Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
YCL063W (VAC17)1.4ON42342321380.0
Smik_3.131.4ON42542617610.0
Skud_3.21.4ON42642617170.0
Suva_3.1511.4ON42142316730.0
TDEL0C069801.4ON4263635713e-68
ZYRO0F18502g1.4ON4504245471e-64
Kpol_2002.71.4ON4744854513e-50
CAGL0B00308g1.4ON4304524352e-48
KNAG0C001901.4ON4424674119e-45
SAKL0C00440g1.4ON4623614092e-44
NDAI0A001301.4ON4785083822e-40
NCAS0B091201.4ON4334623548e-37
TPHA0E040201.4ON5402543464e-35
TBLA0A075801.4ON5133222873e-27
KLLA0C00462g1.4ON4604762811e-26
Kwal_33.130031.4ON4492412103e-17
KAFR0D001201.4ON3994672083e-17
KLTH0F00462g1.4ON4512382032e-16
Ecym_10071.4ON4621591017e-04
Skud_5.1587.217ON39138751.1
Suva_5.1507.217ON39145731.8
Smik_5.1737.217ON39144713.2
YER048C (CAJ1)7.217ON39144703.6
KNAG0L013307.217ON39638687.0
CAGL0D01672g3.340ON1014160697.2
Kpol_2000.671.81ON82483687.9
Kpol_1031.165.415ON11664648.5
SAKL0E05588g2.368ON600586710.0
NOTE: 1 genes in the same pillar as YCL063W were not hit in these BLAST results
LIST: AFR746C

BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= YCL063W
         (423 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

YCL063W Chr3 (17290..18561) [1272 bp, 423 aa] {ON}  VAC17Phospho...   828   0.0  
Smik_3.13 Chr3 (18714..19991) [1278 bp, 425 aa] {ON} YCL063W (REAL)   682   0.0  
Skud_3.2 Chr3 (5324..6604) [1281 bp, 426 aa] {ON} YCL063W (REAL)      665   0.0  
Suva_3.151 Chr3 (227186..228451) [1266 bp, 421 aa] {ON} YCL063W ...   649   0.0  
TDEL0C06980 Chr3 complement(1267077..1268357) [1281 bp, 426 aa] ...   224   3e-68
ZYRO0F18502g Chr6 complement(1527109..1528461) [1353 bp, 450 aa]...   215   1e-64
Kpol_2002.7 s2002 (10372..11796) [1425 bp, 474 aa] {ON} (10372.....   178   3e-50
CAGL0B00308g Chr2 (16533..17825) [1293 bp, 430 aa] {ON} similar ...   172   2e-48
KNAG0C00190 Chr3 (28746..30074) [1329 bp, 442 aa] {ON} Anc_1.4 Y...   162   9e-45
SAKL0C00440g Chr3 (39662..41050) [1389 bp, 462 aa] {ON} weakly s...   162   2e-44
NDAI0A00130 Chr1 (6694..8130) [1437 bp, 478 aa] {ON} Anc_1.4 YCL...   151   2e-40
NCAS0B09120 Chr2 complement(1749531..1750832) [1302 bp, 433 aa] ...   140   8e-37
TPHA0E04020 Chr5 complement(842960..844582) [1623 bp, 540 aa] {O...   137   4e-35
TBLA0A07580 Chr1 complement(1878594..1880135) [1542 bp, 513 aa] ...   115   3e-27
KLLA0C00462g Chr3 (33948..35330) [1383 bp, 460 aa] {ON} weakly s...   112   1e-26
Kwal_33.13003 s33 (35425..36774) [1350 bp, 449 aa] {ON} YCL063W ...    86   3e-17
KAFR0D00120 Chr4 (9052..10251) [1200 bp, 399 aa] {ON} Anc_1.4 YC...    85   3e-17
KLTH0F00462g Chr6 (35640..36995) [1356 bp, 451 aa] {ON} weakly s...    83   2e-16
Ecym_1007 Chr1 (11741..13129) [1389 bp, 462 aa] {ON} similar to ...    44   7e-04
Skud_5.158 Chr5 complement(244775..245950) [1176 bp, 391 aa] {ON...    33   1.1  
Suva_5.150 Chr5 complement(223538..224713) [1176 bp, 391 aa] {ON...    33   1.8  
Smik_5.173 Chr5 complement(251699..252874) [1176 bp, 391 aa] {ON...    32   3.2  
YER048C Chr5 complement(246982..248157) [1176 bp, 391 aa] {ON}  ...    32   3.6  
KNAG0L01330 Chr12 complement(239806..240996) [1191 bp, 396 aa] {...    31   7.0  
CAGL0D01672g Chr4 complement(173338..176382) [3045 bp, 1014 aa] ...    31   7.2  
Kpol_2000.67 s2000 (144161..146635) [2475 bp, 824 aa] {ON} (1441...    31   7.9  
Kpol_1031.16 s1031 complement(41507..41857) [351 bp, 116 aa] {ON...    29   8.5  
SAKL0E05588g Chr5 complement(458799..460601) [1803 bp, 600 aa] {...    30   10.0 

>YCL063W Chr3 (17290..18561) [1272 bp, 423 aa] {ON}
           VAC17Phosphoprotein involved in vacuole inheritance;
           degraded in late M phase of the cell cycle; acts as a
           vacuole-specific receptor for myosin Myo2p
          Length = 423

 Score =  828 bits (2138), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 408/423 (96%), Positives = 408/423 (96%)

Query: 1   MATQALEDITERLLIRSQEAILQLDLWIQRQQRSSICQTTDQESLDKLSQQYNQYMSQLN 60
           MATQALEDITERLLIRSQEAILQLDLWIQRQQRSSICQTTDQESLDKLSQQYNQYMSQLN
Sbjct: 1   MATQALEDITERLLIRSQEAILQLDLWIQRQQRSSICQTTDQESLDKLSQQYNQYMSQLN 60

Query: 61  SLYVRSESVRDKLSKEQQRRLITEDNEHQRIEDLVREFQDITLRLNELATVPNEAPNDSP 120
           SLYVRSESVRDKLSKEQQRRLITEDNEHQRIEDLVREFQDITLRLNELATVPNEAPNDSP
Sbjct: 61  SLYVRSESVRDKLSKEQQRRLITEDNEHQRIEDLVREFQDITLRLNELATVPNEAPNDSP 120

Query: 121 QSQSTRSSLGSFQPRPLKIIERQRLCMVTPSKPPKKSVGFNPINEVDCPSKTNSLPCSPK 180
           QSQSTRSSLGSFQPRPLKIIERQRLCMVTPSKPPKKSVGFNPINEVDCPSKTNSLPCSPK
Sbjct: 121 QSQSTRSSLGSFQPRPLKIIERQRLCMVTPSKPPKKSVGFNPINEVDCPSKTNSLPCSPK 180

Query: 181 KQPARNRTLRAAKSHDTGLNKSKKPSSSDTYESFFKNRQRLSLTXXXXXXXXXXXXXXXT 240
           KQPARNRTLRAAKSHDTGLNKSKKPSSSDTYESFFKNRQRLSLT               T
Sbjct: 181 KQPARNRTLRAAKSHDTGLNKSKKPSSSDTYESFFKNRQRLSLTFFDEMDDEDFDSDQDT 240

Query: 241 IILPNISTPPHVGVTAKGAEFEPLRRYNSHESILSNKPAPSKSLNLGSFSASFFRPSNPT 300
           IILPNISTPPHVGVTAKGAEFEPLRRYNSHESILSNKPAPSKSLNLGSFSASFFRPSNPT
Sbjct: 241 IILPNISTPPHVGVTAKGAEFEPLRRYNSHESILSNKPAPSKSLNLGSFSASFFRPSNPT 300

Query: 301 FGTSISNVQVNCHPTVAATMAPSRNGPRISSSKALLSSFIARSDTHTVKENNTNLKHASF 360
           FGTSISNVQVNCHPTVAATMAPSRNGPRISSSKALLSSFIARSDTHTVKENNTNLKHASF
Sbjct: 301 FGTSISNVQVNCHPTVAATMAPSRNGPRISSSKALLSSFIARSDTHTVKENNTNLKHASF 360

Query: 361 MDKFNSSLSTISESFQSKRGRKNKGMNEERISNHNVAQEQKNNMDISVSIEELQDALNTE 420
           MDKFNSSLSTISESFQSKRGRKNKGMNEERISNHNVAQEQKNNMDISVSIEELQDALNTE
Sbjct: 361 MDKFNSSLSTISESFQSKRGRKNKGMNEERISNHNVAQEQKNNMDISVSIEELQDALNTE 420

Query: 421 LLF 423
           LLF
Sbjct: 421 LLF 423

>Smik_3.13 Chr3 (18714..19991) [1278 bp, 425 aa] {ON} YCL063W (REAL)
          Length = 425

 Score =  682 bits (1761), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 346/426 (81%), Positives = 369/426 (86%), Gaps = 4/426 (0%)

Query: 1   MATQALEDITERLLIRSQEAILQLDLWIQRQQRSSICQTTDQESLDKLSQQYNQYMSQLN 60
           M TQALEDITERLLIRSQEAILQLDLWIQRQQRSS+CQTTDQE LDK+S+QYNQYMSQLN
Sbjct: 1   MTTQALEDITERLLIRSQEAILQLDLWIQRQQRSSVCQTTDQELLDKVSKQYNQYMSQLN 60

Query: 61  SLYVRSESVRDKLSKEQQRRLITEDNEHQRIEDLVREFQDITLRLNELATVPNEAPNDSP 120
           SLYVRSESVRDKLSKEQQRRLITEDNEHQRIEDLVREFQDITLRLNELAT PNE  NDSP
Sbjct: 61  SLYVRSESVRDKLSKEQQRRLITEDNEHQRIEDLVREFQDITLRLNELATAPNEVANDSP 120

Query: 121 QSQSTRSSLGSFQPRPLKIIERQRLCMVTPSKPPKKSVGFNPINEVDCPSKTNSLPCSPK 180
           QSQSTRSSL SFQPRPLKIIERQRLCMVTPSKPPKKSVGFNPIN+VDCPSKTNSLPCSPK
Sbjct: 121 QSQSTRSSLESFQPRPLKIIERQRLCMVTPSKPPKKSVGFNPINDVDCPSKTNSLPCSPK 180

Query: 181 KQPARNRTLRAAKSHDTGLNKSKKPSSSDTYESFFKNRQRLSLTXXXXXXXXXXXXXXXT 240
           KQPA+N TLRAAKSHDTGLNKSKKPSS+D YESFFKNRQRLSLT               T
Sbjct: 181 KQPAKNHTLRAAKSHDTGLNKSKKPSSADAYESFFKNRQRLSLTFFDEMDDEDFDSDQDT 240

Query: 241 IILPNISTPPHVGVTAKGAEFEPLRRYNSHESILSNKPAPSKSLNLGSFSASFFRPSNPT 300
           +ILPNISTPPHV VTAKGAEFEPLRRYNSHESILSNKPAP  S +LGSF  SFF+PSNPT
Sbjct: 241 VILPNISTPPHVNVTAKGAEFEPLRRYNSHESILSNKPAPLMSHSLGSFPVSFFKPSNPT 300

Query: 301 FGTSISNVQVNCHPTVAATMAPSRNGPRISSSKALLSSFIARSDTHTVKENNTNLKHASF 360
           FGTSISNVQ NCHPT+ ATMAP RNG    SSKALLSSFI RS+   VK+N  NLKH S 
Sbjct: 301 FGTSISNVQANCHPTITATMAPRRNGVHAPSSKALLSSFIGRSERPMVKQNTPNLKHVSL 360

Query: 361 MDKFNSSLSTISESFQSKRGRKNKGMNEERISN-HNVAQEQKNN--MDISVSIEELQDAL 417
           +DKFNSSL+TISESFQSK+ +  K +N+ERIS+  ++    +NN  MD+SVSIEELQDAL
Sbjct: 361 LDKFNSSLTTISESFQSKKKKN-KDLNDERISSLDHIGAHDRNNCIMDMSVSIEELQDAL 419

Query: 418 NTELLF 423
           NTELL 
Sbjct: 420 NTELLL 425

>Skud_3.2 Chr3 (5324..6604) [1281 bp, 426 aa] {ON} YCL063W (REAL)
          Length = 426

 Score =  665 bits (1717), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 346/426 (81%), Positives = 371/426 (87%), Gaps = 3/426 (0%)

Query: 1   MATQALEDITERLLIRSQEAILQLDLWIQRQQRSSICQTTDQESLDKLSQQYNQYMSQLN 60
           MATQALEDITERLLIRSQEAILQLDLWIQRQQRSS+CQT+DQESLDKLSQQYNQYMSQLN
Sbjct: 1   MATQALEDITERLLIRSQEAILQLDLWIQRQQRSSVCQTSDQESLDKLSQQYNQYMSQLN 60

Query: 61  SLYVRSESVRDKLSKEQQRRLITEDNEHQRIEDLVREFQDITLRLNELATVPNEAPNDSP 120
           SLYVRSESVRDKLSKEQQRRLITEDNEHQRIEDLV EFQDIT RLNELATVP+   NDSP
Sbjct: 61  SLYVRSESVRDKLSKEQQRRLITEDNEHQRIEDLVHEFQDITSRLNELATVPHGVSNDSP 120

Query: 121 QSQSTRSSLGSFQPRPLKIIERQRLCMVTPSKPPKKSVGFNPINEVDCPSKTNSLPCSPK 180
           QSQSTRSS GSFQPRPLKIIERQR+CMVTPSKPPKKSVGFNPIN+VDCPSKTNSLPCSPK
Sbjct: 121 QSQSTRSSSGSFQPRPLKIIERQRVCMVTPSKPPKKSVGFNPINDVDCPSKTNSLPCSPK 180

Query: 181 KQPARNRTLRAAKSHDTGLNKSKKPSSSDTYESFFKNRQRLSLTXXXXXXXXXXXXXXXT 240
           K PA+NRTLRAAKSHDTGLNKSKK SS+D YESFFKN+QRLSLT               T
Sbjct: 181 KPPAKNRTLRAAKSHDTGLNKSKKMSSTDAYESFFKNKQRLSLTFFDEMDDEDLDSDQDT 240

Query: 241 IILPNISTPPHVGVTAKGAEFEPLRRYNSHESILSNKPAPSKSLNLGSFSASFFRPSNPT 300
           IILPNISTPPH+ VTAKGAEFEPLRRYNSHESILSNKPAP  SL+LG F  SF++PS+PT
Sbjct: 241 IILPNISTPPHMNVTAKGAEFEPLRRYNSHESILSNKPAPIMSLSLGGFPGSFYKPSHPT 300

Query: 301 FGTSISNVQVNCHPTVAATMAPSRNGPRISSSKALLSSFIARSDTHTVKENNTNLKHASF 360
           FGTS SNVQV+CHPT+  +MA  RNG    SSKALLSSFIAR D    K++ TNLKH SF
Sbjct: 301 FGTSTSNVQVDCHPTITVSMASRRNGCYAPSSKALLSSFIARPDRIAAKQDPTNLKHTSF 360

Query: 361 MDKFNSSLSTISESFQSKRGRKNKGMNEERIS--NHNVAQEQKNN-MDISVSIEELQDAL 417
           +DKFNSSLSTISESFQ+K+G+KNK +N+ RIS  NH   QEQK N MD+SVSIEELQDAL
Sbjct: 361 LDKFNSSLSTISESFQNKKGKKNKDVNDGRISNLNHIATQEQKKNIMDMSVSIEELQDAL 420

Query: 418 NTELLF 423
           NTELLF
Sbjct: 421 NTELLF 426

>Suva_3.151 Chr3 (227186..228451) [1266 bp, 421 aa] {ON} YCL063W
           (REAL)
          Length = 421

 Score =  649 bits (1673), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 322/423 (76%), Positives = 362/423 (85%), Gaps = 2/423 (0%)

Query: 1   MATQALEDITERLLIRSQEAILQLDLWIQRQQRSSICQTTDQESLDKLSQQYNQYMSQLN 60
           MATQALEDITERLL RS+EAILQLDLWIQRQQRSS+C+ +D++SLDKLSQQYNQYMSQLN
Sbjct: 1   MATQALEDITERLLTRSEEAILQLDLWIQRQQRSSVCEPSDRDSLDKLSQQYNQYMSQLN 60

Query: 61  SLYVRSESVRDKLSKEQQRRLITEDNEHQRIEDLVREFQDITLRLNELATVPNEAPNDSP 120
           SLYVRSESVRDKLSKEQ RRL TE+NEH+RIEDLV EFQDIT+RLN+LATVPN+A NDSP
Sbjct: 61  SLYVRSESVRDKLSKEQWRRLNTEENEHKRIEDLVHEFQDITVRLNDLATVPNKASNDSP 120

Query: 121 QSQSTRSSLGSFQPRPLKIIERQRLCMVTPSKPPKKSVGFNPINEVDCPSKTNSLPCSPK 180
           QSQSTRSSL SFQPRPLKIIERQRLC+VTPSKPPKKSV FNPIN+V+CPSKTNSLPCSPK
Sbjct: 121 QSQSTRSSLDSFQPRPLKIIERQRLCVVTPSKPPKKSVVFNPINDVECPSKTNSLPCSPK 180

Query: 181 KQPARNRTLRAAKSHDTGLNKSKKPSSSDTYESFFKNRQRLSLTXXXXXXXXXXXXXXXT 240
           KQP +  TLRAAKSHDTGLNKSKKPSS+D YESFFKN+QRLSLT               T
Sbjct: 181 KQPGKAHTLRAAKSHDTGLNKSKKPSSTDAYESFFKNKQRLSLTFFDEMDDEDLDSDQDT 240

Query: 241 IILPNISTPPHVGVTAKGAEFEPLRRYNSHESILSNKPAPSKSLNLGSFSASFFRPSNPT 300
           IILPNISTP H+ +  KGAEFEPLRRYNSHESILSNKPAP+ SL+LGSF   FF+PSNPT
Sbjct: 241 IILPNISTPSHMDMATKGAEFEPLRRYNSHESILSNKPAPAMSLSLGSF--PFFKPSNPT 298

Query: 301 FGTSISNVQVNCHPTVAATMAPSRNGPRISSSKALLSSFIARSDTHTVKENNTNLKHASF 360
           FGTS+SNVQVN  P +AA+M P RNG R  +SKALLSSFIA+ D   VK+ +TNLKH SF
Sbjct: 299 FGTSVSNVQVNYRPKMAASMIPKRNGSRAPTSKALLSSFIAQPDRIVVKQKSTNLKHTSF 358

Query: 361 MDKFNSSLSTISESFQSKRGRKNKGMNEERISNHNVAQEQKNNMDISVSIEELQDALNTE 420
           +DKFNSSLSTISESFQ+K+G+K+  +N++RI  H + +   N MD+ VSIEELQDALNTE
Sbjct: 359 LDKFNSSLSTISESFQNKKGKKSSDLNDDRIPPHIMPEHNNNLMDMGVSIEELQDALNTE 418

Query: 421 LLF 423
           LL 
Sbjct: 419 LLL 421

>TDEL0C06980 Chr3 complement(1267077..1268357) [1281 bp, 426 aa]
           {ON} Anc_1.4 YCL063W
          Length = 426

 Score =  224 bits (571), Expect = 3e-68,   Method: Compositional matrix adjust.
 Identities = 159/363 (43%), Positives = 217/363 (59%), Gaps = 42/363 (11%)

Query: 6   LEDITERLLIRSQEAILQLDLWIQRQQRSSICQTTDQESLDKLSQQYNQYMSQLNSLYVR 65
           LED++ERLL RSQEAILQL+LWIQRQQ     +  +  S+DKL  QYN Y++QLNSL VR
Sbjct: 3   LEDLSERLLTRSQEAILQLELWIQRQQH---LRELEDSSIDKLGNQYNVYIAQLNSLCVR 59

Query: 66  SESVRDKLSKEQQRRLITEDNEHQRIEDLVREFQDITLRLNELATVPNEAPNDSPQSQST 125
           SE VRDKL+KE++RR+ +  N+ + IEDLV EFQDIT++LNELA   +++ + +P S+ST
Sbjct: 60  SEYVRDKLNKERERRM-SIINDRKYIEDLVFEFQDITVKLNELAQ--SQSIDSTPSSKST 116

Query: 126 RSSLGSFQPRPLKIIERQ----RLCMVTP--SKPPKKSVGFNPINEV--DCPSKTNSLPC 177
           RSSLGSFQPRPLK+ ER     +    +P  +K   KSV F+ +++   +  SK  SLP 
Sbjct: 117 RSSLGSFQPRPLKLTERHGPNVKALRESPLKNKSVIKSVKFSGLHDSKEEAVSKCLSLPG 176

Query: 178 SPKKQPARNRTLRAAKSHDTGLNK--SKKPSSSDTYE--SFFKNRQRLSLTXXXXXXXXX 233
           SP +     R++R AKS+DTGLN   +KK   S  Y+  S F+  QRLS+T         
Sbjct: 177 SPVRVTGPTRSIRMAKSYDTGLNSKNTKKSKGSRDYDVPSIFRENQRLSITVFDDFDEDA 236

Query: 234 XXXXXXTIILPNISTPPHVGVTAKGAEFEPLRRYNSHESILSNKPAPSKSLNLGSFSASF 293
                   ++  +      G+        PLRR+NSHESILS K  P  SL L S   SF
Sbjct: 237 DSTSDQDTVISLVPADDGKGL--------PLRRFNSHESILSTKVQPISSLPLFS---SF 285

Query: 294 FRPSNPTFGTSISNVQVNCHPTVAATMAPSRNGPRISSSKALLSSFIAR----SDTHTVK 349
             PS+     S+ +V+V+  P  + T AP       +SS+ LLS+F+ R    S+   +K
Sbjct: 286 LLPSSNR--PSMKSVRVSSAPVFSKTSAP-------ASSRDLLSTFVTRPGKASNATGIK 336

Query: 350 ENN 352
           + N
Sbjct: 337 QEN 339

>ZYRO0F18502g Chr6 complement(1527109..1528461) [1353 bp, 450 aa]
           {ON} similar to uniprot|P25591 Saccharomyces cerevisiae
           YCL063W VAC17 vacuole inheritance
          Length = 450

 Score =  215 bits (547), Expect = 1e-64,   Method: Compositional matrix adjust.
 Identities = 167/424 (39%), Positives = 228/424 (53%), Gaps = 44/424 (10%)

Query: 5   ALEDITERLLIRSQEAILQLDLWIQRQQRSSICQTTDQESLDKLSQQYNQYMSQLNSLYV 64
           +L+DI+ERL IRSQEA+LQL+LWI+RQQ   + +   + + DK++ QYN YM+QLNSL V
Sbjct: 3   SLDDISERLFIRSQEAVLQLELWIRRQQH--LSEIEHEHARDKIADQYNLYMAQLNSLCV 60

Query: 65  RSESVRDKLSKEQQRRLITEDNEHQRIEDLVREFQDITLRLNELATVPNEAPNDSPQSQS 124
           RSE VRDKL+   Q R     NE   IEDLV EFQDIT++LNELA   N+    +P S+ 
Sbjct: 61  RSEYVRDKLNAGYQNRKPPIVNEQNYIEDLVYEFQDITVKLNELAQ--NQKEQVTPSSKH 118

Query: 125 TRSSLGSFQPRPLKIIERQRLCMVTPSKPPK------KSVGF--NPINEVDCPSKTNSLP 176
           +  S+ SFQPRPLKI ER R  +    + P       K+V F    + E+ CPSK  SLP
Sbjct: 119 SNGSVNSFQPRPLKITERYRTDIGATRQSPTRINGKLKNVNFVEESLPELFCPSKCTSLP 178

Query: 177 CSPKKQ--PAR--NRTLRAAKSHDTGLNKSKKPSSSDTYE----SFFKNRQRLSLTXXXX 228
            SP K   P R  +R LR AKS+DTGLN + +       E    S FK  QRLS+T    
Sbjct: 179 GSPLKMRSPDRLPDRPLRVAKSYDTGLNPNSRAKLKKQKEEEMLSVFKENQRLSITFCDD 238

Query: 229 XXXXXXXXXXXTIILPNISTPP-HVGVTAKGAEFEPLRRYNSHESILSNKPAPSKSLNLG 287
                        ++     PP H       +E  PLRRYNSH+S+LS K  P  S    
Sbjct: 239 IDEGSDSASDQNTVISTSPIPPSHPIQYDVQSEKPPLRRYNSHDSVLSTKVQPISSAKCP 298

Query: 288 SFSA--SFFRPSNPTFGTSISNVQVNCHPTVAATMAPSRNGPRISSSKALLSSFIARSDT 345
           +F    +  RP       S+ +V V+  P +++T          +SSK LLSSFI+ +  
Sbjct: 299 TFLTIPTANRP-------SMKSVTVSSAPIISSTGGK-------ASSKDLLSSFISNTQD 344

Query: 346 HTVKENNTNLKHASFMDKFNSSLSTISESFQSKRGRKNKGMNEERISNHNVAQEQKNNMD 405
           +  K  N N  +    ++F+S+L  I   F+ K  +KN+     R+   +V  E+K N  
Sbjct: 345 YDKKARNDNGNN----NRFSSNL--IWNLFKQK-SQKNRNPTPLRVPQQDVTSERKENQL 397

Query: 406 ISVS 409
           ++ S
Sbjct: 398 LTTS 401

>Kpol_2002.7 s2002 (10372..11796) [1425 bp, 474 aa] {ON}
           (10372..11796) [1425 nt, 475 aa]
          Length = 474

 Score =  178 bits (451), Expect = 3e-50,   Method: Compositional matrix adjust.
 Identities = 167/485 (34%), Positives = 240/485 (49%), Gaps = 78/485 (16%)

Query: 1   MATQALEDITERLLIRSQEAILQLDLWIQRQQRSSICQTT-DQESLDKLSQQYNQYMSQL 59
           M    ++D++ERLL+RSQEAILQLDLWIQRQQ+ +      D+  L+K++  YN YMSQL
Sbjct: 1   MPYSNIDDLSERLLVRSQEAILQLDLWIQRQQQWAESDDNHDENDLEKVTDTYNLYMSQL 60

Query: 60  NSLYVRSESVRDKLSKEQQRRLIT---------EDNEHQRIEDLVREFQDITLRLNELAT 110
           NSLY+RS++VRDKL+ +++ R  T           N    IEDL+ EFQDIT +LN LA+
Sbjct: 61  NSLYIRSQNVRDKLNTKKKSRTNTIKYVSPSKVNMNGQSDIEDLIFEFQDITRKLNVLAS 120

Query: 111 VPNEAPNDSPQSQSTRSSLGSFQPRPLKIIERQRLCMVTPSKPPKKSVGFN--PINEVDC 168
                 + S  S S  SS+GSFQP+PLKI  ++   +    +  KK+V F+   + +++ 
Sbjct: 121 SRRRCSS-SKSSSSRSSSIGSFQPKPLKISLKRNKSL---KEQNKKTVTFDVEEVTDLNI 176

Query: 169 PSKTNSLPCSP----KKQPARNRTLRAAKSHDTGLN-----KSKKPSSSDTYESFFKNRQ 219
            S   SLP SP    +  P  N  LR AKS+DTGLN     K KK      Y+S FKN Q
Sbjct: 177 NSVI-SLPGSPLRNEQSSPPMNHHLRQAKSYDTGLNSKRSIKPKKSKIDSVYDSTFKNTQ 235

Query: 220 RLSLT---XXXXXXXXXXXXXXXTIILPNIST--PPHVGVTAKGAEFEPLRRYNSHESIL 274
           RLS++                  T+I  +  T   P   +  +    +PLRRYNSHESIL
Sbjct: 236 RLSISLFDIDTNENDITNISDQETVISSSSLTMDEPLEIIDDQKNNLKPLRRYNSHESIL 295

Query: 275 SNKPAP---SKSLNLGSF----------------------SASFFRPSNPTFGTSISNVQ 309
           S K  P   SK   +G F                      +  F++P+      S ++  
Sbjct: 296 STKIRPISISKRFQIGPFRSVSTTTTSTNYDTTASNTDVKADDFYKPN---LSNSTTSKD 352

Query: 310 VNCHPTVAATMAPSRNGPRISSSKALLSS-------------FIARSDTHTVKENNTNLK 356
           +    ++   +  S  G  I++ K   SS              IA S+  + +ENNT  K
Sbjct: 353 ILSMYSIKNDVQNSNRGNIINNKKESNSSTSFFNKWNIFNFPLIASSEVGSKQENNTTAK 412

Query: 357 HASFMDKFNSSLSTISESFQSKRGRKNKGMNEERISNHNVAQEQKNNMDISVSIEELQDA 416
           H  F  +    +S++S + ++       G N     +  + +   +N   +VS +EL DA
Sbjct: 413 H--FGSQRKKQISSLSYN-KANYSTMTIGPNGSMFCSPTIYEPTFSN---TVSFQELHDA 466

Query: 417 LNTEL 421
           LNTEL
Sbjct: 467 LNTEL 471

>CAGL0B00308g Chr2 (16533..17825) [1293 bp, 430 aa] {ON} similar to
           uniprot|P25591 Saccharomyces cerevisiae YCL063w
          Length = 430

 Score =  172 bits (435), Expect = 2e-48,   Method: Compositional matrix adjust.
 Identities = 154/452 (34%), Positives = 235/452 (51%), Gaps = 57/452 (12%)

Query: 5   ALEDITERLLIRSQEAILQLDLWI--QRQQRSSICQTTDQESLDKLSQQYNQYMSQLNSL 62
           +LE+ITERLL RS EAI QLD WI  Q + R      +  +S+++L  +Y +++ +LNSL
Sbjct: 3   SLEEITERLLERSNEAIEQLDEWILLQNKNRHISENKSGLDSIERLDDKYTEFLEKLNSL 62

Query: 63  YVRSESVRDKLSKEQQRRLITEDNE--HQRIEDLVREFQDITLRLNELATVPNEAPND-- 118
           Y+RS+ ++DK+  E+  +     +E    RI++L+ EF++ITL LNE+A   +E  +   
Sbjct: 63  YIRSQYIKDKIRTEKNAKATKRKSELNTSRIQELMLEFKEITLSLNEIAQQDDETNSKQL 122

Query: 119 SPQSQSTRSSLGSFQPRPLKIIERQRLCMVTPSKPPKK-SVGFNPINEVDCPSKTNSLPC 177
           SP S ST+SSL SF P+PLKI+ R  +     + PPKK ++ F PI+E    ++  SLP 
Sbjct: 123 SPASTSTKSSLESFTPKPLKILNRASMIRSPINSPPKKRNISFCPIHENLSVTEYESLPS 182

Query: 178 SPKKQ---PARNRTLRAAKSHDTGL--NKSKKPSSSDTYESFFKNRQRLSLTXXXXXXXX 232
           SP +      + + L  A+S  TGL   K++KP   +  + +FK++QRLSLT        
Sbjct: 183 SPNRSNLLEEQEQVLHPARSFQTGLRTEKARKP-DKNQLDKYFKDKQRLSLTLFGSADAD 241

Query: 233 X-------XXXXXXTIILPNISTPPHVGVTAKGAEFEPLRRYNSHESILS--NKPAPSKS 283
                         T+I    ++  ++   A   + +P+RR NSHES+LS  NK  P  +
Sbjct: 242 DGESLNNNDYSDEETVIF---TSSSNIETDAITDDMKPIRRCNSHESVLSVHNKFVPKNN 298

Query: 284 LN------LGSFSASFFRPSNPTFGT-SISNVQVNCHPTVA-ATMAPSRNGPRISS--SK 333
            N      L  F       +N  F   SI N+QV+   T++  +    R   ++ S  SK
Sbjct: 299 NNLQFQNRLEPFGRYLATSNNRNFTIPSIQNIQVSGTSTLSRFSREQDREMTQLGSKTSK 358

Query: 334 ALLSSFIARSDTHTVKENNTNLKHASFMDKFNS--SLSTISESFQSKRGRKNKGMNEERI 391
            LL+S +  +   T + N       +F DKFNS  + STISE  Q     KN+       
Sbjct: 359 DLLTSVMTATPITTQRNN-----KLTFFDKFNSMFNFSTISEE-QKTTVEKNRS------ 406

Query: 392 SNHNVAQEQKNNMDISVSIEELQDALNTELLF 423
                A+  +N+    VSIEEL +AL T ++ 
Sbjct: 407 -----AESPRNDF---VSIEELNEALTTNMVM 430

>KNAG0C00190 Chr3 (28746..30074) [1329 bp, 442 aa] {ON} Anc_1.4
           YCL063W
          Length = 442

 Score =  162 bits (411), Expect = 9e-45,   Method: Compositional matrix adjust.
 Identities = 163/467 (34%), Positives = 224/467 (47%), Gaps = 75/467 (16%)

Query: 5   ALEDITERLLIRSQEAILQLDLWIQRQQRSSICQ--TTDQESLDKLSQQYNQYMSQLNSL 62
            LED+T+RLLIRSQ+AILQL+LW+Q+Q++  +    + D++  + ++QQ N ++SQLNSL
Sbjct: 3   CLEDVTDRLLIRSQDAILQLELWVQQQEKLLLTDHASVDRKKFEAIAQQRNLHLSQLNSL 62

Query: 63  YVRSESVRDKLSKEQQRRLITEDNEHQR--IEDLVREFQDITLRLNELATVPNEAPNDSP 120
            +RS  +++KL+ E   R I    + +R  IE+LV EFQDI + LNEL+    +  N SP
Sbjct: 63  CLRSRYIKEKLASE---RNICSIRKGRRSYIENLVYEFQDIAMSLNELSETNRK--NGSP 117

Query: 121 QSQSTRSSLGSFQPRPLKIIERQRLCMVTPSKPPKKSVGFNPI-----------NEVDCP 169
            SQ+T +S  SF+P+PL+I+ERQR C      P K++     I           N  DC 
Sbjct: 118 VSQATTNSSDSFEPKPLRILERQRTC--NAKSPTKRNSNHIKIPRETEKSDFTENVADCL 175

Query: 170 SKTNSLPCSP-KKQPARNRTLRAAKSHDTGLNKSKKPSSSDTYESFFKNRQRLSLTXXXX 228
              +SLP SP +      +T+R  KS+   LN  +KP+S     + F  + RLSL     
Sbjct: 176 H--SSLPSSPLRGSNGSQQTIRLTKSYHESLN-GQKPTSHSPLMNPFNAKNRLSLYLFDN 232

Query: 229 XXXXXXX------XXXXTIILPNISTPPHVGVTAKGAEFEPLRRYNSHESILS-NKPAPS 281
                            T++    ++P    V +KGA FEPLRRYNSHESILS  K AP 
Sbjct: 233 IDEKELTPCDDDNSDQETVMY---NSP----VVSKGAAFEPLRRYNSHESILSVAKKAPI 285

Query: 282 KSLNLGSFSASFFRPSNPTFGTSISNVQVNCHPTVAATMAPSRNGPRISSSKALLSSFI- 340
            S    S     F PS     TS  +V V+  P     ++        S SK LLSS   
Sbjct: 286 HS----SAQKLQFYPSATNGTTSAQSVFVSSKPVYTKPLSVQ------SRSKDLLSSIAH 335

Query: 341 --ARSDTHTVKE-NNTNLKHASFMDKFNSSLSTISESFQSKRGRKN------------KG 385
             A  DT T    N  NL   S      S + T + S +     K               
Sbjct: 336 AEASKDTKTTSVFNGWNLFGKSSTAAITSEVGTCAISQKKHSAIKTNRRYITGDTLVIST 395

Query: 386 MNEERISNHNVAQEQKNN---------MDISVSIEELQDALNTELLF 423
            N  R+S  +V Q    N         +D  V   EL +AL TELL 
Sbjct: 396 SNRPRLSRSSVRQPHGYNRHTSPITPIVDHQVRQNELSEALETELLL 442

>SAKL0C00440g Chr3 (39662..41050) [1389 bp, 462 aa] {ON} weakly
           similar to uniprot|P25591 Saccharomyces cerevisiae
           YCL063W VAC17 vacuole inheritance
          Length = 462

 Score =  162 bits (409), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 136/361 (37%), Positives = 188/361 (52%), Gaps = 37/361 (10%)

Query: 4   QALEDITERLLIRSQEAILQLDLWIQRQQRSSICQTTDQES---LDKLSQQYNQYMSQLN 60
           + L +I+++LL+RSQEAILQLDL+IQRQQR    +T DQ     L KL Q+Y   ++QLN
Sbjct: 2   EGLHEISQKLLVRSQEAILQLDLYIQRQQRLYEYETLDQPDNGLLTKL-QEYQTCLAQLN 60

Query: 61  SLYVRSESVRDKLSKEQQRRLITEDNEHQRIEDLVREFQDITLRLNELATVPNEAPNDSP 120
           SL++RSE +RD+++    R   ++D +   I  LV EFQ IT +LNELA   + A   SP
Sbjct: 61  SLHIRSEHLRDRIASTDHR--ASQDGDS--IGHLVTEFQKITTKLNELAATQDRA-YQSP 115

Query: 121 QSQSTRSSLGSFQPRPLKIIERQRLCMVT-PSK----PPKKSV------GFNPINEVDCP 169
            SQST+ S+ SF+P+PLKI+ER +L   T P+K    PPKK         F+        
Sbjct: 116 GSQSTK-SVSSFEPKPLKILERTKLQHPTSPTKRVATPPKKIAPLRKNPPFDKKVMFSGH 174

Query: 170 SKTNSLPCSPKKQPA------RNRTLRAAKSHDTGLNK-SKKPSSSDTYESFFKNRQRLS 222
           SK+ SLP SP    +      + R  R AKS D GLNK  ++   SD   +FFK  QRLS
Sbjct: 175 SKSTSLPGSPSMAASSPVSIQQERFPRHAKSCDAGLNKQQRRRQDSDNRLNFFKENQRLS 234

Query: 223 LTXXXXXXXXXXXXXXXTIILPNISTPPHVGVTAKGAEFEPLRRYNSHESILSNKPAPSK 282
           ++                 +     +PP         + EPLRRYNSHES+LS K     
Sbjct: 235 ISFFDDEIDYSSDEDTVISV-----SPPETTSFKGFPKAEPLRRYNSHESVLSRKEVLPA 289

Query: 283 SL--NLGSFSASFFRPSNPTFGTSISNVQVNCHPTVAATMAPSRNGPRISSSKALLSSFI 340
           +L    G FS    R + P       +V +N  P  +       +     +SK LL+ F+
Sbjct: 290 ALPARAGWFSLWAGRNNKPK--PMAESVSINDKPVYSTAALLRSHSKTTETSKDLLAQFV 347

Query: 341 A 341
           +
Sbjct: 348 S 348

>NDAI0A00130 Chr1 (6694..8130) [1437 bp, 478 aa] {ON} Anc_1.4
           YCL063W
          Length = 478

 Score =  151 bits (382), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 164/508 (32%), Positives = 243/508 (47%), Gaps = 115/508 (22%)

Query: 1   MATQALEDITERLLIRSQEAILQLDLWIQR---QQRSSICQTTDQESLDKL-SQQYNQYM 56
           M+T  L+DITERLLIRSQEAILQLDLWIQR   QQ  S    ++  + D + +QQYN Y+
Sbjct: 1   MST-TLQDITERLLIRSQEAILQLDLWIQREKKQQELSTLNNSNNITYDHVDNQQYNVYL 59

Query: 57  SQLNSLYVRSESVRDKLSKEQQRRLITEDNEHQRIEDLVREFQDITLRLNELA--TVPNE 114
           +QLNSL VR + +RDK      +   T+D E + IE+LV EF+ ITL+LN+L+       
Sbjct: 60  AQLNSLIVRVQYIRDKFLHNINQLDSTQD-EQKYIENLVYEFKQITLKLNDLSKKNKTTS 118

Query: 115 APNDSPQSQSTRSSLGSFQPRPLKIIERQRLCMVTPSKPPKKSVGFNP----INEVDCPS 170
           +  +S ++ S++SS+ SF+P+PLKII+R +          K S   N     I + +   
Sbjct: 119 SSENSSKTASSKSSMESFEPKPLKIIKRTK-------NDQKVSNTINNDHDLIMQDENLQ 171

Query: 171 KTNSLPCSPKKQPA------RNRTLRAAKSHD--TGLNKSKKPS-------SSDTYESFF 215
           + NSLP SP ++ +        + LR  KS D  T  N S+  +        +DT   FF
Sbjct: 172 RPNSLPSSPIEKSSYVTISQNEQNLRLMKSQDFSTKKNTSRNTNYNTIRKFENDTINQFF 231

Query: 216 KNRQRLSLTXXXXXXXXXXXXXXXTIILPNISTPPHV-------------GVTAKGA--- 259
           K++QRLS+                 I   N+ T   +              V ++G    
Sbjct: 232 KSQQRLSI--------GIFDNDDDNIYSTNMGTATRITGEYLTDNNSDQATVISQGTIKR 283

Query: 260 ---EFEPLRRYNSHESILSNK----PAPSKSLNLGSFSASFFRPSNPTFGT----SISNV 308
              +F PLRRYNSHESILS K    P    + NL       F    P + +    S+ ++
Sbjct: 284 NDDDFTPLRRYNSHESILSQKISSTPLIDNNNNLT------FNSKLPLYSSIRRPSMQSI 337

Query: 309 QVNCHPTVAATMAPSRNGPRISSSKALLSSFI-------------ARSDT---------- 345
            V  +P      A S  G    +SK LLSSF+              R+ T          
Sbjct: 338 HVTSNP----IFARSSQGK---TSKDLLSSFVTSSIPRNNNRNIQTRTKTRTQSRRNNQL 390

Query: 346 --HTVKENNTN--LKHASFMDKFNSSLSTISESFQSKRGRKNKGMNEERISNHNVAQEQK 401
             HT+ + +T+    + +F+++FN   S  + +   KR      +N+ R  N +V     
Sbjct: 391 RDHTINQTSTSSFFGNWNFLNRFNMITSETNTTTNRKRNYNIPLVNQSRAHNIDVNDTMD 450

Query: 402 N------NMDISVSIEELQDALNTELLF 423
           +        D ++S+++L+DALNTELL 
Sbjct: 451 SISIKEPVYDNTISLDDLEDALNTELLL 478

>NCAS0B09120 Chr2 complement(1749531..1750832) [1302 bp, 433 aa]
           {ON} Anc_1.4 YCL063W
          Length = 433

 Score =  140 bits (354), Expect = 8e-37,   Method: Compositional matrix adjust.
 Identities = 158/462 (34%), Positives = 227/462 (49%), Gaps = 76/462 (16%)

Query: 6   LEDITERLLIRSQEAILQLDLWIQRQQRSSICQTTD---------------QESLDKLSQ 50
           L+DI+ERLL+RSQEAILQLD+WIQRQ+R       +               + +L +  +
Sbjct: 4   LQDISERLLVRSQEAILQLDVWIQRQRRLQELMEGEEEQEQGGDTNTNMDIRGTLPQFLE 63

Query: 51  QYNQYMSQLNSLYVRSESVRDKLS-------KEQQRRLITEDNEHQRIEDLVREFQDITL 103
           QYN YM+QLNSL VR E +RD L        + QQ       +E + I+DLV EFQDIT 
Sbjct: 64  QYNTYMAQLNSLQVRVEFIRDTLVNKKNTGIRNQQLESNNSVDEQKYIQDLVHEFQDITQ 123

Query: 104 RLNELATVPNEAPNDSPQSQSTRSSLGSFQPRPLKIIERQRL-CMVTPSKPPKKSVGFNP 162
           +L+EL+TV N +   S +S ST+SS+ SF+P+PL+II R      +       K V FN 
Sbjct: 124 KLSELSTVRNPSTASS-RSTSTKSSIESFKPKPLRIISRSNTHSHLHQQTSLDKKVSFNE 182

Query: 163 INEVDCPSKTNSLPCSPKKQPARNRTLRAAKSHDTGLNKSKKPSSSDTYESFFKNRQRLS 222
               D  + + S   S +     +++LR  KS D  L +S   + SD +     +RQRLS
Sbjct: 183 ----DESNSSISHSRSMESLHENSKSLRNTKSMDV-LKRSTFKNHSD-FSKLLNSRQRLS 236

Query: 223 LT----------XXXXXXXXXXXXXXXTIILPNISTPPHVGVTAKGAEFEPLRRYNSHES 272
           +                          T+I        H G   +GA+   LRRYNSHES
Sbjct: 237 INIFDDDLIANEDGNEFYNQYSDSDQATVI-------SH-GTPIRGADTPLLRRYNSHES 288

Query: 273 ILS-NKPAPSKSLNLGSFSASFFRPSNPTFGTSISNVQVNCHPTVAATMAPSRNGPRISS 331
           ILS  KP  S+  N     +S  +P       S+ +V VN +P + + M P+      ++
Sbjct: 289 ILSFRKPTQSRQPNQILPYSSVRQP-------SMQSVAVNSNP-IFSRMRPN------AT 334

Query: 332 SKALLSSFIARSDTHTVKE------NNTNLKHASFMDKFNSSLS----TISESFQSKRGR 381
           SK LLSSFI +   + + +      +N+     +F +KFNS  S    T ++ + +    
Sbjct: 335 SKDLLSSFINKPQPNRLHQQKPKPNSNSLFGKWNFFNKFNSVTSEIGTTTTQLYPTNSSM 394

Query: 382 KNKGMNEERISNHNVAQEQKNNMDISVSIEELQDALNTELLF 423
            NK  N   I +    +E     D S+ +E+L DALNTELL 
Sbjct: 395 SNK-FNPNDIPSSASIREPV--FDDSLHLEDLNDALNTELLL 433

>TPHA0E04020 Chr5 complement(842960..844582) [1623 bp, 540 aa] {ON}
           Anc_1.4 YCL063W
          Length = 540

 Score =  137 bits (346), Expect = 4e-35,   Method: Compositional matrix adjust.
 Identities = 99/254 (38%), Positives = 141/254 (55%), Gaps = 39/254 (15%)

Query: 6   LEDITERLLIRSQEAILQLDLWIQRQQRSS----ICQTTD--------QESLDKLSQQYN 53
           LE+++E+LLIRSQEAILQLDLWI RQQ+          TD         E+L+ L   Y+
Sbjct: 8   LEELSEKLLIRSQEAILQLDLWILRQQQQHNDHRFGTATDTGNKTKDSNEALNALRSTYD 67

Query: 54  QYMSQLNSLYVRSESVRDKLSKEQQRRLITEDN-EHQRIEDLVREFQDITLRLNELATVP 112
            YMSQLNSLYVRSE +RDKL+ E+    + + N +H+ IE+LV EFQ+I  +LN+LA   
Sbjct: 68  LYMSQLNSLYVRSEFIRDKLNSEKNN--VNKFNLDHRNIEELVFEFQNIREKLNQLAASS 125

Query: 113 NEAPNDSPQSQSTRSSLGSFQPRPLKIIER--QRLCMVTPSKPPKKSVGFNPINEVDCPS 170
               +  P++ +  SS+ S   +PLK++ +  +R+      K  +KSV F    E     
Sbjct: 126 KLDKHSPPKTSTRSSSMESMNLKPLKVVAKHEKRMSKELELKNKEKSVTFGK--ETRISL 183

Query: 171 KTNSL----------PCSPKKQPARNRTLRAAKSHDTGLN---KSKKPSSSD-------T 210
            TN +            SP+    + + LR A S+DTGLN   KS K S+ +        
Sbjct: 184 TTNGIGGKLMIKDDSDASPQLIDKKYKVLRNAISYDTGLNSKSKSNKRSNREYRKKNDAA 243

Query: 211 YESFFKNRQRLSLT 224
           Y+S FKN+QR S++
Sbjct: 244 YDSLFKNKQRFSIS 257

 Score = 35.4 bits (80), Expect = 0.28,   Method: Compositional matrix adjust.
 Identities = 21/52 (40%), Positives = 31/52 (59%), Gaps = 6/52 (11%)

Query: 264 LRRYNSHESILSNKPAPSKSLNLGS------FSASFFRPSNPTFGTSISNVQ 309
           LRR NSHESILS K   +   N+GS        +SF+RP+  +  T+ +N++
Sbjct: 337 LRRCNSHESILSTKLENTFYKNVGSNFYDRFIFSSFYRPTVASVSTTSTNIE 388

>TBLA0A07580 Chr1 complement(1878594..1880135) [1542 bp, 513 aa]
           {ON} Anc_1.4 YCL063W
          Length = 513

 Score =  115 bits (287), Expect = 3e-27,   Method: Compositional matrix adjust.
 Identities = 102/322 (31%), Positives = 152/322 (47%), Gaps = 61/322 (18%)

Query: 1   MATQALEDITERLLIRSQEAILQLDLWIQRQQ----RSSICQTTDQESLDKLSQQYNQYM 56
           MA Q  E+++ RLL ++QEA+LQLDLWI+ QQ    R  +  +T  ESL++  + YN+YM
Sbjct: 1   MALQ--EEVSIRLLTKAQEAVLQLDLWIKDQQGFQNRDGLRAST-SESLEQAERDYNRYM 57

Query: 57  SQLNSLYVRSESVRDKLSKEQQRRLITED------NEHQRIEDLVREFQDITLRLNELAT 110
            QLNSLY+R++ +RDK+ K+    L   D      N H  ++ LV EF  +++++NEL+ 
Sbjct: 58  FQLNSLYLRAQYIRDKIEKQNAYNLADSDVAGNDTNSHAYVQQLVTEFYSLSIKMNELSA 117

Query: 111 VPNEAPNDSP----QSQSTRSSLG----SFQPRPLKIIERQRLCMVTPSKPPKKSVGFNP 162
           +     N S     +S  +  SL      FQPRPLKI++RQ+            +   +P
Sbjct: 118 IQENVTNGSSPLSNKSSHSNDSLSKITDGFQPRPLKILQRQKH---------NNNQNTHP 168

Query: 163 INEVDCP------SKTNSLPCSPKKQPARNRTLRAAKSHDTGL----------------- 199
             +++ P      S  N L  S KK+    +   + KS +  L                 
Sbjct: 169 QPDLESPLKLKHRSSYNKLLSSNKKESKPYKNFNSKKSKNNELLSDISPVKIQSFEEPTF 228

Query: 200 ---NKSKKPSSSDTYESFFKNRQRLSLTXXXXXXXXXXXXXXXTIILPN---ISTPPHVG 253
              N   K S    + S FK   RLS+                 I   +   +ST P + 
Sbjct: 229 SVANTRNKNSMDPLHYSLFKTNNRLSIQFPDGYDNDDEYDDPTCISDQDTIFVST-PKIA 287

Query: 254 VTAKGAEFEPLRRYNSHESILS 275
            + K    EPLR++NSHESILS
Sbjct: 288 SSIKNTS-EPLRKFNSHESILS 308

>KLLA0C00462g Chr3 (33948..35330) [1383 bp, 460 aa] {ON} weakly
           similar to uniprot|P25591 Saccharomyces cerevisiae
           YCL063W VAC17 vacuole inheritance
          Length = 460

 Score =  112 bits (281), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 142/476 (29%), Positives = 219/476 (46%), Gaps = 83/476 (17%)

Query: 9   ITERLLIRSQEAILQLDLWIQRQQRSSICQTTDQESLDKLS-QQYNQYMSQLNSLYVRSE 67
           + ERL+IR  EA++QL+L IQR+    +C+     S   +  Q+Y  ++++L+SL +R+E
Sbjct: 7   VAERLVIRCNEAVMQLELSIQRK----MCEFDPNNSHCFIQVQEYYSFLARLSSLKLRAE 62

Query: 68  SVRDKLSKEQQRRLITEDNEHQRIEDLVREFQDITLRLNELATVPNEAPNDSPQSQSTRS 127
            V++ L + Q++       E++ +E L+ EFQDIT+ LNE+A    ++P  S +S S++ 
Sbjct: 63  HVQESL-RHQRKDPNDVCIEYETLEKLIYEFQDITMSLNEVARA-YQSPTKSARSGSSKE 120

Query: 128 SLGSFQP-RPLKIIERQR--LCMVTPSK---------------PPKKSVGF-----NPIN 164
           S  S  P + LKIIER R  L   +P K               P K++V F     + ++
Sbjct: 121 S--SVIPLKTLKIIERNRDSLIGTSPMKKSLSQLKKEEHNQSLPAKRNVRFQEDDLDILH 178

Query: 165 EVDCPSKTNSLPCSPKKQPA--------RNRTLRAAKSHDTGLNKSKKPSSSDTYESFFK 216
            +    + NSLP SP              ++TLR AKS+D GLN   K ++   +E FFK
Sbjct: 179 HLHSVKRANSLPGSPMPDTLLESQMFSREHKTLRMAKSYDVGLNGRAKKNAD--WE-FFK 235

Query: 217 NRQRLSLTX-XXXXXXXXXXXXXXTIILPNISTPPHVGVTAKGAEFEPLRRYNSHESILS 275
           N+ RLSL+                ++  PNIS   ++         + +RR NSHESILS
Sbjct: 236 NKNRLSLSVFDDVNTDASDEETVISVSPPNISY--YLSQNEDQYPSKQVRRCNSHESILS 293

Query: 276 NKP-APSKSLNLGSFSASFFRPSNPTFGTSISNVQVNCHPTVAATMAPSRNGPRISS--- 331
            K  +PS   NL        R   PT+ +      +   PT++ + + S   P I S   
Sbjct: 294 RKILSPSTPANL------IMR---PTYQSVWQKKAIVTKPTISCSTSNSTASPTIGSPHL 344

Query: 332 SKALLSSFIARSDTHTVK-----ENNTNLKHASFMDKFNSSLSTISESFQSKRGRKNKGM 386
           SK +LS F+    +   +      N+T    + F   FNS      E         + G 
Sbjct: 345 SKDMLSQFVTAPPSKKYRGWFSSSNSTPFASSIFQKWFNSDSLVTKEIGNPDNSSPSSGR 404

Query: 387 ----NEER-----------ISNHNVAQEQKNNMD----ISVSIEELQDALNTELLF 423
               N +R           +   N A+  +   D     +VS  ELQ+ALNTE  F
Sbjct: 405 PIVENRQRHSSSNSYSTSIVIGPNGAKFIRGLNDPLVTCTVSYNELQEALNTEFNF 460

>Kwal_33.13003 s33 (35425..36774) [1350 bp, 449 aa] {ON} YCL063W -
           Hypothetical ORF [contig 123] FULL
          Length = 449

 Score = 85.5 bits (210), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 76/241 (31%), Positives = 123/241 (51%), Gaps = 30/241 (12%)

Query: 4   QALEDITERLLIRSQEAILQLDLWIQRQQRSSICQTTDQ---ESLDKLSQQYNQYMSQLN 60
           + L  I +  L RS+EA+++L+  + +Q+R    + +DQ   E       QY  Y+ QLN
Sbjct: 2   EQLAKIAQCALERSEEALVRLEKCVGKQRRLYESERSDQCLSEESSSTIVQYYSYLGQLN 61

Query: 61  SLYVRSESVRDKLSKEQQRRLITEDNEHQRIEDLVREFQDITLRLNELATVPNEAPNDSP 120
            LY++++S++D +     R     ++  + IE L  +++ +    NEL  +  +   DSP
Sbjct: 62  CLYIKAQSLKDMMG---NRCGHLPNSTQEAIERLEHDYKALCNHANELG-IREKNLEDSP 117

Query: 121 QSQSTRSSLGSFQPRPLKIIERQ---------RLCMVTPSKPPKKSVGFNPINEV--DCP 169
              S  +S+ SFQP+PLKIIER+         ++C  T         G +  ++   D  
Sbjct: 118 SCLSP-ASVSSFQPKPLKIIERRLAQTNTSPTKVCTATVMAKSFCRSGTDKNSDYIPDEI 176

Query: 170 SKTNSL----PCS--PKKQPARNRTLRAAKSHDTGLNKSKKPSSSDTYESFFKNRQRLSL 223
            KTNS     PC+   KK+P   + +R  KS  TGLNK   P  +    SFF++RQRLS+
Sbjct: 177 GKTNSCNTNSPCTNEAKKEP---KFIRVVKSCGTGLNKHSNPHENRL--SFFRDRQRLSI 231

Query: 224 T 224
           +
Sbjct: 232 S 232

>KAFR0D00120 Chr4 (9052..10251) [1200 bp, 399 aa] {ON} Anc_1.4
           YCL063W
          Length = 399

 Score = 84.7 bits (208), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 124/467 (26%), Positives = 211/467 (45%), Gaps = 124/467 (26%)

Query: 9   ITERLLIRSQEAILQLDLWIQRQQRSSICQTT-DQESLDKLSQQYNQYMSQLNSLYVRSE 67
           +++ LL RS+EA+ QL+ W+++Q++  + QTT + + L+ L  + ++Y+S L  L   S 
Sbjct: 5   VSDTLLQRSEEAVSQLESWLKQQEQ--LHQTTAEYKQLNSLCAK-SKYISNL--LKDDSS 59

Query: 68  SVRDKLSKEQQRRLITEDNEHQRIEDLVREFQDITLRLNELATVPNEAPNDSPQSQSTRS 127
           S+   L ++++R  I        +E L+ EF +I+ +LNE+ T      + SPQ     S
Sbjct: 60  SIPHDLMEQKERSFI--------VESLIHEFNEISTKLNEIVT------HTSPQ-----S 100

Query: 128 SLGSFQPRPLKIIERQRLCM-------VTPSKPPKK-SVGFNPINEVDCPSKTNSLPCSP 179
           ++ SF+P+PL ++ + ++         VT  +  +K S+   P++     +K NS+P SP
Sbjct: 101 TIDSFEPKPLNLLRKNKILESPTRSSPVTRGRLERKISINLFPMHTT---TKCNSVPTSP 157

Query: 180 KKQPA---RNRTLRAAKSHDTGLNKSKKPSSSDTYESFFKNRQRLSLT--------XXXX 228
           K +       RTLR  KS+  GLN          Y + FK   RLS++            
Sbjct: 158 KCKSTSTLNQRTLRNIKSYHYGLNGD--------YINPFKENNRLSISFFNGDNTFNDNN 209

Query: 229 XXXXXXXXXXXTIIL--PNISTPPHVGVTAKGAEFEPLRRYNSHESILSN-----KPAPS 281
                      T+++  P ++ P            + L+R NS +S+  N     KP+  
Sbjct: 210 SDSESDIDDDDTVLVTSPFLTNPK-----------QKLKRSNSQDSVFWNENYLRKPSFQ 258

Query: 282 KSLNLGSFSASFFRPSNPTFGTSISNVQVNCHPTVAATMAPSRNGPRISSSKALLSSFIA 341
           K LNL  F ++  +P+       +S+ QV    T          G   SSSKALL+SF+ 
Sbjct: 259 KQLNL--FPSTLTKPT-----AELSSTQVFLKNT----------GRLGSSSKALLTSFVK 301

Query: 342 RSDTHTVKENNTNLKHASFMDKFNSSLSTISES-------------------------FQ 376
            +     + +N     +SF + FNS  S I +S                           
Sbjct: 302 DNLQQQQRTHNA----SSFNNIFNSVTSEIGKSKLDKSQIIHTERRVLSDNSIVISTLIT 357

Query: 377 SKRGRKNKGMNEERISNHNVAQEQKNNMDISVSIEELQDALNTELLF 423
           SK+ R N+  + +     N++  +K  ++  V   +L DALNTE L+
Sbjct: 358 SKKSRFNRFSSVD-----NISPTKKPIINNDVQYSDLNDALNTEFLY 399

>KLTH0F00462g Chr6 (35640..36995) [1356 bp, 451 aa] {ON} weakly
           similar to uniprot|P25591 Saccharomyces cerevisiae
           YCL063W VAC17 vacuole inheritance
          Length = 451

 Score = 82.8 bits (203), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 75/238 (31%), Positives = 125/238 (52%), Gaps = 27/238 (11%)

Query: 6   LEDITERLLIRSQEAILQLDLWIQRQQRSSICQTTDQESLDKLS---QQYNQYMSQLNSL 62
           L++I +  L  SQ A+ +LD  ++RQ+R       DQ   DK S    QY +Y+ QL SL
Sbjct: 4   LQEIAQESLALSQSALARLDSCLERQRRLYESGFPDQCLSDKSSTNMAQYYEYIGQLYSL 63

Query: 63  YVRSESVRDKLSKEQQRRLITEDNEHQRIEDLVREFQDITLRLNELATVPNEAPNDSPQS 122
           Y +++ + D +     + L +   + + IE+L++EFQ+I        +    +  +SP S
Sbjct: 64  YTKAQKLSDTVILSDSKSLSSV--QQRAIENLIQEFQEIAKNDENFISY---SMRESPNS 118

Query: 123 QSTRSSLGSFQPRPLKIIERQRLCMVTPSK---PPKKSVGFNPINEVDCPSKTN------ 173
            S + S+ SFQP+PLKI++R++  + +P+K    P  S+  N  +E +  + ++      
Sbjct: 119 MSVQ-SICSFQPKPLKILQRRQAQLESPTKRSFRPSMSLLDNRGDETNLATASDRSQERL 177

Query: 174 --SLPCS-----PKKQPARNRTLRAAKSHDTGLNKSKKPSSSDTYESFFKNRQRLSLT 224
             S P S     P    A    +R+AKS D GLN+   P   +   +FFK+RQRLS++
Sbjct: 178 LGSSPSSIHFFRPSHTNADTLFIRSAKSCDAGLNRRSNP--HENRLNFFKDRQRLSIS 233

>Ecym_1007 Chr1 (11741..13129) [1389 bp, 462 aa] {ON} similar to
           XP_452214  K. lactis KLLA0C00462g
          Length = 462

 Score = 43.5 bits (101), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 44/159 (27%), Positives = 69/159 (43%), Gaps = 31/159 (19%)

Query: 11  ERLLIRSQEAILQLDLWIQRQ-----------------QRSSICQTT-----DQESLDKL 48
            RLL R QE+++ L+L IQ                       IC+ T      Q   D+ 
Sbjct: 9   HRLLTRCQESLVDLNLHIQMSWSLFELAQDCGGSECNGHNCDICRYTCRSAVQQSCGDQR 68

Query: 49  SQQYNQY---MSQLNSLYVRSESVRDKLSKEQQRRLITEDNEHQRIEDLVREFQDITLRL 105
           ++Q  +Y   M+ L SL +R++ + DK  K      I  D     ++ L  EF+DI+  L
Sbjct: 69  TEQMRRYQSSMAHLMSLSIRAQFLIDKFHKGGSGYQIDLDT----VKKLGSEFEDISHNL 124

Query: 106 NELATVPNEAPNDSPQSQSTRSSLGSFQPRPLKIIERQR 144
             L   PN+  + +     +      FQ RPLK+++R R
Sbjct: 125 CFLE--PNKVFDKNHTRFRSSEYPAPFQLRPLKLLQRIR 161

>Skud_5.158 Chr5 complement(244775..245950) [1176 bp, 391 aa] {ON}
           YER048C (REAL)
          Length = 391

 Score = 33.5 bits (75), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 16/38 (42%), Positives = 29/38 (76%), Gaps = 2/38 (5%)

Query: 70  RDKLSKEQQRRLITEDNEHQRIEDLVREFQDITLRLNE 107
           +DKLSKEQ+ +L+  + E +R ED++++  ++T +LNE
Sbjct: 154 KDKLSKEQREKLL--EMEKKRREDMMKQVDELTEKLNE 189

>Suva_5.150 Chr5 complement(223538..224713) [1176 bp, 391 aa] {ON}
           YER048C (REAL)
          Length = 391

 Score = 32.7 bits (73), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 16/45 (35%), Positives = 33/45 (73%), Gaps = 6/45 (13%)

Query: 63  YVRSESVRDKLSKEQQRRLITEDNEHQRIEDLVREFQDITLRLNE 107
           Y+R    +D+LSKEQ+++L+  + E +R ED++++  ++ ++LNE
Sbjct: 151 YMR----KDRLSKEQRKKLL--EMERKRREDMMKQVDELAVKLNE 189

>Smik_5.173 Chr5 complement(251699..252874) [1176 bp, 391 aa] {ON}
           YER048C (REAL)
          Length = 391

 Score = 32.0 bits (71), Expect = 3.2,   Method: Compositional matrix adjust.
 Identities = 17/44 (38%), Positives = 33/44 (75%), Gaps = 3/44 (6%)

Query: 65  RSESVR-DKLSKEQQRRLITEDNEHQRIEDLVREFQDITLRLNE 107
           ++ES++ DKLSKEQ+ +L+  + E +R ED++++  ++  +LNE
Sbjct: 148 KAESLKKDKLSKEQREKLL--EMERKRREDMMKQVDELAEKLNE 189

>YER048C Chr5 complement(246982..248157) [1176 bp, 391 aa] {ON}
           CAJ1Nuclear type II J heat shock protein of the E. coli
           dnaJ family, contains a leucine zipper-like motif, binds
           to non-native substrates for presentation to Ssa3p, may
           function during protein translocation, assembly and
           disassembly
          Length = 391

 Score = 31.6 bits (70), Expect = 3.6,   Method: Compositional matrix adjust.
 Identities = 17/44 (38%), Positives = 33/44 (75%), Gaps = 3/44 (6%)

Query: 65  RSESVR-DKLSKEQQRRLITEDNEHQRIEDLVREFQDITLRLNE 107
           ++ES++ DKLSKEQ+ +L+  + E +R ED++++  ++  +LNE
Sbjct: 148 KAESLKKDKLSKEQREKLM--EMEKKRREDMMKQVDELAEKLNE 189

>KNAG0L01330 Chr12 complement(239806..240996) [1191 bp, 396 aa] {ON}
           Anc_7.217 YER048C
          Length = 396

 Score = 30.8 bits (68), Expect = 7.0,   Method: Compositional matrix adjust.
 Identities = 17/38 (44%), Positives = 28/38 (73%), Gaps = 2/38 (5%)

Query: 70  RDKLSKEQQRRLITEDNEHQRIEDLVREFQDITLRLNE 107
           R+KL+KEQ+ +L+  + E +R EDL ++  D+T +LNE
Sbjct: 159 RNKLTKEQREKLM--ELEKRRREDLEKQVVDLTKKLNE 194

>CAGL0D01672g Chr4 complement(173338..176382) [3045 bp, 1014 aa]
           {ON} similar to uniprot|P32855 Saccharomyces cerevisiae
           YPR055w SEC8 transport protein
          Length = 1014

 Score = 31.2 bits (69), Expect = 7.2,   Method: Compositional matrix adjust.
 Identities = 37/160 (23%), Positives = 67/160 (41%), Gaps = 35/160 (21%)

Query: 3   TQALEDITERLLIRSQEAILQLDLWIQRQQRSSICQTTDQESLDKLSQQYNQYMSQLNSL 62
           TQA+  IT     +SQ+ IL+L   ++      +   +D E L+  S +YNQ +  LNS+
Sbjct: 109 TQAVNAIT-----KSQQKILELKDSVREANHKFVLDKSDLEDLNNQSLKYNQVIEDLNSI 163

Query: 63  ------------YVRSESVRDK---------LSKEQQRRLIT---------EDNEHQRIE 92
                       ++R ++ RD          L+  Q  + ++         E  EH    
Sbjct: 164 EKLIQYPDIIEEHIRGKNYRDARILLEKGFLLAGSQTLKDVSAIKPLVQQLELQEHVLFN 223

Query: 93  DLVREFQDITLRLNELATVPNEAPNDSPQSQSTRSSLGSF 132
            ++ E  +I    N+ + V NE       +Q+  S+L ++
Sbjct: 224 TIIEEIHNILYSKNDDSFVTNEIGRMVGTAQTNFSTLENY 263

>Kpol_2000.67 s2000 (144161..146635) [2475 bp, 824 aa] {ON}
           (144161..146635) [2475 nt, 825 aa]
          Length = 824

 Score = 30.8 bits (68), Expect = 7.9,   Method: Compositional matrix adjust.
 Identities = 22/83 (26%), Positives = 44/83 (53%), Gaps = 4/83 (4%)

Query: 23  QLDLWIQRQQRSSICQTTDQESLDKLSQQYNQYMSQLNSLYVRSESVRDKLSKEQQRRLI 82
           QL+  +QR +R+ + Q T  E  + L  +Y+Q     N   V+   + ++  +E + RL 
Sbjct: 31  QLEDKLQRSRRTIMEQQTAIEQYNDLKVKYDQLDKNFNVTKVKIAKLENESKEEHKLRLS 90

Query: 83  TEDNEHQRIEDLVREFQDITLRL 105
            E    Q++++L +E +++T  L
Sbjct: 91  AE----QKVDELNKEVEELTASL 109

>Kpol_1031.16 s1031 complement(41507..41857) [351 bp, 116 aa] {ON}
           complement(41507..41857) [351 nt, 117 aa]
          Length = 116

 Score = 29.3 bits (64), Expect = 8.5,   Method: Composition-based stats.
 Identities = 18/64 (28%), Positives = 36/64 (56%), Gaps = 1/64 (1%)

Query: 45  LDKLSQQYNQYMSQLNSLYVRSESVRDKLSKEQQRRLITEDNEHQRIEDLVREFQDITLR 104
           +DKLS  Y+  + ++N  YV S  ++ K   ++Q  LI+++     ++  ++ F+DI  +
Sbjct: 20  IDKLSVDYDYLLYKIND-YVNSIQIQTKEVCQRQNELISQNVVEDIVDVNIQSFKDILSK 78

Query: 105 LNEL 108
             EL
Sbjct: 79  CEEL 82

>SAKL0E05588g Chr5 complement(458799..460601) [1803 bp, 600 aa] {ON}
           weakly similar to uniprot|Q12066 Saccharomyces
           cerevisiae YDL089W Protein of unknown function interacts
           with meiotic division protein Csm1p green fluorescent
           protein (GFP)-fusion protein localizes to the nuclear
           periphery potential Cdc28p substrate
          Length = 600

 Score = 30.4 bits (67), Expect = 10.0,   Method: Compositional matrix adjust.
 Identities = 22/58 (37%), Positives = 31/58 (53%), Gaps = 6/58 (10%)

Query: 56  MSQLNSLYVRSESVRDKLSKEQQRRLITEDNEHQ-----RIEDLVREF-QDITLRLNE 107
           MS+  SL +  ESV D ++KE+Q+  +  + EH+      I  LV     DI L LNE
Sbjct: 5   MSRFESLPIEGESVHDMINKEEQKTQLLVNAEHKIGWFRYITSLVTSSPYDIYLMLNE 62

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.311    0.125    0.343 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 43,577,407
Number of extensions: 1922085
Number of successful extensions: 9904
Number of sequences better than 10.0: 237
Number of HSP's gapped: 10337
Number of HSP's successfully gapped: 242
Length of query: 423
Length of database: 53,481,399
Length adjustment: 112
Effective length of query: 311
Effective length of database: 40,638,807
Effective search space: 12638668977
Effective search space used: 12638668977
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.8 bits)
S2: 67 (30.4 bits)