (1808016..1809296) [1281 bp, 426 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YCL064C (CHA1)
          Length = 426

 Score =  318 bits (814), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 157/341 (46%), Positives = 220/341 (64%), Gaps = 7/341 (2%)

Query: 1   MSIVYNKTPLLRQFFPGK-----ASAQFFLKYECLQPSGSFKSRGIGNLIMKSAIRIQKD 55
           M+  Y KTPL+R  F  +     A+ +  LKYE  QPSGSFKSRGIGNLI K   +I+++
Sbjct: 69  MASFYCKTPLMRHVFARQNVRYTANPEIMLKYEFFQPSGSFKSRGIGNLIWKEMQKIRQN 128

Query: 56  GKRSPQVXXXXXXXXXXXXXXXCQRLSLPCTVVVPTATKKRMVDKIRNTGAQVIVSGAYW 115
               P V                ++L LPCTVVVP  T++RMV++IR+TGA VI  G+  
Sbjct: 129 SSLQPHVFASSGGNAGLAAATASRQLGLPCTVVVPETTRRRMVERIRSTGADVISMGSVL 188

Query: 116 KEADTFLKTNVMNKIDSQVIEPIYVHPFDNPDIWEGHSSMIDEIVQDLKSQHISVNKVKG 175
           KE+D +L++ +M  ++ + + PIY HPFDNP IWEGH++M+DE+V+ L  Q + +  VKG
Sbjct: 189 KESDDYLRSELMGNVNLEKVAPIYAHPFDNPLIWEGHATMVDEVVEALHLQGVQLESVKG 248

Query: 176 IVCSVXXXXXXXXXXXXXERYGLADRIPIVGVETNGCHVFNTSLKIGQPVQFKKITSIAT 235
           IVCSV             E++GLAD IP+V VET GC V + SL +G+ V      S+AT
Sbjct: 249 IVCSVGGGGLYNGIVYGLEKHGLADSIPVVAVETEGCEVLHRSLLLGRNVSMNP-KSVAT 307

Query: 236 SLGTAVISNQTFEYARKYNTRSVVIEDKDVIETCLKYTHQFNMVIEPACGAALHLGYNTK 295
           SL T+ +++ T  YA+KY T+SVV++   V++TCL +  + N+V EPACGAALHLGY+ +
Sbjct: 308 SLCTSFVTDLTLSYAQKYRTKSVVLDQLAVVQTCLNFAEESNIVTEPACGAALHLGYHPE 367

Query: 296 ILENALGSKLAADDIVIIIACGGSSNTIKDLEEALDSMRKK 336
           ILE  LG  L   D+VI+IACGGS+  + DL+E+ D ++ K
Sbjct: 368 ILERELG-PLTPQDVVIVIACGGSTMNLADLKESEDQLQPK 407

>Smik_9.2 Chr9 (6779..7795) [1017 bp, 338 aa] {ON} YCL064C (REAL)
          Length = 338

 Score =  313 bits (803), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 159/326 (48%), Positives = 211/326 (64%), Gaps = 1/326 (0%)

Query: 5   YNKTPLLRQFFP-GKASAQFFLKYECLQPSGSFKSRGIGNLIMKSAIRIQKDGKRSPQVX 63
           Y KTPL+RQ F  GK +  F++K++ LQP GSFKSRGIG+LI K       +G     V 
Sbjct: 6   YEKTPLIRQVFDNGKTNPLFYIKHDMLQPGGSFKSRGIGHLIRKKNKEALAEGSGKLVVF 65

Query: 64  XXXXXXXXXXXXXXCQRLSLPCTVVVPTATKKRMVDKIRNTGAQVIVSGAYWKEADTFLK 123
                         C+ ++L CTVVVP  TK RMV KI++ GA+VI+ G +W EAD +LK
Sbjct: 66  SSSGGNAGLAAATSCRLMALNCTVVVPKTTKSRMVKKIQSAGAKVIIHGDHWGEADEYLK 125

Query: 124 TNVMNKIDSQVIEPIYVHPFDNPDIWEGHSSMIDEIVQDLKSQHISVNKVKGIVCSVXXX 183
             VM +      + +YVHPFD+  IWEGHS+++DEI+Q L+ + IS  +VKG+VCSV   
Sbjct: 126 QEVMAQEGQHGSKTLYVHPFDDEIIWEGHSTIVDEILQQLQEKDISPLQVKGLVCSVGGG 185

Query: 184 XXXXXXXXXXERYGLADRIPIVGVETNGCHVFNTSLKIGQPVQFKKITSIATSLGTAVIS 243
                     ER  LA +IPIV VET GC V N SLK G PV  +++TS+ATSLG+  I+
Sbjct: 186 GLFSGIIKGLERNRLAGKIPIVAVETAGCDVLNKSLKNGSPVALERLTSVATSLGSPYIA 245

Query: 244 NQTFEYARKYNTRSVVIEDKDVIETCLKYTHQFNMVIEPACGAALHLGYNTKILENALGS 303
              FE    Y  +SVV+ D+DV++TCL+Y   +N ++EPACGA+LHL Y+ +ILE ALG 
Sbjct: 246 PFAFESFITYGCKSVVLSDQDVLDTCLRYADDYNFIVEPACGASLHLCYHPEILEKALGQ 305

Query: 304 KLAADDIVIIIACGGSSNTIKDLEEA 329
           KL+ DD+VIIIACGGS  T +DL +A
Sbjct: 306 KLSEDDVVIIIACGGSCMTYEDLVKA 331

>Ecym_1006 Chr1 complement(9635..10729) [1095 bp, 364 aa] {ON}
           similar to Ashbya gossypii AFR747W
          Length = 364

 Score =  313 bits (801), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 160/350 (45%), Positives = 225/350 (64%), Gaps = 16/350 (4%)

Query: 1   MSIVYNKTPLLRQFFPGKAS------AQFFLKYECLQPSGSFKSRGIGNLIMKSAIRIQK 54
           MS +Y KTPLLR+ F GK +       QF +KYE  QPSGSFKSRGIGNLI      I++
Sbjct: 1   MSSLYVKTPLLRRAF-GKPNIQISKVPQFLVKYEFFQPSGSFKSRGIGNLIYNKVSEIRR 59

Query: 55  DGKRSPQVXXXXXXXXXXXXXXXCQRLSLPCTVVVPTATKKRMVDKIRNTGAQVIVSGAY 114
           D  + P V                QR+ +PCTVVVPT+T++R+++KI  TGA +I  G Y
Sbjct: 60  DPAKQPHVFSSSGGNAGLAAATASQRMGIPCTVVVPTSTRQRIIEKIMATGATIICRGDY 119

Query: 115 WKEADTFLKTNVMNKIDSQVIE----PIYVHPFDNPDIWEGHSSMIDEIVQDLKSQHISV 170
           + EAD++LK  +    +    +    PIYVHPF++P IW GHS +++EI++ L++++I  
Sbjct: 120 FAEADSYLKDLMQEAANKNTRDKKNVPIYVHPFNHPLIWHGHSYIVEEILESLRNENIPY 179

Query: 171 NKVKGIVCSVXXXXXXXXXXXXXERYGLADRIPIVGVETNGCHVFNTSLKIGQPVQFKKI 230
           ++VKGIVCSV             ER+ LA+ IPI+GVET GC V + SL  G+ + FKK 
Sbjct: 180 SRVKGIVCSVGGGGLYNGIIEGLERHSLANTIPIIGVETEGCEVLHKSLIAGKLITFKKA 239

Query: 231 TSIATSLGTAVISNQTFEYARKYNTRSVVIEDKDVIETCLKYTHQFNMVIEPACGAALHL 290
            S+ATSL    I+ +T  YA+KY T+S+V+ + +V++TCL++T + N+V EPACGA LHL
Sbjct: 240 LSVATSLSVPTITKETLRYAQKYKTKSLVLGEGEVLDTCLRFTDESNIVTEPACGATLHL 299

Query: 291 GYNTKILENALGSKLAADDIVIIIACGGSSNTIKDLEEALDSMRKKDTPV 340
           GY+  IL   LG  L+++DIVI+IACGGS+ T+ DL E    ++ K  PV
Sbjct: 300 GYHPAILHKELGP-LSSEDIVILIACGGSATTLADLRE----LKLKYNPV 344

>Scer_YGOB_SDL1 Chr9 (29032..29411,29415..30048) [1014 bp, 337 aa]
           {ON} ANNOTATED BY YGOB - Skipping over stop codon in
           S288c
          Length = 337

 Score =  308 bits (790), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 155/330 (46%), Positives = 213/330 (64%), Gaps = 2/330 (0%)

Query: 5   YNKTPLLRQFFP-GKASAQFFLKYECLQPSGSFKSRGIGNLIMKSAIRIQKDGKRSPQVX 63
           Y KTPL+RQF   GK ++ F++K+E LQP GSFKSRGIG+LI KS      +G     V 
Sbjct: 6   YEKTPLIRQFLNNGKTNSWFYVKHEMLQPGGSFKSRGIGHLIRKSNEEALSEGSGKLAVF 65

Query: 64  XXXXXXXXXXXXXXCQRLSLPCTVVVPTATKKRMVDKIRNTGAQVIVSGAYWKEADTFLK 123
                         C+ ++L C+VVVP  TK RMV KI++ GA+VI+ G +W EAD +L+
Sbjct: 66  SSSGGNAGLAAATACRSMALNCSVVVPKTTKPRMVKKIQSAGAKVIIHGDHWGEADEYLR 125

Query: 124 TNVMNKIDSQVIEPIYVHPFDNPDIWEGHSSMIDEIVQDLKSQHISVNKVKGIVCSVXXX 183
            + M +      + +YVHPFDN  IWEGHS+++DEI++ LK   IS+ +VK +VCSV   
Sbjct: 126 -HEMAQESQHGSKTLYVHPFDNETIWEGHSTIVDEIIEQLKENDISLPRVKALVCSVGGG 184

Query: 184 XXXXXXXXXXERYGLADRIPIVGVETNGCHVFNTSLKIGQPVQFKKITSIATSLGTAVIS 243
                     +R  LA++IP+V VET GC V N SLK G PV  +K+TS+ATSL +  I+
Sbjct: 185 GLFSGIIKGLDRNQLAEKIPVVAVETAGCDVLNKSLKKGSPVTLEKLTSVATSLASPYIA 244

Query: 244 NQTFEYARKYNTRSVVIEDKDVIETCLKYTHQFNMVIEPACGAALHLGYNTKILENALGS 303
           +  FE   KY  +SVV+ D+DV+ TCL+Y   +N ++EPACGA+LHL Y+ +ILE+ L  
Sbjct: 245 SFAFESFNKYGCKSVVLSDQDVLATCLRYADDYNFIVEPACGASLHLCYHPEILEDILEQ 304

Query: 304 KLAADDIVIIIACGGSSNTIKDLEEALDSM 333
           K+  DDIVIIIACGGS  T +DL +A  ++
Sbjct: 305 KIYEDDIVIIIACGGSCMTYEDLVKASSTL 334

>Skud_9.2 Chr9 (5919..6938) [1020 bp, 339 aa] {ON} YCL064C (REAL)
          Length = 339

 Score =  302 bits (773), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 148/325 (45%), Positives = 207/325 (63%), Gaps = 1/325 (0%)

Query: 5   YNKTPLLRQFFP-GKASAQFFLKYECLQPSGSFKSRGIGNLIMKSAIRIQKDGKRSPQVX 63
           Y +TPL+ Q F  G+   + ++K+E LQP GSFKSRGIG+LI +S      DG     V 
Sbjct: 6   YERTPLIHQVFNNGQTGPRLYVKHEMLQPGGSFKSRGIGHLINRSNEEALADGSGKLAVF 65

Query: 64  XXXXXXXXXXXXXXCQRLSLPCTVVVPTATKKRMVDKIRNTGAQVIVSGAYWKEADTFLK 123
                         C  ++L CTVVVP  TK RM+ KI+N GA+VI+ G++W EAD +L+
Sbjct: 66  SSSGGNAGLAAATACSSMALDCTVVVPKTTKSRMIKKIQNAGAKVIIHGSHWGEADEYLR 125

Query: 124 TNVMNKIDSQVIEPIYVHPFDNPDIWEGHSSMIDEIVQDLKSQHISVNKVKGIVCSVXXX 183
             +M +      + +YVHPFD+  IWEGHS+++DE++Q L+ ++IS+ ++K +VCSV   
Sbjct: 126 QELMIQESQLGSKTLYVHPFDDERIWEGHSTIVDEVLQQLQEKNISLARIKAMVCSVGGG 185

Query: 184 XXXXXXXXXXERYGLADRIPIVGVETNGCHVFNTSLKIGQPVQFKKITSIATSLGTAVIS 243
                     ER  LA +I ++ VET GC V N SL  G P+  ++++SIATSLG+  I+
Sbjct: 186 GLFSGIIKGLERNNLAGKIRVIAVETIGCDVLNKSLVNGSPITLERLSSIATSLGSPYIA 245

Query: 244 NQTFEYARKYNTRSVVIEDKDVIETCLKYTHQFNMVIEPACGAALHLGYNTKILENALGS 303
              FE    Y  +SVV+ D+DV+ TCL+Y   +N ++EPACGA+LHL Y+ +ILENAL  
Sbjct: 246 PFAFESFNAYGCKSVVLSDQDVLATCLRYADDYNSIVEPACGASLHLCYHQEILENALEQ 305

Query: 304 KLAADDIVIIIACGGSSNTIKDLEE 328
           KL+ DDIVIIIACGGS  T +DL E
Sbjct: 306 KLSDDDIVIIIACGGSCMTYEDLVE 330

>TDEL0D06540 Chr4 (1175562..1176575) [1014 bp, 337 aa] {ON} 
          Length = 337

 Score =  291 bits (745), Expect = 2e-96,   Method: Compositional matrix adjust.
 Identities = 152/324 (46%), Positives = 201/324 (62%), Gaps = 3/324 (0%)

Query: 6   NKTPLLRQFF--PGKASAQFFLKYECLQPSGSFKSRGIGNLIMKSAIRIQKDGKRSPQVX 63
           +K+PLL + F    K   QFFLKYE LQPSGSFKSRGIG LI   A   +        V 
Sbjct: 5   HKSPLLNRRFKESEKDGPQFFLKYETLQPSGSFKSRGIGYLINSKAKEARSRDGSDVHVF 64

Query: 64  XXXXXXXXXXXXXXCQRLSLPCTVVVPTATKKRMVDKIRNTGAQVIVSGAYWKEADTFLK 123
                          + L+L CTVVVP  TK+ M+D+I+N G+QVIV G +W  ADT+LK
Sbjct: 65  SSSGGNAGLAAANASKLLNLNCTVVVPVTTKRHMIDRIQNAGSQVIVHGTHWGMADTYLK 124

Query: 124 TNVMNKIDSQVIEPIYVHPFDNPDIWEGHSSMIDEIVQDLKSQHISVNKVKGIVCSVXXX 183
             VM K+ S V EP+YVHPFD+P +WEGHS MIDEIV+ L+ Q  S+  VKGI+CSV   
Sbjct: 125 EVVMKKVPSNV-EPLYVHPFDDPLVWEGHSFMIDEIVEQLQEQGRSMRDVKGIICSVGGG 183

Query: 184 XXXXXXXXXXERYGLADRIPIVGVETNGCHVFNTSLKIGQPVQFKKITSIATSLGTAVIS 243
                     ER+G A +IPI+ VET G      SL  G+PV+  ++TSIA+SLG+  I+
Sbjct: 184 GLYNGIVGGLERHGYAGKIPIIAVETVGADALAKSLAAGKPVRLTEVTSIASSLGSPYIA 243

Query: 244 NQTFEYARKYNTRSVVIEDKDVIETCLKYTHQFNMVIEPACGAALHLGYNTKILENALGS 303
             +FE A +Y TRS V  D++ + T L++  + N+++EPAC A++ L Y+   L   L  
Sbjct: 244 QDSFEKAIRYKTRSFVQTDEEAVRTSLRFFQETNILVEPACAASVSLCYHVDELNKLLSC 303

Query: 304 KLAADDIVIIIACGGSSNTIKDLE 327
           KL++ DIVI+I CGGS+ TI DLE
Sbjct: 304 KLSSKDIVIVIVCGGSATTISDLE 327

>KLLA0E01805g Chr5 complement(173125..174093) [969 bp, 322 aa] {ON}
           similar to uniprot|P25379 Saccharomyces cerevisiae
           YCL064C CHA1 catabolism of hydroxy amino acids catabolic
           serine (threonine) dehydratase
          Length = 322

 Score =  281 bits (719), Expect = 1e-92,   Method: Compositional matrix adjust.
 Identities = 145/321 (45%), Positives = 201/321 (62%), Gaps = 8/321 (2%)

Query: 7   KTPLLRQFFPGKASAQFFLKYECLQPSGSFKSRGIGNLIMKSAIRIQKDGKRSPQVXXXX 66
           KTPLL    P      F LKYE LQP GSFKSRGI +LI K+ +    D +    V    
Sbjct: 7   KTPLLPFREPLNGGPTFLLKYENLQPGGSFKSRGISHLI-KTTMDSISDPENELAVYSSS 65

Query: 67  XXXXXXXXXXXCQRLSLPCTVVVPTATKKRMVDKIRNTGAQVIVSGAYWKEADTFLKTNV 126
                      C  L +PCTV+VP +TK RM+ KI + GA+V++ G +WKEADT+L+  V
Sbjct: 66  GGNAGLAAARACATLKVPCTVIVPKSTKPRMIKKIESAGAKVVIFGDHWKEADTYLREYV 125

Query: 127 MNKIDSQVIEPIYVHPFDNPDIWEGHSSMIDEIVQDLKSQHISVNKVKGIVCSVXXXXXX 186
           M +  S     +YVHPFDNP IW+GHS+MIDEI++ L   H  +N VKGIVCSV      
Sbjct: 126 MRQ--SSYSNTLYVHPFDNPIIWDGHSTMIDEIIEQLAESHTDINDVKGIVCSVGGGGLY 183

Query: 187 XXXXXXXERYGLADRIPIVGVETNGCHVFNTSLKIGQPVQFKKITSIATSLGTAVISNQT 246
                  ER+GLA  IP+  +ET+GC V + SL  G+PV   +I+SIATSLG+  I   +
Sbjct: 184 NGVVNGLERHGLAGSIPVFAMETDGCDVLSKSLIAGEPVVLDRISSIATSLGSTEICADS 243

Query: 247 FEYARKYNTRSVVIEDKDVIETCLKYTHQFNMVIEPACGAALHLGYNTKILENALGSKLA 306
           F+ A K++++S+V++DK+V++TCL++  + ++++EPACGA+LH  Y  ++L       L 
Sbjct: 244 FQKAIKFSSKSIVLDDKNVVDTCLRFFDETSILVEPACGASLHTCYRPELL-----GPLG 298

Query: 307 ADDIVIIIACGGSSNTIKDLE 327
            DDIV++I CGGS NT  DL+
Sbjct: 299 PDDIVVVILCGGSCNTYDDLK 319

>KNAG0A01150 Chr1 (6346..7041) [696 bp, 231 aa] {ON}
          Length = 231

 Score =  217 bits (553), Expect = 7e-69,   Method: Compositional matrix adjust.
 Identities = 107/223 (47%), Positives = 145/223 (65%), Gaps = 2/223 (0%)

Query: 107 QVIVSGAYWKEADTFLKTNVMNKIDSQVIEPIYVHPFDNPDIWEGHSSMIDEIVQDLKSQ 166
           +V V  A  KEAD +L+  V++      ++PIYV+PFD+P IWEGHS++IDEI+  L  +
Sbjct: 4   EVFVHVANLKEADYYLQNVVIDLYKD--VQPIYVNPFDDPLIWEGHSTIIDEILNTLTQE 61

Query: 167 HISVNKVKGIVCSVXXXXXXXXXXXXXERYGLADRIPIVGVETNGCHVFNTSLKIGQPVQ 226
           +I V  VKGI+CS              E+Y LA  IP+V VET GC V N SL   +PVQ
Sbjct: 62  NIEVGSVKGIICSFSGGGLYNGIMQGLEKYDLAYNIPVVAVETKGCDVLNLSLAANKPVQ 121

Query: 227 FKKITSIATSLGTAVISNQTFEYARKYNTRSVVIEDKDVIETCLKYTHQFNMVIEPACGA 286
              ITSIA SLG++V+S + F+   KY+++S+V+ D D ++TC KY   F  V+EPACGA
Sbjct: 122 LDSITSIAKSLGSSVVSQKVFDNVIKYHSKSLVLNDSDALDTCFKYLDDFGTVLEPACGA 181

Query: 287 ALHLGYNTKILENALGSKLAADDIVIIIACGGSSNTIKDLEEA 329
           ++H  Y+  +LE AL  KL  DD++IIIACGGS  T +DLE A
Sbjct: 182 SVHTAYHYNVLEEALDQKLRPDDVIIIIACGGSCATFQDLERA 224

>YIL167W Chr9 (29416..30048) [633 bp, 210 aa] {OFF}  SDL1Open
           reading frame, unlikely to produce a functional protein
           in S288C; in closely related species and other S.
           cerevisiae strain backgrounds YIL167W and adjacent
           ORF, YIL168W, constitute a single ORF encoding L-serine
           dehydratase
          Length = 210

 Score =  207 bits (527), Expect = 3e-65,   Method: Compositional matrix adjust.
 Identities = 99/196 (50%), Positives = 135/196 (68%)

Query: 138 IYVHPFDNPDIWEGHSSMIDEIVQDLKSQHISVNKVKGIVCSVXXXXXXXXXXXXXERYG 197
           +YVHPFDN  IWEGHS+++DEI++ LK   IS+ +VK +VCSV             +R  
Sbjct: 12  LYVHPFDNETIWEGHSTIVDEIIEQLKENDISLPRVKALVCSVGGGGLFSGIIKGLDRNQ 71

Query: 198 LADRIPIVGVETNGCHVFNTSLKIGQPVQFKKITSIATSLGTAVISNQTFEYARKYNTRS 257
           LA++IP+V VET GC V N SLK G PV  +K+TS+ATSL +  I++  FE   KY  +S
Sbjct: 72  LAEKIPVVAVETAGCDVLNKSLKKGSPVTLEKLTSVATSLASPYIASFAFESFNKYGCKS 131

Query: 258 VVIEDKDVIETCLKYTHQFNMVIEPACGAALHLGYNTKILENALGSKLAADDIVIIIACG 317
           VV+ D+DV+ TCL+Y   +N ++EPACGA+LHL Y+ +ILE+ L  K+  DDIVIIIACG
Sbjct: 132 VVLSDQDVLATCLRYADDYNFIVEPACGASLHLCYHPEILEDILEQKIYEDDIVIIIACG 191

Query: 318 GSSNTIKDLEEALDSM 333
           GS  T +DL +A  ++
Sbjct: 192 GSCMTYEDLVKASSTL 207

>YIL168W Chr9 (29032..29415) [384 bp, 127 aa] {OFF} Open reading
           frame, unlikely to produce a functional protein in
           S288C; in closely related species and other S.
           cerevisiae strain backgrounds YIL168W and adjacent
           ORF, YIL167W, constitute a single ORF encoding L-serine
           dehydratase
          Length = 127

 Score =  111 bits (278), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 55/120 (45%), Positives = 74/120 (61%), Gaps = 1/120 (0%)

Query: 5   YNKTPLLRQFFP-GKASAQFFLKYECLQPSGSFKSRGIGNLIMKSAIRIQKDGKRSPQVX 63
           Y KTPL+RQF   GK ++ F++K+E LQP GSFKSRGIG+LI KS      +G     V 
Sbjct: 6   YEKTPLIRQFLNNGKTNSWFYVKHEMLQPGGSFKSRGIGHLIRKSNEEALSEGSGKLAVF 65

Query: 64  XXXXXXXXXXXXXXCQRLSLPCTVVVPTATKKRMVDKIRNTGAQVIVSGAYWKEADTFLK 123
                         C+ ++L C+VVVP  TK RMV KI++ GA+VI+ G +W EAD +L+
Sbjct: 66  SSSGGNAGLAAATACRSMALNCSVVVPKTTKPRMVKKIQSAGAKVIIHGDHWGEADEYLR 125

>SAKL0F11858g Chr6 (920767..922455) [1689 bp, 562 aa] {ON} highly
           similar to uniprot|P00927 Saccharomyces cerevisiae
           YER086W ILV1 Threonine deaminase catalyzes the first
           step in isoleucine biosynthesis expression is under
           general amino acid control ILV1 locus exhibits highly
           positioned nucleosomes whose organization is independent
           of known ILV1 regulation
          Length = 562

 Score = 70.9 bits (172), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 61/266 (22%), Positives = 112/266 (42%), Gaps = 17/266 (6%)

Query: 18  KASAQFFLKYECLQPSGSFKSRGIGNLIMKSAIRIQKDGKRSPQVXXXXXXXXXXXXXXX 77
           + +A   LK E L P  SFK RG  N+I K       + +++  V               
Sbjct: 76  RLNANVQLKREDLLPVFSFKLRGAYNMIAK-----LDESQKTQGVIACSAGNHAQGVAYA 130

Query: 78  CQRLSLPCTVVVPTATKKRMVDKIRNTGAQVIVSGAYWKEADTFLKTNVMNKIDSQVIEP 137
            + L++P T+V+P +T       +   G+QV++ G  + EA    K       + + +  
Sbjct: 131 SKHLNIPATIVMPVSTPSIKYQNVSRLGSQVVLYGNDFDEA----KAECTKLTEERGLTN 186

Query: 138 IYVHPFDNPDIWEGHSSMIDEIVQDLKSQHISVNKVKGIVCSVXXXXXXXXXXXXXERYG 197
           I   PFD+P +  G  ++  EI++ + +     +K+K + C+V             +R  
Sbjct: 187 I--PPFDHPYVIAGQGTIAMEILRQVHN----ASKIKAVFCAVGGGGLITGVGAYLKR-- 238

Query: 198 LADRIPIVGVETNGCHVFNTSLKIGQPVQFKKITSIATSLGTAVISNQTFEYARKYNTRS 257
           +A  I ++GVET      +TSLK G+ V    + + A      +I  +TF  A+      
Sbjct: 239 IAPHIKVIGVETYDAATLHTSLKAGKRVPLPNVGTFADGTSVRMIGEETFRVAKDVVDEV 298

Query: 258 VVIEDKDVIETCLKYTHQFNMVIEPA 283
           V++   ++             ++EP+
Sbjct: 299 VLVNTDEICAAVKDIFEDTRSIVEPS 324

>KAFR0K01700 Chr11 (352943..354682) [1740 bp, 579 aa] {ON} Anc_7.367
           YER086W
          Length = 579

 Score = 65.1 bits (157), Expect = 8e-11,   Method: Compositional matrix adjust.
 Identities = 63/250 (25%), Positives = 104/250 (41%), Gaps = 24/250 (9%)

Query: 25  LKYECLQPSGSFKSRGIGNLIMKSAIRIQKDGKRSPQVXXXXXXXXXXXXXXXCQRLSLP 84
           LK E L P  SFK RG  N+I K       D  R+  V                ++L +P
Sbjct: 100 LKREDLLPVFSFKLRGAYNMIAK-----LDDNVRNQGVIACSAGNHAQGVAYAAKKLGIP 154

Query: 85  CTVVVPTATKKRMVDKIRNTGAQVIVSGAYWKEADTFLKTNVMNKIDSQVIEPIYVHPFD 144
            T+V+P +T       +   G+QV++ G  + EA    K       + + +  I   PFD
Sbjct: 155 ATIVMPVSTPSIKYQNVSRLGSQVVLYGNDFDEA----KAECAKLSEERGLTNI--PPFD 208

Query: 145 NPDIWEGHSSMIDEIVQDLKSQHISVNKVKGIVCSVXXXXXXXXXXXXXERYGLADRIPI 204
           +P +  G  ++  EI++ + +     NK+  +   V             +R  +A  I +
Sbjct: 209 HPYVIAGQGTVAMEILRQVHN----ANKINAVFVPVGGGGLIAGVGAYLKR--IAPHIKV 262

Query: 205 VGVETNGCHVFNTSLKIGQPVQFKKITSIATSLGTAVISNQTFEYARK-------YNTRS 257
           +GVET      +TSL+ G+  +  K+ + A      +I  +TF  A++        NT  
Sbjct: 263 IGVETYDATTLHTSLQNGKRTELTKVGTFADGTSVRLIGEETFRVAQEVVDEIVLVNTDE 322

Query: 258 VVIEDKDVIE 267
           +    KDV E
Sbjct: 323 LCAAIKDVFE 332

>Suva_5.199 Chr5 (303073..304803) [1731 bp, 576 aa] {ON} YER086W
           (REAL)
          Length = 576

 Score = 63.9 bits (154), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 65/272 (23%), Positives = 110/272 (40%), Gaps = 25/272 (9%)

Query: 4   VYNKTPLLRQF-FPGKASAQFFLKYECLQPSGSFKSRGIGNLIMKSAIRIQKDGKRSPQV 62
           V N++P+ +      + +    LK E L P  SFK RG  N+I K       D +R+  V
Sbjct: 75  VINESPISQGVGLSSRLNTNVILKREDLLPVFSFKLRGAYNMIAK-----LDDSQRNQGV 129

Query: 63  XXXXXXXXXXXXXXXCQRLSLPCTVVVPTATKKRMVDKIRNTGAQVIVSGAYWKEADTFL 122
                           + L +P T+V+P  T       +   G+QV++ G  + EA    
Sbjct: 130 IACSAGNHAQGVAFAAKHLKIPATIVMPVCTPSIKYQNVSRLGSQVVLFGNDFDEA---- 185

Query: 123 KTNVMNKIDSQVIEPIYVHPFDNPDIWEGHSSMIDEIVQDLKSQHISVNKVKGIVCSVXX 182
           K       + + +  I   PFD+P +  G  ++  EI++ +++    VNK+  +   V  
Sbjct: 186 KAECTKLAEERGLTNI--PPFDHPYVIAGQGTVAMEILRQVRT----VNKIGAVFVPVGG 239

Query: 183 XXXXXXXXXXXERYGLADRIPIVGVETNGCHVFNTSLKIGQPVQFKKITSIATSLGTAVI 242
                      +R  +A  I ++GVET      + SL+  Q      + + A      +I
Sbjct: 240 GGLIAGIGAYLKR--IAPHIKVIGVETYDAATLHNSLQRNQRTPLPAVGTFADGTSVRMI 297

Query: 243 SNQTFEYARK-------YNTRSVVIEDKDVIE 267
             +TF  A++        NT  +    KDV E
Sbjct: 298 GEETFRVAQQVVDEVVLVNTDEICAAVKDVFE 329

>NCAS0A14230 Chr1 (2801647..2803356) [1710 bp, 569 aa] {ON}
           Anc_7.367
          Length = 569

 Score = 63.5 bits (153), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 61/264 (23%), Positives = 106/264 (40%), Gaps = 17/264 (6%)

Query: 25  LKYECLQPSGSFKSRGIGNLIMKSAIRIQKDGKRSPQVXXXXXXXXXXXXXXXCQRLSLP 84
           LK E L P  SFK RG  N+I K       D +R+  V                + L +P
Sbjct: 90  LKREDLLPVFSFKLRGAYNMIAK-----LDDSQRNQGVIACSAGNHAQGVAYAAKHLGIP 144

Query: 85  CTVVVPTATKKRMVDKIRNTGAQVIVSGAYWKEADTFLKTNVMNKIDSQVIEPIYVHPFD 144
            T+V+P +T       +   G+QV++ G  + EA    K       + + +  I   PFD
Sbjct: 145 ATIVMPVSTPSIKYQNVSRLGSQVVLYGNDFDEA----KAECTKLAEERGLTNI--PPFD 198

Query: 145 NPDIWEGHSSMIDEIVQDLKSQHISVNKVKGIVCSVXXXXXXXXXXXXXERYGLADRIPI 204
           +P +  G  ++  EI++ + +     NK+  +   V             +R  +A  I +
Sbjct: 199 HPYVIAGQGTVAMEILRQVHN----ANKIGAVFVPVGGGGFIAGVGAYLKR--IAPHIKV 252

Query: 205 VGVETNGCHVFNTSLKIGQPVQFKKITSIATSLGTAVISNQTFEYARKYNTRSVVIEDKD 264
           +GVET      +TSLK  +      + + A      VI  +TF  A++     V++   +
Sbjct: 253 IGVETFDAATLHTSLKHNKRTPLPTVGTFADGTSVRVIGEETFRVAQQVVDEVVLVNTDE 312

Query: 265 VIETCLKYTHQFNMVIEPACGAAL 288
           +             ++EP+   A+
Sbjct: 313 ICAAVKDIFEDTRSIVEPSGALAV 336

>CAGL0I05126g Chr9 complement(481145..482860) [1716 bp, 571 aa] {ON}
           highly similar to uniprot|P00927 Saccharomyces
           cerevisiae YER086w ILV1 anabolic serine and threonine
           dehydratase precursor
          Length = 571

 Score = 63.2 bits (152), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 61/264 (23%), Positives = 106/264 (40%), Gaps = 17/264 (6%)

Query: 25  LKYECLQPSGSFKSRGIGNLIMKSAIRIQKDGKRSPQVXXXXXXXXXXXXXXXCQRLSLP 84
           LK E L P  SFK RG  N+I K       D +R+  V                + L +P
Sbjct: 92  LKREDLLPVFSFKLRGAYNMIAK-----LDDTQRNQGVIACSAGNHAQGVAYAARHLDIP 146

Query: 85  CTVVVPTATKKRMVDKIRNTGAQVIVSGAYWKEADTFLKTNVMNKIDSQVIEPIYVHPFD 144
            T+V+P +T       +   G+QV++ G  + EA    K       + + +  I   PFD
Sbjct: 147 ATIVMPVSTPSIKYQNVSRLGSQVVLYGNDFDEA----KAECTKLAEERGLTNI--PPFD 200

Query: 145 NPDIWEGHSSMIDEIVQDLKSQHISVNKVKGIVCSVXXXXXXXXXXXXXERYGLADRIPI 204
           +P +  G  ++  EI++    Q  + NK+  +   V             +R  +   I I
Sbjct: 201 HPYVIAGQGTVAMEILR----QVYNSNKIGAVFVPVGGGGLIAGVGAYLKR--VTPHIKI 254

Query: 205 VGVETNGCHVFNTSLKIGQPVQFKKITSIATSLGTAVISNQTFEYARKYNTRSVVIEDKD 264
           +GVET+     +TSL+  +      + + A      +I  +TF  AR+     V++   +
Sbjct: 255 IGVETHDAATLHTSLQRNKRTNLASVGTFADGTSVRIIGEETFRVAREVVDEIVLVNTDE 314

Query: 265 VIETCLKYTHQFNMVIEPACGAAL 288
           +             ++EP+   A+
Sbjct: 315 ICAAVKDVFEDTRSIVEPSGALAV 338

>NDAI0A01810 Chr1 complement(400890..402602) [1713 bp, 570 aa] {ON}
           Anc_7.367
          Length = 570

 Score = 62.0 bits (149), Expect = 8e-10,   Method: Compositional matrix adjust.
 Identities = 64/250 (25%), Positives = 102/250 (40%), Gaps = 24/250 (9%)

Query: 25  LKYECLQPSGSFKSRGIGNLIMKSAIRIQKDGKRSPQVXXXXXXXXXXXXXXXCQRLSLP 84
           LK E L P  SFK RG  N+I K       D +R+  V                + L++P
Sbjct: 91  LKREDLLPVFSFKLRGAYNMIAK-----LDDSQRNQGVIACSAGNHAQGVAFAAKHLNIP 145

Query: 85  CTVVVPTATKKRMVDKIRNTGAQVIVSGAYWKEADTFLKTNVMNKIDSQVIEPIYVHPFD 144
            T+V+P +T       +   G+QV++ G  + EA    K       + + +  I   PFD
Sbjct: 146 ATIVMPVSTPSIKYQNVSRLGSQVVLYGNDFDEA----KAECTKLAEERGLTNI--PPFD 199

Query: 145 NPDIWEGHSSMIDEIVQDLKSQHISVNKVKGIVCSVXXXXXXXXXXXXXERYGLADRIPI 204
           +P +  G  ++  EI++ + +     NK+  +   V             +R  +A  I I
Sbjct: 200 HPYVIAGQGTVAMEILRQVHN----ANKIGAVFVPVGGGGLVAGVGAYLKR--IAPHIKI 253

Query: 205 VGVETNGCHVFNTSLKIGQPVQFKKITSIATSLGTAVISNQTFEYARK-------YNTRS 257
           +GVET+      TSLK G+      +   A      +I  +TF  A++        NT  
Sbjct: 254 IGVETHDAATLQTSLKHGRRTPLSVVGPFADGTSVRLIGEETFRVAQEVVDEVVLVNTDE 313

Query: 258 VVIEDKDVIE 267
           +    KDV E
Sbjct: 314 ICAAVKDVFE 323

>YER086W Chr5 (328477..330207) [1731 bp, 576 aa] {ON}  ILV1Threonine
           deaminase, catalyzes the first step in isoleucine
           biosynthesis; expression is under general amino acid
           control; ILV1 locus exhibits highly positioned
           nucleosomes whose organization is independent of known
           ILV1 regulation
          Length = 576

 Score = 62.0 bits (149), Expect = 8e-10,   Method: Compositional matrix adjust.
 Identities = 62/281 (22%), Positives = 112/281 (39%), Gaps = 18/281 (6%)

Query: 4   VYNKTPLLRQF-FPGKASAQFFLKYECLQPSGSFKSRGIGNLIMKSAIRIQKDGKRSPQV 62
           V N++P+ +      + +    LK E L P  SFK RG  N+I K       D +R+  V
Sbjct: 75  VINESPISQGVGLSSRLNTNVILKREDLLPVFSFKLRGAYNMIAK-----LDDSQRNQGV 129

Query: 63  XXXXXXXXXXXXXXXCQRLSLPCTVVVPTATKKRMVDKIRNTGAQVIVSGAYWKEADTFL 122
                           + L +P T+V+P  T       +   G+QV++ G  + EA    
Sbjct: 130 IACSAGNHAQGVAFAAKHLKIPATIVMPVCTPSIKYQNVSRLGSQVVLYGNDFDEA---- 185

Query: 123 KTNVMNKIDSQVIEPIYVHPFDNPDIWEGHSSMIDEIVQDLKSQHISVNKVKGIVCSVXX 182
           K       + + +  I   PFD+P +  G  ++  EI++ +++     NK+  +   V  
Sbjct: 186 KAECAKLAEERGLTNI--PPFDHPYVIAGQGTVAMEILRQVRT----ANKIGAVFVPVGG 239

Query: 183 XXXXXXXXXXXERYGLADRIPIVGVETNGCHVFNTSLKIGQPVQFKKITSIATSLGTAVI 242
                      +R  +A  I I+GVET      + SL+  Q      + + A      +I
Sbjct: 240 GGLIAGIGAYLKR--VAPHIKIIGVETYDAATLHNSLQRNQRTPLPVVGTFADGTSVRMI 297

Query: 243 SNQTFEYARKYNTRSVVIEDKDVIETCLKYTHQFNMVIEPA 283
             +TF  A++     V++   ++             ++EP+
Sbjct: 298 GEETFRVAQQVVDEVVLVNTDEICAAVKDIFEDTRSIVEPS 338

>Skud_5.205 Chr5 (322688..324418) [1731 bp, 576 aa] {ON} YER086W
           (REAL)
          Length = 576

 Score = 62.0 bits (149), Expect = 9e-10,   Method: Compositional matrix adjust.
 Identities = 62/250 (24%), Positives = 100/250 (40%), Gaps = 24/250 (9%)

Query: 25  LKYECLQPSGSFKSRGIGNLIMKSAIRIQKDGKRSPQVXXXXXXXXXXXXXXXCQRLSLP 84
           LK E L P  SFK RG  N+I K       D +R+  V                + L +P
Sbjct: 97  LKREDLLPVFSFKLRGAYNMIAK-----LDDSQRNQGVIACSAGNHAQGVAFAAKHLKIP 151

Query: 85  CTVVVPTATKKRMVDKIRNTGAQVIVSGAYWKEADTFLKTNVMNKIDSQVIEPIYVHPFD 144
            T+V+P  T       +   G+QV++ G  + EA    K       + + +  I   PFD
Sbjct: 152 ATIVMPVCTPSIKYQNVSRLGSQVVLYGNDFDEA----KAECAKLAEERGLTNI--PPFD 205

Query: 145 NPDIWEGHSSMIDEIVQDLKSQHISVNKVKGIVCSVXXXXXXXXXXXXXERYGLADRIPI 204
           +P +  G  ++  EI++ +++     NK+  +   V             +R  +A  I +
Sbjct: 206 HPYVIAGQGTVAMEILRQVRT----ANKIGAVFVPVGGGGLIAGIGAYLKR--VAPHIKV 259

Query: 205 VGVETNGCHVFNTSLKIGQPVQFKKITSIATSLGTAVISNQTFEYARK-------YNTRS 257
           +GVET      + SL+  Q      + S A      +I  +TF  A++        NT  
Sbjct: 260 IGVETFDAPTLHNSLQRNQRTPLPVVGSFADGTSVRMIGEETFRVAQQVVDEVVLVNTDE 319

Query: 258 VVIEDKDVIE 267
           +    KDV E
Sbjct: 320 ICAAVKDVFE 329

>ZYRO0B02772g Chr2 (224426..226135) [1710 bp, 569 aa] {ON} highly
           similar to uniprot|P00927 Saccharomyces cerevisiae
           YER086W ILV1 Threonine deaminase catalyzes the first
           step in isoleucine biosynthesis expression is under
           general amino acid control ILV1 locus exhibits highly
           positioned nucleosomes whose organization is independent
           of known ILV1 regulation
          Length = 569

 Score = 61.2 bits (147), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 61/259 (23%), Positives = 107/259 (41%), Gaps = 17/259 (6%)

Query: 25  LKYECLQPSGSFKSRGIGNLIMKSAIRIQKDGKRSPQVXXXXXXXXXXXXXXXCQRLSLP 84
           LK E L P  SFK RG  N+I K       + +++  V                + +++P
Sbjct: 90  LKREDLLPVFSFKLRGAYNMIAK-----LDENQKNQGVIACSAGNHAQGVAYAARHMNIP 144

Query: 85  CTVVVPTATKKRMVDKIRNTGAQVIVSGAYWKEADTFLKTNVMNKIDSQVIEPIYVHPFD 144
            T+V+P +T       +   G+QV++ G  + EA    K       + + +  I   PFD
Sbjct: 145 ATIVMPVSTPSIKYQNVSRLGSQVVLYGNDFDEA----KAECAKLAEERGLTNI--PPFD 198

Query: 145 NPDIWEGHSSMIDEIVQDLKSQHISVNKVKGIVCSVXXXXXXXXXXXXXERYGLADRIPI 204
           +P +  G  ++  EI   L+  H S+ K+  +   V             +R  +A  I I
Sbjct: 199 HPYVIAGQGTVAMEI---LRQVHNSL-KIGAVFVPVGGGGLIAGIGAYLKR--IAPHIKI 252

Query: 205 VGVETNGCHVFNTSLKIGQPVQFKKITSIATSLGTAVISNQTFEYARKYNTRSVVIEDKD 264
           VGVET+     + S+K G+    K + S A      +I  +TF  +++     V++   +
Sbjct: 253 VGVETHDAPTLSASMKTGKRELLKTVGSFADGTSVRIIGEETFRVSQEVVDEIVLVNTDE 312

Query: 265 VIETCLKYTHQFNMVIEPA 283
           +             +IEP+
Sbjct: 313 ICAAVKDIFEDTRSIIEPS 331

>Smik_5.225 Chr5 (337064..338794) [1731 bp, 576 aa] {ON} YER086W
           (REAL)
          Length = 576

 Score = 61.2 bits (147), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 61/281 (21%), Positives = 112/281 (39%), Gaps = 18/281 (6%)

Query: 4   VYNKTPLLRQF-FPGKASAQFFLKYECLQPSGSFKSRGIGNLIMKSAIRIQKDGKRSPQV 62
           V N++P+ +      + +    LK E L P  SFK RG  N+I K       D +R+  V
Sbjct: 75  VINESPISQGVGLSSRLNTNVILKREDLLPVFSFKLRGAYNMIAK-----LDDSQRNQGV 129

Query: 63  XXXXXXXXXXXXXXXCQRLSLPCTVVVPTATKKRMVDKIRNTGAQVIVSGAYWKEADTFL 122
                           + L +P T+V+P  T       +   G+QV++ G  + EA    
Sbjct: 130 IACSAGNHAQGVAFAAKHLKIPATIVMPVCTPSIKYQNVSRLGSQVVLYGNDFDEA---- 185

Query: 123 KTNVMNKIDSQVIEPIYVHPFDNPDIWEGHSSMIDEIVQDLKSQHISVNKVKGIVCSVXX 182
           K       + + +  I   PFD+P +  G  ++  EI++ +++     NK+  +   V  
Sbjct: 186 KAECAKLAEERGLTNI--PPFDHPYVIAGQGTVAMEILRQVRT----ANKIGAVFVPVGG 239

Query: 183 XXXXXXXXXXXERYGLADRIPIVGVETNGCHVFNTSLKIGQPVQFKKITSIATSLGTAVI 242
                      +R  +A  I ++GVET      + SL+  Q      + + A      +I
Sbjct: 240 GGLIAGIGAYLKR--VAPHIKVIGVETYDAATLHNSLQRNQRTPLPVVGTFADGTSVRMI 297

Query: 243 SNQTFEYARKYNTRSVVIEDKDVIETCLKYTHQFNMVIEPA 283
             +TF  A++     V++   ++             ++EP+
Sbjct: 298 GEETFRVAQQVVDEVVLVNTDEICAAVKDIFEDTRSIVEPS 338

>TPHA0F03130 Chr6 complement(685292..686998) [1707 bp, 568 aa] {ON}
           Anc_7.367 YER086W
          Length = 568

 Score = 60.8 bits (146), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 60/264 (22%), Positives = 108/264 (40%), Gaps = 17/264 (6%)

Query: 25  LKYECLQPSGSFKSRGIGNLIMKSAIRIQKDGKRSPQVXXXXXXXXXXXXXXXCQRLSLP 84
           LK + L P  SFK RG  N++ K       D +++  V                + L +P
Sbjct: 89  LKRDDLLPVFSFKLRGAYNMMAK-----LDDTQKNQGVIACSAGNHAQGVAYAAKHLKIP 143

Query: 85  CTVVVPTATKKRMVDKIRNTGAQVIVSGAYWKEADTFLKTNVMNKIDSQVIEPIYVHPFD 144
            T+V+P +T       +   G+QV++ G  + EA    K       + + +  I   PFD
Sbjct: 144 ATIVMPVSTPSIKYQNVSRLGSQVVLYGNDFDEA----KAECARLAEERGLTNI--PPFD 197

Query: 145 NPDIWEGHSSMIDEIVQDLKSQHISVNKVKGIVCSVXXXXXXXXXXXXXERYGLADRIPI 204
           +P +  G  ++  EI   L+  H+S +K+  +   V             +R  +A  I I
Sbjct: 198 HPYVIAGQGTVAMEI---LRQVHMS-SKIGAVFVPVGGGGLIAGVGTYLKR--IAPHIKI 251

Query: 205 VGVETNGCHVFNTSLKIGQPVQFKKITSIATSLGTAVISNQTFEYARKYNTRSVVIEDKD 264
           +GVET       TSL+ G+    + + S A      ++  +TF  A++     V++   +
Sbjct: 252 IGVETYDACALYTSLQSGKRAALESVGSFADGTAVRLLGEETFRVAQEVVDEVVLVNTDE 311

Query: 265 VIETCLKYTHQFNMVIEPACGAAL 288
           +             ++EP+   A+
Sbjct: 312 ICAGIKDIFEDTRSIVEPSGALAV 335

>Ecym_4708 Chr4 (1386138..1387850) [1713 bp, 570 aa] {ON} similar to
           Ashbya gossypii ACR232C
          Length = 570

 Score = 60.5 bits (145), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 60/286 (20%), Positives = 114/286 (39%), Gaps = 18/286 (6%)

Query: 4   VYNKTPLLR-QFFPGKASAQFFLKYECLQPSGSFKSRGIGNLIMKSAIRIQKDGKRSPQV 62
           + N++P+ R +F   + +    LK E L P  SFK RG  N+I         D ++   V
Sbjct: 69  IINESPISRSEFLSSRLNTDVQLKREDLLPVFSFKLRGAYNMISH-----LDDVQKKCGV 123

Query: 63  XXXXXXXXXXXXXXXCQRLSLPCTVVVPTATKKRMVDKIRNTGAQVIVSGAYWKEADTFL 122
                           + L +P T+V+P +T       +   GA+V++ G      D F 
Sbjct: 124 IACSAGNHAQGVAYSAKHLGIPATIVMPVSTPSIKYQNVSRLGAEVVLYG------DNFD 177

Query: 123 KTNVMNKIDSQVIEPIYVHPFDNPDIWEGHSSMIDEIVQDLKSQHISVNKVKGIVCSVXX 182
              V     S+      + PFD+P +  G  ++  EI++ +++     +K+  + C+V  
Sbjct: 178 AAKVECSRLSEEKGLYDIPPFDHPYVIAGQGTIAMEILKQIQNS----SKIGAVFCAVGG 233

Query: 183 XXXXXXXXXXXERYGLADRIPIVGVETNGCHVFNTSLKIGQPVQFKKITSIATSLGTAVI 242
                      +R   A  I ++GVET      +TS++        ++   A      +I
Sbjct: 234 GGLIAGVGAYIKR--AAPHIKVIGVETYDAATLHTSMQNNARTTLSQVGGFADGTSVRLI 291

Query: 243 SNQTFEYARKYNTRSVVIEDKDVIETCLKYTHQFNMVIEPACGAAL 288
             ++F  AR+     +++   ++             V+EP+   A+
Sbjct: 292 GEESFRVAREVVDEVILVNTDEICAAIKDIFEDTRAVVEPSGALAV 337

>Kpol_530.16 s530 complement(41170..42870) [1701 bp, 566 aa] {ON}
           complement(41170..42870) [1701 nt, 567 aa]
          Length = 566

 Score = 60.5 bits (145), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 61/250 (24%), Positives = 102/250 (40%), Gaps = 24/250 (9%)

Query: 25  LKYECLQPSGSFKSRGIGNLIMKSAIRIQKDGKRSPQVXXXXXXXXXXXXXXXCQRLSLP 84
           LK E L P  SFK RG  N++ K       D +++  V                + L++P
Sbjct: 87  LKREDLLPVFSFKLRGAYNMMAK-----LDDSQKNQGVIACSAGNHAQGIAYAAKHLNIP 141

Query: 85  CTVVVPTATKKRMVDKIRNTGAQVIVSGAYWKEADTFLKTNVMNKIDSQVIEPIYVHPFD 144
            T+V+P +T       +   G+QV++ G  + EA    K       + + +  I   PFD
Sbjct: 142 ATIVMPVSTPSIKYQNVSRLGSQVVLYGNDFDEA----KAECARLAEERGLTNI--PPFD 195

Query: 145 NPDIWEGHSSMIDEIVQDLKSQHISVNKVKGIVCSVXXXXXXXXXXXXXERYGLADRIPI 204
           +P +  G  ++  EI++ +       NK+  +   V             +R  +A  I I
Sbjct: 196 HPYVIAGQGTVAMEILRQVHK----ANKIGAVFVPVGGGGLIAGVGAYLKR--IAPHIKI 249

Query: 205 VGVETNGCHVFNTSLKIGQPVQFKKITSIATSLGTAVISNQTFEYARK-------YNTRS 257
           +GVET   +   TSL+ G+ V    + + A      +I  +TF   ++        NT  
Sbjct: 250 IGVETFDANCLYTSLQSGKRVPLSSVGTFADGTAVRLIGEETFRVCQEVVDEVVLVNTDE 309

Query: 258 VVIEDKDVIE 267
           +    KDV E
Sbjct: 310 ICAAVKDVFE 319

>TDEL0C01800 Chr3 complement(313699..315408) [1710 bp, 569 aa] {ON}
           Anc_7.367 YER086W
          Length = 569

 Score = 59.7 bits (143), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 59/264 (22%), Positives = 106/264 (40%), Gaps = 17/264 (6%)

Query: 25  LKYECLQPSGSFKSRGIGNLIMKSAIRIQKDGKRSPQVXXXXXXXXXXXXXXXCQRLSLP 84
           LK E L P  SFK RG  N+I K       D +++  V                + +S+P
Sbjct: 90  LKREDLLPVFSFKLRGAYNMIAK-----LDDSQKNQGVIACSAGNHAQGVAFAAKHMSIP 144

Query: 85  CTVVVPTATKKRMVDKIRNTGAQVIVSGAYWKEADTFLKTNVMNKIDSQVIEPIYVHPFD 144
            T+V+P +T       +   G+QV++ G  + EA    K       + + +  I   PFD
Sbjct: 145 ATIVMPVSTPSIKYQNVSRLGSQVVLYGNDFDEA----KAECTRLSEERGLTNI--PPFD 198

Query: 145 NPDIWEGHSSMIDEIVQDLKSQHISVNKVKGIVCSVXXXXXXXXXXXXXERYGLADRIPI 204
           +P +  G  ++  EI++ +++      K+  +                 +R  +A  I I
Sbjct: 199 HPYVIAGQGTVAMEILRQVRNS----AKIGAVFVPCGGGGLVAGIGAYLKR--IAPHIKI 252

Query: 205 VGVETNGCHVFNTSLKIGQPVQFKKITSIATSLGTAVISNQTFEYARKYNTRSVVIEDKD 264
           +GVET      +TSLK G+      + + A      +I  +TF  A+      V++   +
Sbjct: 253 IGVETFDSATLHTSLKNGKRTPLASVGTFADGTSVRMIGEETFRIAQDVVDEVVLVGTDE 312

Query: 265 VIETCLKYTHQFNMVIEPACGAAL 288
           +             ++EP+   A+
Sbjct: 313 ICAAIKDIFEDTRGIVEPSGALAV 336

>KLLA0E19779g Chr5 complement(1760800..1762503) [1704 bp, 567 aa]
           {ON} highly similar to uniprot|P00927 Saccharomyces
           cerevisiae YER086W ILV1 Threonine deaminase catalyzes
           the first step in isoleucine biosynthesis expression is
           under general amino acid control ILV1 locus exhibits
           highly positioned nucleosomes whose organization is
           independent of known ILV1 regulation
          Length = 567

 Score = 59.7 bits (143), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 59/286 (20%), Positives = 114/286 (39%), Gaps = 18/286 (6%)

Query: 4   VYNKTPLLRQF-FPGKASAQFFLKYECLQPSGSFKSRGIGNLIMKSAIRIQKDGKRSPQV 62
           V  +TP+ R      + +    LK E L P  SFK RG  N+I K       + +++  V
Sbjct: 66  VIEETPISRAVSLSSRLNTNVKLKREDLLPVFSFKLRGAYNMIAK-----LDETQKNAGV 120

Query: 63  XXXXXXXXXXXXXXXCQRLSLPCTVVVPTATKKRMVDKIRNTGAQVIVSGAYWKEADTFL 122
                             +++P T+V+P +T       +   GAQV++ G  + EA    
Sbjct: 121 IACSAGNHAQGVAFSSNHMNIPATIVMPVSTPSIKYQNVSRLGAQVVLYGDDFDEA---- 176

Query: 123 KTNVMNKIDSQVIEPIYVHPFDNPDIWEGHSSMIDEIVQDLKSQHISVNKVKGIVCSVXX 182
           K       + + +  I   PFD+P +  G  ++  EI++ +++     + +  + C+V  
Sbjct: 177 KLECARLAEERGMTDI--PPFDHPYVIAGQGTIAMEILRQVQNG----SNIGAVFCAVGG 230

Query: 183 XXXXXXXXXXXERYGLADRIPIVGVETNGCHVFNTSLKIGQPVQFKKITSIATSLGTAVI 242
                      +R  +A  I ++GVET      + SLK G+      + + A      +I
Sbjct: 231 GGLISGIGSYLKR--IAPHIKVIGVETYDAATLDVSLKNGKRTPLPSVGTFADGTSVRLI 288

Query: 243 SNQTFEYARKYNTRSVVIEDKDVIETCLKYTHQFNMVIEPACGAAL 288
             +TF   +      +++   ++             ++EP+   A+
Sbjct: 289 GEETFRVCQDVVDEVILVNTDEICAAVKDVFEDTRSIVEPSGALAV 334

>SAKL0A10626g Chr1 complement(932879..933841) [963 bp, 320 aa] {ON}
           similar to uniprot|P36007 Saccharomyces cerevisiae
           YKL218C SRY1 3-hydroxyaspartate dehydratase deaminates
           L- threo-3-hydroxyaspartate to form oxaloacetate and
           ammonia required for survival in the presence of
           hydroxyaspartate
          Length = 320

 Score = 58.9 bits (141), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 67/314 (21%), Positives = 122/314 (38%), Gaps = 30/314 (9%)

Query: 6   NKTPLL-RQFFPGKASAQFFLKYECLQPSGSFKSRGIGNLIMKSAIRIQKDGKRSPQVXX 64
           NKTP+L  +    +  A+ + K E  Q  G+FK RG  N ++K         +R+  V  
Sbjct: 21  NKTPVLTSRTVNAELGAEVYFKCENFQRIGAFKFRGAMNTLLK-----LTQEQRAAGVVA 75

Query: 65  XXXXXXXXXXXXXCQRLSLPCTVVVPTATKKRMVDKIRNTGAQVIVSGAYWKEADTFLKT 124
                         + L +P T+V+P       V      GA ++    Y ++ +   + 
Sbjct: 76  FSSGNHAQAIALSAKLLGVPATIVMPNDAPAAKVRATAGYGANIVRYDRYTEDREQIGRA 135

Query: 125 NVMNKIDSQVIEPIYVHPFDNPDIWEGHSSMIDEIVQDLKSQHISVNKVKGIVCSVXXXX 184
               K  +       V P+D+PD+  G  +   E++++       V ++  +   +    
Sbjct: 136 LAEEKGLT------LVPPYDHPDVIAGQGTAAKELIEE-------VGELDLLFVPLGGGG 182

Query: 185 XXXXXXXXXERYGLADRIPIVGVETNGCHVFNTSLKIGQPVQFKKITSIATSLGTAVISN 244
                    +R  L+ R  I+GVE    +    SL+ G  V      +IA    T  +  
Sbjct: 183 LLSGSALAAKR--LSPRCEIIGVEPEAGNDGQQSLRSGSIVHIDTPETIADGAQTQHLGQ 240

Query: 245 QTFEYARKYNTRSVVIEDKDVIETCLKYTHQFNMVIEP-ACGAALHLGYNTKILENALGS 303
            TFE         +   D +++++   +  +  +V+EP  C     LG+     + A   
Sbjct: 241 YTFEVIHANVADILTASDAELVDSMRFFAERMKIVVEPTGC-----LGFAAARAQKA--- 292

Query: 304 KLAADDIVIIIACG 317
           KLA   + II++ G
Sbjct: 293 KLAGKRVGIIVSGG 306

>ACR232C Chr3 complement(767330..769012) [1683 bp, 560 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YER086W
           (ILV1)
          Length = 560

 Score = 58.2 bits (139), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 55/260 (21%), Positives = 105/260 (40%), Gaps = 19/260 (7%)

Query: 25  LKYECLQPSGSFKSRGIGNLIMKSAIRIQKDGKRSPQVXXXXXXXXXXXXXXXCQRLSLP 84
           LK E L P  SFK RG  N+I         + ++S  V                + L + 
Sbjct: 82  LKREDLLPVFSFKLRGAYNMISN-----LDEYQKSAGVIACSAGNHAQGVAFSARELGIR 136

Query: 85  CTVVVPTATKKRMVDKIRNTGAQVIVSGAYWKEADT-FLKTNVMNKIDSQVIEPIYVHPF 143
             +V+PT+T     + +   GA+V++ G  + EA     +   ++K+         + PF
Sbjct: 137 AMIVMPTSTPSIKYNSVAAMGAEVVLYGKDFDEAKAECARLAQLHKLTD-------IPPF 189

Query: 144 DNPDIWEGHSSMIDEIVQDLKSQHISVNKVKGIVCSVXXXXXXXXXXXXXERYGLADRIP 203
           D+P +  G  ++  EI++ + +     +++  + C V             +R  +A  I 
Sbjct: 190 DHPYVIAGQGTIATEILRQVHN----ASQIGAVFCGVGGGGLIAGIGSYLKR--IAPHIK 243

Query: 204 IVGVETNGCHVFNTSLKIGQPVQFKKITSIATSLGTAVISNQTFEYARKYNTRSVVIEDK 263
           I+GVET+     +T+LK G+      +   A      ++  +TF  AR      V++   
Sbjct: 244 IIGVETHDAPTLHTALKQGRRTMLPAVGCFADGTSVRMMGEETFRVARDVVDEVVLVNTD 303

Query: 264 DVIETCLKYTHQFNMVIEPA 283
           ++             ++EP+
Sbjct: 304 ELCAAIKDIFEDTRAIVEPS 323

>KNAG0C03690 Chr3 complement(722238..723971) [1734 bp, 577 aa] {ON}
           Anc_7.367 YER086W
          Length = 577

 Score = 57.8 bits (138), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 61/264 (23%), Positives = 106/264 (40%), Gaps = 17/264 (6%)

Query: 25  LKYECLQPSGSFKSRGIGNLIMKSAIRIQKDGKRSPQVXXXXXXXXXXXXXXXCQRLSLP 84
           LK E L P  SFK RG  N++ K       D +++  V                + L +P
Sbjct: 98  LKREDLLPVFSFKLRGAYNMMAK-----LDDTQKNQGVIACSAGNHAQGVAFAAKHLDIP 152

Query: 85  CTVVVPTATKKRMVDKIRNTGAQVIVSGAYWKEADTFLKTNVMNKIDSQVIEPIYVHPFD 144
            T+V+P +T       +   G+QV++ G  + EA    +   ++K       P    PFD
Sbjct: 153 ATIVMPVSTPSIKYQNVSRLGSQVVLYGNDFDEAKA--ECTKLSKERGLTNIP----PFD 206

Query: 145 NPDIWEGHSSMIDEIVQDLKSQHISVNKVKGIVCSVXXXXXXXXXXXXXERYGLADRIPI 204
           +P +  G  ++  EI   L+  HI+ NK+  +   V             +R  +A  I I
Sbjct: 207 HPYVIAGQGTVAMEI---LRQVHIA-NKIGAVFVPVGGGGLVAGVGAYLKR--IAPHIKI 260

Query: 205 VGVETNGCHVFNTSLKIGQPVQFKKITSIATSLGTAVISNQTFEYARKYNTRSVVIEDKD 264
           +GVET       TSL+ G+      + + A      +I  +TF  ++      V++   +
Sbjct: 261 IGVETFDASTLYTSLQRGRRTSLPSVGTFADGTSVKLIGEETFRISQDVVDEVVLVNTDE 320

Query: 265 VIETCLKYTHQFNMVIEPACGAAL 288
           +             ++EP+   A+
Sbjct: 321 ICAAVKDIFEDTRSIVEPSGALAV 344

>YKL218C Chr11 complement(17359..18339) [981 bp, 326 aa] {ON}
           SRY13-hydroxyaspartate dehydratase, deaminates
           L-threo-3-hydroxyaspartate to form oxaloacetate and
           ammonia; required in the presence of hydroxyaspartate;
           highly similar to mouse serine racemase (Srr) but has no
           serine racemase activity
          Length = 326

 Score = 56.6 bits (135), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 69/317 (21%), Positives = 122/317 (38%), Gaps = 36/317 (11%)

Query: 6   NKTPLL-RQFFPGKASAQFFLKYECLQPSGSFKSRGIGNLIMKSAIRIQKDGKRSPQVXX 64
           NKTP+L  +    +  AQ + K E  Q  G+FK RG  N + K +     D KRS  V  
Sbjct: 21  NKTPVLTSRMLNDRLGAQIYFKGENFQRVGAFKFRGAMNAVSKLS-----DEKRSKGVIA 75

Query: 65  XXXXXXXXXXXXXCQRLSLPCTVVVPTATKKRMVDKIRNTGAQVIVSGAYWKEADTFLKT 124
                         + L++P T+V+P       V      GA +I    Y ++ +     
Sbjct: 76  FSSGNHAQAIALSAKLLNVPATIVMPEDAPALKVAATAGYGAHIIRYNRYTEDRE----- 130

Query: 125 NVMNKIDSQVIEP---IYVHPFDNPDIWEGHSSMIDEIVQDLKSQHISVNKVKGIVCSVX 181
               +I  Q+        + P+D+PD+  G  +   E++++       V ++  +   V 
Sbjct: 131 ----QIGRQLAAEHGFALIPPYDHPDVIAGQGTSAKELLEE-------VGQLDALF--VP 177

Query: 182 XXXXXXXXXXXXERYGLADRIPIVGVETNGCHVFNTSLKIGQPVQFKKITSIATSLGTAV 241
                           L+    I GVE    +    S + G  V      +IA    T  
Sbjct: 178 LGGGGLLSGSALAARSLSPGCKIFGVEPEAGNDGQQSFRSGSIVHINTPKTIADGAQTQH 237

Query: 242 ISNQTFEYARKYNTRSVVIEDKDVIETCLKYTHQFNMVIEP-ACGAALHLGYNTKILENA 300
           +   TF   R+     + + D+++++       +  +V+EP AC     LG+   +L+  
Sbjct: 238 LGEYTFAIIRENVDDILTVSDQELVKCMHFLAERMKVVVEPTAC-----LGFAGALLKK- 291

Query: 301 LGSKLAADDIVIIIACG 317
              +L    + II++ G
Sbjct: 292 --EELVGKKVGIILSGG 306

>TBLA0C05070 Chr3 (1230732..1232459) [1728 bp, 575 aa] {ON}
           Anc_7.367 YER086W
          Length = 575

 Score = 57.0 bits (136), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 60/281 (21%), Positives = 114/281 (40%), Gaps = 18/281 (6%)

Query: 4   VYNKTPLLRQF-FPGKASAQFFLKYECLQPSGSFKSRGIGNLIMKSAIRIQKDGKRSPQV 62
           V N++P+ +      K ++Q  LK E L P  SFK RG  N++ K       + +R   V
Sbjct: 69  VINESPMTKGIGLSSKLNSQIQLKREDLLPVFSFKMRGAYNMVAK-----LDETQRKQGV 123

Query: 63  XXXXXXXXXXXXXXXCQRLSLPCTVVVPTATKKRMVDKIRNTGAQVIVSGAYWKEADTFL 122
                           + L +P T+V+P +T     + +   G+QV++ G  +  +    
Sbjct: 124 IACSAGNHAQGVAYAAKHLGIPATIVMPVSTPSIKYENVSRLGSQVVLYGNDFDSS---- 179

Query: 123 KTNVMNKIDSQVIEPIYVHPFDNPDIWEGHSSMIDEIVQDLKSQHISVNKVKGIVCSVXX 182
           K       + + +  + + PFD+P +  G  ++  EI++ +K+      K+  +   V  
Sbjct: 180 KGECERLCEERGL--VNIPPFDHPYVIAGQGTVAMEILRQVKNS----AKIGAVFVPVGG 233

Query: 183 XXXXXXXXXXXERYGLADRIPIVGVETNGCHVFNTSLKIGQPVQFKKITSIATSLGTAVI 242
                      +R  +A  I IVGVET       TSL  G+  +   + + A      +I
Sbjct: 234 GGLVAGIGAYLKR--IAPHIKIVGVETYDAATLKTSLDNGKRTELNTVGTFADGTAVKMI 291

Query: 243 SNQTFEYARKYNTRSVVIEDKDVIETCLKYTHQFNMVIEPA 283
             +TF  ++      V++   ++             ++EP+
Sbjct: 292 GEETFRVSKDVVDEIVLVNTDELCAAVKDIFEDTRSIVEPS 332

>Kwal_33.14822 s33 complement(830029..831717) [1689 bp, 562 aa] {ON}
           YER086W (ILV1) - threonine deaminase [contig 101] FULL
          Length = 562

 Score = 51.6 bits (122), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 59/268 (22%), Positives = 101/268 (37%), Gaps = 25/268 (9%)

Query: 25  LKYECLQPSGSFKSRGIGNLIMKSAIRIQKDGKRSPQVXXXXXXXXXXXXXXXCQRLSLP 84
           LK E L P  SFK RG  N++ K A     +G+ +  V                + L++P
Sbjct: 83  LKREDLLPVFSFKLRGAYNMMAKLA-----EGQGNKGVIACSAGNHAQGVAFASRHLNIP 137

Query: 85  CTVVVPTATKKRMVDKIRNTGAQVIVSGAYWKEADTFLKTNVMNKIDSQVIEP----IYV 140
             +V+P  T       +   G QV++ G  + EA          KI+   I        +
Sbjct: 138 AIIVMPVNTPSIKYQNVSRLGGQVVLYGNDFDEA----------KIECARISEERGLTNI 187

Query: 141 HPFDNPDIWEGHSSMIDEIVQDLKSQHISVNKVKGIVCSVXXXXXXXXXXXXXERYGLAD 200
            PFD+P +  G  ++  EI++ + +     +K+  +   V             +R  +A 
Sbjct: 188 PPFDHPYVIAGQGTVAMEILRQVHN----ASKIGAVFVPVGGGGLVAGVAAYLKR--IAP 241

Query: 201 RIPIVGVETNGCHVFNTSLKIGQPVQFKKITSIATSLGTAVISNQTFEYARKYNTRSVVI 260
            I IVGVET       TSL  G       + + A      +I  +TF     +    V++
Sbjct: 242 HIKIVGVETYDSATLKTSLDAGCRTPLTSVGTFADGTSVRMIGEETFRICEDFVDEVVLV 301

Query: 261 EDKDVIETCLKYTHQFNMVIEPACGAAL 288
              ++             ++EP+   A+
Sbjct: 302 NTDEICAAVKDIFEDTRSIVEPSGALAV 329

>Skud_11.2 Chr11 complement(1812..2792) [981 bp, 326 aa] {ON}
           YKL218C (REAL)
          Length = 326

 Score = 50.4 bits (119), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 64/314 (20%), Positives = 120/314 (38%), Gaps = 30/314 (9%)

Query: 6   NKTPLL-RQFFPGKASAQFFLKYECLQPSGSFKSRGIGNLIMKSAIRIQKDGKRSPQVXX 64
           NKTP+L  +    +  A+ + K E  Q  G+FK RG  N + K +     D +R   V  
Sbjct: 21  NKTPVLTSRTLNDRLEAEVYFKGENYQRVGAFKFRGAMNAVSKLS-----DKERKKGVIA 75

Query: 65  XXXXXXXXXXXXXCQRLSLPCTVVVPTATKKRMVDKIRNTGAQVIVSGAYWKEADTFLKT 124
                         +  ++P T+++P       V      GA +I    Y ++ +   + 
Sbjct: 76  FSSGNHAQAIALSAKLFNVPATIIMPEDAPALKVAATAGYGAHIIKYNRYTEDREHIGRQ 135

Query: 125 NVMNKIDSQVIEPIYVHPFDNPDIWEGHSSMIDEIVQDLKSQHISVNKVKGIVCSVXXXX 184
             +      V+ P    P+D+PD+  G  +   E+ ++       V ++  +   V    
Sbjct: 136 --LAAKHGYVLIP----PYDHPDVIAGQGTSAKELFEE-------VGELDALF--VPLGG 180

Query: 185 XXXXXXXXXERYGLADRIPIVGVETNGCHVFNTSLKIGQPVQFKKITSIATSLGTAVISN 244
                        L+    + GVE    +    S K G  V     ++IA    T  +  
Sbjct: 181 GGLLSGSALAARSLSPGCKVFGVEPEAGNDGQQSFKSGSIVHIDTPSTIADGAQTQHLGE 240

Query: 245 QTFEYARKYNTRSVVIEDKDVIETCLKYTHQFNMVIEP-ACGAALHLGYNTKILENALGS 303
            T+   R+     + + D++++E       +  +V+EP AC     LG+   +L+     
Sbjct: 241 YTYAVIRENVDDILTVSDEELVECMHFLAERMKLVVEPTAC-----LGFAGALLKK---R 292

Query: 304 KLAADDIVIIIACG 317
           +L    + II++ G
Sbjct: 293 ELVGKKVGIILSGG 306

>KLTH0B04884g Chr2 (400193..401914) [1722 bp, 573 aa] {ON} highly
           similar to uniprot|P00927 Saccharomyces cerevisiae
           YER086W ILV1 Threonine deaminase catalyzes the first
           step in isoleucine biosynthesis expression is under
           general amino acid control ILV1 locus exhibits highly
           positioned nucleosomes whose organization is independent
           of known ILV1 regulation
          Length = 573

 Score = 48.5 bits (114), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 60/271 (22%), Positives = 104/271 (38%), Gaps = 31/271 (11%)

Query: 25  LKYECLQPSGSFKSRGIGNLIMKSAIRIQKDGKRSPQVXXXXXXXXXXXXXXXCQRLSLP 84
           LK E L P  SFK RG  N++ K +     + +++  V                + L++P
Sbjct: 94  LKREDLLPVFSFKLRGAYNMMAKLS-----EAQKNQGVIACSAGNHAQGVAFASRHLNIP 148

Query: 85  CTVVVPTATKKRMVDKIRNTGAQVIVSGAYWKEADTFLKTNVMNKIDSQVIEPIYVHPFD 144
             +V+P  T       +   G QV++ G  + EA    KT      + + +  I   PFD
Sbjct: 149 AIIVMPVNTPSIKYQNVSRLGGQVVLYGNDFDEA----KTECTRISEERGLTNI--PPFD 202

Query: 145 NPDIWEGHSSMIDEIVQDLKSQHISVNKVKGIVCSVXXXXXXXXXXXXXERYGLADRIPI 204
           +P +  G  ++  EI++ + +      K+  +   V             +R  +A  I I
Sbjct: 203 HPYVIAGQGTVAMEILRQVHN----AAKIGAVFVPVGGGGLVAGVAAYLKR--IAPHIKI 256

Query: 205 VGVETNGCHVFNTSLKIGQPVQFKKITSIATSLGTAVISNQTFEYARKY-------NTRS 257
           +GVET       TSL+ G       + + A      +I  +TF   +         NT  
Sbjct: 257 IGVETYDSATLKTSLEAGTRTPLSTVGTFADGTSVRMIGEETFRICQDLVDDVILVNTDE 316

Query: 258 VVIEDKDVIETCLKYTHQFNMVIEPACGAAL 288
           +    KD+ E           ++EP+   A+
Sbjct: 317 ICAAVKDIFEDT-------RSIVEPSGALAV 340

>KLLA0A11814g Chr1 (1021526..1022434) [909 bp, 302 aa] {ON} highly
           similar to uniprot|P20459 Saccharomyces cerevisiae
           YJR007W SUI2 Alpha subunit of the translation initiation
           factor eIF2 involved in the identification of the start
           codon phosphorylation of Ser51 is required for
           regulation of translation by inhibiting the exchange of
           GDP for GTP
          Length = 302

 Score = 32.7 bits (73), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 14/35 (40%), Positives = 21/35 (60%), Gaps = 7/35 (20%)

Query: 139 YVHPFD-------NPDIWEGHSSMIDEIVQDLKSQ 166
           Y H +D       +P++W+G  S+ DEI Q+LK Q
Sbjct: 138 YGHAYDAYKMSIVDPNVWDGIESISDEIFQELKGQ 172

>NCAS0I01120 Chr9 complement(205511..205990) [480 bp, 159 aa] {ON}
           Anc_3.357 YPR067W
          Length = 159

 Score = 29.6 bits (65), Expect = 8.4,   Method: Compositional matrix adjust.
 Identities = 21/86 (24%), Positives = 42/86 (48%), Gaps = 3/86 (3%)

Query: 194 ERYGLADRIPIVGVETNGCHVFNTSLKIGQPVQFKKITSIATSLGTAVISNQTFEYARKY 253
           E Y  ++ +  +GVE+ GCH F  +L +    Q ++ T   + +    I+ ++  Y    
Sbjct: 46  EIYKASNEVLKIGVESGGCHGFQYNLDLIPADQSQQETKRTSMMSLLRITIKSVVYVMPP 105

Query: 254 NTRSVVIED---KDVIETCLKYTHQF 276
           +   V+I++   K + +T L YT + 
Sbjct: 106 DGGKVIIDENSLKILNDTVLNYTTEL 131

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.319    0.135    0.390 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 33,923,214
Number of extensions: 1316831
Number of successful extensions: 3803
Number of sequences better than 10.0: 60
Number of HSP's gapped: 3783
Number of HSP's successfully gapped: 60
Length of query: 360
Length of database: 53,481,399
Length adjustment: 111
Effective length of query: 249
Effective length of database: 40,753,473
Effective search space: 10147614777
Effective search space used: 10147614777
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 66 (30.0 bits)