Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
YCL058W-A (ADF1)1.7ON1131134561e-59
Skud_3.51.7ON1131133743e-47
Smik_3.161.7ON1131133692e-46
Suva_3.1541.7ON1131133501e-43
TBLA0A049501.7ON113871679e-16
NCAS0B090901.7ON119931671e-15
KAFR0D001601.7ON111871591e-14
CAGL0B00374g1.7ON121911531e-13
SAKL0C00506g1.7ON105901502e-13
KNAG0C002401.7ON126971496e-13
NDAI0A001601.7ON123921471e-12
TDEL0C069501.7ON111891356e-11
Kpol_2002.101.7ON111901278e-10
KLTH0F00528g1.7ON104801215e-09
TPHA0E039901.7ON116911218e-09
ZYRO0F18436g1.7ON112901191e-08
Kwal_YGOB_YCL058W-A1.7ON105891139e-08
Kwal_33.13015singletonOFF105891139e-08
AFR743CA1.7ON101871007e-06
KAFR0K010607.156ON68545607.8
Suva_4.1874.248ON61657598.6
NOTE: 1 genes in the same pillar as YCL058W-A were not hit in these BLAST results
LIST: KLLA0C00528g

BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= YCL058W-A
         (113 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

YCL058W-A Chr3 (23584..23925) [342 bp, 113 aa] {ON}  ADF1Transcr...   180   1e-59
Skud_3.5 Chr3 (11576..11917) [342 bp, 113 aa] {ON} YCL058W-A (REAL)   148   3e-47
Smik_3.16 Chr3 (25034..25375) [342 bp, 113 aa] {ON} YCL058W-A (R...   146   2e-46
Suva_3.154 Chr3 (233345..233686) [342 bp, 113 aa] {ON} YCL058W-A...   139   1e-43
TBLA0A04950 Chr1 (1219399..1219740) [342 bp, 113 aa] {ON} Anc_1....    69   9e-16
NCAS0B09090 Chr2 complement(1744560..1744919) [360 bp, 119 aa] {...    69   1e-15
KAFR0D00160 Chr4 (17823..18158) [336 bp, 111 aa] {ON} Anc_1.7 YC...    66   1e-14
CAGL0B00374g Chr2 (23693..24058) [366 bp, 121 aa] {ON} similar t...    64   1e-13
SAKL0C00506g Chr3 (46439..46756) [318 bp, 105 aa] {ON} weakly si...    62   2e-13
KNAG0C00240 Chr3 (38093..38473) [381 bp, 126 aa] {ON} Anc_1.7 YC...    62   6e-13
NDAI0A00160 Chr1 (13398..13769) [372 bp, 123 aa] {ON} Anc_1.7 YC...    61   1e-12
TDEL0C06950 Chr3 complement(1262284..1262619) [336 bp, 111 aa] {...    57   6e-11
Kpol_2002.10 s2002 (19162..19497) [336 bp, 111 aa] {ON} (19162.....    54   8e-10
KLTH0F00528g Chr6 (41595..41909) [315 bp, 104 aa] {ON} conserved...    51   5e-09
TPHA0E03990 Chr5 complement(837690..838040) [351 bp, 116 aa] {ON...    51   8e-09
ZYRO0F18436g Chr6 complement(1522314..1522652) [339 bp, 112 aa] ...    50   1e-08
Kwal_YGOB_YCL058W-A s33 (41330..41647) [318 bp, 105 aa] {ON} ANN...    48   9e-08
Kwal_33.13015 s33 (41330..41647) [318 bp, 105 aa] {OFF} [contig ...    48   9e-08
AFR743CA Chr6 complement(1801173..1801478) [306 bp, 101 aa] {ON}...    43   7e-06
KAFR0K01060 Chr11 complement(218447..220504) [2058 bp, 685 aa] {...    28   7.8  
Suva_4.187 Chr4 complement(327838..329688) [1851 bp, 616 aa] {ON...    27   8.6  

>YCL058W-A Chr3 (23584..23925) [342 bp, 113 aa] {ON}
           ADF1Transcriptional repressor encoded by the antisense
           strand of the FYV5 gene; negatively regulates
           transcription of FYV5 by binding to the promoter on the
           sense strand
          Length = 113

 Score =  180 bits (456), Expect = 1e-59,   Method: Compositional matrix adjust.
 Identities = 95/113 (84%), Positives = 95/113 (84%)

Query: 1   MGKCSMXXXXXXXXXXXXXXXXXXRSISTAERKRTKLQVEKLNKSSETMIPTLLREASTQ 60
           MGKCSM                  RSISTAERKRTKLQVEKLNKSSETMIPTLLREASTQ
Sbjct: 1   MGKCSMKKKGVGKNVGVGKKVQKKRSISTAERKRTKLQVEKLNKSSETMIPTLLREASTQ 60

Query: 61  EPAKLKAETTLKAEELIKDQEKDSKVREQIRTEKSKTNDSMLKQIEMISGFSL 113
           EPAKLKAETTLKAEELIKDQEKDSKVREQIRTEKSKTNDSMLKQIEMISGFSL
Sbjct: 61  EPAKLKAETTLKAEELIKDQEKDSKVREQIRTEKSKTNDSMLKQIEMISGFSL 113

>Skud_3.5 Chr3 (11576..11917) [342 bp, 113 aa] {ON} YCL058W-A (REAL)
          Length = 113

 Score =  148 bits (374), Expect = 3e-47,   Method: Compositional matrix adjust.
 Identities = 79/113 (69%), Positives = 87/113 (76%)

Query: 1   MGKCSMXXXXXXXXXXXXXXXXXXRSISTAERKRTKLQVEKLNKSSETMIPTLLREASTQ 60
           MGK S+                  R ISTAERKRTKLQVEKLNKSSE MIPTLLRE +TQ
Sbjct: 1   MGKSSLRMKTQGKNGGVGKKVQKKRPISTAERKRTKLQVEKLNKSSEIMIPTLLRETATQ 60

Query: 61  EPAKLKAETTLKAEELIKDQEKDSKVREQIRTEKSKTNDSMLKQIEMISGFSL 113
           EP K +A++TLKAEEL+KDQ KD KVREQI+TEKSKTNDSML+QIEMISGFSL
Sbjct: 61  EPTKKRAKSTLKAEELVKDQAKDCKVREQIQTEKSKTNDSMLEQIEMISGFSL 113

>Smik_3.16 Chr3 (25034..25375) [342 bp, 113 aa] {ON} YCL058W-A
           (REAL)
          Length = 113

 Score =  146 bits (369), Expect = 2e-46,   Method: Compositional matrix adjust.
 Identities = 79/113 (69%), Positives = 84/113 (74%)

Query: 1   MGKCSMXXXXXXXXXXXXXXXXXXRSISTAERKRTKLQVEKLNKSSETMIPTLLREASTQ 60
           MGK SM                  RSISTA +KRTKLQVEKLNKSSE MIPTLLRE   Q
Sbjct: 1   MGKNSMRRKSVGKNVGVGKKVQKRRSISTAVKKRTKLQVEKLNKSSEMMIPTLLRETGAQ 60

Query: 61  EPAKLKAETTLKAEELIKDQEKDSKVREQIRTEKSKTNDSMLKQIEMISGFSL 113
           EPAK K E+TLKA +LIKDQEKDSKVRE I+ EKSKTND+MLKQIEMISGFSL
Sbjct: 61  EPAKRKTESTLKAGDLIKDQEKDSKVREHIQMEKSKTNDNMLKQIEMISGFSL 113

>Suva_3.154 Chr3 (233345..233686) [342 bp, 113 aa] {ON} YCL058W-A
           (REAL)
          Length = 113

 Score =  139 bits (350), Expect = 1e-43,   Method: Compositional matrix adjust.
 Identities = 76/113 (67%), Positives = 83/113 (73%)

Query: 1   MGKCSMXXXXXXXXXXXXXXXXXXRSISTAERKRTKLQVEKLNKSSETMIPTLLREASTQ 60
           MGK SM                  R ISTAE KRTKLQVE+LNKSSETMIPTLL+EAS Q
Sbjct: 1   MGKSSMRKKTQGKNGGVGKKQQKKRPISTAEMKRTKLQVERLNKSSETMIPTLLKEASKQ 60

Query: 61  EPAKLKAETTLKAEELIKDQEKDSKVREQIRTEKSKTNDSMLKQIEMISGFSL 113
           +  K K  +TL+AEEL+KDQ +DSKVRE I TEKSKTNDSMLKQIEMISGFSL
Sbjct: 61  DLDKKKTRSTLEAEELVKDQARDSKVREHIETEKSKTNDSMLKQIEMISGFSL 113

>TBLA0A04950 Chr1 (1219399..1219740) [342 bp, 113 aa] {ON} Anc_1.7
           YCL058W-A
          Length = 113

 Score = 68.9 bits (167), Expect = 9e-16,   Method: Compositional matrix adjust.
 Identities = 39/87 (44%), Positives = 56/87 (64%), Gaps = 2/87 (2%)

Query: 27  ISTAERKRTKLQVEKLNKSSETMIPTLLREASTQEPAKLKAETTLKAEELIKDQEKDSKV 86
           IS  ++KR KLQVEK+NK    +   +     ++E AK     TL +++L KDQEKD  +
Sbjct: 29  ISVGDKKRAKLQVEKMNKQDSLLSDIINLNGKSKELAK--NVNTLSSKQLKKDQEKDRLL 86

Query: 87  REQIRTEKSKTNDSMLKQIEMISGFSL 113
             +I+ +K +TND ++ QIEMISGFSL
Sbjct: 87  NVEIKNKKKQTNDDLIAQIEMISGFSL 113

>NCAS0B09090 Chr2 complement(1744560..1744919) [360 bp, 119 aa] {ON}
           Anc_1.7 YCL058W-A
          Length = 119

 Score = 68.9 bits (167), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 41/93 (44%), Positives = 63/93 (67%), Gaps = 8/93 (8%)

Query: 26  SISTAERKRTKLQVEKLNKSSETMIPTLL-----REASTQEPAKLKAETTLKAEELIKDQ 80
           SIS ++RK+ K QVEKLNK  E ++P  +     ++  +++P  LK  + L A  L++DQ
Sbjct: 30  SISFSDRKKAKHQVEKLNKK-ENLLPMNVLDLQKKKNLSKKPEPLK--SILHARSLLQDQ 86

Query: 81  EKDSKVREQIRTEKSKTNDSMLKQIEMISGFSL 113
           +KD ++R +IR E+  T+DS+ KQIEMISGF+ 
Sbjct: 87  KKDKEIRNKIRAEQKATDDSIEKQIEMISGFTF 119

>KAFR0D00160 Chr4 (17823..18158) [336 bp, 111 aa] {ON} Anc_1.7
           YCL058W-A
          Length = 111

 Score = 65.9 bits (159), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 38/87 (43%), Positives = 57/87 (65%)

Query: 27  ISTAERKRTKLQVEKLNKSSETMIPTLLREASTQEPAKLKAETTLKAEELIKDQEKDSKV 86
           IS +ERK+ KL VEK N+ + T +  L ++    +    K +  L+ ++L+ DQ +D +V
Sbjct: 25  ISQSERKKNKLIVEKFNQQTITNVQELNKDLKKDKRRLSKTKNALETKKLLHDQARDHEV 84

Query: 87  REQIRTEKSKTNDSMLKQIEMISGFSL 113
           ++ I T+  +T DSMLKQIEMISGFSL
Sbjct: 85  KQNIETKLKETEDSMLKQIEMISGFSL 111

>CAGL0B00374g Chr2 (23693..24058) [366 bp, 121 aa] {ON} similar to
           CA0039|IPF3998 Candida albicans and KLLA0C00528g
           Kluyveromyces lactis
          Length = 121

 Score = 63.5 bits (153), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 38/91 (41%), Positives = 58/91 (63%), Gaps = 6/91 (6%)

Query: 27  ISTAERKRTKLQVEKLNKSSETMIPTLLREAS----TQEPAKLKAETTLKAEELIKDQEK 82
           IS +ERK++K+   +LNK ++     +++E +     +EP K   +T L    L+KDQ++
Sbjct: 33  ISASERKKSKILTARLNKDADVAELKIIQELNDNKIAEEPKK--RQTALDMNCLVKDQKR 90

Query: 83  DSKVREQIRTEKSKTNDSMLKQIEMISGFSL 113
           D KVRE I    S+TN  MLKQ+E++SGFSL
Sbjct: 91  DKKVREHIEKINSETNSDMLKQLELMSGFSL 121

>SAKL0C00506g Chr3 (46439..46756) [318 bp, 105 aa] {ON} weakly
           similar to uniprot|Q2V2Q1 Saccharomyces cerevisiae
           YCL058W-A
          Length = 105

 Score = 62.4 bits (150), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 39/90 (43%), Positives = 60/90 (66%), Gaps = 6/90 (6%)

Query: 26  SISTAERKRTKLQVEKLNKSSETMIPTL--LREASTQEPAKLKAETTLKAEELIKDQEKD 83
            I  +++KRT++QVE+LNK  E ++  L      ST+   K K   TL+A+ L +DQ+KD
Sbjct: 20  GIKKSQKKRTRIQVEQLNKQ-EFLLSDLNMTNAGSTKTKEKPK---TLQAKALAQDQKKD 75

Query: 84  SKVREQIRTEKSKTNDSMLKQIEMISGFSL 113
            + R+++  ++  TND+ML Q+EMISGFSL
Sbjct: 76  KETRDKLEKQRKDTNDNMLAQLEMISGFSL 105

>KNAG0C00240 Chr3 (38093..38473) [381 bp, 126 aa] {ON} Anc_1.7
           YCL058W-A
          Length = 126

 Score = 62.0 bits (149), Expect = 6e-13,   Method: Compositional matrix adjust.
 Identities = 38/97 (39%), Positives = 60/97 (61%), Gaps = 8/97 (8%)

Query: 25  RSISTAERKRTKLQVEKLNKSSETMI---PTLLREASTQEPAKLKAET-----TLKAEEL 76
           ++I  +ERKR KLQVEKLN+ +  MI      +R    +   +++ +      +L  E+L
Sbjct: 30  KTIPLSERKRNKLQVEKLNRPTNGMIEGNAVDIRNEIDKHNQEVEGQNRTVHRSLDVEKL 89

Query: 77  IKDQEKDSKVREQIRTEKSKTNDSMLKQIEMISGFSL 113
            +D+ KD  ++EQ+  ++ +T+ SML QIEMISGFSL
Sbjct: 90  AQDKSKDRIIQEQVAKKQKETDQSMLAQIEMISGFSL 126

>NDAI0A00160 Chr1 (13398..13769) [372 bp, 123 aa] {ON} Anc_1.7
           YCL058W-A
          Length = 123

 Score = 61.2 bits (147), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 34/92 (36%), Positives = 53/92 (57%), Gaps = 5/92 (5%)

Query: 27  ISTAERKRTKLQVEKLNKSSETMIPTLLREASTQEPAK-----LKAETTLKAEELIKDQE 81
           I  ++RK+ K++V   NK S   +      + +  P K     L+  ++L A +L+ DQ+
Sbjct: 32  IKQSDRKKNKIKVAMFNKESSLHMNVSELNSQSMSPIKQKQDSLRKGSSLSAHDLLNDQK 91

Query: 82  KDSKVREQIRTEKSKTNDSMLKQIEMISGFSL 113
           KD +   +I+TEK + ND ML+QIEMISGF  
Sbjct: 92  KDIEANNRIQTEKKQVNDDMLRQIEMISGFKF 123

>TDEL0C06950 Chr3 complement(1262284..1262619) [336 bp, 111 aa] {ON}
           Anc_1.7 YCL058W-A
          Length = 111

 Score = 56.6 bits (135), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 34/89 (38%), Positives = 54/89 (60%)

Query: 25  RSISTAERKRTKLQVEKLNKSSETMIPTLLREASTQEPAKLKAETTLKAEELIKDQEKDS 84
           ++IS  + K+TK +VE LN+ + ++   +   AST      +   TL+   L KD +KD 
Sbjct: 23  KAISRRDVKKTKFRVENLNRDTASLSEIIKLNASTAVKGSARKANTLENRTLQKDWQKDQ 82

Query: 85  KVREQIRTEKSKTNDSMLKQIEMISGFSL 113
           K+RE+ + EK +  +++ KQIE ISGFSL
Sbjct: 83  KIREKSKAEKEEMANNLEKQIEDISGFSL 111

>Kpol_2002.10 s2002 (19162..19497) [336 bp, 111 aa] {ON}
           (19162..19497) [336 nt, 112 aa]
          Length = 111

 Score = 53.5 bits (127), Expect = 8e-10,   Method: Compositional matrix adjust.
 Identities = 34/90 (37%), Positives = 58/90 (64%), Gaps = 5/90 (5%)

Query: 27  ISTAERKRTKLQVEKLNKSSETMIPT---LLREASTQEPAKLKAETTLKAEELIKDQEKD 83
           IS +E+KR K+++EK+NK  E ++P+    L   +    ++   E  L++++L +D  KD
Sbjct: 24  ISQSEKKRNKIKMEKINK--EGILPSDILQLNNETRNGQSEGNKERALESQKLQQDNVKD 81

Query: 84  SKVREQIRTEKSKTNDSMLKQIEMISGFSL 113
            +   +I   K +T+DSMLKQIE+++GFSL
Sbjct: 82  RETIAKIEASKKETDDSMLKQIELMTGFSL 111

>KLTH0F00528g Chr6 (41595..41909) [315 bp, 104 aa] {ON} conserved
           hypothetical protein
          Length = 104

 Score = 51.2 bits (121), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 31/80 (38%), Positives = 55/80 (68%), Gaps = 3/80 (3%)

Query: 34  RTKLQVEKLNKSSETMIPTLLREASTQEPAKLKAETTLKAEELIKDQEKDSKVREQIRTE 93
           RTKL+VE+ NK S  +     RE +T+    L++   LK  +LI+D+EKD  +++++  +
Sbjct: 28  RTKLKVEQANKESFLISELNEREHNTKRTPALES---LKVSDLIEDREKDKSMQKKMEEQ 84

Query: 94  KSKTNDSMLKQIEMISGFSL 113
           K  T++++++Q+E+ISGFSL
Sbjct: 85  KQSTDNNIIEQLELISGFSL 104

>TPHA0E03990 Chr5 complement(837690..838040) [351 bp, 116 aa] {ON}
           Anc_1.7 YCL058W-A
          Length = 116

 Score = 51.2 bits (121), Expect = 8e-09,   Method: Compositional matrix adjust.
 Identities = 38/91 (41%), Positives = 56/91 (61%), Gaps = 8/91 (8%)

Query: 27  ISTAERKRTKLQVEKLNK----SSETMIPTLLREASTQEPAKLKAETTLKAEELIKDQEK 82
           +S+  RK TK +VEKLNK    SS+ +          +E    K  + L+A+ L KD  K
Sbjct: 30  LSSQVRKSTKHKVEKLNKLEVISSDDINALNALNGKKRE----KQTSVLEAKTLAKDNLK 85

Query: 83  DSKVREQIRTEKSKTNDSMLKQIEMISGFSL 113
           D ++ E+I ++K +TN S+L+QIEM+SGFSL
Sbjct: 86  DRQLIEKIESKKKETNASLLQQIEMMSGFSL 116

>ZYRO0F18436g Chr6 complement(1522314..1522652) [339 bp, 112 aa]
           {ON} similar to uniprot|Q2V2Q1 Saccharomyces cerevisiae
           YCL058W-A
          Length = 112

 Score = 50.4 bits (119), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 31/90 (34%), Positives = 59/90 (65%), Gaps = 3/90 (3%)

Query: 25  RSISTAERKRTKLQVEKLNKSSETMIPT-LLREASTQEPAKLKAETTLKAEELIKDQEKD 83
           +SIS +++KRTK +VEKL+  ++ ++P+ + +   +         ++L A  L +D++ D
Sbjct: 25  KSISHSDKKRTKSKVEKLD--AKGLLPSEIFKLNRSASSKTSNGSSSLLARNLEQDRKMD 82

Query: 84  SKVREQIRTEKSKTNDSMLKQIEMISGFSL 113
              R++   +K +T++++L+QIEMISGFSL
Sbjct: 83  QDTRDKANAKKKETDNNILQQIEMISGFSL 112

>Kwal_YGOB_YCL058W-A s33 (41330..41647) [318 bp, 105 aa] {ON}
           ANNOTATED BY YGOB -
          Length = 105

 Score = 48.1 bits (113), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 32/89 (35%), Positives = 59/89 (66%), Gaps = 7/89 (7%)

Query: 27  ISTAERKRTKLQVEKLNKSSETMIPTLL--REASTQEPAKLKAETTLKAEELIKDQEKDS 84
           I   ++ RTKL+VE+ NK  E  + + L  RE + ++ + L+   +LK   L+KD +KD 
Sbjct: 22  IKKHQKIRTKLKVEQANK--EVFLISELNKREDTKRQSSPLE---SLKPSRLVKDIKKDQ 76

Query: 85  KVREQIRTEKSKTNDSMLKQIEMISGFSL 113
             ++Q+ +++  T++++L+Q+E+ISGFSL
Sbjct: 77  NAQKQLESQRKATDENVLRQLELISGFSL 105

>Kwal_33.13015 s33 (41330..41647) [318 bp, 105 aa] {OFF} [contig
           123] FULL
          Length = 105

 Score = 48.1 bits (113), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 32/89 (35%), Positives = 59/89 (66%), Gaps = 7/89 (7%)

Query: 27  ISTAERKRTKLQVEKLNKSSETMIPTLL--REASTQEPAKLKAETTLKAEELIKDQEKDS 84
           I   ++ RTKL+VE+ NK  E  + + L  RE + ++ + L+   +LK   L+KD +KD 
Sbjct: 22  IKKHQKIRTKLKVEQANK--EVFLISELNKREDTKRQSSPLE---SLKPSRLVKDIKKDQ 76

Query: 85  KVREQIRTEKSKTNDSMLKQIEMISGFSL 113
             ++Q+ +++  T++++L+Q+E+ISGFSL
Sbjct: 77  NAQKQLESQRKATDENVLRQLELISGFSL 105

>AFR743CA Chr6 complement(1801173..1801478) [306 bp, 101 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YCL058W-A
          Length = 101

 Score = 43.1 bits (100), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 31/87 (35%), Positives = 48/87 (55%), Gaps = 7/87 (8%)

Query: 27  ISTAERKRTKLQVEKLNKSSETMIPTLLREASTQEPAKLKAETTLKAEELIKDQEKDSKV 86
           IS A++KR KLQVEKL+K         +  A     A       L+A  L +DQ  D++ 
Sbjct: 22  ISKADKKRAKLQVEKLDKRG-------VLLAELTAAAPAAKTGVLQAASLAQDQRSDAQA 74

Query: 87  REQIRTEKSKTNDSMLKQIEMISGFSL 113
           ++Q   E+S  +  +++Q+E I+GFSL
Sbjct: 75  QQQRAQERSNVDKKVVQQLEAIAGFSL 101

>KAFR0K01060 Chr11 complement(218447..220504) [2058 bp, 685 aa]
          {ON} Anc_7.156 YIR003W
          Length = 685

 Score = 27.7 bits (60), Expect = 7.8,   Method: Compositional matrix adjust.
 Identities = 15/45 (33%), Positives = 27/45 (60%), Gaps = 2/45 (4%)

Query: 57 ASTQEPAKLKAETTLK--AEELIKDQEKDSKVREQIRTEKSKTND 99
          +++QEP K+ ++  ++    E+I+D E D  + E   TE SK +D
Sbjct: 19 SNSQEPPKIPSQRPVRRTTTEIIEDNESDEDIIESYGTEDSKPSD 63

>Suva_4.187 Chr4 complement(327838..329688) [1851 bp, 616 aa] {ON}
           YDL063C (REAL)
          Length = 616

 Score = 27.3 bits (59), Expect = 8.6,   Method: Compositional matrix adjust.
 Identities = 18/57 (31%), Positives = 31/57 (54%), Gaps = 3/57 (5%)

Query: 49  MIPTLLREASTQEPAKLKAETTLKAEELIKDQEKD--SKVREQIRTEKSKTNDSMLK 103
           MI ++    +  +P +L  +     EE+    +KD  SKV E+I+   +K N+SM+K
Sbjct: 286 MIHSVCHSINNIDPVQLMNDIN-NPEEIAPATDKDETSKVIEKIKNYNAKRNESMMK 341

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.305    0.119    0.290 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 7,812,763
Number of extensions: 251256
Number of successful extensions: 2243
Number of sequences better than 10.0: 190
Number of HSP's gapped: 2220
Number of HSP's successfully gapped: 196
Length of query: 113
Length of database: 53,481,399
Length adjustment: 83
Effective length of query: 30
Effective length of database: 43,964,121
Effective search space: 1318923630
Effective search space used: 1318923630
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 43 (22.0 bits)
S2: 59 (27.3 bits)