Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
YCL061C (MRC1)1.5ON1096109648060.0
Smik_3.141.5ON1113112532240.0
Skud_3.31.5ON1152111428570.0
Suva_3.1521.5ON1140112527960.0
KAFR0D001401.5ON1041114311161e-134
NCAS0B091101.5ON10204748167e-92
NDAI0A001401.5ON10914957731e-85
SAKL0C00462g1.5ON11773977663e-84
KNAG0C002201.5ON11614327644e-84
TBLA0A075701.5ON12526967435e-81
Kpol_2002.81.5ON9854476903e-75
TPHA0E040101.5ON9654716682e-72
ZYRO0F18480g1.5ON9604415958e-63
CAGL0B00330g1.5ON11363545838e-61
TDEL0C069701.5ON9414385645e-59
Ecym_10081.5ON11183725383e-55
KLLA0C00484g1.5ON9254545343e-55
AFR745W1.5ON10183845104e-52
KLTH0F00484g1.5ON9934524882e-49
Kwal_33.130051.5ON9704664623e-46
TPHA0J007208.259ON139368801.0
Ecym_27301.382ON23181734.1
KAFR0B040605.125ON29541709.4
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= YCL061C
         (1096 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

YCL061C Chr3 complement(18816..22106) [3291 bp, 1096 aa] {ON}  M...  1855   0.0  
Smik_3.14 Chr3 complement(20226..23567) [3342 bp, 1113 aa] {ON} ...  1246   0.0  
Skud_3.3 Chr3 complement(6855..10313) [3459 bp, 1152 aa] {ON} YC...  1105   0.0  
Suva_3.152 Chr3 complement(228665..232087) [3423 bp, 1140 aa] {O...  1081   0.0  
KAFR0D00140 Chr4 complement(13233..16358) [3126 bp, 1041 aa] {ON...   434   e-134
NCAS0B09110 Chr2 (1746358..1749420) [3063 bp, 1020 aa] {ON} Anc_...   318   7e-92
NDAI0A00140 Chr1 complement(8373..11648) [3276 bp, 1091 aa] {ON}...   302   1e-85
SAKL0C00462g Chr3 complement(41257..44790) [3534 bp, 1177 aa] {O...   299   3e-84
KNAG0C00220 Chr3 complement(33011..36496) [3486 bp, 1161 aa] {ON...   298   4e-84
TBLA0A07570 Chr1 (1874419..1878177) [3759 bp, 1252 aa] {ON} Anc_...   290   5e-81
Kpol_2002.8 s2002 complement(11914..14871) [2958 bp, 985 aa] {ON...   270   3e-75
TPHA0E04010 Chr5 (839903..842800) [2898 bp, 965 aa] {ON} Anc_1.5...   261   2e-72
ZYRO0F18480g Chr6 (1524051..1526933) [2883 bp, 960 aa] {ON} weak...   233   8e-63
CAGL0B00330g Chr2 complement(18031..21441) [3411 bp, 1136 aa] {O...   229   8e-61
TDEL0C06970 Chr3 (1264155..1266980) [2826 bp, 941 aa] {ON} Anc_1...   221   5e-59
Ecym_1008 Chr1 complement(13340..16696) [3357 bp, 1118 aa] {ON} ...   211   3e-55
KLLA0C00484g Chr3 complement(35397..38174) [2778 bp, 925 aa] {ON...   210   3e-55
AFR745W Chr6 (1803046..1806102) [3057 bp, 1018 aa] {ON} Syntenic...   201   4e-52
KLTH0F00484g Chr6 complement(37017..39998) [2982 bp, 993 aa] {ON...   192   2e-49
Kwal_33.13005 s33 complement(36797..39709) [2913 bp, 970 aa] {ON...   182   3e-46
TPHA0J00720 Chr10 (161017..165198) [4182 bp, 1393 aa] {ON} Anc_8...    35   1.0  
Ecym_2730 Chr2 complement(1407649..1408344) [696 bp, 231 aa] {ON...    33   4.1  
KAFR0B04060 Chr2 (843896..844783) [888 bp, 295 aa] {ON} Anc_5.12...    32   9.4  

>YCL061C Chr3 complement(18816..22106) [3291 bp, 1096 aa] {ON}
            MRC1S-phase checkpoint protein required for DNA
            replication; interacts with and stabilizes Pol2p at
            stalled replication forks during stress, where it forms a
            pausing complex with Tof1p and is phosphorylated by
            Mec1p; protects uncapped telomeres
          Length = 1096

 Score = 1855 bits (4806), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 944/1096 (86%), Positives = 944/1096 (86%)

Query: 1    MDDALHALSSLTAKKRTTTYKKVAVPILDEXXXXXXXXXXXXXXXXELTGNGFLFANATL 60
            MDDALHALSSLTAKKRTTTYKKVAVPILDE                ELTGNGFLFANATL
Sbjct: 1    MDDALHALSSLTAKKRTTTYKKVAVPILDENDNTNGNGPNDIDNPPELTGNGFLFANATL 60

Query: 61   NRVKNRLEGKKAPEQNHNNGKDRSENSLPTQLISNLYDGGEELEKSEVKDNSYSEKNVSS 120
            NRVKNRLEGKKAPEQNHNNGKDRSENSLPTQLISNLYDGGEELEKSEVKDNSYSEKNVSS
Sbjct: 61   NRVKNRLEGKKAPEQNHNNGKDRSENSLPTQLISNLYDGGEELEKSEVKDNSYSEKNVSS 120

Query: 121  SFTQTQRIPVSIQQDKVFNVPIHSVNDGKPTQLIKEDGLVNETSQALKTPLTTGRPGATQ 180
            SFTQTQRIPVSIQQDKVFNVPIHSVNDGKPTQLIKEDGLVNETSQALKTPLTTGRPGATQ
Sbjct: 121  SFTQTQRIPVSIQQDKVFNVPIHSVNDGKPTQLIKEDGLVNETSQALKTPLTTGRPGATQ 180

Query: 181  RIDSSGATSQTQPIKSIEPQSQIITTSSNHSNALSPKIPIIPTELIGTSPLFQSIQNRGP 240
            RIDSSGATSQTQPIKSIEPQSQIITTSSNHSNALSPKIPIIPTELIGTSPLFQSIQNRGP
Sbjct: 181  RIDSSGATSQTQPIKSIEPQSQIITTSSNHSNALSPKIPIIPTELIGTSPLFQSIQNRGP 240

Query: 241  DTQMDVPPQTAHDEDKTQAIGIPQATHQEQKTQIDTVAQTLQDEVPHTLKIREIQSELAS 300
            DTQMDVPPQTAHDEDKTQAIGIPQATHQEQKTQIDTVAQTLQDEVPHTLKIREIQSELAS
Sbjct: 241  DTQMDVPPQTAHDEDKTQAIGIPQATHQEQKTQIDTVAQTLQDEVPHTLKIREIQSELAS 300

Query: 301  EDSKREKARNVEYKKPQKPIPTKKFFSKESFLAXXXXXXXXXXXXIKLENAHPKPVQNDD 360
            EDSKREKARNVEYKKPQKPIPTKKFFSKESFLA            IKLENAHPKPVQNDD
Sbjct: 301  EDSKREKARNVEYKKPQKPIPTKKFFSKESFLADFDDSSSNEDDDIKLENAHPKPVQNDD 360

Query: 361  ELHENKSVELNLTDETRINEKRVPLLSSYANNLKREIDSSKCITLXXXXXXXXXXXXXXX 420
            ELHENKSVELNLTDETRINEKRVPLLSSYANNLKREIDSSKCITL               
Sbjct: 361  ELHENKSVELNLTDETRINEKRVPLLSSYANNLKREIDSSKCITLDLDSDSDEYGDDDMD 420

Query: 421  XIKLSKDESVLPISQLSKATILNLKARLSKQNQKLSQRPNKSKDPKVDHNVLLNTLRKAS 480
             IKLSKDESVLPISQLSKATILNLKARLSKQNQKLSQRPNKSKDPKVDHNVLLNTLRKAS
Sbjct: 421  SIKLSKDESVLPISQLSKATILNLKARLSKQNQKLSQRPNKSKDPKVDHNVLLNTLRKAS 480

Query: 481  RKQILDHQKEVIETKGLKLEDMAKEKEIVENLLEQEILRNXXXXXXXXXXXXXXXNDFQL 540
            RKQILDHQKEVIETKGLKLEDMAKEKEIVENLLEQEILRN               NDFQL
Sbjct: 481  RKQILDHQKEVIETKGLKLEDMAKEKEIVENLLEQEILRNKRIRQKEKRREKLEENDFQL 540

Query: 541  NAHDXXXXXXXXXXXXXXXXNEIADYESSGSENXXXXXXXXXXXXXXIILKQKKSHHVKH 600
            NAHD                NEIADYESSGSEN              IILKQKKSHHVKH
Sbjct: 541  NAHDSGSDSGSESSGFALSGNEIADYESSGSENDNRRESDSEKEDDEIILKQKKSHHVKH 600

Query: 601  IINESDSDTEVEAKPKEKADESLPKRIAINLGHYGDNIGEDTDKFQETNVLDTQNIEEVM 660
            IINESDSDTEVEAKPKEKADESLPKRIAINLGHYGDNIGEDTDKFQETNVLDTQNIEEVM
Sbjct: 601  IINESDSDTEVEAKPKEKADESLPKRIAINLGHYGDNIGEDTDKFQETNVLDTQNIEEVM 660

Query: 661  AERNTIENEVKDDVYVNEEADEAIRRQLIDXXXXXXXXXXXXHEAKIKELKKRGVTNFFX 720
            AERNTIENEVKDDVYVNEEADEAIRRQLID            HEAKIKELKKRGVTNFF 
Sbjct: 661  AERNTIENEVKDDVYVNEEADEAIRRQLIDKEKLQLKQKEKEHEAKIKELKKRGVTNFFE 720

Query: 721  XXXXXXXXXWHGIGGADGEGSDDYDSDLEKMIDDYSKNNFNPHEIREMLAAENKEMDIKM 780
                     WHGIGGADGEGSDDYDSDLEKMIDDYSKNNFNPHEIREMLAAENKEMDIKM
Sbjct: 721  MEAEESEDEWHGIGGADGEGSDDYDSDLEKMIDDYSKNNFNPHEIREMLAAENKEMDIKM 780

Query: 781  INKILYDIKNGGFRNKRAKNXXXXXXXXXXXXXVLQQYXXXXXXXXXXXXXXIGDDAKLV 840
            INKILYDIKNGGFRNKRAKN             VLQQY              IGDDAKLV
Sbjct: 781  INKILYDIKNGGFRNKRAKNSLELELSDDDEDDVLQQYRLKRRELMRKRRLEIGDDAKLV 840

Query: 841  KNPKSSAFFESMVEDIIEYKNPFGAEEEYNLDITSTATDLDTQDNSINVGDNTGNNEQKP 900
            KNPKSSAFFESMVEDIIEYKNPFGAEEEYNLDITSTATDLDTQDNSINVGDNTGNNEQKP
Sbjct: 841  KNPKSSAFFESMVEDIIEYKNPFGAEEEYNLDITSTATDLDTQDNSINVGDNTGNNEQKP 900

Query: 901  VDQKNKKVIISEDFVQKSLSFLKSNNYEDFETDKELSRIQHGNDEAIEDLYTLKQNSSIK 960
            VDQKNKKVIISEDFVQKSLSFLKSNNYEDFETDKELSRIQHGNDEAIEDLYTLKQNSSIK
Sbjct: 901  VDQKNKKVIISEDFVQKSLSFLKSNNYEDFETDKELSRIQHGNDEAIEDLYTLKQNSSIK 960

Query: 961  SFTNSQTDSTTSKTVNTIIDLEKRPEDEDEVENGDTSLVGVFKHPSIIKSFASRTDINDK 1020
            SFTNSQTDSTTSKTVNTIIDLEKRPEDEDEVENGDTSLVGVFKHPSIIKSFASRTDINDK
Sbjct: 961  SFTNSQTDSTTSKTVNTIIDLEKRPEDEDEVENGDTSLVGVFKHPSIIKSFASRTDINDK 1020

Query: 1021 FKEGNKTVKILKSYKTVGSSKASITYMGKTRKLIAPKRKTEGSHRYHHDHHXXXXXXXXX 1080
            FKEGNKTVKILKSYKTVGSSKASITYMGKTRKLIAPKRKTEGSHRYHHDHH         
Sbjct: 1021 FKEGNKTVKILKSYKTVGSSKASITYMGKTRKLIAPKRKTEGSHRYHHDHHNKKMKMKTK 1080

Query: 1081 XXXXXLFESGQDSFDN 1096
                 LFESGQDSFDN
Sbjct: 1081 TKSNKLFESGQDSFDN 1096

>Smik_3.14 Chr3 complement(20226..23567) [3342 bp, 1113 aa] {ON}
            YCL061C (REAL)
          Length = 1113

 Score = 1246 bits (3224), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 684/1125 (60%), Positives = 794/1125 (70%), Gaps = 43/1125 (3%)

Query: 1    MDDALHALSSLTAKKRTTTYKKVAVPILDEXXXXXXXXXXXXXXXX-ELTGNGFLFANAT 59
            MDDAL+ALSSL +KKR TTYKKVA+ I D+                  LTGNGFLFANAT
Sbjct: 1    MDDALNALSSLRSKKRVTTYKKVAIHIPDDNDNTDGNLYTNDIVAPPALTGNGFLFANAT 60

Query: 60   LNRVKNRLEGKKAPEQNHNNGKDRSENSLPTQLISNLYDGGEELEKSEVKDNSYSEKNVS 119
            LNRVKNRLEG KAPEQ H+N  D  E+   +QLI+NLY+GGE+LE+++  +N  + KN  
Sbjct: 61   LNRVKNRLEGGKAPEQEHDNKDDEDEDVSSSQLIANLYEGGEDLEETKSNENDCTGKNCM 120

Query: 120  SSFTQTQRIPVSIQQDKVFNVPIHSVNDGKPTQLIKEDGLVNETSQALKTPLTTGRPGAT 179
             +FTQTQRIPVSIQQDKV +VPIHSVN+ KPTQ+IK+D  VN+  QA K   TT +P AT
Sbjct: 121  PTFTQTQRIPVSIQQDKVVDVPIHSVNEEKPTQIIKDDCFVNKIPQAQKLSTTTIKPVAT 180

Query: 180  QRIDSSGATSQTQ---PIKSIEPQSQIITTSSNHSNALSPKIPIIPTELIGTSPLFQSIQ 236
            QRIDS    +Q+Q   PIK IE  SQ  T +SN  +  S K P++    IG SPLFQ + 
Sbjct: 181  QRIDSDDIITQSQQALPIKPIESPSQGKTATSNDLDVQSSKPPVL---TIGKSPLFQPLL 237

Query: 237  NRGP---------------DTQMDVPPQTAHDEDKTQAIGIPQATHQEQKTQIDTVAQTL 281
             RGP               +TQ+DV PQ    ++KTQ   IPQ TH E KTQ+DT++QTL
Sbjct: 238  TRGPVNQMDTPLESSPNNDETQLDVMPQNTQSDNKTQIDTIPQTTHYEDKTQMDTMSQTL 297

Query: 282  QDEVPHTLKIREIQSELASEDSKREKARNVEYKKPQKPIPTKKFFSKESFLAXXXXXXXX 341
            QD VPHTLKIREIQ+ELA EDS+RE+A NVEY KPQK I TK  FSKESFLA        
Sbjct: 298  QDGVPHTLKIREIQNELALEDSRRERASNVEYTKPQKTIATKLKFSKESFLADFDDSSSN 357

Query: 342  XXXXIKLENAHPKPVQNDDELHENKSVELNLTDETRINEKRVPLLSSYANNLKREIDSSK 401
                IK+E+AHPKP+ N++ELHE+K++E ++ + T+  +KRVPLLSSYANNLKREIDSSK
Sbjct: 358  EDAEIKVESAHPKPLGNEEELHEDKNIEPSINEVTKKTDKRVPLLSSYANNLKREIDSSK 417

Query: 402  CITLXXXXXXXXXXXXXXXXIKLSKDESVLPISQLSKATILNLKARLSKQNQKLSQRPNK 461
            CITL                 KL KDE  LPISQLSKATILNLKARLSKQNQ +SQRP +
Sbjct: 418  CITLDLDSGSDDDDNIVVDDRKLIKDEGALPISQLSKATILNLKARLSKQNQDISQRPLE 477

Query: 462  SKDPKVDHNVLLNTLRKASRKQILDHQKEVIETKGLKLEDMAKEKEIVENLLEQEILRNX 521
             +D ++DHN L NTLRKASRKQILDHQ+EVIETKG KLEDM KEKE+VENLLEQEI+RN 
Sbjct: 478  GRDARLDHNKLFNTLRKASRKQILDHQREVIETKGFKLEDMVKEKELVENLLEQEIIRNK 537

Query: 522  XXXXXXXXXXXXXXNDFQLNAHDXXXXXXXXXXXXXXXXNEIADYESSGSEN--XXXXXX 579
                          ++F+L+ HD                NE+ DYE SGSE+        
Sbjct: 538  KIRQKEKRREKLENSEFKLSPHDSGSDSGSESSKFALSGNEVTDYELSGSEDEIREEPDN 597

Query: 580  XXXXXXXXIILKQKKSHHVKHIINESDSDTEVEAKPKEKADESLPKRIAINLGHYGDNIG 639
                    I+ K+KK+HHVK +I+ESDS  E EA PKEK D S+PKRIAINLGHYGDNI 
Sbjct: 598  EEEEEEDDIVPKKKKAHHVKRMIDESDS--ENEAVPKEKVDASVPKRIAINLGHYGDNIE 655

Query: 640  EDTDKFQETNVLDTQNIEEVMAERNTIENE-------VKDDVYVNEEADEAIRRQLIDXX 692
            E+ +KFQETN ++TQ  +++  ERN +EN+       V D+  +NEEADEAIRR+LID  
Sbjct: 656  EEVNKFQETNDMNTQQTDKITMERNIVENKAILEDTAVVDEDNINEEADEAIRRELIDKE 715

Query: 693  XXXXXXXXXXHEAKIKELKKRGVTNFFXXXXXXXXXXWHGIGGADGEGSDDYDSDLEKMI 752
                         K+KELK +GVTNFF          WHGIGGADGEGSD+YDSD+EKMI
Sbjct: 716  KLQLRQKELEKAIKLKELKHKGVTNFFEMEAEESDDEWHGIGGADGEGSDEYDSDVEKMI 775

Query: 753  DDYSKNNFNPHEIREMLAAENKEMDIKMINKILYDIKNGGFRNKRAKNXXXXXXXXXXXX 812
            DDYSKNNFN HEIREMLAAENKEMD+KMINKILYDIKNGGFRNKRAKN            
Sbjct: 776  DDYSKNNFNSHEIREMLAAENKEMDVKMINKILYDIKNGGFRNKRAKN-SLELELSDDED 834

Query: 813  XVLQQYXXXXXXXXXXXXXXIGDDAKLVKNPKSSAFFESMVEDIIEYKNPFGAEEEYNLD 872
             VLQQY              IGD  KLVKNPKS AFFESMVEDI+EYKNPF AEEE N D
Sbjct: 835  DVLQQYRLKRRELMRKRRLEIGDGTKLVKNPKSKAFFESMVEDIMEYKNPFRAEEESNQD 894

Query: 873  ITSTATDLDTQD-NSINVGDNTGNNEQKPVDQKNKKVIISEDFVQKSLSFLKSNNYEDFE 931
            ITSTATDLDT D NS+NV D+T NNE+ PVD K+KK+IISEDFVQKSLSFLKSNNY +FE
Sbjct: 895  ITSTATDLDTLDNNSLNVRDSTRNNEKGPVDDKSKKIIISEDFVQKSLSFLKSNNYNEFE 954

Query: 932  TDKELSRIQHGN-DEAIEDLYTLKQNSSIKSFTNSQTDSTTSKTVNTIIDLEKRPEDEDE 990
             DKEL+++QHGN DE IEDL+TLKQ+SSIKSFTNSQTDS TS+TV T+IDLEKR EDEDE
Sbjct: 955  MDKELAKMQHGNDDEPIEDLFTLKQHSSIKSFTNSQTDSFTSRTVTTMIDLEKRTEDEDE 1014

Query: 991  VENGDTSLVGVFKHPSIIKSFASRTDINDKFKEGNKTVKILKSYKTVGSSKASITYMGKT 1050
            +ENGD+SLV  FKHPSI+KSFASRTDINDKFKEGNKTVKI KSYK VGSSKASITYMGKT
Sbjct: 1015 MENGDSSLVSGFKHPSIVKSFASRTDINDKFKEGNKTVKISKSYKMVGSSKASITYMGKT 1074

Query: 1051 RKLIAPKRKTEGSHRYHHDHHXXXXXXXXXXXXXXLFESGQDSFD 1095
            RKL+APKRK  G+ + HH H               LFESGQ+SFD
Sbjct: 1075 RKLMAPKRKA-GTDQNHHRH------KKTKTKTSKLFESGQNSFD 1112

>Skud_3.3 Chr3 complement(6855..10313) [3459 bp, 1152 aa] {ON} YCL061C
            (REAL)
          Length = 1152

 Score = 1105 bits (2857), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 625/1114 (56%), Positives = 752/1114 (67%), Gaps = 35/1114 (3%)

Query: 1    MDDALHALSSLTAKKRTTTYKKVAVPI-LDEXXXXXXXXXXXXXXXXELTGNGFLFANAT 59
            MD+ L  LSSLT+KKR TTYKK+A PI   +                 LTGNGFLF NAT
Sbjct: 56   MDNVLEVLSSLTSKKRVTTYKKIASPIPDGDDDVDGDLLSNNMGAPPALTGNGFLFGNAT 115

Query: 60   LNRVKNRLEGKKAPEQNHNNGKDRSENSLPTQLISNLYDGGEELEKSEVKDNSYSEKNVS 119
            LNRVKNRLEG   PE +     + +E+++ TQLI+NLYDGGE+LE+++   ++ S K+  
Sbjct: 116  LNRVKNRLEGIDVPEDDRQIKDNENEDAVSTQLIANLYDGGEDLEETKSMGDNASLKDGI 175

Query: 120  SSFTQTQRIPVSIQQDKVFNVPIHSVNDGKPTQLIKEDGLVNETSQALKTPLTTGR--PG 177
            ++FTQTQRIPVSIQ + V +VPIHS+N GK  ++I++DG  +  +Q  K    T R  P 
Sbjct: 176  AAFTQTQRIPVSIQSENVVDVPIHSINQGKSARIIRDDGFFSTAAQTQKIIPATARIIPV 235

Query: 178  ATQRIDSSGATSQTQPI---KSIEPQSQIITTSSNHSNALSPKIPIIPTELIGTSPLFQS 234
            ATQRI S    SQTQ +   K IEPQ+QII T++N S+    +IP++  E    S LFQ+
Sbjct: 236  ATQRIHSRDTASQTQQVPFTKPIEPQTQIIGTTANDSDTQPLRIPVLTAE---ASLLFQT 292

Query: 235  IQNRGPDTQMDVPPQTAHDEDKTQAIGIPQATHQEQKTQIDTVAQTLQDEVPHTLKIREI 294
              +  P  +MD P Q  HD+ KTQ   + Q  H E KTQ+DT+ QT+ D+V HTLKIRE+
Sbjct: 293  TPDCVPTIRMDPPSQIEHDKYKTQLDTMTQTAHDEGKTQVDTMPQTIHDDVSHTLKIREL 352

Query: 295  QSELASEDSKREKARNVEYKKPQKPIPTKKFFSKESFLAXXXXXXXXXXXXIKLENAHPK 354
            QSELA EDSKREKARNVEYKK ++ IPT   FSKESFLA            ++LE +  K
Sbjct: 353  QSELALEDSKREKARNVEYKKSRRNIPTMINFSKESFLADFDNSSSDEGTDVQLEKSQLK 412

Query: 355  PVQNDDELHENKSVELNLTDETRINEKRVPLLSSYANNLKREIDSSKCITLXXXXXXXXX 414
              Q+D+E+HENK  E N    +R + K VPLLSSYANNLKREIDSSKCI L         
Sbjct: 413  QQQDDNEVHENKPSEPNSVKNSRESYKNVPLLSSYANNLKREIDSSKCIILDLDSDSDDD 472

Query: 415  XXXXXXXIKLSKDESVLPISQLSKATILNLKARLSKQNQKLSQRPNKSKDPKVDHNVLLN 474
                       KDES LPIS+LSKA ILNLKARLSKQ+Q L+Q PNK+K  KVDHN L N
Sbjct: 473  GDDYMGGNMSIKDESALPISRLSKAAILNLKARLSKQSQNLTQMPNKNKGAKVDHNKLFN 532

Query: 475  TLRKASRKQILDHQKEVIETKGLKLEDMAKEKEIVENLLEQEILRNXXXXXXXXXXXXXX 534
             LRKASRKQILDHQ+EVIETKG KLEDMAKEKEIVENLLEQEILRN              
Sbjct: 533  ILRKASRKQILDHQREVIETKGFKLEDMAKEKEIVENLLEQEILRNRRIRQKEKEKEKL- 591

Query: 535  XNDFQLNAHDXXXXXXXXXXXXXXXXNEIADYESSGSE-----NXXXXXXXXXXXXXXII 589
                     D                NEIA+YE S SE     N              I+
Sbjct: 592  ------ENKDSGSDSGSESSKFEMSDNEIANYELSSSESEKNKNSDDEQEEEEEEEEDIV 645

Query: 590  LKQKKSHHVKHIINESDSDTEVEAKPK-EKADESLPKRIAINLGHYGDNIGED-TDKFQE 647
            L +KKS+HVKH+INESDS+ E E K K  K  ++ PKR AI+LGHYGDNI E+ ++ F+E
Sbjct: 646  LNKKKSYHVKHVINESDSEIETEQKMKVSKKFDATPKRNAIDLGHYGDNIDEEASNSFEE 705

Query: 648  TNVLDTQNIEEVMAERNTIENEVKDDVY---VNEEADEAIRRQLIDXXXXXXXXXXXXHE 704
               L+TQ I+ ++ + +TIEN  +++V    ++EE  EAIRR+LID            H 
Sbjct: 706  ATTLNTQKIDNIIIKTHTIENREEEEVENDSIDEEVSEAIRRELIDKKKSQLRQKEKKHV 765

Query: 705  AKIKELKKRGVTNFFXXXXXXXXXXWHGIGGADGEGSDDYDSDLEKMIDDYSKNNFNPHE 764
            A++KE K +G+TNFF          WHG+GGADGEGS++YDS++EKMIDDYSKN+FN HE
Sbjct: 766  AELKEFKSKGITNFFEMEAEESEDEWHGVGGADGEGSEEYDSEVEKMIDDYSKNSFNSHE 825

Query: 765  IREMLAAENKEMDIKMINKILYDIKNGGFRNKRAKNXXXXXXXXXXXXXVLQQYXXXXXX 824
            IREMLAAENKEMD+KMIN+ILYDIKNGGFRNKRAKN             VLQQY      
Sbjct: 826  IREMLAAENKEMDVKMINRILYDIKNGGFRNKRAKNSLELELSDDEDD-VLQQYRLKRRE 884

Query: 825  XXXXXXXXIGDDAKLVKNPKSSAFFESMVEDIIEYKNPFGAEEEYNLDITSTATDLDTQD 884
                    IGDD KLVKNPKS AFFESMVEDI+E+KNPF AEEE + D+TSTATDLDTQD
Sbjct: 885  LMRKRRLEIGDDTKLVKNPKSKAFFESMVEDIMEFKNPFKAEEESHQDLTSTATDLDTQD 944

Query: 885  N-SINVGDNTGNNEQKPVDQKNKKVIISEDFVQKSLSFLKSNNYEDFETDKELSRIQHG- 942
            N SI +GD+T NNE + VD ++KK IISEDFVQKSLSFL+SNNY++FE DKE +RIQH  
Sbjct: 945  NDSIQIGDSTRNNEHRRVDDRSKKTIISEDFVQKSLSFLRSNNYDEFEMDKERARIQHDI 1004

Query: 943  NDEAIEDLYTLKQNSSIKSFTNSQTDSTTSKTVNTIIDLEKRPEDEDEVENGDTSLVGVF 1002
             DE +EDL+TLKQ+SSIKSFTNS TDS +SK VN++IDLE+  ED +EVEN D SL+G F
Sbjct: 1005 GDEGVEDLFTLKQHSSIKSFTNSPTDSLSSKRVNSMIDLEQPTEDNNEVENEDPSLIGGF 1064

Query: 1003 KHPSIIKSFASRTDINDKFKEGNKTVKILKSYKTVGSSKASITYMGKTRKLIAPKRKTEG 1062
            KHPSIIKSFASRTDINDKFKEGNKTVKI K+YKTVGSSKASITYMGKTRKL+APK+K + 
Sbjct: 1065 KHPSIIKSFASRTDINDKFKEGNKTVKISKTYKTVGSSKASITYMGKTRKLMAPKKKADR 1124

Query: 1063 SHRYHHDHHXXXXXXXXXXXXXXLFESGQDSFDN 1096
             H  HH+HH              LFESGQDSFD+
Sbjct: 1125 DH--HHNHH----SKAWKTQKSKLFESGQDSFDS 1152

>Suva_3.152 Chr3 complement(228665..232087) [3423 bp, 1140 aa] {ON}
            YCL061C (REAL)
          Length = 1140

 Score = 1081 bits (2796), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 629/1125 (55%), Positives = 742/1125 (65%), Gaps = 59/1125 (5%)

Query: 1    MDDALHALSSLTAKKRTTTYKKVAVPILDEXXXXXXXXXXXXXXXX-ELTGNGFLFANAT 59
            MDDAL+ALSSLT+KKR TTYKKVA PILDE                  LTGNGFLF NAT
Sbjct: 44   MDDALNALSSLTSKKRATTYKKVASPILDENYDTDGNLPIDGMNAPPALTGNGFLFGNAT 103

Query: 60   LNRVKNRLEGKKAPEQNHNNGKDRSENSLPTQLISNLYDGGEELEKSEVKDNSYSEKNVS 119
            LNRVKNRLEG+    Q+  + ++  E+   TQLI+NLYDGGEELE     D +  + NVS
Sbjct: 104  LNRVKNRLEGRNELGQDGQDKENEDEDVFSTQLIANLYDGGEELESKSNGDKNNQKVNVS 163

Query: 120  SSFTQTQRIPVSI-QQDKVFNVPIHSVNDGKPTQLIKEDGLVNETSQALKTPLTTGR--P 176
            S FTQTQRIPVSI QQ+   NVPIHS+N+G+PTQ  K  G V  TSQ    P TT +   
Sbjct: 164  S-FTQTQRIPVSITQQNNEINVPIHSINEGEPTQKAKNRGSVITTSQTQAIPFTTAQITQ 222

Query: 177  GATQRIDSSGATSQTQ---PIKSIEPQSQIITTSSNHSNALSPKIPIIPTELIGTSPLFQ 233
              TQ +++ GATSQTQ   P K  E Q+Q    ++N S+    K+P++ TE   TSPLFQ
Sbjct: 223  KTTQCLNNHGATSQTQQIPPTKPSEAQTQADVATANDSDT-QQKVPMLTTE---TSPLFQ 278

Query: 234  SIQNRGPDTQMDVPPQTAHDEDKTQAIGIPQATHQEQKTQIDTVAQTLQDEVPHTLKIRE 293
            ++ ++ P TQM+ PP T HD+                +TQ+DTVAQT+QD+VP TLKI E
Sbjct: 279  TVPDQSPSTQMNTPPPTVHDD----------------RTQMDTVAQTMQDKVPPTLKIHE 322

Query: 294  IQSELASEDSKREKARNVEYKKPQKPIPTKKFFSKESFLAXXXXXXXXXXXXIKLENAHP 353
            +QSELA ED  R+KA+N EY+K QK IP  K FSKESFLA             KLE++ P
Sbjct: 323  LQSELALEDFNRKKAQNTEYRKLQKTIPIVKRFSKESFLADFDNSSSDEDTNFKLESSQP 382

Query: 354  KPVQNDDELHENKSVELNLTDETRINEKRVPLLSSYANNLKREIDSSKCITLXXXXXXXX 413
            K  QN  E+ +         ++    +K+VPLLS+YANNLKREIDSSKCITL        
Sbjct: 383  KQQQNGYEMIDISQSNPQPAEKENKKDKKVPLLSTYANNLKREIDSSKCITLDLDSGSDK 442

Query: 414  XXXXXXXXIKLSKDESVLPISQLSKATILNLKARLSKQNQKLSQRPNKSKDPKVDHNVLL 473
                     KL++DES LPISQLSKATI NLKARLSKQNQKL+Q  NK+KD K DHN L+
Sbjct: 443  DNDNHMDTDKLNEDESALPISQLSKATIFNLKARLSKQNQKLAQGSNKNKDFKSDHNKLI 502

Query: 474  NTLRKASRKQILDHQKEVIETKGLKLEDMAKEKEIVENLLEQEILRNXXXXXXXXXXXXX 533
            NTLRKASRKQILDHQ+E++ETKG KLEDM KEKEIVE+LLEQEILRN             
Sbjct: 503  NTLRKASRKQILDHQREIVETKGFKLEDMVKEKEIVEDLLEQEILRNKKIRQKEKKKEEL 562

Query: 534  XXNDFQLNAHDXXXXXXXXXXXXXXXXNEIADYESSGSENXXXXXXXXXXXXXXIILKQK 593
              N F+LN+HD                NEIADYE SGSEN               I  +K
Sbjct: 563  ENNGFKLNSHDSDSDSGSESSKFALSDNEIADYELSGSENEKGGDTDDGEEEDDNITNKK 622

Query: 594  KSHHVKHIINESDSDTEVEAKPK-EKADESLPKRIAINLGHYGDNIGED-TDKFQETNVL 651
            K +  KHI++ESDS+ E E K + EK  E++PKR AI+LGHYG+NI  D ++ FQ   VL
Sbjct: 623  KPYRTKHILDESDSEVEDEQKMEVEKNVENVPKRNAIDLGHYGNNIDVDGSNSFQAAIVL 682

Query: 652  DTQNIEEVMAERNTIENEVKDDVYVNEE------------------ADEAIRRQLIDXXX 693
            DTQ + E+  +  T E+E  +     EE                    EAIRR+LID   
Sbjct: 683  DTQQVGEITTQTKTTEHEDDEGEEEKEETDDNDDDDDNDDDDNDDEVSEAIRRELIDREK 742

Query: 694  XXXXXXXXXHEAKIKELKKRGVTNFFXXXXXXXXXXWHGIGGADGEGSDDYDSDLEKMID 753
                        K+KELK +GVTNFF          WHG+GGADGEGSD+YDS++EKMID
Sbjct: 743  SERRQKEKEQATKLKELKSKGVTNFFEMEAEESEDEWHGVGGADGEGSDEYDSEVEKMID 802

Query: 754  DYSKNNFNPHEIREMLAAENKEMDIKMINKILYDIKNGGFRNKRAKNXXXXXXXXXXXXX 813
            DYSKN FN HEIREMLAAENKEMD+KMINKILYDIKNGGFRNKRAKN             
Sbjct: 803  DYSKNKFNSHEIREMLAAENKEMDVKMINKILYDIKNGGFRNKRAKNSLELELSDDEDD- 861

Query: 814  VLQQYXXXXXXXXXXXXXXIGDDAKLVKNPKSSAFFESMVEDIIEYKNPFGAEEEYNLDI 873
            VLQQY              IGDD KLVKNPKS AFFESMVEDI+E+KNPFGAE+E + D+
Sbjct: 862  VLQQYRLKRRELMRKRRLEIGDDTKLVKNPKSKAFFESMVEDIMEFKNPFGAEKESDQDV 921

Query: 874  TSTATDLDTQDN-SINVGDNTGNNEQ-KPVDQKNKKVIISEDFVQKSLSFLKSNNYEDFE 931
            TSTATDLDTQDN +   GDNT NNE  K V  K+KK+IISEDFVQKSLSFLKSNNY++FE
Sbjct: 922  TSTATDLDTQDNDNTKPGDNTSNNEHNKHVGDKSKKLIISEDFVQKSLSFLKSNNYDEFE 981

Query: 932  TDKELSRIQHGNDEA-IEDLYTLKQNSSIKSFTNSQTDSTTSKTVNTIIDLEKRPEDEDE 990
             D+EL+RIQHGN E  + DL+TLKQ+SSIKSFTNSQT+S +S+T+NT+I+LE+  E  DE
Sbjct: 982  MDRELARIQHGNGEGDVVDLFTLKQHSSIKSFTNSQTNSLSSRTMNTVINLEEHTEGNDE 1041

Query: 991  VENGDTSLVGVFKHPSIIKSFASRTDINDKFKEGNKTVKILKSYKTVGSSKASITYMGKT 1050
             ENGD SL+G FKHPS+IKSFASRTDINDKFKEGNKTVKI KSYKTVGSSKASITYMGKT
Sbjct: 1042 GENGDQSLIGGFKHPSVIKSFASRTDINDKFKEGNKTVKISKSYKTVGSSKASITYMGKT 1101

Query: 1051 RKLIAPKRKTEGSHRYHHDHHXXXXXXXXXXXXXXLFESGQDSFD 1095
            RKL+APKRKTE +H  +H                 LFE+GQDSFD
Sbjct: 1102 RKLMAPKRKTEENHHPNH-------IKKSKTQKSKLFENGQDSFD 1139

>KAFR0D00140 Chr4 complement(13233..16358) [3126 bp, 1041 aa] {ON}
            Anc_1.5 YCL061C
          Length = 1041

 Score =  434 bits (1116), Expect = e-134,   Method: Compositional matrix adjust.
 Identities = 404/1143 (35%), Positives = 556/1143 (48%), Gaps = 215/1143 (18%)

Query: 1    MDDALHALSSLTAKKRTTTYKKVAVPILDEXXXXXXXXXXXXXXXXELTGNGFLFANATL 60
            MD     L +L  KKRTT YKK++  + ++                 LTG GFLF N TL
Sbjct: 1    MDGIFGNLQALKPKKRTT-YKKISDDLENDTSESNNDPPA-------LTGEGFLFDNPTL 52

Query: 61   NRVKNRLEGKKAPEQNHNNGKDRSENSLPTQLISNLYDGGEELEKSEVKDNSYSEKNVSS 120
            NR+K RL+G++     +      + N   TQLISNLY GGE+L+  EV+     ++ +  
Sbjct: 53   NRIKKRLDGEEKDVVQY------TMNFSQTQLISNLYGGGEDLDAPEVE--RREKQQLHE 104

Query: 121  SFTQTQRIPVSIQQDKVFNVPIHSVNDGK---PTQLIKEDGL-----------------V 160
               +  +   S  Q   F     ++ND +   PTQ+I    L                 V
Sbjct: 105  QQLELTKKRASKGQLHAFTKSSGNINDLRLMQPTQVIGSTQLAKEFSPVSRTYFKYVPDV 164

Query: 161  NETSQALK------TPLTTGRPG---ATQRIDSSGATSQ----TQPIKSIEPQSQIITTS 207
            N+++Q +       T + + R     ATQ      A++Q    TQ  +SI   +Q I+ S
Sbjct: 165  NQSTQVIHSATQDDTQVVSAREADTQATQMTQVLSASTQGIYNTQETQSITDSTQPISYS 224

Query: 208  SNHSNALSPKIPIIPTELIGTSPLFQSIQNRGP---DTQMDVPPQTAHDEDKTQAIGIPQ 264
            S+  +  + K                   NR P   DTQ+ +P +    +D    + IP+
Sbjct: 225  SSTQDYKTNKF------------------NRHPTPEDTQI-IPREF---DDDASTLPIPE 262

Query: 265  ATHQEQ------KTQIDTVAQ--TLQDEVPHTLKIREIQSELASEDSKREKARNVEYKKP 316
                ++      KTQID+  +  +    V  TLKI EIQ EL  E+S++ K    EYK+ 
Sbjct: 263  GDKTQKDTSAVLKTQIDSTTEGTSYSATVSDTLKIHEIQREL--EESQKTKTI-PEYKQH 319

Query: 317  QKPIPTKKFFSKESFLAXXXXXXXXXXXXIK----------LENAHPKPVQNDDELHENK 366
             +       F+KES+              ++          L+N  P    ND +     
Sbjct: 320  VRTPKNVIVFTKESYFDEFDSDDEEKEENLESEGDSQKVQLLKNTSPSDKSNDGK----- 374

Query: 367  SVELNLTDETRINEKRVPLL---SSYANNLKREIDSSKCITLXXXXXXXXXXXXXXXXIK 423
                 L D+TR +    P L   ++Y   LKR+++S + I L                  
Sbjct: 375  ----RLPDKTRTSPSFKPKLHGLNNYELKLKRQLNSDQQIDLNLD--------------- 415

Query: 424  LSKDESVL-------PISQLSKATILNLKARLSKQNQKLSQRP--NKSKDPKVDHNVLLN 474
             S DE  +       PISQ+SKAT+ ++KARLSK+      RP    S D K   + L N
Sbjct: 416  -SDDEDGIDRMGEKGPISQMSKATVFDIKARLSKK------RPIVKISNDSKTTLHTLFN 468

Query: 475  TLRKASRKQILDHQKEVIETKGLKLEDMAKEKEIVENLLEQEILRNXXXXXXXXXXXXXX 534
             L+KASR+QI++HQKEVIE KGL LED+ KEK+IVENLLEQEI RN              
Sbjct: 469  KLQKASRQQIIEHQKEVIEKKGLNLEDIEKEKKIVENLLEQEINRNKKIRQREKEREKQL 528

Query: 535  XNDFQLNAHDXXXXXXXXXXXXXXXXNEIADYESSGSENXXXXXXXXXXXXXXIILKQKK 594
              D Q + +D                NE+ + E SG E+               + K K+
Sbjct: 529  A-DAQDDENDLDFDHSA---------NELDESELSGEESAIDSDNDYDDFS---LEKTKR 575

Query: 595  SHHVKHIINESDSDTEVE-------AKPKEKADESLPK-RIAINLGHYGDNIGEDTDKFQ 646
            S   K +I E DSDTE+E       A+ +E+ D+SL + R AINLG YGDN+        
Sbjct: 576  SK--KKVIVE-DSDTEIEDEKMSHNAQIREEKDDSLFQNRNAINLGPYGDNLS------- 625

Query: 647  ETNVLDTQNIEEVMAERNTIENEVKDDVYVNEEA----DEAI----RRQLIDXXXXXXXX 698
                        +   R T E +   +  V+ E+    DE I    R +LI+        
Sbjct: 626  ------------LAPIRITTEKQSGKNFKVSRESGDERDEEIPEKDRIRLIEEKKQHELE 673

Query: 699  XXXXHEAKIKELKKRGVTNFFXXXXXXXXXXWHGIGGADGEGSDDYDSDLEKMIDDYSKN 758
                   K KE+K +G+TNF           WHGIGG DGE SD+YDS++EKMIDDYSK 
Sbjct: 674  RQRKQMKKRKEMKAKGITNFLEEEAEESEDEWHGIGGIDGEMSDEYDSEVEKMIDDYSKA 733

Query: 759  NFNPHEIREMLAAENKEMDIKMINKILYDIKNGGFRNKRAKNXXXXXXXXXXXXXVLQQY 818
            NFNP EIR+MLA ENKE DIKM+ KILYDIKNGGFR +R                 L+QY
Sbjct: 734  NFNPDEIRQMLADENKETDIKMVEKILYDIKNGGFRKRRKGAMDLELSDEEDDE--LKQY 791

Query: 819  XXXXXXXXXXXXXXIGDDAKLVKNPKSSAFFESMVEDIIEYKNPFGA-EEEYNLDITSTA 877
                          +G+   LVKNPKS AFFESMV+DI+E KNPF   E + +  IT   
Sbjct: 792  RLKRRELMRQKRLEVGEAETLVKNPKSKAFFESMVDDIVEVKNPFAVFEPQRSGTIT--- 848

Query: 878  TDLDTQDNSINVGDNTGNNEQKPVDQKNKKVIISEDFVQKSLSFLKSN-NYEDFETDKEL 936
            TD  TQ+N+     N G   Q P    +KKV++SE+FVQ++LSFL S+ + + F   + +
Sbjct: 849  TDDGTQENA---NSNEGAASQNP----SKKVMLSEEFVQRTLSFLNSSKDMDQFAPARSM 901

Query: 937  SRIQHGNDEAIEDLYTLKQNSSIKSFTNSQTDSTTSKTVNTIIDLEKRPEDEDEVENGDT 996
                  NDE IEDL  LK+ SSIKSF  ++   +   T     D +K  E++D  ++   
Sbjct: 902  R--AEANDELIEDLTALKKQSSIKSFKTTRASVSQEPT-----DFDK--ENDDSFDDLLN 952

Query: 997  SLVGVFKHPSIIKSFASRTDINDKFKEGNKTVKILKSYKTVGSSKASITYMGKTRKLIAP 1056
            S VG     SI+K+F++  DINDKF+EG KTVK+ K+YK+V SSKASITYMGK RKL+AP
Sbjct: 953  SRVGT---SSIMKTFSATVDINDKFQEGVKTVKVSKAYKSVSSSKASITYMGKMRKLVAP 1009

Query: 1057 KRK 1059
            ++K
Sbjct: 1010 QKK 1012

>NCAS0B09110 Chr2 (1746358..1749420) [3063 bp, 1020 aa] {ON} Anc_1.5
            YCL061C
          Length = 1020

 Score =  318 bits (816), Expect = 7e-92,   Method: Compositional matrix adjust.
 Identities = 216/474 (45%), Positives = 278/474 (58%), Gaps = 65/474 (13%)

Query: 590  LKQKKSHHVKHIINESDSDTEVEAKPKEKADESLPKRIAINLGHYGDNIGEDTDKFQETN 649
            L +K+ H V+ II ESD + E+             K   I+LG YG N            
Sbjct: 578  LTRKEKHPVR-IIQESDDENEIN------------KINTIDLGVYGGN------------ 612

Query: 650  VLDTQNIEEVMAERNTIENEVKDDVYVNEEADEAIRRQLIDXXXXXXXXXXXXHEAKIKE 709
             LD  N      E N  ++E +   Y N+E  E  R  LI             + A+ KE
Sbjct: 613  -LDNPNPLSSQTEPNE-DDEDEKSTYENKEITEEERHALILAEKKRIQLIEKKNAARTKE 670

Query: 710  LKKRGVTNFFXXXXXXXXXXWHGIGGADGEGSDDYDSDLEKMIDDYSKNNFNPHEIREML 769
            +KK+GV   F          WHGIGGADGE SD+YDS++EKMIDDYSK+NFNP EIR+ML
Sbjct: 671  MKKKGVNKLFEMEAEESEDEWHGIGGADGEVSDEYDSEVEKMIDDYSKSNFNPDEIRQML 730

Query: 770  AAENKEMDIKMINKILYDIKNGGFRNKRAKNXXXXXXXXXXXXXVLQQYXXXXXXXXXXX 829
            A ENKEMD+ MI KILYDIKNGGFR +R                 L++Y           
Sbjct: 731  ALENKEMDLNMITKILYDIKNGGFRKRRRGGLDLELSDDDEDDEELREYHKRKRELMKKR 790

Query: 830  XXXIGDDAKLVKNPKSSAFFESMVEDIIEYKNPFGAEEEYNLDITSTATDLDTQ---DNS 886
               IGDD KL+KNPKS AFFESMVEDI++ KN FG  E     I  ++T+LDTQ   +  
Sbjct: 791  MLEIGDDKKLIKNPKSKAFFESMVEDIVDEKNAFGDIE----SIEKSSTELDTQEEKEQD 846

Query: 887  INVGDNTGNNEQKPVDQKNKKVIISEDFVQKSLSFLKSN-NYEDFETDKELSRIQHGNDE 945
            +  G          VD+  KK +ISE+FVQK+LSFL+S  + E+F  +++L++ QHG  E
Sbjct: 847  VTPG----------VDK--KKNVISEEFVQKTLSFLRSGRDLEEFNIEEDLAKEQHG--E 892

Query: 946  AIEDLYTLKQNSSIKSFTN-SQTDSTTSKTVNTIIDLEKRPEDEDEVENGDTSLVGVFKH 1004
             +EDL++LKQ S+IK F N SQT+     T++ I          + VEN ++S +G FK 
Sbjct: 893  NVEDLFSLKQRSTIKEFRNPSQTN-----TIDLI----------NNVENVESSPLGGFKP 937

Query: 1005 PSIIKSFASRTDINDKFKEGNKTVKILKSYKTVGSSKASITYMGKTRKLIAPKR 1058
            PS+IKSF+SRTDIN+KFK+GNKTV I K YKTVGSSKASITY+GK+RKL+ PK+
Sbjct: 938  PSVIKSFSSRTDINEKFKDGNKTVTISKVYKTVGSSKASITYLGKSRKLMPPKK 991

 Score =  127 bits (320), Expect = 4e-29,   Method: Compositional matrix adjust.
 Identities = 174/554 (31%), Positives = 257/554 (46%), Gaps = 126/554 (22%)

Query: 10  SLTAKKRTTTYKKV-AVPILDEXXXXXXXXXXXXXXXXELTGNGFLFANATLNRVKNRLE 68
           SL  K+R TTYKK+   P  DE                 + GNGF+F NA +++++NRL+
Sbjct: 9   SLPKKQRKTTYKKIHEEPNNDEEALTEAVDVMAPP----VIGNGFIFGNALIDKIRNRLD 64

Query: 69  GKKAPEQNHNNGKDRSENSLPTQ--LISNLYDGGEELEKSEVKDNSYSEKNVSSSFTQTQ 126
           GK+          ++ +  +PTQ  +I NLY   EELE+  ++    +  N      QTQ
Sbjct: 65  GKE----------NKEDTPVPTQTQMIDNLYKDAEELEEETIEYEKEA-INKEQEVVQTQ 113

Query: 127 RIPVSIQQDKVFNVPIHSVNDGKPTQLIKEDGLVNETSQALKTPLTTGRPGATQRIDSSG 186
            I  + +++++ N+   S    + TQ I+E   +  T++ L+T                 
Sbjct: 114 LI--AKEKEEIENIKNPSDAYLQETQPIEEKSFLLGTNKELET----------------- 154

Query: 187 ATSQTQPIKSIEPQSQIITTSSNHSNALSPKIPIIPTELIGTSPLFQSIQNRGPDTQM-- 244
              +TQ I  +  +SQ    S N S+  + KIP   T+ I      ++++N   D  +  
Sbjct: 155 --QETQVINPVLSESQ---PSENRSS--NEKIPFTFTQKI--QDFVETVENYSTDLSLSK 205

Query: 245 ------DVPPQTAHDEDKTQAIGIPQA---THQEQKTQI------DTVAQTLQD------ 283
                 ++P     +    +A  I Q    T  +  TQ+      D +  T+ D      
Sbjct: 206 DETITINLPNHATDNSTSKRAHRISQELQRTMTDMDTQVINNTNLDVIEATMADLPNLNE 265

Query: 284 ------EVPHT-LKIREIQSELASEDSKREKARNVEYKKPQKPI---PTKKFFSKESFLA 333
                 ++P T LKI EIQ EL  E + +E     EYKKP K I   P K  FSK S L 
Sbjct: 266 PQSTVADIPSTGLKIHEIQKELERERNSKELK---EYKKPSKEIKVIPIK--FSKTSLLD 320

Query: 334 XXXXXXXXXXXXIKLENAHPKPVQNDDELHENKSVELNLTDE-------TRINEKRVPLL 386
                          +N+      +DDEL   K +++  T E        +I  K++  L
Sbjct: 321 G-------------FDNS-----SSDDELEVQKDMKITRTKEKPESSIKPKIKPKKLTGL 362

Query: 387 SSYANNLKREIDSSKCITLXXXXXXXXXXXXXXXXIKLSKDESVLPISQLSKATILNLKA 446
           ++Y N LK+++   K I L                          PIS+ SKAT+LNLKA
Sbjct: 363 NTYENKLKKKLLEKKHIQLDSDSDNDSDIAKR------------FPISRTSKATLLNLKA 410

Query: 447 RLSKQNQKLSQRPNKSKDPKVDHNVLLNTLRKASRKQILDHQKEVIETKGLKLEDMAKEK 506
           RLSK   K   + NKS +  +D  VL   L++ASRKQILDHQ+E++E +G KLED+ KEK
Sbjct: 411 RLSK---KKPVKSNKSTNTSLD--VLFQNLKQASRKQILDHQRELVENRGFKLEDIEKEK 465

Query: 507 EIVENLLEQEILRN 520
           EIVENLLE+EI RN
Sbjct: 466 EIVENLLEEEIKRN 479

>NDAI0A00140 Chr1 complement(8373..11648) [3276 bp, 1091 aa] {ON}
            Anc_1.5 YCL061C
          Length = 1091

 Score =  302 bits (773), Expect = 1e-85,   Method: Compositional matrix adjust.
 Identities = 207/495 (41%), Positives = 278/495 (56%), Gaps = 57/495 (11%)

Query: 617  EKADESLPKRIAINLGHYGDNIGEDTDKFQETNV----------LDTQNIEEVMAERNTI 666
            E  ++++ KR AI+LG YGDN+     K Q+ +           LDTQ +E    ER  I
Sbjct: 639  EDDEDTISKRNAIDLGAYGDNLTTANVKSQDDDDLEVDDDKNENLDTQPLELTEQERIDI 698

Query: 667  ENEVKDDVYVNEEADEAIRRQLIDXXXXXXXXXXXXHEAKIKELKKRGVTNFFXXXXXXX 726
                K  + + +E                          K KE+ K+GVT FF       
Sbjct: 699  IEAEKTKIKMQQE----------------------KMRHKEKEMMKKGVTKFFEMEAEES 736

Query: 727  XXXWHGIGGADGEGSDDYDSDLEKMIDDYSKNNFNPHEIREMLAAENKEMDIKMINKILY 786
               WHGIGG DGE SD+YDSD+EKMIDDYSK NF+P+EIREMLAAENKEMD+ MINKILY
Sbjct: 737  EDEWHGIGGIDGEMSDEYDSDVEKMIDDYSKANFDPNEIREMLAAENKEMDLNMINKILY 796

Query: 787  DIKNGGFRNKRAKNXXXXXXXXXXXXXVLQQYXXXXXXXXXXXXXXIGDD-AKLVKNPKS 845
            DIKNGGFR KR +               L++Y              +GDD  KLVKNPKS
Sbjct: 797  DIKNGGFR-KRKRGGLELELSEDEDDDALREYHLKRKELMRKRRLELGDDEKKLVKNPKS 855

Query: 846  SAFFESMVEDIIEYKNPFGAE---EEYNLDITSTATDLDTQDNSINVGDNTGNNEQKPVD 902
             AFFESMVEDI + KN F  E   E    +I +T  D+  +D ++ V +N G++++    
Sbjct: 856  KAFFESMVEDITDDKNAFNDEPLGETSTQEINNTQDDMKEEDAAV-VKEN-GDSKRIKKK 913

Query: 903  QKNKKVIISEDFVQKSLSFLKSNNY-EDFETDKELSRIQHGNDEAIEDLYTLKQNSSIKS 961
            +       SE+FVQ++LSFLKS+   E+F  ++ L++ QHG    +E+L +LKQ SSIK 
Sbjct: 914  KTII----SEEFVQRTLSFLKSSREDEEFAMNENLAKEQHGT--KVENLLSLKQQSSIKV 967

Query: 962  FTNSQTDSTTSKTVNTIIDLEKRPEDEDEVENGDTSLVGVFKHPSIIKSFASRTDINDKF 1021
            F +   +S  SK +       K  +  ++ ++ + S + +FK PSI+KSF S+TDIN+KF
Sbjct: 968  FQSPSNNS--SKVI-------KLDDINNDDDDDEDSPIALFKVPSILKSFGSKTDINEKF 1018

Query: 1022 KEGNKTVKILKSYKTVGSSKASITYMGKTRKLIAPKRKTEGSHRYHHDHHXXXXXXXXXX 1081
            ++GNKTV I KSY+TVGSSKASITY+GK+RKL+AP        R     +          
Sbjct: 1019 QDGNKTVTISKSYRTVGSSKASITYLGKSRKLMAPTHSKMKPLRSRVTDN--NKITKGER 1076

Query: 1082 XXXXLFESGQDSFDN 1096
                LF +G DSF+N
Sbjct: 1077 NIGSLFSTGDDSFEN 1091

 Score =  121 bits (303), Expect = 5e-27,   Method: Compositional matrix adjust.
 Identities = 162/564 (28%), Positives = 247/564 (43%), Gaps = 77/564 (13%)

Query: 1   MDDALHALSSLTAKKRTTTYKKVAVPILDEXXXXXXXXXXXXXXXXELT--GNGFLFANA 58
           MD  +  L  +T  ++TT  KK   P ++E                  T  G GFLF N+
Sbjct: 1   MDSLIDDLKPVTKVRKTTYNKKSLDPSIEEQEEDGILTDVTSGGNVTPTILGTGFLFKNS 60

Query: 59  TLNRVKNRLEGKKAPEQNHNNGKDRSENSLPTQLISNLYDGGEELEKSEVKDNSYSEKNV 118
           T+++V+ RL GK   EQ        + +   TQ+I+NLY  GE+LEK  +K    S    
Sbjct: 61  TIDKVRARLSGKNYIEQEKT---PLASSEQETQIITNLYTNGEDLEKDLIKHIPVS---- 113

Query: 119 SSSFTQTQRIPVS---IQQDKVFNVPIHSVNDGKPTQLIKEDGLVNETSQALKTPLTTGR 175
                QTQ I  +    Q ++   V I + ++  PTQ+I      +ET++  +      +
Sbjct: 114 -----QTQPITNTGERTQLEQEIKVTIDNDSNEMPTQVIGSTERDDETAERTQIGEVATQ 168

Query: 176 --PGATQRIDSSGATSQTQPIKSIE-PQSQIITTSSNHSNALSPKIPIIPTELIGTSPLF 232
             PG T    S+   +Q Q +K+   PQ+     + N +N ++     +P         F
Sbjct: 169 LIPGDTYDRTSTMQKTQEQLLKTQRIPQNS--RDNHNQTNIINESFGSVPFTFTQKIKNF 226

Query: 233 QS-IQNRGPDTQMDVPPQT---AHDEDKTQAIGIPQATHQEQKTQIDTVAQTLQDEVPHT 288
           ++ I N   D       QT   + + D  +A  +  ++   Q T I   A T++D+ P +
Sbjct: 227 ETNITNENDDFTNGSKSQTVLISTNVDNVRAEYVDASSSLLQATAI---AATVRDDGPSS 283

Query: 289 -----------------LKIREIQSELASEDSKREKARNVEYKKPQKPIPTKKF-FSKES 330
                            L I + Q EL  E+     ++  EYK   KPI T    F+K+S
Sbjct: 284 TALVGTVADDKLSSGSNLAIHKFQKELEEEEQLANNSKYKEYKGISKPILTNIVKFTKDS 343

Query: 331 FLA----XXXXXXXXXXXXIKLENAHPK--------PVQNDDELHENKSVELNLTDETRI 378
           FL                 +K    + K          +N++    +    +    ++  
Sbjct: 344 FLQGFDNSSSSSSEEEGDKVKETKRNGKENTSSNSYSTKNNNSTASSDGTTIKPKIKSPK 403

Query: 379 NEKRVPLLSSYANNLKREIDSSKCITLXXXXXXXXXXXXXXXXIKLSKDESVLPISQLSK 438
              ++  LS Y N LK  ++S   + L                      E+ LP+S+ SK
Sbjct: 404 KFSKLNTLSRYENKLKTVLNSKNQLQLGSDDESSDDT------------ENSLPVSRTSK 451

Query: 439 ATILNLKARLSKQNQKLSQRPNKSKDPKVDHNV--LLNTLRKASRKQILDHQKEVIETKG 496
           ATIL +KARLSKQ  K     N  KD  V+ N+  L   L+K+SRKQIL++Q+E+IE KG
Sbjct: 452 ATILTIKARLSKQKSK----KNVQKDGTVNTNLNKLFENLKKSSRKQILENQRELIENKG 507

Query: 497 LKLEDMAKEKEIVENLLEQEILRN 520
           L  ED+  EKE+VENLLEQEI RN
Sbjct: 508 LNFEDIEMEKELVENLLEQEIKRN 531

>SAKL0C00462g Chr3 complement(41257..44790) [3534 bp, 1177 aa] {ON}
            some similarities with uniprot|P25588 Saccharomyces
            cerevisiae YCL061C MRC1 S-phase checkpoint protein found
            at replication forks required for DNA replication also
            required for Rad53p activation during DNA replication
            stress where it forms a replication-pausing complex with
            Tof1p and is phosphorylated by Mec1p protein involved in
            replication checkpoint
          Length = 1177

 Score =  299 bits (766), Expect = 3e-84,   Method: Compositional matrix adjust.
 Identities = 182/397 (45%), Positives = 237/397 (59%), Gaps = 33/397 (8%)

Query: 706  KIKELKKRGVTNFFXXXXXXXXXXWHGIGGADGEGSDDYDSDLEKMIDDYSKNNFNPHEI 765
            K KE+K++GV+  F          WHG+GGADGE SD+YDS+LEKM+DDY+K  F+P EI
Sbjct: 806  KRKEMKRKGVSKMFEMEAEESEDEWHGVGGADGELSDEYDSELEKMVDDYTKTTFDPAEI 865

Query: 766  REMLAAENKEMDIKMINKILYDIKNGGFRNKRAKNXXXXXXXXXXXXXVLQQYXXXXXXX 825
            R+MLAAE+KE D K++NKIL+DIKNGGFR +R K               LQ+Y       
Sbjct: 866  RQMLAAEDKEYDEKIVNKILHDIKNGGFR-RRGKGALDIELSDDEDDE-LQRYHAKRREL 923

Query: 826  XXXXXXXIGDDAKLVKNPKSSAFFESMVEDIIEYKNPFGAEEEYNLDITSTATDLDTQDN 885
                    G+ +KLV NPKS AFFESMVED++E KNPF   E  + D +   ++ D  DN
Sbjct: 924  LRQKVLENGEASKLVSNPKSHAFFESMVEDLVESKNPFSIGETADPD-SGAISENDKVDN 982

Query: 886  SINVGDNTGNNEQKPVDQKNKKVIISEDFVQKSLSFLKSNNYED--FETDKELSRIQH-- 941
            +   G       Q PV  + K++ IS++FVQ+SLSFL S +  D  FE D+ L++ QH  
Sbjct: 983  ASEHGTQPDAGGQ-PVRTERKRIKISQEFVQRSLSFLNSKDELDNEFELDRRLAKHQHST 1041

Query: 942  -GND-EAIEDLYTLKQNSSIKSFTNSQTDSTTSKTVNTIIDLEKRPEDEDEVENGDTSLV 999
             G+D + +EDL+TLKQNS IK+        T ++T +  +DLE    D +   NG     
Sbjct: 1042 LGDDNDDLEDLFTLKQNSCIKTL------HTPARTSSRTVDLEV---DGNSPANG----- 1087

Query: 1000 GVFKHPSIIKSFASRTDINDKFKEGNKTVKILKSYKTVGSSKASITYMGKTRKLIAPKRK 1059
              FK PS+I SF+SR DIN+KFKEG KTVK+ KSYKT+G S+ASITY+GK RKL APKRK
Sbjct: 1088 --FKLPSVISSFSSRIDINEKFKEGTKTVKVSKSYKTIGGSRASITYLGKVRKLNAPKRK 1145

Query: 1060 TEGSHR-YHHDHHXXXXXXXXXXXXXXLFESGQDSFD 1095
              G    + H H               LF    DSF+
Sbjct: 1146 ESGRKPVFGHRH------PEAAPKRAGLFADNDDSFE 1176

 Score = 95.1 bits (235), Expect = 5e-19,   Method: Compositional matrix adjust.
 Identities = 64/156 (41%), Positives = 92/156 (58%), Gaps = 26/156 (16%)

Query: 373 TDETRINEK------RVPLLSSYANNLKREIDSSKCITLXXXXXXXXXXXXXXXXIKLSK 426
           TDE R   K       VPL +SY N LK  +DS + I L                    +
Sbjct: 394 TDEGRSTRKDKEEAGWVPL-NSYKNQLKARLDSKEHIDLDSSS---------------DE 437

Query: 427 DESVLPISQLSKATILNLKARLSKQN--QKLSQRPNKSKDPKVDHNVLLNTLRKASRKQI 484
           DE+ +P S++SKA +L +KAR SK+   +K  Q+P+  + P +    L ++L+KA++KQI
Sbjct: 438 DENSVPASKMSKAAVLEIKARTSKRQGIKKTRQQPSTPRAPSLKE--LFSSLKKANKKQI 495

Query: 485 LDHQKEVIETKGLKLEDMAKEKEIVENLLEQEILRN 520
           LDH++E+ E +GL LED+ +EK+ VENLLEQEI RN
Sbjct: 496 LDHRREITEKRGLNLEDIEREKKEVENLLEQEIERN 531

 Score = 40.0 bits (92), Expect = 0.036,   Method: Compositional matrix adjust.
 Identities = 91/356 (25%), Positives = 142/356 (39%), Gaps = 58/356 (16%)

Query: 3   DALHALSSLT-AKKRTTTYKKVAVPILDEXXXXXXXXXXXXXXXXELTGNGFLFANATL- 60
           D L AL  L   KK+ TTY K      D                 +L+   FLF N+T+ 
Sbjct: 2   DFLDALGDLKHPKKKKTTYVK------DIEVYATQEENDEEKKQPQLSSASFLFGNSTIV 55

Query: 61  NRVKNRLEGKKAPEQNHNNGKDRSENSLP-TQLISNLYDGGEELEK--------SEVKDN 111
           ++VK+RL G    E +   G     ++LP TQ+I N YD GE+LE+          V + 
Sbjct: 56  DKVKSRLNGVSNEETDGERG-----DALPQTQVIPNYYD-GEDLEQDFVSPPKPRRVSNT 109

Query: 112 SYSEKNVSSSFTQTQRIPVSIQQDKVFN---VPIHS---VNDGKPTQLIKEDGLVNETSQ 165
            + +     S  QTQ +P   Q+   +    VP+ +   V++  P  +   DGL+ E+  
Sbjct: 110 GHGQDCDCDSEEQTQLMPT--QETGAYESQVVPVIAPVQVSETIPVSI--NDGLLGESLF 165

Query: 166 ALKTPLTTGRPGATQRIDSSGATSQTQPIKSIE----PQSQIITTSSNHSNALSPKIPII 221
                   G  G T R  +      TQ I S +     Q Q+ T  +  +  +     I+
Sbjct: 166 KTSKDEVKGNGGNTTRNLAEPCYGLTQIIPSPQYKNSQQMQLETQEAGETQEVDKTQRIL 225

Query: 222 PTELIGTSPLFQSIQNRGPDTQMDVPPQTAHDEDKTQAIGIPQATHQEQKTQIDTVAQTL 281
             E     P           ++ D    T    D ++A+     T     + +  V  T 
Sbjct: 226 --EATARDPTL---------SEEDFVAATVA--DGSEAVTTQLDTCVPDTSALGDVQPTA 272

Query: 282 QDEVPH----TLKIREIQSELASEDSKREKARNVEYKKPQKPI-PTKKFFSKESFL 332
            D+  H     L I EI+ +L   D++ E+ + +   KP   +   KK F KE+FL
Sbjct: 273 PDQSAHRNSQRLLIHEIEKDL---DAEEEREKRITEAKPHDVVLVVKKKFDKEAFL 325

>KNAG0C00220 Chr3 complement(33011..36496) [3486 bp, 1161 aa] {ON}
            Anc_1.5 YCL061C
          Length = 1161

 Score =  298 bits (764), Expect = 4e-84,   Method: Compositional matrix adjust.
 Identities = 185/432 (42%), Positives = 246/432 (56%), Gaps = 49/432 (11%)

Query: 628  AINLGHYGDNIGEDTDKFQETNVLDTQNIEEVMAERNTIENEVKDDVYVNEEADEAIRRQ 687
            AI+LG YG+N+                   E+ AE N  E   K D       DE    +
Sbjct: 747  AIDLGDYGNNL-------------------EIRAELNNTE---KLDTKC--MLDEKEHAR 782

Query: 688  LIDXXXXXXXXXXXXHEAKIKELKKRGVTNFFXXXXXXXXXXWHGIGGADGEGSDDYDSD 747
             +D               K  ELK++GV+NFF          WHGIGG DGE SD+YDS+
Sbjct: 783  AVDKERLKTIMKEKKLMLKRAELKEKGVSNFFEEEAEESEDEWHGIGGIDGEVSDEYDSE 842

Query: 748  LEKMIDDYSKNNFNPHEIREMLAAENKEMDIKMINKILYDIKNGGFRNKRAKNXXXXXXX 807
            +EKMIDDYS+ + +P EIR++L +ENKEMD+KM+NKIL+DIKNG FR KR ++       
Sbjct: 843  VEKMIDDYSRADMDPEEIRKLLVSENKEMDVKMVNKILFDIKNGNFR-KRGRDTLELELS 901

Query: 808  XXXXXXVLQQYXXXXXXXXXXXXXXIGDDAKLVKNPKSSAFFESMVEDIIEYKNPFGAEE 867
                   L+QY              +GDD KLVKN K+ AFF+S+VEDI+E KNPFG   
Sbjct: 902  DEEDDD-LRQYRQKRNELMKQRLLDLGDDKKLVKNVKTKAFFDSLVEDIVEVKNPFGV-- 958

Query: 868  EYNLDITSTATDLDTQDNSINVGDNTGNNEQKPVDQKNKKVIISEDFVQKSLSFLKSN-N 926
               +    T    +T        ++  N E+KP  +K KK ++SE+FVQ+SLSFL SN N
Sbjct: 959  ---MSDNETQDTDETTTIDTQTRESVSNKEEKPTQEKGKKTVLSEEFVQRSLSFLNSNRN 1015

Query: 927  YEDFETDKELSRIQHGNDEAIEDLYTLKQNSSIKSFTNSQTDSTTSKTVNTIIDLEKRPE 986
              +FE +++L+R+QH +D  + DLYTLK+ SS+KSF      S  SK  N II++     
Sbjct: 1016 LTEFEQNQDLARLQHDDD--VSDLYTLKKQSSVKSFK-----SVGSK--NEIINV----- 1061

Query: 987  DEDEVENGDTSLV-GVFKHPSIIKSFASRTDINDKFKEGNKTVKILKSYKTVGSSKASIT 1045
              D  +N  T++    F+ PSIIKSF S+ +++DKF+ G KTVK  KSYK VG SK S+T
Sbjct: 1062 --DANDNSGTAVATATFRPPSIIKSFNSKLNVDDKFRNGKKTVKTFKSYKAVGGSKTSVT 1119

Query: 1046 YMGKTRKLIAPK 1057
            YM K RKL APK
Sbjct: 1120 YMNKVRKLTAPK 1131

 Score = 92.0 bits (227), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 124/438 (28%), Positives = 199/438 (45%), Gaps = 54/438 (12%)

Query: 99  GGEELEKSEVKDNSYSEKNVSSSFTQTQRIPVSIQQDKVFNVPIHSVNDGKPTQLIKEDG 158
           GGE L+   V   + + + + S    TQ +    Q  ++ +       D +PTQ+I  D 
Sbjct: 232 GGELLKTQTVNARTQATQVIHSDTQPTQLVDTDTQPTQIVDT------DSQPTQIIDTDT 285

Query: 159 LVNETSQALKTPLTTGRPGATQRIDSSGATSQTQPIKSIEPQSQ---IITTSSNHSNALS 215
              +   A    +       TQ ID++      QP + I+P +Q   +I  S   +    
Sbjct: 286 QPTQLIDAQPAQIIDAETQPTQIIDTNA-----QPTQIIDPDTQPTQLINYSHESNGKHI 340

Query: 216 PKIPIIPTELI--GTSPLFQSIQNRGPDTQMDVPPQTAHDEDKTQAIGIPQATHQEQKTQ 273
           P +P  P  L+  GTS L  +I    P  +      T++ + K  +  I +      + +
Sbjct: 341 PTLPA-PDALLSTGTSLLGLNI----PLHRYATAGTTSNPKHKNDSQHIIEDNIATMRDR 395

Query: 274 IDT--VAQTLQDEVP---HTLKIREIQSELASEDSKREKARNVEYKKPQK-PIPTKKFFS 327
           ++T     T+ D+V    +TLKI EIQ+++  E+++    R VE++K +  P   +  F+
Sbjct: 396 LETQEFQPTVADDVKSGGNTLKIHEIQTQI-DEETRNMLNRGVEHRKSRGVPSRVEVRFT 454

Query: 328 KESFLA---XXXXXXXXXXXXIKLENAHPK--PVQNDDELHENKSVELNLTDETRINEKR 382
           KESF+A                ++ +  P+    QN D     K  E   T       KR
Sbjct: 455 KESFMADFEESDSASDMESDSDQINDTTPETGSSQNSDSNKARKPTEAPKT-------KR 507

Query: 383 VPLLSSYANNLKREIDSSKCITLXXXXXXXXXXXXXXXXIKLSKDESVLPISQLSKATIL 442
           V  LSSY   L+ +++  +C+ L                 K SK      +SQ SKA +L
Sbjct: 508 VTGLSSYETILRNKVNDDECLDLGSDDTYSSEEEYD----KESK------VSQASKAAVL 557

Query: 443 NLKARLSKQNQKLSQRPNKSKDPKVDHNVLLNTLRKASRKQILDHQKEVIETKGLKLEDM 502
           N+KA+  K+   +          K   + L + L+K +R+QIL HQ E+I TKG+  +D+
Sbjct: 558 NIKAKALKKKAIVKAANTN----KTTLDSLFSDLKKKNRQQILSHQAEIIGTKGINHKDL 613

Query: 503 AKEKEIVENLLEQEILRN 520
            +EKEIVE+LLEQEILRN
Sbjct: 614 EREKEIVEDLLEQEILRN 631

 Score = 73.6 bits (179), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 45/107 (42%), Positives = 60/107 (56%), Gaps = 10/107 (9%)

Query: 1   MDDALHALSSLTAKKRTTTYKKVAVPILDEXXXXXXXXXXXXXXXXELTGNGFLFANATL 60
           MDD L   +S+  K+RTT YKKV     DE                 L GNGFLF NAT+
Sbjct: 1   MDDLLERFNSVKVKRRTT-YKKVQQNSTDEAAGDDDCVPTS------LAGNGFLFGNATV 53

Query: 61  NRVKNRLEGKKAPEQNHNNGKDRSENSLP---TQLISNLYDGGEELE 104
           +++KNRL  +  P  + +  K  SE+ +P   +QL+S LYDGGE+LE
Sbjct: 54  DKIKNRLNNEDHPNSSIDVTKSSSEDQIPVSQSQLLSTLYDGGEDLE 100

>TBLA0A07570 Chr1 (1874419..1878177) [3759 bp, 1252 aa] {ON} Anc_1.5
            YCL061C
          Length = 1252

 Score =  290 bits (743), Expect = 5e-81,   Method: Compositional matrix adjust.
 Identities = 249/696 (35%), Positives = 331/696 (47%), Gaps = 71/696 (10%)

Query: 381  KRVPLLSSYANNLKREIDSSKCITLXXXXXXXXXXXXXXXXIKLSKDESVLPISQLSKAT 440
            KR  +LS Y N LK  +  +  I L                      +S +  S  SKA 
Sbjct: 575  KRKVILSQYENRLKENLLYNNSIDLYSDSEENT--------------QSDILFSTASKAQ 620

Query: 441  ILNLKARLSKQNQKLSQRPNKSKDPKVDHNV--LLNTLRKASRKQILDHQKEVIETKGLK 498
            IL+++        KLS++  + K   +  N+  L N L+KAS+KQI DHQK  IE+KGLK
Sbjct: 621  ILDIR-------HKLSKKKPQVKKKTIQTNLDQLFNKLKKASKKQIFDHQKNAIESKGLK 673

Query: 499  LEDMAKEKEIVENLLEQEILRNXXXXXXXXXXXXXXXNDFQLNAHDXXXXXXXXXXXXXX 558
            LED+ KEKEIVENLLEQEI RN                       D              
Sbjct: 674  LEDLKKEKEIVENLLEQEIERNRKIRAKERKRENKKNK-----VDDKSVQSASDEDDFDH 728

Query: 559  XXNEIAD--YESSGSENXXXXXXXXXXXXXXIILKQKKSHHVKHIINESDSDTEVEAKPK 616
              NE+ D  Y  S                   I + KK   +K +  ESDS+ +    P 
Sbjct: 729  SANELEDSFYNDSDENKEIIEPEEEDSEDDINIFRHKKG--LKLVTEESDSEND---NPL 783

Query: 617  EKADESLPKRIAINLGHYGDNIGEDTDKFQETNVLDTQNIEEVMAERNTIENEVKDDVYV 676
            E     +   I INLGHYGDN+   +  F E +    ++IE+  A+ N+ EN        
Sbjct: 784  ESEKIPINPNI-INLGHYGDNLDSKSTIFNENSKKFIEDIEQFEAD-NSTENS------- 834

Query: 677  NEEADEAIRRQLIDXXXXXXXXXXXXHEAKIKELKKRGVTNFFXXXXXXXXXXWHGIGGA 736
            N E +E   ++ I              +AK++ELKK G +  F          W GIGGA
Sbjct: 835  NNELNELEYKRHIKQELEKQKLKEAKKKAKLRELKKVGASKMFDMEAEESEDEWFGIGGA 894

Query: 737  DGEGSDDYDSDLEKMIDDYSKNNFNPHEIREMLAAENKEMDIKMINKILYDIKNGGFRNK 796
            DGE SD+YDS++EK+IDDYS+ +FNP EIR  L  ENKEMDIKM+N+ILYDIKNGGFR K
Sbjct: 895  DGEVSDEYDSEVEKLIDDYSRQDFNPDEIRNKLMNENKEMDIKMVNRILYDIKNGGFR-K 953

Query: 797  RAKNXXXXXXXXXXXXXVLQQYXXXXXXXXXXXXXXIGDDAKLVKNPKSSAFFESMVEDI 856
            R +N             + ++Y              + +  K++K  KS AFF SMV+DI
Sbjct: 954  RNRNNIDLELSDDEDDEL-REYRIKRREIMKKKRLEVTNTDKILKTSKSKAFFMSMVDDI 1012

Query: 857  IEYKNPFGAEEEYNLDITSTATDLDTQDNSINVGDNTGNNEQKPVD-------QKNKKVI 909
            +E  NPF   +  + D      D  +  N  +  +   + + K  D          KK +
Sbjct: 1013 VETSNPFMITQPSDDDSDDNNMDSISNKNHKDANNAKKDKKDKRTDDHARLSQSSRKKFV 1072

Query: 910  ISEDFVQKSLSFLKSNNYEDFETDKELSRIQHGNDE------AIEDLYTLKQNSSIKSF- 962
            +SEDFV K+LSFL  +        KE++  QH N+        I D+ +LKQ SSIK+  
Sbjct: 1073 MSEDFVHKTLSFLTKS--------KEVNEFQHVNEHYKSQIGTINDIQSLKQKSSIKTMH 1124

Query: 963  -TNSQTDSTTSKTVNTIIDLEKRPEDEDEVENG-DTSLVGVFKHPSIIKSFASRTDINDK 1020
              +  +  T      +  D +         +N  D  L  V K PSIIK F S  DINDK
Sbjct: 1125 VLSMMSQDTNVDLDASDKDDDDMIHHAGSFDNSFDDPLSSVSKAPSIIKIFGSTHDINDK 1184

Query: 1021 FKEGNKTVKILKSYKTVGSSKASITYMGKTRKLIAP 1056
            FK+GNKTV I  SYKTVG  K SIT  G+ RKL+AP
Sbjct: 1185 FKDGNKTVTISNSYKTVGGMKTSITSFGR-RKLVAP 1219

 Score = 35.0 bits (79), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 25/67 (37%), Positives = 29/67 (43%), Gaps = 3/67 (4%)

Query: 1  MDDALHALSSLTAKKRTTTYKKVAVPILDEXXXXXXXXXXXXXXXXELTGNGFLFANATL 60
          MD    +L  L  KKRTT YKKV   +  E                     GFLFAN  L
Sbjct: 3  MDAVFDSLDELKIKKRTT-YKKVPEQVATELDKAATTISNPVPSFN--LSEGFLFANDKL 59

Query: 61 NRVKNRL 67
           ++KNRL
Sbjct: 60 EKIKNRL 66

>Kpol_2002.8 s2002 complement(11914..14871) [2958 bp, 985 aa] {ON}
            complement(11914..14871) [2958 nt, 986 aa]
          Length = 985

 Score =  270 bits (690), Expect = 3e-75,   Method: Compositional matrix adjust.
 Identities = 183/447 (40%), Positives = 241/447 (53%), Gaps = 60/447 (13%)

Query: 624  PKRIAINLGHYGDNIGEDTDKFQETNVLDTQNIEEVMAERNTIENEVKDDVYVNEEADEA 683
            P    INLGHYGDN+       QE N            ERN I+++        E  DE 
Sbjct: 575  PSLNTINLGHYGDNLS------QENN-----------NERNNIDSD--------ESEDEE 609

Query: 684  IRRQLIDXXXXXXXXXXXXHEAKIKELKKRGVTNFFXXXXXXXXXXWHGIGGADGEGSDD 743
            + ++++                K++ELK +G+T+ F          WHGIGG DGE SD+
Sbjct: 610  LYKEMVKKEIDRRRDQERKQRQKLRELKDKGITDMFEVEAEESEDEWHGIGGVDGELSDE 669

Query: 744  YDSDLEKMIDDYSKNNFNPHEIREMLAAENKEMDIKMINKILYDIKNGGFRNKRAKNXXX 803
            YDS++EKMIDDYSK NFN  EIRE LAAENK+MD+KM+N+IL DIKNGGFR +R      
Sbjct: 670  YDSEVEKMIDDYSKENFNAGEIREKLAAENKDMDLKMVNRILNDIKNGGFRKRR---NAL 726

Query: 804  XXXXXXXXXXVLQQYXXXXXXXXXXXXXXIGDDAKLVKNPKSSAFFESMVEDIIEYKNPF 863
                       L+ Y                 + KL+ N KS AF ESMV+DI+E KNPF
Sbjct: 727  EIELSDDEDDDLKAYRAKRRQLMKEKRLETDHNKKLMTNKKSHAFLESMVDDIVEVKNPF 786

Query: 864  GAEEEYNLDITSTATDLDTQDNSINVGDNTGNNEQKPVDQKNKKVIISEDFVQKSLSFLK 923
               ++  +D T                D  G+     +  K KK I+SE FVQKSLSFL 
Sbjct: 787  DERDDNIMDDTPET-------------DAEGDVNSNELLNKKKKFILSEAFVQKSLSFLS 833

Query: 924  SN-NYEDFETDKELSRIQHGNDEAIEDLYTLKQNSSIKSFTN---SQTDSTTSKTVNTII 979
            S+ N E+FE +  L++ QH +  A  D++ LK + SIKS  +   S  +S +SK     +
Sbjct: 834  SSRNLEEFEMNNNLAKEQHSH--AATDMFALKSHCSIKSLESLPGSHNNSISSK-----L 886

Query: 980  DLEKRPEDEDEVENGDTSLVGVFKHPSIIKSFASRTDINDKFKEGNKTVKILKSYKTVGS 1039
            DL          E   T   G+ K  S+IKSF+S  DI+ KFK+GNKTVK+ KSY+TVGS
Sbjct: 887  DLLHE-------EIVSTPFSGL-KQTSVIKSFSSSIDIDSKFKDGNKTVKVSKSYRTVGS 938

Query: 1040 SKASITYMGKTRKLIAPKRKTEGSHRY 1066
            +KASITY+GK RKL+ PK+K    H +
Sbjct: 939  AKASITYLGKARKLVPPKKKEHKPHSH 965

 Score =  110 bits (274), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 158/530 (29%), Positives = 240/530 (45%), Gaps = 100/530 (18%)

Query: 1   MDDALHALSSLTAKKRTTTYKKVAVPILDEXXXXXXXXXXXXXXXXELTGNG--FLFANA 58
           MD     L +L  KKRTT YKKV    +++                EL G G   LF N+
Sbjct: 1   MDFVFDGLDALKGKKRTT-YKKVTDGDVEDEPKISEFNI-------ELPGLGQSILFNNS 52

Query: 59  TLNRVKNRLEGKKAPEQNHNNGKDRSENSLPTQLISNLYDGGEELEKSEVKDNSYSEKNV 118
            L +++NRLEG     +N ++ +  ++    TQ+ISNLY+GGE+LE+ E +         
Sbjct: 53  KLKQIRNRLEGNNNDSEN-DSSQAETQVIADTQIISNLYEGGEDLEEKEER--------- 102

Query: 119 SSSFTQTQRIPVSIQQDKVFNVPIHSVNDGKPTQLIKEDGLVNETSQALKTPLTTGRPGA 178
              F Q  +I           V  H       TQ+I  D  V  +S+ ++    + +   
Sbjct: 103 --RFLQRTQI-----------VEDH-------TQII--DASVTYSSKTIE----SNKMDN 136

Query: 179 TQRIDSSGATSQTQPIKSIEPQSQIITTSSNHSNALSPKIPIIPTELIGTSPLFQSIQNR 238
           TQ+  ++  +  TQ    I    +++  + N    L  +  ++ T L       Q ++ +
Sbjct: 137 TQKYINASDSEPTQI--QISKVDKLLKITDN----LDSQKKVLDTTLET-----QELETQ 185

Query: 239 GPDTQMDVPPQTAHDEDKTQAIGIPQATHQEQKTQIDTVAQTLQDEVPHT---LKIREIQ 295
              TQ+D         DKTQ    P     ++     T  QT+ D   H+   LKI EI+
Sbjct: 186 YGKTQVDKTQVDKTQVDKTQI--FPTLVADDEIKHSSTAVQTVDDNT-HSNSELKINEIE 242

Query: 296 SELASEDS-KREKARNVEYKKPQKPIPTKKFFSKESFLA--XXXXXXXXXXXXIKLENAH 352
            +L  ED   +EK+   EYK+   P+ +K  FSK  FL               +KL +  
Sbjct: 243 RQLDEEDQILKEKSMGTEYKRNIAPVMSKVKFSKNDFLEHFDSSSSEEDEEGVVKLSSTE 302

Query: 353 PKPVQNDDELHENKSVELNLTDETRINEKRVPLLSSYANNLKREIDSSKCITLXXXXXXX 412
           P          E  ++ L  +      E +   LS+Y N LK++I+   CI         
Sbjct: 303 P----------ETAAMNLENSLPQFSKESKFIGLSNYENILKKDINKQNCIEFSD----- 347

Query: 413 XXXXXXXXXIKLSKDESVLP--ISQLSKATILNLKARLSKQNQKLSQRPNKSKDPKVDHN 470
                       S+DE+ +   +S+ SKATIL++KA LS+     S   NK+        
Sbjct: 348 ------------SEDETEVTSKVSRASKATILSIKANLSRHKPAQSSINNKNA-----LG 390

Query: 471 VLLNTLRKASRKQILDHQKEVIETKGLKLEDMAKEKEIVENLLEQEILRN 520
            L + L+KA++ QILDH+KE++E KG K+E++ KEKEIVENLLEQEI RN
Sbjct: 391 NLFSDLKKATKAQILDHKKEIMEQKGYKMEEIEKEKEIVENLLEQEIERN 440

>TPHA0E04010 Chr5 (839903..842800) [2898 bp, 965 aa] {ON} Anc_1.5
            YCL061C
          Length = 965

 Score =  261 bits (668), Expect = 2e-72,   Method: Compositional matrix adjust.
 Identities = 187/471 (39%), Positives = 251/471 (53%), Gaps = 60/471 (12%)

Query: 593  KKSHHVKHIINESDSDTEVEAKPKEKADESLPKRIAINLGHYGDNIGEDTDKFQETNVLD 652
            K+ H    I++  DSD+E+EA+  +  +  +     I+LGHYGDNI + +   +ET    
Sbjct: 523  KRKHKKTEIVD--DSDSEIEAQIVDSKE--IITANTIDLGHYGDNIIQQS---RETLNET 575

Query: 653  TQNIEEVMAERNTIENEVKDDVYVNEEADEAIRRQLIDXXXXXXXXXXXXHEAK-IKELK 711
             ++ EE     N I               E IR+Q                EAK +KE+K
Sbjct: 576  EESDEEDEERYNAI-------------ISEGIRKQ----------KELEKREAKRLKEMK 612

Query: 712  KRGVTNFFXXXXXXXXXXWHGIGGADGEGSDDYDSDLEKMIDDYSKNNFNPHEIREMLAA 771
              GV+  F          WHGIGG D + SD YDS++EKMIDDYS+ NFNP EIREMLA 
Sbjct: 613  TSGVSKMFEVEAEESEDEWHGIGGVDSDFSDAYDSEVEKMIDDYSRQNFNPSEIREMLAK 672

Query: 772  ENKEMDIKMINKILYDIKNGGFRNKRAKNXXXXXXXXXXXXXVLQQYXXXXXXXXXXXXX 831
            ENKE D+ ++NKILYDIKNGGFR ++ ++              L+ Y             
Sbjct: 673  ENKETDLALVNKILYDIKNGGFRTRKRRDRDLEFSDDDDDD--LKAYRAKRRALMREKRL 730

Query: 832  XIGDDAKLVKNPKSSAFFESMVEDIIEYKNPFGAEEEYNLDITSTATDLDTQDNSINVGD 891
             I  D K+VKNPKS AFFES+V+DIIE KNPF         I    T     DN   +  
Sbjct: 731  DIEGDKKIVKNPKSKAFFESIVDDIIETKNPFDDMNTSIEQIVEKETPTVDIDNDEKLAT 790

Query: 892  NTGNNEQKPVDQKNKKVIISEDFVQKSLSFLKSNNYED-FETDKELSRIQHGNDE---AI 947
            N        V +K KK++ISE+FVQ+SLSFL S   +D FE +      QH   E   + 
Sbjct: 791  N--------VTKKKKKIVISEEFVQRSLSFLNSCREQDEFEINN-----QHNGGEKATST 837

Query: 948  EDLYTLKQNSSIKSFTNSQTDSTTSKTVNTIIDLEKRPEDEDEVENGDTSLVGVFKHPSI 1007
             DLYTLK+ SSIK+  +  +  ++S   N    L ++P           SL    +  S+
Sbjct: 838  ADLYTLKRYSSIKTLQSVTSSRSSSIASN----LNEQP------SQSSGSLFNDLRKTSV 887

Query: 1008 IKSFASRTDINDKFKEGNKTVKILKSYKTVGSSKASITYMGKTRKLIAPKR 1058
            + SF+S  DIN KFKEG K+VK+  +YKTVGS++ASITYMG +R+L+APK+
Sbjct: 888  LNSFSSDVDINSKFKEGTKSVKVSNAYKTVGSARASITYMGTSRRLVAPKK 938

 Score =  101 bits (252), Expect = 4e-21,   Method: Compositional matrix adjust.
 Identities = 150/536 (27%), Positives = 230/536 (42%), Gaps = 115/536 (21%)

Query: 1   MDDALHALSSLTAKKRTTTYKKVAVPILDEXXXXXXXXXXXXXXXXELTGNGFLFANATL 60
           MD     L+    KK+ TTY K+   +L+E                     G LF N+ L
Sbjct: 1   MDSLFDQLNHF--KKKRTTYDKIPHDLLEEEQESEDILKNKTAKEISQLDGGILFGNSIL 58

Query: 61  NRVKNRL---------EGKKAPEQ--NHNNGKDRSENSLPTQLISNLYDGGEELEKSEVK 109
            +++NRL         +GK+A E   + +N +D ++    TQ+I+NLYDGGE+LE +E+ 
Sbjct: 59  GQIRNRLNNIDNEDKDKGKEASESITSKDNEQDSTQIFPQTQIINNLYDGGEDLE-NEIF 117

Query: 110 DNSYSEKNVSSS--FTQTQRIPVSIQQDKVFNVPIHSVNDGKPTQLIKEDGLVNETSQAL 167
            NS+ +  + +     +T     S Q +K   + I+     KP  +      VN T   L
Sbjct: 118 HNSFKKTQIITDNILIETNTNDKSTQYEKTQVITINERLSDKPLDV------VNNTQTVL 171

Query: 168 KTPLTTGRPGATQRIDSSGATSQTQPIKSIEPQSQIITTSSNHSNALSPKIPII-PTELI 226
                                  TQP+ S E ++Q++       N ++  +P+  PT+ I
Sbjct: 172 -------------------VIENTQPLPS-EIKTQVV-------NEVNSALPVTQPTQTI 204

Query: 227 GTSPLFQSIQNRGPDTQMDVPPQTAHDEDKTQAIGIPQATHQEQKTQIDTVAQTLQDEVP 286
                                         TQA  +   T QE    +D VA        
Sbjct: 205 VA----------------------------TQANEVTYDT-QELMPTVDDVAMR-----S 230

Query: 287 HTLKIREIQSELASEDS-KREKARNVEYKKPQKPIPTKKFFSKESFLAXXXXXXXXXXXX 345
             LKI +I+ EL  E    +E     E+K  +      K FSKE FL             
Sbjct: 231 TGLKITDIEKELEEEQRLAKETEFGTEFKFKESESKISKKFSKEDFLNHFDDSSSSEDET 290

Query: 346 IKLENAHPKPVQNDDELH-ENKSVELNLTDETRINEKRVPLLSSYANNLKREIDSSKCIT 404
            K  N     V   + LH +NKS       +T +  K +  L +Y +NL+R+ ++ + I 
Sbjct: 291 SK--NEKGPNVDKSEVLHPDNKS-------KTLLKVKSINGLGNYEHNLRRKANNEQIIE 341

Query: 405 LXXXXXXXXXXXXXXXXIKLSKDESVLPISQLSKATILNLKARLSKQNQKLSQRPNKSKD 464
                                 D ++ P S  SKA ILN++A  SKQ  K+SQ+ +++  
Sbjct: 342 FSESDEDS--------------DTNISP-SYASKAVILNIRANKSKQQPKVSQKSDQTT- 385

Query: 465 PKVDHNVLLNTLRKASRKQILDHQKEVIETKGLKLEDMAKEKEIVENLLEQEILRN 520
                 +L N L++AS++QI+ +QKE++E KG+ LE++ KE EIVENLLEQEI RN
Sbjct: 386 ----LLMLYNNLKRASKEQIVSYQKELMEKKGINLEELEKENEIVENLLEQEIARN 437

>ZYRO0F18480g Chr6 (1524051..1526933) [2883 bp, 960 aa] {ON} weakly
            similar to uniprot|P25588 Saccharomyces cerevisiae
            YCL061C MRC1 S-phase checkpoint protein found at
            replication forks required for DNA replication also
            required for Rad53p activation during DNA replication
            stress where it forms a replication-pausing complex with
            Tof1p and is phosphorylated by Mec1p protein involved in
            replication checkpoint
          Length = 960

 Score =  233 bits (595), Expect = 8e-63,   Method: Compositional matrix adjust.
 Identities = 171/441 (38%), Positives = 236/441 (53%), Gaps = 61/441 (13%)

Query: 620  DESLPKRIAINLGHYGDNIGEDTDKFQETNVLDTQNIEEVMAERNTIENEVKDDVYVNEE 679
            D++LP+ I I+LG YG+N+                N EE M      EN    D    + 
Sbjct: 551  DDTLPRNI-IDLGPYGNNL--------------QVNHEEDM------ENLPLSDSAEIDA 589

Query: 680  ADEAIRRQLIDXXXXXXXXXXXXHEAKIKELKKRGVTNFFXXXXXXXXXXWHGIGGADGE 739
            A+E    +LI              E ++K++K +G+              W G+GG DG+
Sbjct: 590  AEEEKTNELIMEKIRKIEMRKKKKEQRLKDMKAKGLNKMLEMEAEESEDEWKGVGGVDGD 649

Query: 740  GSDDYDSDLEKMIDDYSKNNFNPHEIREMLAAENKEMDIKMINKILYDIKNGGFRNKRAK 799
             SD++DSDLE+MIDD++K+N N  ++R++LA ENKE+D KM+NKILYDIKNGGFR KR +
Sbjct: 650  LSDEHDSDLEEMIDDFTKSNENFDDVRQLLAKENKELDEKMVNKILYDIKNGGFR-KRGR 708

Query: 800  NXXXXXXXXXXXXXVLQQYXXXXXXXXXXXXXXIGDDAKLVKNPKSSAFFESMVEDIIEY 859
            N              L+ Y                D  K  +N KS AF ESMV+DI E 
Sbjct: 709  NALDLELSDDEDED-LRNYRLKRRELMKKSRIEGKDKEKAFRNAKSKAFLESMVDDIDES 767

Query: 860  KNPFGAEEEYNLDITSTATDLDTQDNSINVGDNTGNNEQKPVDQKNKKVIISEDFVQKSL 919
            KNPFG  E   +D+    TD+DTQ+N     D   N E         K  +S++FVQ+SL
Sbjct: 768  KNPFGDPE---MDVEDN-TDVDTQEN-----DYPKNKE---------KNTLSQEFVQRSL 809

Query: 920  SFLKSNN-YEDFETDKELSRIQHGNDEAIEDLYTLKQNSSIKSFTNSQTDSTTSKTVNTI 978
            SFL +NN   +FE  ++   I  G++E  +D+ +LK+NSSI +  NS   S+  K     
Sbjct: 810  SFLSNNNSSREFELGEQ---ITLGDEE--QDVSSLKRNSSIHALHNS---SSPIKE---- 857

Query: 979  IDLEKRPEDEDEVENGDTSLVGVFKHPSIIKSFASRTDINDKFKEGNKTVKILKSYKTVG 1038
             DLEK  +DED +       +  FK PS+IKS A   D N+KF+ G KTV + KSY+ VG
Sbjct: 858  -DLEKENQDEDFI------TLPNFKPPSLIKSLAGGFDPNNKFQSGKKTVTVSKSYRAVG 910

Query: 1039 SSKASITYMGKTRKLIAPKRK 1059
             S++SITY GK RKL+ PK +
Sbjct: 911  GSRSSITYFGKMRKLVGPKNR 931

 Score =  159 bits (402), Expect = 6e-39,   Method: Compositional matrix adjust.
 Identities = 172/541 (31%), Positives = 252/541 (46%), Gaps = 119/541 (21%)

Query: 1   MDDALHALSSLTAKKRTTTYKKVAVPILDEXXXXXXXXXXXXXXXXELTGNGFLFANATL 60
           MD  L  L  L++K+RTT YKKV                        + GNGFLF N+T+
Sbjct: 1   MDSLLEKLDPLSSKRRTT-YKKVFE-----PQEEEETQQISNSPPPPILGNGFLFQNSTI 54

Query: 61  NRVKNRL----EGKKAPEQNHNNGKDRSENSL-PTQLISNLYDGGEELE---KSEVKDNS 112
           ++V+NRL    +G    +Q     +   E  L  TQ+I++LY+G EELE   K  V+   
Sbjct: 55  DKVRNRLRNAEDGANKVQQKEQEQEQEQETQLNQTQVIADLYEGAEELEEQNKERVR-LP 113

Query: 113 YSEKNVSSSFTQTQRIPVSIQQDKVFNVPIHSVNDGKPTQLIKEDGLVNETSQALKTPLT 172
            S+K  S+S  +TQ IP +                  PT     +G+ N   Q      T
Sbjct: 114 LSKKTSSASQEKTQVIPWA------------------PTV----EGVENNVEQG-----T 146

Query: 173 TGRPGATQRIDSSGATSQ-TQPIKSIEPQSQIITTSSNHSNALSPKIPIIPTELIGTSPL 231
                 TQ++ +  +  Q TQ I+S + Q+++                          PL
Sbjct: 147 DIHEEKTQQVPNEISYDQKTQAIQSFQ-QTEV-------------------------EPL 180

Query: 232 FQSIQNRGPDTQMDVPPQTAHDEDKTQAIGIPQATHQEQK--TQIDT----VAQTLQDEV 285
            Q I    P+  +DVP   A  ED        Q   QEQ   TQ+D     + Q    ++
Sbjct: 181 TQRISE--PERTLDVPTYAATSED--------QLDTQEQNPITQLDISNSLLFQATDSDI 230

Query: 286 PHT----LKIREIQSELASEDSKREKARNVEYKKPQKPIPTKKFFSKESFLAXXXXXXXX 341
           P +    LK+ +I+ EL  +  +R+  RN+EY+ P+KP+  K+ FSKE+FL         
Sbjct: 231 PKSPPQRLKMHDIEKELEEKRQERDHRRNIEYRAPEKPVNVKRVFSKEAFLKNFDEESSS 290

Query: 342 XXXXIKLE--NAHPKPVQNDDELHENKSVELNLTDETRINEKRVPLLSSYANNLKREIDS 399
               I+L   +   K  + D    EN          T  + +R  + S Y   LK E+DS
Sbjct: 291 EDELIELRSRDIEKKHTEKDKSTLEN----------TTESSQRQRVFSVYEYKLKGELDS 340

Query: 400 SKCITLXXXXXXXXXXXXXXXXIKLSKDESVLPISQLSKATILNLKARLSKQNQKLSQRP 459
            +CI L                   S ++  +P+S++SKAT+L++KAR SKQ + LS   
Sbjct: 341 KRCIQLDDDEDE-------------SDEDVEVPLSRVSKATVLDIKARRSKQ-EPLS--- 383

Query: 460 NKSKDPKVDHNVLLNTLRKASRKQILDHQKEVIETKGLKLEDMAKEKEIVENLLEQEILR 519
            K K  K   N L+ TL+KAS+KQI DHQ E+++++G KLED+ K+KE +ENLLEQEI R
Sbjct: 384 -KIKQKKTTLNDLICTLKKASKKQITDHQNELMKSRGYKLEDIEKQKEEIENLLEQEIAR 442

Query: 520 N 520
           N
Sbjct: 443 N 443

>CAGL0B00330g Chr2 complement(18031..21441) [3411 bp, 1136 aa] {ON}
            similar to uniprot|P25588 Saccharomyces cerevisiae
            YCL061c
          Length = 1136

 Score =  229 bits (583), Expect = 8e-61,   Method: Compositional matrix adjust.
 Identities = 151/354 (42%), Positives = 207/354 (58%), Gaps = 38/354 (10%)

Query: 706  KIKELKKRGVTNFFXXXXXXXXXXWHGIGGADGEGSDDYDSDLEKMIDDYSKNNFNPHEI 765
            K++EL  +GV  +F          W GIGG DG+   +YDS++EKMIDDYSK   +   +
Sbjct: 794  KLQELANKGVNQYFEEEAEESDDEWRGIGGVDGDDFGEYDSEVEKMIDDYSKTEVDLTSL 853

Query: 766  REMLAAENKEMDIKMINKILYDIKNGGFRNKRAKNXXXXXXXXXXXXXVLQQYXXXXXXX 825
            R+ +  ENKEMD+K++NKILYDIKNGGFR KR +N              LQ++       
Sbjct: 854  RQKIMDENKEMDLKLVNKILYDIKNGGFR-KRGRNDMELEFSDDEDAE-LQEFRRKRREL 911

Query: 826  XXXXXXXIGDDAKLVKNPKSSAFFESMVEDIIEYKNPFGAEEEYNLDITSTATDLDTQDN 885
                     D  KL KNPKS AFFESM+ D++E KN        N D  S   +L  ++ 
Sbjct: 912  MKQRMLENEDTDKLTKNPKSKAFFESMIVDLVEDKN--------NFDDLSDQIEL--KEE 961

Query: 886  SINVGDNTGN-NEQKPVDQKNKKVIISEDFVQKSLSFLKSN-NYEDFETDKELSRIQHGN 943
            +I   DN    NE K    K  K+ ISEDFVQK+LSFL ++ + ++F+    +S+     
Sbjct: 962  NITQEDNEKEYNEAKS--NKRGKIRISEDFVQKTLSFLHNDESTQEFQPSFIMSK----- 1014

Query: 944  DEAIEDLYTLKQNSSIKSFTNSQTDSTTSKTVNTIIDLEKRPEDEDEVENGDTSLVGVFK 1003
            ++ I D+  LK NSS+ SF +    ST+ K +N         ++ED +E  ++     FK
Sbjct: 1015 EKGIGDMNALKSNSSL-SFCSKL--STSRKIIN---------DEEDVIEEFES-----FK 1057

Query: 1004 HPSIIKSFASRTDINDKFKEGNKTVKILKSYKTVGSSKASITYMGKTRKLIAPK 1057
             PSII+SF+S+  I+DKFK+GNK+VK+  SYKTVG SKASITY+GKTRKL+ PK
Sbjct: 1058 RPSIIQSFSSKFTIDDKFKDGNKSVKVSTSYKTVGGSKASITYLGKTRKLVPPK 1111

 Score = 85.1 bits (209), Expect = 6e-16,   Method: Compositional matrix adjust.
 Identities = 104/371 (28%), Positives = 168/371 (45%), Gaps = 72/371 (19%)

Query: 177 GATQRIDSSGATSQTQPIKSIEPQSQIITTSSNHSNALSPKIPIIPTELIGTSPLFQSIQ 236
           GATQ +      S  Q IK  E ++ + ++   H+   +P   I+P     +S   QS  
Sbjct: 289 GATQHVPIETQNSYLQTIKDHEDKT-VGSSKDLHTPNFNPNTSILPLFKNNSSEEAQS-- 345

Query: 237 NRGPDTQMDVPPQTAHDEDKTQAIGIPQATHQEQKTQIDTVAQTLQDEVPHTLKIREIQS 296
               +TQ+DV  +  H   KT+          E  TQ+D        ++   L I +I+ 
Sbjct: 346 ----ETQIDVVHEEVH---KTK----------ENDTQMDDT------QITEVLAITKIEQ 382

Query: 297 ELASEDSKREKARNVEYKKPQKP--IPTKKFFSKESFLAXXXXXXXXXXXXIKLEN---- 350
           EL + D +    +  EY   + P  +P K  F+KE  L             I  E     
Sbjct: 383 ELEN-DERAITDKQTEYIPKRSPNVLPAKSQFTKEKLLQNFDSSSSDEEDTILGEKQKDQ 441

Query: 351 --AHPKPVQNDDELHENK-----SVELNLTD---ETRINEKRVPL-----------LSSY 389
             +  + ++N+D + + K     S E N +D      I+ +  P+           L +Y
Sbjct: 442 NLSDSESLENNDIMTDQKTSVTPSSEYNGSDNEHSASISLRSSPISKPRWKSSSMILPAY 501

Query: 390 ANNLKREIDSSKCITLXXXXXXXXXXXXXXXXIKLSKDESVLPISQLSKATILNLKARLS 449
            NNLK+++++ K                            +  +S  SKAT+LNLK RLS
Sbjct: 502 VNNLKQKVENKKL-------------QLSSDSDDEVDSAVIYKLSNKSKATLLNLKVRLS 548

Query: 450 KQNQKLSQRPNKSKDPKVDHNVLLNTLRKASRKQILDHQKEVIETKGLKLEDMAKEKEIV 509
           K+  K  ++ +  KD     N+L N LRKA+++QI+ H+KE++E++GL  ED+ K+K +V
Sbjct: 549 KK--KPVKKVHNEKDST---NLLFNNLRKATKQQIMLHRKELMESRGLNFEDLEKQKVMV 603

Query: 510 ENLLEQEILRN 520
           E+LLE+EI RN
Sbjct: 604 EDLLEKEIERN 614

>TDEL0C06970 Chr3 (1264155..1266980) [2826 bp, 941 aa] {ON} Anc_1.5
            YCL061C
          Length = 941

 Score =  221 bits (564), Expect = 5e-59,   Method: Compositional matrix adjust.
 Identities = 166/438 (37%), Positives = 231/438 (52%), Gaps = 74/438 (16%)

Query: 628  AINLGHYGDNIGEDTDKFQETNVLDTQNIEEVMAERNTIE--NEVKDDVYVNEEADEA-I 684
            AINLG YGDN+           +  T++     AE +T +  NE+ +  Y   E +++ I
Sbjct: 542  AINLGAYGDNL-----------ITTTKDEAHTSAEEHTTQLVNEISESQYRTMEKEKSKI 590

Query: 685  RRQLIDXXXXXXXXXXXXHEAKIKELKKRGVTNFFXXXXXXXXXXWHGIGGADGEGSDDY 744
            R Q                + ++K++K+ GVTN F          W G+GG DGE  DDY
Sbjct: 591  RAQ--------------EEKQRLKQMKESGVTNMFDMEAEESDDEWRGVGGVDGETIDDY 636

Query: 745  DSDLEKMIDDYSKNNFNPHEIREMLAAENKEMDIKMINKILYDIKNGGFRNKRAKNXXXX 804
            DSDLEKMIDD+S    N  +IR++L AENKE D+K +NKIL+DIKNGGFR +R  N    
Sbjct: 637  DSDLEKMIDDFSNTTSNADQIRQLLMAENKETDLKTVNKILHDIKNGGFRKRRQNNLQLE 696

Query: 805  XXXXXXXXXVLQQYXXXXXXXXXXXXXXIG-DDAKLVKNPKSSAFFESMVEDIIEYKNPF 863
                      L  Y               G DD KL+KN +S AFFESMVEDII+ K+PF
Sbjct: 697  LSDDEDDE--LLNYKKRKLELMRKRRLQFGADDKKLLKNSRSKAFFESMVEDIIDLKDPF 754

Query: 864  GAEEEYNLDITSTATDLDTQDNSINVGDNTGNNEQKPVDQKNK-KVIISEDFVQKSLSFL 922
              + E         ++ D +   +             VD  NK K  IS +FVQ+SLS  
Sbjct: 755  SNQAE--------TSEKDKKSEGL-------------VDASNKQKDTISHEFVQQSLS-- 791

Query: 923  KSNNYEDFETDKELSRI-QHGNDEAIEDLYTLKQNSSIKSFTNSQTDSTTSKTVNTIIDL 981
              ++  DF ++ E++R+ Q G  E   DL +LKQ+S++K+              + II  
Sbjct: 792  FLSSSRDF-SEFEVARVSQEG--ERNTDLNSLKQDSTVKTLY----------APSNIISE 838

Query: 982  EKRPEDEDEVENGDTSLVGV-FKHPSIIKSFASRTDINDKFKEGNKTVKILKSYKTVGSS 1040
             +R + E+     D S++ V   + S++KSF    + NDK KEG KTV + KSY+TVG +
Sbjct: 839  SERADHEE----FDNSVLPVESSYSSVVKSFGFDLNANDKLKEGRKTVTVSKSYRTVGGN 894

Query: 1041 KASITYMGKTRKLIAPKR 1058
            KASITY+GK RKL+APK+
Sbjct: 895  KASITYLGKMRKLVAPKK 912

 Score =  139 bits (350), Expect = 9e-33,   Method: Compositional matrix adjust.
 Identities = 149/486 (30%), Positives = 230/486 (47%), Gaps = 104/486 (21%)

Query: 48  LTGNGFLFANATLNRVKNRLEGKKAPEQNHNNGKDRSENSL-PTQLISNLYDGGEELEKS 106
           + GNGFLF ++TL++VKNRL          N  +++   ++  TQ++SNLY+ GE+LEK 
Sbjct: 40  VLGNGFLFNSSTLDKVKNRL----------NKDQEQGTQAIDTTQVLSNLYEDGEDLEK- 88

Query: 107 EVKDNSYSEKNVSSSFTQTQRIPVSIQQDKVFNVPIHSVNDGKPTQLIKEDGLVNETSQA 166
                                +P SI Q K  + PI       PT LI      +   + 
Sbjct: 89  --------------------EVP-SILQSK--SKPI-------PTILIP-----SIEREI 113

Query: 167 LKTPLTTGRPGATQRIDSSGATSQTQPIKSIEPQSQIITTSSNHSNALSPKIP---IIP- 222
           LK P            ++   T  T PI     +S  IT + +  +  SP+IP    IP 
Sbjct: 114 LKQPFN----------ENHNFTGVTVPI----AKSSAITKNLDREDLESPEIPETQPIPD 159

Query: 223 ---TELIGTSPLFQSIQNRGPDTQMDVPPQTAHDEDKTQAIGIPQATHQEQK-TQIDTVA 278
              +++   + + ++      DT        A++E  TQ + + + T+ +Q+ +Q D + 
Sbjct: 160 FSASDVPTQTQVLKTTSETAADTGTVATAAIAYEESLTQ-VEVSEQTYPDQRNSQEDIIQ 218

Query: 279 QTLQDEVPHT-LKIREIQSELASEDSKREKARNVEYKKPQKPIPTKKFFSKESFLAXXXX 337
           QT  D VP T LKI EI+   + E     K   V+Y+ P +P+   K F+KE+F+     
Sbjct: 219 QTAADAVPITRLKIHEIEEMWSREVQTETKEHKVKYRAP-RPL---KVFTKEAFMQDFDK 274

Query: 338 XXXXXXXXIKLENAHPKPV-QNDDELHENKSVELNLTDETRINEKRVPLLSSYANNLKRE 396
                      E     P+ +N+D +      E+  +D   + +K    L++Y   LK +
Sbjct: 275 SSDSDSDVFDQEIKATSPIGRNNDSIS-----EVGTSDVKVLKDKSSGALTAYQRELKEK 329

Query: 397 IDSSKCITLXXXXXXXXXXXXXXXXIKLSKDESVLPI--SQLSKATILNLKARLSKQNQK 454
            + +K + L                +  S DE  L +  S  +KAT+L LKARLSK+   
Sbjct: 330 AEIAKGVML----------------LSESDDEEDLAVSTSHEAKATVLKLKARLSKR--- 370

Query: 455 LSQRPNKSKDPKVDHNVLLNTLRKASRKQILDHQKEVIETKGLKLEDMAKEKEIVENLLE 514
             + P +S+  K   + L+  LR ++++QILD QKE IE +GLK ED+ KEKEIVENLLE
Sbjct: 371 --RPPVESQHGKASLSALMKNLRNSTKRQILDRQKEGIERQGLKFEDVEKEKEIVENLLE 428

Query: 515 QEILRN 520
           QEI RN
Sbjct: 429 QEIARN 434

>Ecym_1008 Chr1 complement(13340..16696) [3357 bp, 1118 aa] {ON}
            similar to Ashbya gossypii AFR745W
          Length = 1118

 Score =  211 bits (538), Expect = 3e-55,   Method: Compositional matrix adjust.
 Identities = 143/372 (38%), Positives = 199/372 (53%), Gaps = 58/372 (15%)

Query: 706  KIKELKKRGVTNFFXXXXXXXXXXWHGIGGADGEGSDDYDSDLEKMIDDYSKNNFNPHEI 765
            K KE++K GV              WHG+GG D E SD+YDSDL+KMIDDY+KN F+P EI
Sbjct: 773  KQKEMRKLGVNKMVELEADESEDEWHGVGGVDYEASDEYDSDLDKMIDDYNKNEFDPVEI 832

Query: 766  REMLAAENKEMDIKMINKILYDIKNGGFRNKRAKNXXXXXXXXXXXXXVLQQYXXXXXXX 825
            R++LA+E+ + D  M+NKIL+DIK GGFR KR +              +LQ Y       
Sbjct: 833  RKILASEDLQHDKNMVNKILHDIKTGGFR-KRGRG-ELDLELSEDEDGILQSYRAKRWNE 890

Query: 826  XXXXXXXIGDDAKLVKNPKSSAFFESMVEDIIEYKNPFGAEEEYNLDITSTATDLDTQDN 885
                      +  +  NPKS  FFESMV             +E+ + +      L T D+
Sbjct: 891  QKQKMLDSEHNTSVKSNPKSLPFFESMV-------------DEFTIPVERA---LGTPDS 934

Query: 886  ----SINVGDNTGNNEQKPVDQKNKKVIISEDFVQKSLSFLKSN-NYEDFETDKELSRIQ 940
                S NV +   N +Q        K++ISE FV+++LSFL S+ N  +  ++  + +  
Sbjct: 935  PPAQSTNVLELKQNTKQ--------KIVISEHFVKQTLSFLTSDENMTNMRSEINVEKPN 986

Query: 941  HGND---EAIEDLYTLKQNSSIKSFTNSQTDSTTSKTVNTIIDLEKRPEDEDEVENGDTS 997
            + ND     +EDLYTLK+ S+I             K +NT        EDED  E G   
Sbjct: 987  NDNDIYSSEVEDLYTLKETSTI-------------KVLNTYSGKPIVNEDEDGAEFG--- 1030

Query: 998  LVGVFKHPSIIKSFASRTDINDKFKEGNKTVKILKSYKTVGSSKASITYMGKTRKLIAPK 1057
                FK PS++++F SR D+NDKFK+G K+VKI   YKT+GSS+A+IT++GK RKLI PK
Sbjct: 1031 ----FKAPSVMQTFGSRNDVNDKFKDGFKSVKISNKYKTLGSSRAAITFLGKKRKLIIPK 1086

Query: 1058 RKT----EGSHR 1065
            R +    + +HR
Sbjct: 1087 RSSKSPRDSAHR 1098

 Score = 68.9 bits (167), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 40/91 (43%), Positives = 62/91 (68%), Gaps = 4/91 (4%)

Query: 431 LPISQLSKATILNLKARLSKQNQKLSQRPNKS-KDPKVDHNVLLNTLRKASRKQILDHQK 489
              S + KA +LN+KA++SK N  LS+   +S   P +    L  +L+KA++KQILDH++
Sbjct: 436 FATSTMVKAALLNIKAKISK-NMNLSKNAEQSINSPTLKQ--LFISLKKANKKQILDHRR 492

Query: 490 EVIETKGLKLEDMAKEKEIVENLLEQEILRN 520
           E+ E +G+ LE + +E+E VE+LLEQ+I RN
Sbjct: 493 EITEKRGISLEQLEQEREKVEDLLEQKIKRN 523

>KLLA0C00484g Chr3 complement(35397..38174) [2778 bp, 925 aa] {ON}
            weakly similar to uniprot|P25588 Saccharomyces cerevisiae
            YCL061C MRC1 S-phase checkpoint protein found at
            replication forks required for DNA replication also
            required for Rad53p activation during DNA replication
            stress where it forms a replication-pausing complex with
            Tof1p and is phosphorylated by Mec1p protein involved in
            replication checkpoint
          Length = 925

 Score =  210 bits (534), Expect = 3e-55,   Method: Compositional matrix adjust.
 Identities = 166/454 (36%), Positives = 222/454 (48%), Gaps = 90/454 (19%)

Query: 627  IAINLGHYGDNIGEDTDKFQETNVLDTQNIEEVMAERNTIEN-EVKDD------VYVNE- 678
            I INLGHYGDN+         +NV  T+N     ++RN   N E+K +      + V E 
Sbjct: 515  IGINLGHYGDNL-------TSSNV--TENDGADQSDRNVPSNSELKMNRSHSAKLLVGEL 565

Query: 679  -------------EADEAIRRQLIDXXXXXXXXXXXXHEAKIKELKKRGVTNFFXXXXXX 725
                         E DE  R +L +             + + + LK  G+          
Sbjct: 566  SSDSSVDSDSSEDELDEVERNRLQERAKMRRRMEIEAAKKRKQVLKSTGLNKILEMEAEE 625

Query: 726  XXXXWHGIGGADGEGSDDYDSDLEKMIDDYSKNNFNPHEIREMLAAENKEMDIKMINKIL 785
                WHG+GGADGE SDDYDSDL+ MIDD+SK+ F+   IRE LA ENKEMD +MINKIL
Sbjct: 626  SEDEWHGVGGADGENSDDYDSDLDTMIDDFSKSKFDTASIRERLALENKEMDERMINKIL 685

Query: 786  YDIKNGGFRNKRAKNXXXXXXXXXXXXXVLQQYXXXXXXXXXXXXXXIGDDAKLVKNPKS 845
            +DI  GGFR KR +              +L+Q+                D   +V N KS
Sbjct: 686  HDINTGGFR-KRGRGALDLELSDDEDE-LLRQFREKRREIMKQKLLENVDG--VVNNSKS 741

Query: 846  SAFFESMVEDIIEYKNPFGAEEEYNLDITSTATDLDTQDNSINVGDNTGNNEQKPVDQKN 905
             AFF+SMVEDI     P          +TS +          N  D  G           
Sbjct: 742  KAFFDSMVEDITRKSIPA---------VTSFS----------NTRDEMGK---------- 772

Query: 906  KKVIISEDFVQKSLSFL--KSNNYEDFETDKELSRIQHGNDEAIEDLYTLKQNSSIKSFT 963
            KK++ISE+FVQ SLSFL  K ++  +FE       +     +A EDL +LKQ S+IKS  
Sbjct: 773  KKIVISEEFVQSSLSFLSAKDDDINEFE-------VTEAAHDATEDLESLKQRSNIKSLD 825

Query: 964  NSQTDSTTSKTVNTIIDLEKRPEDEDEVENGDTSLVGVFKHPSIIKSFASRTDINDKFKE 1023
            + Q +  ++                D+V+   TSL   FK PSI+KSF+S +D+NDKFK 
Sbjct: 826  SPQRNRNSAFF--------------DDVDG--TSLD--FKLPSIVKSFSSNSDVNDKFKT 867

Query: 1024 GNKTVKILKSYKTVGSSKASITYMGKTRKLIAPK 1057
            G KTV I KSY+    S+++IT++GK RKL AP+
Sbjct: 868  GIKTVTISKSYRVASGSRSAITFLGKKRKLKAPQ 901

 Score = 45.1 bits (105), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 34/91 (37%), Positives = 51/91 (56%), Gaps = 10/91 (10%)

Query: 434 SQLSKATILNLKARLSKQNQKLSQRPNKSKDPKVDH----NVLLNTLRKASRKQILDHQK 489
           SQ SKA +L +KA+ S+       +  K+K+  V        L  +L+  +R QIL+ ++
Sbjct: 336 SQSSKAALLLIKAKRSRN------KATKAKNMHVSTVDSLKELFTSLKTKNRDQILEFRR 389

Query: 490 EVIETKGLKLEDMAKEKEIVENLLEQEILRN 520
           E+   KG+ LE +  EK  VE LLEQE+ RN
Sbjct: 390 EISGKKGISLEAIEDEKIQVEKLLEQELERN 420

>AFR745W Chr6 (1803046..1806102) [3057 bp, 1018 aa] {ON} Syntenic
            homolog of Saccharomyces cerevisiae YCL061C (MRC1)
          Length = 1018

 Score =  201 bits (510), Expect = 4e-52,   Method: Compositional matrix adjust.
 Identities = 134/384 (34%), Positives = 197/384 (51%), Gaps = 49/384 (12%)

Query: 678  EEADEAIRRQLIDXXXXXXXXXXXXHEAKIKELKKRGVTNFFXXXXXXXXXXWHGIGGAD 737
            +E D+  RR+++             ++ + +E+KK+G+T             WHGIGG+D
Sbjct: 649  DELDQETRRKILSDLLARNRKRAERNKLRRREMKKKGITKMLEMEAEESEDEWHGIGGSD 708

Query: 738  GEGSDDYDSDLEKMIDDYSKNNFNPHEIREMLAAENKEMDIKMINKILYDIKNGGFRNKR 797
             E S+DYDS++EKMIDDYS ++ N   +R +LA   ++ D  ++NKIL+DI  GGFR +R
Sbjct: 709  NELSEDYDSEVEKMIDDYSVHSSNADHLRAILAKNERQHDENIVNKILHDISTGGFR-RR 767

Query: 798  AKNXXXXXXXXXXXXXVLQQYXXXXXXXXXXXXXXIGDDAKLVKNPKSSAFFESMVEDII 857
             K               LQQ+               GD +KLV NPKS AFF++MV+D+ 
Sbjct: 768  GKGALDLEMSENEDQE-LQQFRQKRRELLKQKILENGDTSKLVSNPKSYAFFQTMVDDVT 826

Query: 858  EYKNPFGAEEEYNLDITSTATDLDTQDNSINVGDNTGNNEQKPVDQKNKKVIISEDFVQK 917
            E    FG   + N+D                        E+       +K++ISE FV++
Sbjct: 827  EAS--FGNTFDANID------------------------EKTDPSAAGRKIVISEQFVKE 860

Query: 918  SLSFLKSNNYEDFETDKELSRIQHGN--DEAIEDLYTLKQNSSIKSFTNSQTDSTTSKTV 975
            +LSFL S +  D E   E   I       E I+DL+TLKQNS+IK    S          
Sbjct: 861  TLSFLSSKSG-DSEIPAETKSISSSTVEREEIQDLHTLKQNSNIKHLKGS---------- 909

Query: 976  NTIIDLEKRPEDEDEVENGDTSLVG--VFKHPSIIKSFASRTDINDKFKEGNKTVKILKS 1033
               ++L   P    E+ +GD    G  + +  S  KSF + T+++DKFK G K V+ILK+
Sbjct: 910  ---LEL---PAQMAELSSGDEGDYGFSLDRFRSAAKSFNNGTNVDDKFKSGTKAVRILKA 963

Query: 1034 YKTVGSSKASITYMGKTRKLIAPK 1057
             KT+G SKA+IT++G+ R+LI PK
Sbjct: 964  NKTIGGSKAAITFIGRKRRLIPPK 987

 Score = 54.3 bits (129), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 33/84 (39%), Positives = 56/84 (66%), Gaps = 4/84 (4%)

Query: 434 SQLSKATILNLKARLSKQNQKLSQRPNKSKDPKVDHNVLLNTLRKASRKQILDHQKEVIE 493
           S +SKA +L +KAR SK      Q+ +++K  K   N L   LRKA+R+Q+L+ ++  IE
Sbjct: 382 SAVSKAAVLAIKARNSKF--ITPQKIDETKSSK--SNELFAKLRKANREQLLEQRRNAIE 437

Query: 494 TKGLKLEDMAKEKEIVENLLEQEI 517
            +G+ ++++ +E+E + NLLEQE+
Sbjct: 438 RRGINMQNLEQEREQLGNLLEQEL 461

>KLTH0F00484g Chr6 complement(37017..39998) [2982 bp, 993 aa] {ON}
            weakly similar to uniprot|P25588 Saccharomyces cerevisiae
            YCL061C MRC1 S-phase checkpoint protein found at
            replication forks required for DNA replication also
            required for Rad53p activation during DNA replication
            stress where it forms a replication-pausing complex with
            Tof1p and is phosphorylated by Mec1p protein involved in
            replication checkpoint
          Length = 993

 Score =  192 bits (488), Expect = 2e-49,   Method: Compositional matrix adjust.
 Identities = 152/452 (33%), Positives = 217/452 (48%), Gaps = 68/452 (15%)

Query: 629  INLGHYGDNIG-----------EDTDKFQETNVLDT-QNIEEVMAERNTIENEVKDDVYV 676
            I+LG YG NIG           E      E ++  T +N   +     +   +V+D+ + 
Sbjct: 559  IDLGAYGSNIGNLNQIEQEQVGEHVGAHIENDLTTTGRNKNLIKPSSRSSSFQVEDNSH- 617

Query: 677  NEEADEAIRRQLIDXXXXXXXXXXXXHEAKIKELKKRGVTNFFXXXXXXXXXXWHGIGGA 736
             E+ +  + R+LI+             EAK+++L +   +             WHGIGG 
Sbjct: 618  -EDMNPGVIRELIEKHKRKELL----REAKLEKLHQSKASRIIDYEAEESDDEWHGIGGV 672

Query: 737  DGEGSDDYDSDLEKMIDDYSKNNFNPHEIREMLAAENKEMDIKMINKILYDIKNGGFRNK 796
            DGE  DD+DSDLEKMIDDYS + F+  E+R+    E    D  M+NKIL+DI+ GGFR K
Sbjct: 673  DGERFDDHDSDLEKMIDDYSNSRFDSSEVRKRQIEEEISEDKSMVNKILHDIETGGFR-K 731

Query: 797  RAKNXXXXXXXXXXXXXVLQQYXXXXXXXXXXXXXXIGDDAKLVKNPKSSAFFESMVEDI 856
            R +N             +  +Y               G+   L +NPKS AFFE++VEDI
Sbjct: 732  RGRNALDLELSDDDDEEL-LKYHSRRKELLRQKVSAQGEAKLLAENPKSKAFFETIVEDI 790

Query: 857  IEYKNPFGAEEEYNLDITSTATDLDTQDNSINVGDNTGNNEQKPVDQKNKKVIISEDFVQ 916
               ++    E+E    +   +        S+N  +   ++     D+K KK ++SE FVQ
Sbjct: 791  ---RSKGALEDEGPPPVRGFS--------SVNAPEEKNSDS----DKKGKKTVLSEAFVQ 835

Query: 917  KSLSFLKS----------NNYEDFETDKELSRIQHGNDEAIEDLYTLKQNSSIKSFTNSQ 966
            ++LSFL S          NN     T      +   N E  +D++ LKQNSSIKS +   
Sbjct: 836  QTLSFLTSGEVGEEKGPENNLGSLPT-----HVPSFNTEETQDIFALKQNSSIKSLS--- 887

Query: 967  TDSTTSKTVNTIIDLEKRPEDEDEVENGDTSLVGVFKHPSIIKSFASRTDINDKFKEGNK 1026
              + T  + N +ID     + ED        L+   +  S    F  R D N+KF+EG K
Sbjct: 888  --APTRNSSNMLID-----DQED--------LLSRKRACSFFARFTKRVDANEKFEEGKK 932

Query: 1027 TVKILKSYKTVGSSKASITYMGKTRKLIAPKR 1058
            TV+ L SYK  GSSKASITY+GK RKL APK+
Sbjct: 933  TVRSLNSYKVAGSSKASITYLGKARKLNAPKK 964

 Score = 69.3 bits (168), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 37/83 (44%), Positives = 57/83 (68%)

Query: 438 KATILNLKARLSKQNQKLSQRPNKSKDPKVDHNVLLNTLRKASRKQILDHQKEVIETKGL 497
           KA IL+LKARLSK++Q L    +K       H +L  +LRKA++ QILD++KE  ++KG+
Sbjct: 360 KAAILDLKARLSKKSQSLLIPRSKVTSNFSSHQILFASLRKANKSQILDYRKEKYQSKGI 419

Query: 498 KLEDMAKEKEIVENLLEQEILRN 520
             + + +EK  +E+LLE+E+ RN
Sbjct: 420 DYDKITEEKNSIESLLERELARN 442

 Score = 37.7 bits (86), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 25/64 (39%), Positives = 36/64 (56%), Gaps = 11/64 (17%)

Query: 48  LTGNGFLFANATLNRVKNRLEGKKAPEQNHNNGKDRS--ENSLP----TQLISNLYDGGE 101
           +TG GFLF N+ L RVK+RL      ++NH     +S  +N       TQ++   YD GE
Sbjct: 31  VTGTGFLFGNSVLRRVKSRL----GDDENHEADSTKSPIDNGCCDLSQTQVVGLAYD-GE 85

Query: 102 ELEK 105
           +LE+
Sbjct: 86  DLEQ 89

>Kwal_33.13005 s33 complement(36797..39709) [2913 bp, 970 aa] {ON}
            YCL061C (MRC1) - protein involved in replication
            checkpoint [contig 123] FULL
          Length = 970

 Score =  182 bits (462), Expect = 3e-46,   Method: Compositional matrix adjust.
 Identities = 160/466 (34%), Positives = 216/466 (46%), Gaps = 61/466 (13%)

Query: 620  DESLP---KRIAINLGHYGDNI--GEDTDKFQETNVLDTQN-IEEVMAERNTIENEVKDD 673
            DE+L    ++  I+LG YG+NI   E  D+     V+ T + + E   ERNT ++ V+  
Sbjct: 531  DEALSNDEQKTVIDLGAYGENILGTERIDEGAGAQVVGTSSSMCEAKLERNTTKSPVRIL 590

Query: 674  VYVNEEA---DEAIRRQLIDXXXXXXXXXXXXHEAKIKELKKRGVTNFFXXXXXXXXXXW 730
                EE    DE  R  +I              EAK+KEL +                 W
Sbjct: 591  NRPCEEKIDQDEETRNPIIKNLIEKRKLKEALREAKMKELNRSKANGMIDFEAEESDDEW 650

Query: 731  HGIGGADGEGSDDYDSDLEKMIDDYSKNNFNPHEIREMLAAENKEMDIKMINKILYDIKN 790
             G+GGADGE SD YDS+L++MIDDYS    +P  +R+ L  E K  D  M+++IL+DI+N
Sbjct: 651  FGVGGADGENSDGYDSELDRMIDDYSNTKSDPEFLRKKLMEEEKLHDKDMVDRILHDIEN 710

Query: 791  GGFRNKRAKNXXXXXXXXXXXXXVLQQYXXXXXXXXXXXXXXIGDDAKLVKNPKSSAFFE 850
            GGFR KR +               L +Y                + + L  NPKS AFF+
Sbjct: 711  GGFR-KRGR-YAMDLTLSDDEDDDLLRYHARRKELLNERKSGNQEISVLATNPKSKAFFD 768

Query: 851  SMVEDIIEYKNPFGAEEEYNLDITSTATDLDTQDNSINVGDNTGNNEQKPVDQKNKKVII 910
            S+ ED  + K      +EY     S A+ L    + I     +G  E +          I
Sbjct: 769  SIFED--DLKGGIANLKEYQ----SHASPLKAAKDEI-----SGKRETR----------I 807

Query: 911  SEDFVQKSLSFLKSNNYEDFETDKELSRI------QHGNDEAIEDLYTLKQNSSIKSFTN 964
            SE FVQK+LSFLKS   ED + D E   +        G+     D Y LKQ S IKSF  
Sbjct: 808  SEQFVQKTLSFLKSK--EDEQGDAEFVSVADTQESSSGDFAEATDFYRLKQLSGIKSF-- 863

Query: 965  SQTDSTTSKTVNTIIDLEKRPEDEDEVENGDTSLVGVFKHPSIIKSFASRTDINDKFKEG 1024
                   S  + + I L        +V N D  L G   + ++++ F    D N+KF+EG
Sbjct: 864  -------SAPLRSSIRL--------QVRNKDGVLSGK-ANTTLVERFVRSVDTNEKFEEG 907

Query: 1025 NKTVKILKSYKTVGSSKASITYMGKTRKLIAPKRKTEGSHRYHHDH 1070
             KTVK L SYK  GSS+ASIT++GK R L A KR   G H     H
Sbjct: 908  RKTVKSLNSYKIAGSSRASITFLGKARSLKARKR---GPHARSAPH 950

 Score = 73.9 bits (180), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 38/84 (45%), Positives = 59/84 (70%)

Query: 437 SKATILNLKARLSKQNQKLSQRPNKSKDPKVDHNVLLNTLRKASRKQILDHQKEVIETKG 496
           SKA IL+LKAR+SK+ Q L+   +K   P      L ++LRKA+R Q+++H+  ++  +G
Sbjct: 338 SKAAILDLKARMSKKKQSLAVTSSKETMPSASLRHLFSSLRKANRDQLVEHRNGLLLLRG 397

Query: 497 LKLEDMAKEKEIVENLLEQEILRN 520
           + L ++AKEKE VE+LLE+E+ RN
Sbjct: 398 VDLAEIAKEKESVESLLERELARN 421

 Score = 39.7 bits (91), Expect = 0.057,   Method: Compositional matrix adjust.
 Identities = 32/85 (37%), Positives = 40/85 (47%), Gaps = 13/85 (15%)

Query: 48  LTGNGFLFANATLNRVKNRLEGKKAPEQNHNNGKDRS----ENSLPTQLISNLYDGGEEL 103
           + G GFLF N+  N+VK R++     E NHN     S    +++  TQ I   YD GEEL
Sbjct: 32  VGGTGFLFENSIFNQVKKRIKATDDNEINHNAPTTASTEILKDTCETQAIERPYD-GEEL 90

Query: 104 EK--------SEVKDNSYSEKNVSS 120
           E         SE KDN       SS
Sbjct: 91  ETDFVLAKAPSEPKDNEVRASQSSS 115

>TPHA0J00720 Chr10 (161017..165198) [4182 bp, 1393 aa] {ON}
           Anc_8.259 YLR086W
          Length = 1393

 Score = 35.4 bits (80), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 23/68 (33%), Positives = 35/68 (51%), Gaps = 6/68 (8%)

Query: 169 TPLTTGRPGATQRIDSSGATSQTQPIKSIEPQSQIITTSSNHSNALSPKIPIIPTELIGT 228
           +PL    P   Q  + S       P+KS  P   II  S+NHSN++SP    +P++L+ +
Sbjct: 19  SPLNNDIPKIAQSRNDSPLQVANDPLKSYTPMKVII--SNNHSNSISP----LPSQLMSS 72

Query: 229 SPLFQSIQ 236
           S    S+Q
Sbjct: 73  STQPPSLQ 80

>Ecym_2730 Chr2 complement(1407649..1408344) [696 bp, 231 aa] {ON}
           similar to Ashbya gossypii AFR118W
          Length = 231

 Score = 32.7 bits (73), Expect = 4.1,   Method: Compositional matrix adjust.
 Identities = 25/81 (30%), Positives = 41/81 (50%), Gaps = 11/81 (13%)

Query: 167 LKTPLTTGRPGATQRIDSSGATSQTQPIKSIEPQSQIITTSSNHSNALSPKIPIIPTELI 226
           L +P+   RP A+  + SS +     PI++      II   S H ++ SP+I ++     
Sbjct: 144 LASPIAFDRPMASSNVGSSISVKNRLPIEN------IIGLPSQHHSSCSPQIRVM---FK 194

Query: 227 GTSPLFQSIQNRGPDTQMDVP 247
           G S + QS+   G D++M VP
Sbjct: 195 GASLMLQSM--IGDDSKMIVP 213

>KAFR0B04060 Chr2 (843896..844783) [888 bp, 295 aa] {ON} Anc_5.125
           YGR208W
          Length = 295

 Score = 31.6 bits (70), Expect = 9.4,   Method: Compositional matrix adjust.
 Identities = 15/41 (36%), Positives = 24/41 (58%)

Query: 351 AHPKPVQNDDELHENKSVELNLTDETRINEKRVPLLSSYAN 391
           AH   +Q DDE   NK + +   D T I ++ + L+++YAN
Sbjct: 58  AHDVIIQKDDEYRRNKKLVVFDMDSTLIYQEVIELIAAYAN 98

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.308    0.127    0.341 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 107,789,218
Number of extensions: 4974230
Number of successful extensions: 24708
Number of sequences better than 10.0: 334
Number of HSP's gapped: 25992
Number of HSP's successfully gapped: 369
Length of query: 1096
Length of database: 53,481,399
Length adjustment: 120
Effective length of query: 976
Effective length of database: 39,721,479
Effective search space: 38768163504
Effective search space used: 38768163504
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.6 bits)
S2: 71 (32.0 bits)