Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
YCL057W (PRD1)1.9ON71271238110.0
Suva_3.1561.9ON71271235180.0
Smik_3.181.9ON71271235180.0
Skud_3.71.9ON71271234190.0
Kpol_2002.121.9ON73970924560.0
NCAS0B090701.9ON73070424440.0
TPHA0E039701.9ON74770524430.0
KNAG0C002601.9ON74467824410.0
ZYRO0F18392g1.9ON72570524170.0
SAKL0C00550g1.9ON73268523820.0
KAFR0D001801.9ON72370323800.0
TBLA0A075601.9ON74168123750.0
NDAI0A001801.9ON74068823280.0
KLLA0C00572g1.9ON71272223160.0
CAGL0B00418g1.9ON74369822320.0
Ecym_1011na 1ON71669120610.0
AGR406C1.9ON68367917880.0
AGR405Cna 1ON71768117310.0
ABR185WsingletonON4574149621e-122
NDAI0E020102.432ON7786755291e-56
KAFR0D029502.432ON7776345141e-54
SAKL0E03938g2.432ON7676804953e-52
Ecym_60992.432ON7735644893e-51
Smik_11.1022.432ON7726354841e-50
ZYRO0G20130g2.432ON7866804813e-50
CAGL0D02112g2.432ON7615494778e-50
TBLA0I007102.432ON7736554752e-49
Skud_11.932.432ON7726384672e-48
YKL134C (OCT1)2.432ON7726384663e-48
Suva_11.912.432ON7756384611e-47
NCAS0A042802.432ON7736864592e-47
KNAG0A062002.432ON7895684541e-46
AFR198W2.432ON7766384522e-46
TDEL0A020802.432ON7875544512e-46
Kwal_26.76162.432ON7705694478e-46
KLTH0D04730g2.432ON7726464451e-45
Kpol_297.82.432ON7875764372e-44
TPHA0G023902.432ON7955674248e-43
KLLA0B12397g2.432ON7796523954e-39
Kwal_23.43705.59ON69280752.1
Kpol_1032.428.210ON77382725.5
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= YCL057W
         (712 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

YCL057W Chr3 (24768..26906) [2139 bp, 712 aa] {ON}  PRD1Zinc met...  1472   0.0  
Suva_3.156 Chr3 (234520..236658) [2139 bp, 712 aa] {ON} YCL057W ...  1359   0.0  
Smik_3.18 Chr3 (26213..28351) [2139 bp, 712 aa] {ON} YCL057W (REAL)  1359   0.0  
Skud_3.7 Chr3 (12763..14901) [2139 bp, 712 aa] {ON} YCL057W (REAL)   1321   0.0  
Kpol_2002.12 s2002 (21544..23763) [2220 bp, 739 aa] {ON} (21544....   950   0.0  
NCAS0B09070 Chr2 complement(1741718..1743910) [2193 bp, 730 aa] ...   946   0.0  
TPHA0E03970 Chr5 complement(834023..836266) [2244 bp, 747 aa] {O...   945   0.0  
KNAG0C00260 Chr3 (39428..41662) [2235 bp, 744 aa] {ON} Anc_1.9 Y...   944   0.0  
ZYRO0F18392g Chr6 complement(1518902..1521079) [2178 bp, 725 aa]...   935   0.0  
SAKL0C00550g Chr3 (48410..50608) [2199 bp, 732 aa] {ON} highly s...   922   0.0  
KAFR0D00180 Chr4 (18900..21071) [2172 bp, 723 aa] {ON} Anc_1.9 Y...   921   0.0  
TBLA0A07560 Chr1 complement(1871629..1873854) [2226 bp, 741 aa] ...   919   0.0  
NDAI0A00180 Chr1 (14692..16914) [2223 bp, 740 aa] {ON} Anc_1.9        901   0.0  
KLLA0C00572g Chr3 (42069..44207) [2139 bp, 712 aa] {ON} similar ...   896   0.0  
CAGL0B00418g Chr2 (26584..28815) [2232 bp, 743 aa] {ON} similar ...   864   0.0  
Ecym_1011 Chr1 (19924..22074) [2151 bp, 716 aa] {ON} similar to ...   798   0.0  
AGR406C Chr7 complement(1472496..1474547) [2052 bp, 683 aa] {ON}...   693   0.0  
AGR405C Chr7 complement(1469769..1471922) [2154 bp, 717 aa] {ON}...   671   0.0  
ABR185W Chr2 (758126..758380,758380..758709,758709..759029,75903...   375   e-122
NDAI0E02010 Chr5 complement(404579..406915) [2337 bp, 778 aa] {O...   208   1e-56
KAFR0D02950 Chr4 complement(581305..583638) [2334 bp, 777 aa] {O...   202   1e-54
SAKL0E03938g Chr5 (317017..319320) [2304 bp, 767 aa] {ON} simila...   195   3e-52
Ecym_6099 Chr6 complement(186647..188968) [2322 bp, 773 aa] {ON}...   192   3e-51
Smik_11.102 Chr11 complement(175013..177331) [2319 bp, 772 aa] {...   191   1e-50
ZYRO0G20130g Chr7 (1666665..1669025) [2361 bp, 786 aa] {ON} simi...   189   3e-50
CAGL0D02112g Chr4 complement(216204..218489) [2286 bp, 761 aa] {...   188   8e-50
TBLA0I00710 Chr9 (128272..130593) [2322 bp, 773 aa] {ON} Anc_2.4...   187   2e-49
Skud_11.93 Chr11 complement(175243..177561) [2319 bp, 772 aa] {O...   184   2e-48
YKL134C Chr11 complement(189124..191442) [2319 bp, 772 aa] {ON} ...   184   3e-48
Suva_11.91 Chr11 complement(175327..177654) [2328 bp, 775 aa] {O...   182   1e-47
NCAS0A04280 Chr1 complement(864327..866648) [2322 bp, 773 aa] {O...   181   2e-47
KNAG0A06200 Chr1 complement(937577..939946) [2370 bp, 789 aa] {O...   179   1e-46
AFR198W Chr6 (797448..799778) [2331 bp, 776 aa] {ON} Syntenic ho...   178   2e-46
TDEL0A02080 Chr1 complement(373425..375788) [2364 bp, 787 aa] {O...   178   2e-46
Kwal_26.7616 s26 (444266..446578) [2313 bp, 770 aa] {ON} YKL134C...   176   8e-46
KLTH0D04730g Chr4 (432572..434890) [2319 bp, 772 aa] {ON} simila...   176   1e-45
Kpol_297.8 s297 complement(11648..14011) [2364 bp, 787 aa] {ON} ...   172   2e-44
TPHA0G02390 Chr7 complement(486025..488412) [2388 bp, 795 aa] {O...   167   8e-43
KLLA0B12397g Chr2 complement(1084129..1086468) [2340 bp, 779 aa]...   156   4e-39
Kwal_23.4370 s23 complement(689686..691764) [2079 bp, 692 aa] {O...    33   2.1  
Kpol_1032.42 s1032 (94902..97223) [2322 bp, 773 aa] {ON} (94902....    32   5.5  

>YCL057W Chr3 (24768..26906) [2139 bp, 712 aa] {ON}  PRD1Zinc
           metalloendopeptidase, found in the cytoplasm and
           intermembrane space of mitochondria; with Cym1p,
           involved in degradation of mitochondrial proteins and of
           presequence peptides cleaved from imported proteins
          Length = 712

 Score = 1472 bits (3811), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 712/712 (100%), Positives = 712/712 (100%)

Query: 1   MRLLLCKNWFASPVISPLLYTRSLYSMANTTSFPIAPQAPPNWSFTPSDISGKTNEIINN 60
           MRLLLCKNWFASPVISPLLYTRSLYSMANTTSFPIAPQAPPNWSFTPSDISGKTNEIINN
Sbjct: 1   MRLLLCKNWFASPVISPLLYTRSLYSMANTTSFPIAPQAPPNWSFTPSDISGKTNEIINN 60

Query: 61  SNNFYDSMSKVESPSVSNFVEPFMKFENELGPIINQLTFLQHVSSDKEIRDASVNSSMKL 120
           SNNFYDSMSKVESPSVSNFVEPFMKFENELGPIINQLTFLQHVSSDKEIRDASVNSSMKL
Sbjct: 61  SNNFYDSMSKVESPSVSNFVEPFMKFENELGPIINQLTFLQHVSSDKEIRDASVNSSMKL 120

Query: 121 DELNIDLSLRHDIFLQFARVWQDVQSKADSVERETFKYVEKSYKDYIHSGLELDEGNRLK 180
           DELNIDLSLRHDIFLQFARVWQDVQSKADSVERETFKYVEKSYKDYIHSGLELDEGNRLK
Sbjct: 121 DELNIDLSLRHDIFLQFARVWQDVQSKADSVERETFKYVEKSYKDYIHSGLELDEGNRLK 180

Query: 181 IKEIKKKISVNSINFSKNLGEQKEYITFTKEQLEGVPDSILTQFETIKSDKDSNETLYKV 240
           IKEIKKKISVNSINFSKNLGEQKEYITFTKEQLEGVPDSILTQFETIKSDKDSNETLYKV
Sbjct: 181 IKEIKKKISVNSINFSKNLGEQKEYITFTKEQLEGVPDSILTQFETIKSDKDSNETLYKV 240

Query: 241 TFKYPDIFPVMKLASSAQTRKQAFLADQNKVPENEAILLDTLKLRDELASLLGYDTYANY 300
           TFKYPDIFPVMKLASSAQTRKQAFLADQNKVPENEAILLDTLKLRDELASLLGYDTYANY
Sbjct: 241 TFKYPDIFPVMKLASSAQTRKQAFLADQNKVPENEAILLDTLKLRDELASLLGYDTYANY 300

Query: 301 NLYDKMAEDSTTVMNFLNDLKDKLIPLGRKELQVLQDMKAEDVKKLNQGADPNYYIWDHR 360
           NLYDKMAEDSTTVMNFLNDLKDKLIPLGRKELQVLQDMKAEDVKKLNQGADPNYYIWDHR
Sbjct: 301 NLYDKMAEDSTTVMNFLNDLKDKLIPLGRKELQVLQDMKAEDVKKLNQGADPNYYIWDHR 360

Query: 361 YYDNKYLLENFNVDLEKISEYFPLEATITGMLEIYETLFNLKFIETKDSQNKSVWHDDVK 420
           YYDNKYLLENFNVDLEKISEYFPLEATITGMLEIYETLFNLKFIETKDSQNKSVWHDDVK
Sbjct: 361 YYDNKYLLENFNVDLEKISEYFPLEATITGMLEIYETLFNLKFIETKDSQNKSVWHDDVK 420

Query: 421 QIAVWNMDDPKSPNFVGWIYFDLHPRDGKYGHAANFGLSSSFMIDDTTRSYPVTALVCNF 480
           QIAVWNMDDPKSPNFVGWIYFDLHPRDGKYGHAANFGLSSSFMIDDTTRSYPVTALVCNF
Sbjct: 421 QIAVWNMDDPKSPNFVGWIYFDLHPRDGKYGHAANFGLSSSFMIDDTTRSYPVTALVCNF 480

Query: 481 SKSTKDKPSLLKHNEIVTFFHELGHGIHDLVGQNKESRFNGPGSVPWDFVEAPSQMLEFW 540
           SKSTKDKPSLLKHNEIVTFFHELGHGIHDLVGQNKESRFNGPGSVPWDFVEAPSQMLEFW
Sbjct: 481 SKSTKDKPSLLKHNEIVTFFHELGHGIHDLVGQNKESRFNGPGSVPWDFVEAPSQMLEFW 540

Query: 541 TWNKNELINLSSHYKTGEKIPESLINSLIKTKHVNGALFTLRQLHFGLFDMKVHTCKDLQ 600
           TWNKNELINLSSHYKTGEKIPESLINSLIKTKHVNGALFTLRQLHFGLFDMKVHTCKDLQ
Sbjct: 541 TWNKNELINLSSHYKTGEKIPESLINSLIKTKHVNGALFTLRQLHFGLFDMKVHTCKDLQ 600

Query: 601 NLSICDTWNQLRQDISLISNGGTLSKGYDSFGHIMSDSYSAGYYGYLWAEVFATDMYHTK 660
           NLSICDTWNQLRQDISLISNGGTLSKGYDSFGHIMSDSYSAGYYGYLWAEVFATDMYHTK
Sbjct: 601 NLSICDTWNQLRQDISLISNGGTLSKGYDSFGHIMSDSYSAGYYGYLWAEVFATDMYHTK 660

Query: 661 FAKDPLNAKNGIQYRDIVLARGGLYDINDNLKEFLGREPSKDAFLKELGLQN 712
           FAKDPLNAKNGIQYRDIVLARGGLYDINDNLKEFLGREPSKDAFLKELGLQN
Sbjct: 661 FAKDPLNAKNGIQYRDIVLARGGLYDINDNLKEFLGREPSKDAFLKELGLQN 712

>Suva_3.156 Chr3 (234520..236658) [2139 bp, 712 aa] {ON} YCL057W
           (REAL)
          Length = 712

 Score = 1359 bits (3518), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 646/712 (90%), Positives = 683/712 (95%)

Query: 1   MRLLLCKNWFASPVISPLLYTRSLYSMANTTSFPIAPQAPPNWSFTPSDISGKTNEIINN 60
           MRLLLCKNWFASPVI+PLLYTR L SM  T SFP APQ PP+WSFTP+DISG+T EII  
Sbjct: 1   MRLLLCKNWFASPVITPLLYTRFLSSMTTTASFPTAPQTPPSWSFTPNDISGRTKEIIEK 60

Query: 61  SNNFYDSMSKVESPSVSNFVEPFMKFENELGPIINQLTFLQHVSSDKEIRDASVNSSMKL 120
           SN FYDSMS+VESP+V+NFVEPFMKFENELGPIINQLTFLQHVSSDKEIRDASV+SSMKL
Sbjct: 61  SNKFYDSMSQVESPAVTNFVEPFMKFENELGPIINQLTFLQHVSSDKEIRDASVDSSMKL 120

Query: 121 DELNIDLSLRHDIFLQFARVWQDVQSKADSVERETFKYVEKSYKDYIHSGLELDEGNRLK 180
           DELNIDLSLRHD+FLQFARVWQD QS+ADS+ERETF+Y+EKSYKDYIHSGLELDE +RLK
Sbjct: 121 DELNIDLSLRHDVFLQFARVWQDAQSQADSIERETFRYIEKSYKDYIHSGLELDEPDRLK 180

Query: 181 IKEIKKKISVNSINFSKNLGEQKEYITFTKEQLEGVPDSILTQFETIKSDKDSNETLYKV 240
           +KEIKKKISVNSINFSKNLGEQKE+ITFTKEQLEGVPDSIL QFETI+S KDSNETLYKV
Sbjct: 181 VKEIKKKISVNSINFSKNLGEQKEFITFTKEQLEGVPDSILAQFETIESGKDSNETLYKV 240

Query: 241 TFKYPDIFPVMKLASSAQTRKQAFLADQNKVPENEAILLDTLKLRDELASLLGYDTYANY 300
           TFKYPDIFPVMKLASS+QTRKQAFLADQNKV ENEAILLDTLKLRDE+ASLLGYDTYANY
Sbjct: 241 TFKYPDIFPVMKLASSSQTRKQAFLADQNKVSENEAILLDTLKLRDEVASLLGYDTYANY 300

Query: 301 NLYDKMAEDSTTVMNFLNDLKDKLIPLGRKELQVLQDMKAEDVKKLNQGADPNYYIWDHR 360
           NLYDKMA+DSTTVM+FLNDLK KLIPLG KELQ+LQDMKA+DVKK NQ  DPNYYIWDHR
Sbjct: 301 NLYDKMAKDSTTVMDFLNDLKKKLIPLGEKELQILQDMKAKDVKKRNQDEDPNYYIWDHR 360

Query: 361 YYDNKYLLENFNVDLEKISEYFPLEATITGMLEIYETLFNLKFIETKDSQNKSVWHDDVK 420
           YYDNKYLLENFNVDLEKISE+FPLE TITGML+IYETLFNLKFIETK+ Q KSVWH+DVK
Sbjct: 361 YYDNKYLLENFNVDLEKISEFFPLETTITGMLQIYETLFNLKFIETKNPQEKSVWHEDVK 420

Query: 421 QIAVWNMDDPKSPNFVGWIYFDLHPRDGKYGHAANFGLSSSFMIDDTTRSYPVTALVCNF 480
           Q+AVWNMDDPKSP F+GWIYFDLHPRDGKYGHAANFGLSSSFM++DTTRSYPVTALVCNF
Sbjct: 421 QLAVWNMDDPKSPRFIGWIYFDLHPRDGKYGHAANFGLSSSFMVNDTTRSYPVTALVCNF 480

Query: 481 SKSTKDKPSLLKHNEIVTFFHELGHGIHDLVGQNKESRFNGPGSVPWDFVEAPSQMLEFW 540
           SKSTKDKPSLLKHNEIVTFFHELGHGIHDLVGQNKESRFNGPGSVPWDFVEAPSQMLEFW
Sbjct: 481 SKSTKDKPSLLKHNEIVTFFHELGHGIHDLVGQNKESRFNGPGSVPWDFVEAPSQMLEFW 540

Query: 541 TWNKNELINLSSHYKTGEKIPESLINSLIKTKHVNGALFTLRQLHFGLFDMKVHTCKDLQ 600
           TWNKNEL++LSSHYKTGEKIPE LI+SLIKTKHVNGALFTLRQLHFGLFDMKVH+CKDLQ
Sbjct: 541 TWNKNELMHLSSHYKTGEKIPEPLIDSLIKTKHVNGALFTLRQLHFGLFDMKVHSCKDLQ 600

Query: 601 NLSICDTWNQLRQDISLISNGGTLSKGYDSFGHIMSDSYSAGYYGYLWAEVFATDMYHTK 660
           NLSICDTWNQLRQDISL+SNGGTLSKGY SFGHIMSDSYSAGYYGYLWAEVFATDMYHTK
Sbjct: 601 NLSICDTWNQLRQDISLMSNGGTLSKGYASFGHIMSDSYSAGYYGYLWAEVFATDMYHTK 660

Query: 661 FAKDPLNAKNGIQYRDIVLARGGLYDINDNLKEFLGREPSKDAFLKELGLQN 712
           FAKDPLN KNGIQYRDIVLARGGL DIND+LKEFLGREPSKDAFLKELGLQN
Sbjct: 661 FAKDPLNTKNGIQYRDIVLARGGLRDINDSLKEFLGREPSKDAFLKELGLQN 712

>Smik_3.18 Chr3 (26213..28351) [2139 bp, 712 aa] {ON} YCL057W (REAL)
          Length = 712

 Score = 1359 bits (3518), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 654/712 (91%), Positives = 692/712 (97%)

Query: 1   MRLLLCKNWFASPVISPLLYTRSLYSMANTTSFPIAPQAPPNWSFTPSDISGKTNEIINN 60
           MRLLLCKNWF SP+ISPLLYTRSLYSM+N TSFPIAPQAPPNW+FTP+DI+GKT EII+ 
Sbjct: 1   MRLLLCKNWFTSPIISPLLYTRSLYSMSNATSFPIAPQAPPNWTFTPNDINGKTKEIIDK 60

Query: 61  SNNFYDSMSKVESPSVSNFVEPFMKFENELGPIINQLTFLQHVSSDKEIRDASVNSSMKL 120
           SNNFY+SMS VE+P+V+NFVEPFMKFENELGPIINQLTFLQHVSSDKEIRDASVNSSMKL
Sbjct: 61  SNNFYESMSNVETPTVTNFVEPFMKFENELGPIINQLTFLQHVSSDKEIRDASVNSSMKL 120

Query: 121 DELNIDLSLRHDIFLQFARVWQDVQSKADSVERETFKYVEKSYKDYIHSGLELDEGNRLK 180
           DELNIDLSLRHDI+LQFARVWQD QSK+DS+ERETFKY+EKSYKDYIHSGLELDE NRLK
Sbjct: 121 DELNIDLSLRHDIYLQFARVWQDAQSKSDSIERETFKYIEKSYKDYIHSGLELDESNRLK 180

Query: 181 IKEIKKKISVNSINFSKNLGEQKEYITFTKEQLEGVPDSILTQFETIKSDKDSNETLYKV 240
           IK+IKKKISVNSINFSKNLGEQKEYITFTKEQLEGVPDS+L QFETIKSDKD NETLYKV
Sbjct: 181 IKDIKKKISVNSINFSKNLGEQKEYITFTKEQLEGVPDSVLAQFETIKSDKDRNETLYKV 240

Query: 241 TFKYPDIFPVMKLASSAQTRKQAFLADQNKVPENEAILLDTLKLRDELASLLGYDTYANY 300
           TFKYPDIFPVMKLASSAQTRK+AFLADQNKVPENEAILLDTL+LRD+LASLLGYDTYANY
Sbjct: 241 TFKYPDIFPVMKLASSAQTRKEAFLADQNKVPENEAILLDTLELRDKLASLLGYDTYANY 300

Query: 301 NLYDKMAEDSTTVMNFLNDLKDKLIPLGRKELQVLQDMKAEDVKKLNQGADPNYYIWDHR 360
           NLYDKMA+DSTTVM+FLNDLKDKLIPLG+KEL++LQ+MK++DVKKLNQ  DPNYYIWDHR
Sbjct: 301 NLYDKMAKDSTTVMDFLNDLKDKLIPLGKKELELLQEMKSKDVKKLNQDEDPNYYIWDHR 360

Query: 361 YYDNKYLLENFNVDLEKISEYFPLEATITGMLEIYETLFNLKFIETKDSQNKSVWHDDVK 420
           YYDNKYLLENFNVDLEKISEYFPLE TITGML+IYETLFNLKFIE KD Q+KSVWHDDVK
Sbjct: 361 YYDNKYLLENFNVDLEKISEYFPLETTITGMLQIYETLFNLKFIEIKDGQSKSVWHDDVK 420

Query: 421 QIAVWNMDDPKSPNFVGWIYFDLHPRDGKYGHAANFGLSSSFMIDDTTRSYPVTALVCNF 480
           Q+AVWNMDDPKSP FVGWIYFDLHPRDGKYGHAANFGLSSSFM +D+ RSYPVTALVCNF
Sbjct: 421 QLAVWNMDDPKSPKFVGWIYFDLHPRDGKYGHAANFGLSSSFMTNDSVRSYPVTALVCNF 480

Query: 481 SKSTKDKPSLLKHNEIVTFFHELGHGIHDLVGQNKESRFNGPGSVPWDFVEAPSQMLEFW 540
           SKSTKDKPSLLKHNEIVTFFHELGHGIHDLVGQNKESRFNGPGSVPWDFVEAPSQMLEFW
Sbjct: 481 SKSTKDKPSLLKHNEIVTFFHELGHGIHDLVGQNKESRFNGPGSVPWDFVEAPSQMLEFW 540

Query: 541 TWNKNELINLSSHYKTGEKIPESLINSLIKTKHVNGALFTLRQLHFGLFDMKVHTCKDLQ 600
           TWNKNELI+LSSHY+TGEKIPESLI+SLIKTKHVNGALFTLRQLHFGLFDMKVHTCKDLQ
Sbjct: 541 TWNKNELIDLSSHYETGEKIPESLIDSLIKTKHVNGALFTLRQLHFGLFDMKVHTCKDLQ 600

Query: 601 NLSICDTWNQLRQDISLISNGGTLSKGYDSFGHIMSDSYSAGYYGYLWAEVFATDMYHTK 660
           NLSIC+TWNQLRQDISLISNGGTLSKGYDSFGHIMSDSYSAGYYGYLWAEVFATDMYHTK
Sbjct: 601 NLSICETWNQLRQDISLISNGGTLSKGYDSFGHIMSDSYSAGYYGYLWAEVFATDMYHTK 660

Query: 661 FAKDPLNAKNGIQYRDIVLARGGLYDINDNLKEFLGREPSKDAFLKELGLQN 712
           FAKDPLN KNGIQYRDIVLARGGL DI D+LK+FLGREPSKDAFLKELGLQN
Sbjct: 661 FAKDPLNTKNGIQYRDIVLARGGLNDIGDDLKKFLGREPSKDAFLKELGLQN 712

>Skud_3.7 Chr3 (12763..14901) [2139 bp, 712 aa] {ON} YCL057W (REAL)
          Length = 712

 Score = 1321 bits (3419), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 635/712 (89%), Positives = 678/712 (95%)

Query: 1   MRLLLCKNWFASPVISPLLYTRSLYSMANTTSFPIAPQAPPNWSFTPSDISGKTNEIINN 60
           MRLLLCKNWF SPVISPLLYTR L +M N  SFPIAPQAPP WSFTP+DI GKT EII+ 
Sbjct: 1   MRLLLCKNWFTSPVISPLLYTRCLSAMTNAASFPIAPQAPPTWSFTPTDIGGKTTEIIDK 60

Query: 61  SNNFYDSMSKVESPSVSNFVEPFMKFENELGPIINQLTFLQHVSSDKEIRDASVNSSMKL 120
           SN FY+ MS+VESPSV+NF+EPFMKFENELGPIIN+LTFLQHVSSDKEIRDASV+SSMKL
Sbjct: 61  SNKFYELMSQVESPSVTNFIEPFMKFENELGPIINRLTFLQHVSSDKEIRDASVDSSMKL 120

Query: 121 DELNIDLSLRHDIFLQFARVWQDVQSKADSVERETFKYVEKSYKDYIHSGLELDEGNRLK 180
           DELNIDLSLRHDIFLQFARVWQD Q KADS+++ETFKY+EKSYKD+IHSGLELDE NRLK
Sbjct: 121 DELNIDLSLRHDIFLQFARVWQDAQPKADSLKKETFKYIEKSYKDFIHSGLELDEANRLK 180

Query: 181 IKEIKKKISVNSINFSKNLGEQKEYITFTKEQLEGVPDSILTQFETIKSDKDSNETLYKV 240
           IKEIKKKIS+NSINFSKNLGEQKEYITFTKEQLEGVPDSIL QFET KS+K   +TLYKV
Sbjct: 181 IKEIKKKISMNSINFSKNLGEQKEYITFTKEQLEGVPDSILAQFETTKSEKGGEDTLYKV 240

Query: 241 TFKYPDIFPVMKLASSAQTRKQAFLADQNKVPENEAILLDTLKLRDELASLLGYDTYANY 300
           TFKYPDIFPVMKLASSAQTRKQAFLADQNKVPENEAILLDTLKLRDELASLLGY+TYA+Y
Sbjct: 241 TFKYPDIFPVMKLASSAQTRKQAFLADQNKVPENEAILLDTLKLRDELASLLGYNTYADY 300

Query: 301 NLYDKMAEDSTTVMNFLNDLKDKLIPLGRKELQVLQDMKAEDVKKLNQGADPNYYIWDHR 360
           NLYDKMA+DS TVM+FLNDLK KLIPLG+KELQVLQDMK +DV++  +  DPNYYIWDHR
Sbjct: 301 NLYDKMAKDSRTVMDFLNDLKGKLIPLGKKELQVLQDMKVKDVERSKKDEDPNYYIWDHR 360

Query: 361 YYDNKYLLENFNVDLEKISEYFPLEATITGMLEIYETLFNLKFIETKDSQNKSVWHDDVK 420
           YYDNK+LLENFNVDLEKISEYFPLE TITGML+IYETLFNLKFIETK+ QNKSVWH+DVK
Sbjct: 361 YYDNKHLLENFNVDLEKISEYFPLETTITGMLQIYETLFNLKFIETKEPQNKSVWHEDVK 420

Query: 421 QIAVWNMDDPKSPNFVGWIYFDLHPRDGKYGHAANFGLSSSFMIDDTTRSYPVTALVCNF 480
           Q+AVWNMDDPKSP F+GWIYFDLHPRDGKYGHAANFGLSSSFMI+D+ RSYPVTALVCNF
Sbjct: 421 QLAVWNMDDPKSPRFIGWIYFDLHPRDGKYGHAANFGLSSSFMINDSKRSYPVTALVCNF 480

Query: 481 SKSTKDKPSLLKHNEIVTFFHELGHGIHDLVGQNKESRFNGPGSVPWDFVEAPSQMLEFW 540
           SKSTKDKPSLLKHNEIVTFFHELGHGIHDLVGQNKESRFNGPGSVPWDFVEAPSQMLEFW
Sbjct: 481 SKSTKDKPSLLKHNEIVTFFHELGHGIHDLVGQNKESRFNGPGSVPWDFVEAPSQMLEFW 540

Query: 541 TWNKNELINLSSHYKTGEKIPESLINSLIKTKHVNGALFTLRQLHFGLFDMKVHTCKDLQ 600
           TWNKNEL++LSSHYKTGE+IPESLI+SLIKTKHVNGALFTLRQLHFGLFDMKVHTCKDL+
Sbjct: 541 TWNKNELVSLSSHYKTGERIPESLIDSLIKTKHVNGALFTLRQLHFGLFDMKVHTCKDLE 600

Query: 601 NLSICDTWNQLRQDISLISNGGTLSKGYDSFGHIMSDSYSAGYYGYLWAEVFATDMYHTK 660
           NLSIC TWNQLRQ+ISL+ NGGTLSKGYDSFGHIMSDSYSAGYYGYLWAEVFATDMYHTK
Sbjct: 601 NLSICHTWNQLRQEISLMPNGGTLSKGYDSFGHIMSDSYSAGYYGYLWAEVFATDMYHTK 660

Query: 661 FAKDPLNAKNGIQYRDIVLARGGLYDINDNLKEFLGREPSKDAFLKELGLQN 712
           FAKDPLN KNG+QYRDIVLARGGLYDINDNLKEFLGREPSKDAFLKELGLQ+
Sbjct: 661 FAKDPLNTKNGVQYRDIVLARGGLYDINDNLKEFLGREPSKDAFLKELGLQS 712

>Kpol_2002.12 s2002 (21544..23763) [2220 bp, 739 aa] {ON}
           (21544..23763) [2220 nt, 740 aa]
          Length = 739

 Score =  950 bits (2456), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 441/709 (62%), Positives = 567/709 (79%), Gaps = 10/709 (1%)

Query: 8   NWFASPVISPLLYTRSLYSMANTTSFPIAPQAPPNWSFTPSDISGKTNEIINNSNNFYDS 67
           ++FA P I+   +T   YS    +S  IAPQ  P W++TP  I      +I +SN  +D+
Sbjct: 34  SFFAVPAIA---FTILKYSTMTNSSLLIAPQPAPTWNWTPEGIVKDAESLIKDSNRIFDN 90

Query: 68  MSKVESPSVSNFVEPFMKFENELGPIINQLTFLQHVSSDKEIRDASVNSSMKLDELNIDL 127
           ++ + SP+V NF+ P+M  EN++ P+INQLTFLQHVS+DK+IRD+S+ ++  +    I+ 
Sbjct: 91  LAAISSPTVENFIVPYMNHENKVSPLINQLTFLQHVSADKDIRDSSMKATELIQNFEIEA 150

Query: 128 SLRHDIFLQFARVWQDVQ------SKADSVERETFKYVEKSYKDYIHSGLELDEGNRLKI 181
           SLR D+F+QF ++W DV+       K+DS   E+++++EK +KD+I SGL L +  R  +
Sbjct: 151 SLRKDLFIQFDKIWTDVKDNSEFNEKSDSKNYESYRFIEKCHKDFIRSGLNLSDEKREIV 210

Query: 182 KEIKKKISVNSINFSKNLGEQKEYITFTKEQLEGVPDSILTQFETIKSDKDSNETLYKVT 241
           K+I+KKI+ NS+NFSKNLGEQKE+I FTKE+L+GV D+++ QFE  K +K + E  +KVT
Sbjct: 211 KDIQKKIASNSLNFSKNLGEQKEFIAFTKEELDGVSDAVMEQFEKFKDEK-TGEEKFKVT 269

Query: 242 FKYPDIFPVMKLASSAQTRKQAFLADQNKVPENEAILLDTLKLRDELASLLGYDTYANYN 301
           FKYPDI PV+K A +  TRK AF ADQNKVPENEA+ +DTLKLR++L+++L Y  YANYN
Sbjct: 270 FKYPDILPVLKSAKNPNTRKLAFNADQNKVPENEALFVDTLKLRNDLSTVLDYSNYANYN 329

Query: 302 LYDKMAEDSTTVMNFLNDLKDKLIPLGRKELQVLQDMKAEDVKKLNQGADPNYYIWDHRY 361
           L  KMA++  TV NFL+DLK KL PLG KE+++L+ +K +D+K+LN   D +YYIWDHRY
Sbjct: 330 LEMKMAKNEETVFNFLDDLKTKLRPLGLKEIEILKQLKEKDMKELNLPYDNHYYIWDHRY 389

Query: 362 YDNKYLLENFNVDLEKISEYFPLEATITGMLEIYETLFNLKFIETKDSQNKSVWHDDVKQ 421
           YDNKYL +NFNVDLEKISEY+P+E++I GML+IYET+  LKF+E  D   ++VWH+DVKQ
Sbjct: 390 YDNKYLKDNFNVDLEKISEYYPIESSIDGMLKIYETVMKLKFVEETDPAKRNVWHEDVKQ 449

Query: 422 IAVWNMDDPKSPNFVGWIYFDLHPRDGKYGHAANFGLSSSFMIDDTTRSYPVTALVCNFS 481
           ++VW MD+P +P F+GWIYFDLHPRDGKYGHAANFG+SSS++ ++  RSYPVTALVCNFS
Sbjct: 450 LSVWKMDNPDAPEFIGWIYFDLHPRDGKYGHAANFGISSSYVDENDKRSYPVTALVCNFS 509

Query: 482 KSTKDKPSLLKHNEIVTFFHELGHGIHDLVGQNKESRFNGPGSVPWDFVEAPSQMLEFWT 541
           K T DKPSLLKHNE+ TFFHELGHGIHDLVG N+ SR NGPGSVPWDFVEAPSQMLEFWT
Sbjct: 510 KPTSDKPSLLKHNELTTFFHELGHGIHDLVGANRCSRLNGPGSVPWDFVEAPSQMLEFWT 569

Query: 542 WNKNELINLSSHYKTGEKIPESLINSLIKTKHVNGALFTLRQLHFGLFDMKVHTCKDLQN 601
           WNKNELI+LS HYKTGEKIPESLI SL+ TKHVNGALF LRQLHF  FDM+VHT +D+  
Sbjct: 570 WNKNELISLSKHYKTGEKIPESLIESLVSTKHVNGALFALRQLHFSTFDMEVHTAEDVSK 629

Query: 602 LSICDTWNQLRQDISLISNGGTLSKGYDSFGHIMSDSYSAGYYGYLWAEVFATDMYHTKF 661
           L++ + WN LR+ I L+ NG  +SKGYDSFGHIMS +YSAGYYGY+WAEVFATDMY+TKF
Sbjct: 630 LNLLELWNGLREQICLVENGDEMSKGYDSFGHIMSGAYSAGYYGYMWAEVFATDMYYTKF 689

Query: 662 AKDPLNAKNGIQYRDIVLARGGLYDINDNLKEFLGREPSKDAFLKELGL 710
           A DPLN+K+G++YRDI+L+RGG+Y++NDNL+EFLGREP+  AFLKE+GL
Sbjct: 690 AADPLNSKSGVEYRDIILSRGGIYEVNDNLEEFLGREPNNSAFLKEMGL 738

>NCAS0B09070 Chr2 complement(1741718..1743910) [2193 bp, 730 aa]
           {ON} Anc_1.9
          Length = 730

 Score =  946 bits (2444), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 444/704 (63%), Positives = 563/704 (79%), Gaps = 5/704 (0%)

Query: 13  PVISPLLYTRSLY-SMANTTSFPIAPQA-PPNWSFTPSDISGKTNEIINNSNNFYDSMSK 70
           P  + +L  +S Y ++       +AP    P W ++P  I  KT E+I+N+ N YDS++ 
Sbjct: 28  PATAFILTRKSFYMTLPTNNKLLVAPTGTAPTWKWSPESILAKTKEVIDNATNLYDSLAA 87

Query: 71  VESPSVSNFVEPFMKFENELGPIINQLTFLQHVSSDKEIRDASVNSSMKLDELNIDLSLR 130
           +E PSV + V+P+M +EN+ G I+NQLTFLQHVS+DK IRDASV ++  L + +I+ S+R
Sbjct: 88  IEEPSVESLVKPYMHYENDEGLIVNQLTFLQHVSADKLIRDASVEATELLQDFSIEASMR 147

Query: 131 HDIFLQFARVWQDVQSKADSVER--ETFKYVEKSYKDYIHSGLELDEGNRLKIKEIKKKI 188
            D+F QF ++W  V+   D   +  ET+K++EK +KDY+ +GL L E  R ++K+IKKKI
Sbjct: 148 LDLFQQFDKIWNQVKDDDDLKSKDFETYKFIEKVHKDYVRNGLNLPEEKRNQVKDIKKKI 207

Query: 189 SVNSINFSKNLGEQKEYITFTKEQLEGVPDSILTQFETIKSDKDSNETLYKVTFKYPDIF 248
           + NS+N+SKNLGEQKEY++FTKEQL+GV +S++ QFE    D  +NE  YKVTFKYPDIF
Sbjct: 208 ASNSLNYSKNLGEQKEYVSFTKEQLKGVSESVMEQFEKF-VDPKTNEEKYKVTFKYPDIF 266

Query: 249 PVMKLASSAQTRKQAFLADQNKVPENEAILLDTLKLRDELASLLGYDTYANYNLYDKMAE 308
           PV+K A   +TRK A+++DQNKVP+NEA+ ++TLKLR++LA LLGY TYANYNL  KMA+
Sbjct: 267 PVLKTAQVPKTRKLAYISDQNKVPQNEALFVETLKLRNQLAQLLGYSTYANYNLDIKMAK 326

Query: 309 DSTTVMNFLNDLKDKLIPLGRKELQVLQDMKAEDVKKLNQGADPNYYIWDHRYYDNKYLL 368
           +  TV +F+N+LKDKL PLG+KE++ L+ +K +D ++L    D +YYIWDHRYYDNK+L 
Sbjct: 327 NQETVFDFVNNLKDKLKPLGQKEIETLKTLKKKDCEELGLAYDDHYYIWDHRYYDNKFLK 386

Query: 369 ENFNVDLEKISEYFPLEATITGMLEIYETLFNLKFIETKDSQNKSVWHDDVKQIAVWNMD 428
           +N+NVDLE+ISEY+PLE+TI GML IYETL  LKF++  + + K VWH+DVKQ+AVW MD
Sbjct: 387 DNYNVDLEQISEYYPLESTIKGMLGIYETLLKLKFVDETNPKIKDVWHEDVKQLAVWKMD 446

Query: 429 DPKSPNFVGWIYFDLHPRDGKYGHAANFGLSSSFMIDDTTRSYPVTALVCNFSKSTKDKP 488
           D K+P F+GWIYFDLHPRDGKY HAANFG+SSS++  D  RS+PVTALVCNFSKST  KP
Sbjct: 447 DEKNPEFIGWIYFDLHPRDGKYSHAANFGISSSYITQDGDRSFPVTALVCNFSKSTDKKP 506

Query: 489 SLLKHNEIVTFFHELGHGIHDLVGQNKESRFNGPGSVPWDFVEAPSQMLEFWTWNKNELI 548
           SLLKHNEI TFFHELGHGIHDLVG+NK +RFNGPG+ PWDFVEAPSQMLEFWTWNKNEL+
Sbjct: 507 SLLKHNEITTFFHELGHGIHDLVGKNKCARFNGPGATPWDFVEAPSQMLEFWTWNKNELL 566

Query: 549 NLSSHYKTGEKIPESLINSLIKTKHVNGALFTLRQLHFGLFDMKVHTCKDLQNLSICDTW 608
           +LS HY+TGEKI E L++SLI TKHVNGALF LRQLHFGLFDM VHT K++++L++   W
Sbjct: 567 SLSGHYQTGEKISEDLLDSLIATKHVNGALFALRQLHFGLFDMTVHTTKNVEDLNLLKLW 626

Query: 609 NQLRQDISLISNGGTLSKGYDSFGHIMSDSYSAGYYGYLWAEVFATDMYHTKFAKDPLNA 668
           N+LR+ I L+ NG  L+KGYDSFGHIMSDSYSAGYYGY+WAEVFA DMY+TKFA DPLN+
Sbjct: 627 NELREKICLVENGNELTKGYDSFGHIMSDSYSAGYYGYMWAEVFAADMYYTKFASDPLNS 686

Query: 669 KNGIQYRDIVLARGGLYDINDNLKEFLGREPSKDAFLKELGLQN 712
           + G+QYRDIVLA GGLY+I D LKEFLGREP+ DAFLKELGL N
Sbjct: 687 QAGVQYRDIVLANGGLYEIADKLKEFLGREPTNDAFLKELGLHN 730

>TPHA0E03970 Chr5 complement(834023..836266) [2244 bp, 747 aa] {ON}
           Anc_1.9 YCL057W
          Length = 747

 Score =  945 bits (2443), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 458/705 (64%), Positives = 552/705 (78%), Gaps = 15/705 (2%)

Query: 19  LYTRSLYSMANTTSFPIAPQAPPNWSFTPSDISGKTNEIINNSNNFYDSMSKVESPSVSN 78
            YT S   M N  +F IAPQ  P W F+P  I     +II+ SN+FY++M  +E+PS+ N
Sbjct: 46  FYTASQVKM-NEAAF-IAPQLSPKWDFSPERILSDAKKIIDTSNDFYNAMVAIENPSIEN 103

Query: 79  FVEPFMKFENELGPIINQLTFLQHVSSDKEIRDASVNSSMKLDELNIDLSLRHDIFLQFA 138
           FV P + FENE    INQLTFLQHVS DK IRDAS+ ++  +   +I++SLR+D+F QF 
Sbjct: 104 FVIPSINFENENSLAINQLTFLQHVSKDKLIRDASLEATELITNFDIEISLRYDMFKQFD 163

Query: 139 RVWQDVQ--------SKADSVERETFKYVEKSYKDYIHSGLELDEGNRLKIKEIKKKISV 190
           +++ D++          A   + E FKYVEK +KDY+ SGL L E  R +IKEIKK+I++
Sbjct: 164 KIFNDLKDNKKYNDLKTATPKDYEIFKYVEKCHKDYVRSGLNLSEEKRNEIKEIKKRIAL 223

Query: 191 NSINFSKNLGEQKEYITFTKEQLEGVPDSILTQFETIKSDKDSNETLYKVTFKYPDIFPV 250
           NS+ FSKNLGEQ E++ FTKE+LEGV D ++ QFET  +D+ + E  +KVTFKYPDIFPV
Sbjct: 224 NSLQFSKNLGEQNEFVAFTKEELEGVSDDVMKQFETY-TDEQTGEQKFKVTFKYPDIFPV 282

Query: 251 MKLASSAQTRKQAFLADQNKVPENEAILLDTLKLRDELASLLGYDTYANYNLYDKMAEDS 310
           +K A +  TRK AF ADQNKVPENE + +DTLKLR +L  +LGYDTYANYNL  KMA++ 
Sbjct: 283 LKTAKNPNTRKIAFNADQNKVPENEKLFIDTLKLRYQLGKILGYDTYANYNLDIKMAKNQ 342

Query: 311 TTVMNFLNDLKDKLIPLGRKELQVLQDMKAEDVKKLNQGADPNYYIWDHRYYDNKYLLEN 370
            TVM FL DLKDKL PL  KE++VL+ +K  + ++LN   D +YYIWDHRYYDNKYL + 
Sbjct: 343 ETVMEFLVDLKDKLKPLAEKEIEVLKAIKKTEAQELNMAYDDHYYIWDHRYYDNKYLKDK 402

Query: 371 FNVDLEKISEYFPLEATITGMLEIYETLFNLKFIETKDSQNKSVWH-DDVKQIAVWNMDD 429
           FNVDLEKISEY+P+E+TI GML+IYET+ NLKFIE  D   KS W  DDVKQ+AVW MDD
Sbjct: 403 FNVDLEKISEYYPVESTIQGMLKIYETVMNLKFIEETDKDLKSTWAGDDVKQLAVWKMDD 462

Query: 430 PKSPNFVGWIYFDLHPRDGKYGHAANFGLSSSFMIDDTTRSYPVTALVCNFSKSTKDKPS 489
           P  P FVGWIYFDLHPR+GKYGHAANFG++ S++  D+ R YPVTALVCNFS +T DKP+
Sbjct: 463 PSKPEFVGWIYFDLHPREGKYGHAANFGMAPSYIDKDSKRIYPVTALVCNFSAATADKPA 522

Query: 490 LLKHNEIVTFFHELGHGIHDLVGQNKESRFNGPGSVPWDFVEAPSQMLEFWTWNKNELIN 549
           LLKHNEI TFFHELGHGIHDLVG N   RFNGPG+VPWDFVEAPSQMLEFWTWNKNEL++
Sbjct: 523 LLKHNEITTFFHELGHGIHDLVGNNGIGRFNGPGAVPWDFVEAPSQMLEFWTWNKNELLS 582

Query: 550 LSSHYKTGEKIPESLINSLIKTKHVNGALFTLRQLHFGLFDMKVHTCKD---LQNLSICD 606
           LS HYKTGEKIPESL+ SLI TKHVNGALF LRQLHFGLFDMKVHT  D   + N+ +  
Sbjct: 583 LSKHYKTGEKIPESLLESLIATKHVNGALFALRQLHFGLFDMKVHTTTDDNQIDNMDLVQ 642

Query: 607 TWNQLRQDISLISNGGTLSKGYDSFGHIMSDSYSAGYYGYLWAEVFATDMYHTKFAKDPL 666
            WN LR++ISL+ NG  ++KGYDSFGHIMSDSYSAGYYGY+WAEVFATDMY++KFAKDPL
Sbjct: 643 LWNGLREEISLVENGDEMNKGYDSFGHIMSDSYSAGYYGYMWAEVFATDMYYSKFAKDPL 702

Query: 667 NAKNGIQYRDIVLARGGLYDINDNLKEFLGREPSKDAFLKELGLQ 711
           N K+GI+YRDI+LARGG+ + NDNLKEFLGREPSK+AFLKELGLQ
Sbjct: 703 NTKSGIEYRDIILARGGIRETNDNLKEFLGREPSKEAFLKELGLQ 747

>KNAG0C00260 Chr3 (39428..41662) [2235 bp, 744 aa] {ON} Anc_1.9
           YCL057W
          Length = 744

 Score =  944 bits (2441), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 440/678 (64%), Positives = 550/678 (81%), Gaps = 6/678 (0%)

Query: 39  APPNWSFTPSDISGKTNEIINNSNNFYDSMSKVESPSVSNFVEPFMKFENELGPIINQLT 98
           A P W F  + I  +   II ++N FYD + ++ +PS+ N V+P+M  EN +G ++NQL 
Sbjct: 67  ALPRWEFPSAKIGEEATRIIESTNKFYDELVEISNPSIDNLVKPYMNHENSIGLMVNQLC 126

Query: 99  FLQHVSSDKEIRDASVNSSMKLDELNIDLSLRHDIFLQFARVWQDVQSKA-----DSVER 153
           FLQHVSSDKEIR+AS  ++  L    I+ SLRHD+FLQF ++W++++ +      D  + 
Sbjct: 127 FLQHVSSDKEIREASNKATELLQNFEIETSLRHDLFLQFDKIWKELKPRKEEFSHDEEQF 186

Query: 154 ETFKYVEKSYKDYIHSGLELDEGNRLKIKEIKKKISVNSINFSKNLGEQKEYITFTKEQL 213
           E +K+VEK +KD++ +GL L E +R K+K+IK KI+ NS+ FSKNLGEQKE++ F+KEQL
Sbjct: 187 EIYKFVEKCHKDFVRAGLNLSEEDRNKVKDIKIKIASNSLEFSKNLGEQKEFLLFSKEQL 246

Query: 214 EGVPDSILTQFETIKSDKDSNETLYKVTFKYPDIFPVMKLASSAQTRKQAFLADQNKVPE 273
           +GV D+++ QFE +K D+ +NET YKVTFKYPDIFPV+K+A +A+TRK AF  DQNKVP+
Sbjct: 247 DGVSDTVMEQFEQVK-DETTNETNYKVTFKYPDIFPVLKMAKNAETRKTAFCGDQNKVPQ 305

Query: 274 NEAILLDTLKLRDELASLLGYDTYANYNLYDKMAEDSTTVMNFLNDLKDKLIPLGRKELQ 333
           NE + + TLKLRDELA+LLGYDTYANYNL  KMA+  +TV  FLNDLKDKL PLG KE+ 
Sbjct: 306 NEELFVATLKLRDELATLLGYDTYANYNLEIKMAKKQSTVFKFLNDLKDKLKPLGEKEIG 365

Query: 334 VLQDMKAEDVKKLNQGADPNYYIWDHRYYDNKYLLENFNVDLEKISEYFPLEATITGMLE 393
           +L+ +K  + K+L    D  YYIWDHRYYD KYL +NFNVD E I+EY+P+++TI GML+
Sbjct: 366 ILKSIKEAECKELGVPFDGRYYIWDHRYYDTKYLKDNFNVDHEAIAEYYPIDSTIEGMLK 425

Query: 394 IYETLFNLKFIETKDSQNKSVWHDDVKQIAVWNMDDPKSPNFVGWIYFDLHPRDGKYGHA 453
           IYET+F LKF+E KD+  K+VW++DVKQIAVW MD+ K+P FVGWIYFDLHPRDGKYGHA
Sbjct: 426 IYETVFKLKFVEEKDTAKKNVWNEDVKQIAVWKMDNVKTPVFVGWIYFDLHPRDGKYGHA 485

Query: 454 ANFGLSSSFMIDDTTRSYPVTALVCNFSKSTKDKPSLLKHNEIVTFFHELGHGIHDLVGQ 513
           ANFG++SS++ +D +RSYPVTALVCNFSKS+  KPSLLKHNEI TFFHELGHGIHDLVG+
Sbjct: 486 ANFGIASSYIREDGSRSYPVTALVCNFSKSSATKPSLLKHNEITTFFHELGHGIHDLVGK 545

Query: 514 NKESRFNGPGSVPWDFVEAPSQMLEFWTWNKNELINLSSHYKTGEKIPESLINSLIKTKH 573
           N+ +RFNGPG+ PWDFVEAPSQMLEF+TW+KN L +LS HYKTGE+IPE L++SLI TKH
Sbjct: 546 NRAARFNGPGATPWDFVEAPSQMLEFYTWDKNALQSLSKHYKTGEQIPEKLLDSLIATKH 605

Query: 574 VNGALFTLRQLHFGLFDMKVHTCKDLQNLSICDTWNQLRQDISLISNGGTLSKGYDSFGH 633
           VNGALF LRQLHFGLFDM VHT KD+ +L +   W  LRQ+ISL+ NGG  +KGYDSFGH
Sbjct: 606 VNGALFALRQLHFGLFDMTVHTSKDVASLDLLKLWGDLRQEISLVENGGQYTKGYDSFGH 665

Query: 634 IMSDSYSAGYYGYLWAEVFATDMYHTKFAKDPLNAKNGIQYRDIVLARGGLYDINDNLKE 693
           IMSDSYSAGYYGY+WAEVFATDMY TKFA +PL++  G++YRDIVLA GGLY+I+DNLKE
Sbjct: 666 IMSDSYSAGYYGYMWAEVFATDMYRTKFAPNPLDSSVGMKYRDIVLANGGLYEIDDNLKE 725

Query: 694 FLGREPSKDAFLKELGLQ 711
           FLGREPSKDAFLKELGLQ
Sbjct: 726 FLGREPSKDAFLKELGLQ 743

>ZYRO0F18392g Chr6 complement(1518902..1521079) [2178 bp, 725 aa]
           {ON} similar to uniprot|P25375 Saccharomyces cerevisiae
           YCL057W PRD1 Zinc metalloendopeptidase found in the
           cytoplasm and intermembrane space of mitochondria
          Length = 725

 Score =  935 bits (2417), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 437/705 (61%), Positives = 560/705 (79%), Gaps = 7/705 (0%)

Query: 11  ASPVISPLLY--TRSLYSMANTTSFPIAPQAPPNWSFTPSDISGKTNEIINNSNNFYDSM 68
           A P ++  +Y  ++  YS  ++ +  IAPQ+ P+W+FTP  +  +T+ +I +S  FYDS+
Sbjct: 22  AVPALAIGIYRVSKFQYSTMSSPNLFIAPQSAPSWAFTPQSLLDETHRLIESSKQFYDSL 81

Query: 69  SKVESPSVSNFVEPFMKFENELGPIINQLTFLQHVSSDKEIRDASVNSSMKLDELNIDLS 128
           +++ +P+V N V+P+M  EN +G I +QLTF Q VS+DKEIRDASV ++  L    I+ S
Sbjct: 82  AQLSNPTVENLVKPYMHHENGVGLIESQLTFPQQVSADKEIRDASVQATEFLQNFGIEQS 141

Query: 129 LRHDIFLQFARVWQDVQSKA---DSVERETFKYVEKSYKDYIHSGLELDEGNRLKIKEIK 185
           LRHD+FLQF ++W +++ K+    S E E +KYVEK ++DY   GL+L E  R K+K++K
Sbjct: 142 LRHDLFLQFDKIWNELKDKSFEQGSQEYEIYKYVEKIHRDYTRDGLQLPEDKRDKVKQLK 201

Query: 186 KKISVNSINFSKNLGEQKEYITFTKEQLEGVPDSILTQFETIKSDKDSNETLYKVTFKYP 245
            KI+ NS+ FSKNLGEQKE++ FTKE+L+GV +S++ QFE  K +  +  T YKVTFKYP
Sbjct: 202 IKIAANSLEFSKNLGEQKEFVAFTKEELDGVSESVMDQFEQFKDENGT--TKYKVTFKYP 259

Query: 246 DIFPVMKLASSAQTRKQAFLADQNKVPENEAILLDTLKLRDELASLLGYDTYANYNLYDK 305
           DIFPV+K A + +TRK AF  DQ+KVP+NE + ++TL+LR+ELA +LGY TYANYNL  K
Sbjct: 260 DIFPVLKTAKNPKTRKLAFARDQDKVPQNEKLFVETLQLRNELADILGYSTYANYNLELK 319

Query: 306 MAEDSTTVMNFLNDLKDKLIPLGRKELQVLQDMKAEDVKKLNQGADPNYYIWDHRYYDNK 365
           MA++   V  FLN+LKDKL PLG KE + L+ +K ++ + L    D +YY+WDHRYYDNK
Sbjct: 320 MAKNQDNVWKFLNELKDKLKPLGLKEAENLKQIKQKECESLGLPYDGHYYVWDHRYYDNK 379

Query: 366 YLLENFNVDLEKISEYFPLEATITGMLEIYETLFNLKFIETKDSQNKSVWHDDVKQIAVW 425
           YL +N+NVDLEKISEY+P+E+TI+GML IYETL  LKF+E  D + +SVWH+DVKQ+AVW
Sbjct: 380 YLKDNYNVDLEKISEYYPIESTISGMLSIYETLLKLKFVEETDPEKRSVWHEDVKQLAVW 439

Query: 426 NMDDPKSPNFVGWIYFDLHPRDGKYGHAANFGLSSSFMIDDTTRSYPVTALVCNFSKSTK 485
            MD+P  P FVGWIYFDLHPRDGKYGHAANFG+S+S++ +D TRSYPVTALVCNFSK + 
Sbjct: 440 KMDNPSKPEFVGWIYFDLHPRDGKYGHAANFGISASYVKEDGTRSYPVTALVCNFSKPSA 499

Query: 486 DKPSLLKHNEIVTFFHELGHGIHDLVGQNKESRFNGPGSVPWDFVEAPSQMLEFWTWNKN 545
            KPSLLKHNEI TFFHELGHGIHDLVG+N+ + FNGPG+VPWDFVEAPSQMLEFWTWN+ 
Sbjct: 500 KKPSLLKHNEISTFFHELGHGIHDLVGENRLTTFNGPGAVPWDFVEAPSQMLEFWTWNER 559

Query: 546 ELINLSSHYKTGEKIPESLINSLIKTKHVNGALFTLRQLHFGLFDMKVHTCKDLQNLSIC 605
           EL  LSSHY++GEKIP+ L+ SLI TKHV+GALF LRQLHFGLFDM VHT K++  L + 
Sbjct: 560 ELHELSSHYESGEKIPKDLLQSLISTKHVDGALFALRQLHFGLFDMYVHTSKNVAKLDLL 619

Query: 606 DTWNQLRQDISLISNGGTLSKGYDSFGHIMSDSYSAGYYGYLWAEVFATDMYHTKFAKDP 665
             WN+LR+++SL+ NG T +KGYDSFGHIMSDSYSAGYYGY+WAEVFA DMYHT+FA DP
Sbjct: 620 KLWNELREEVSLVENGDTFTKGYDSFGHIMSDSYSAGYYGYMWAEVFAADMYHTRFAADP 679

Query: 666 LNAKNGIQYRDIVLARGGLYDINDNLKEFLGREPSKDAFLKELGL 710
           L++K G+QYRDIVL RGGLY+ NDNL+EFLGREPS++AFLKELGL
Sbjct: 680 LDSKAGVQYRDIVLGRGGLYETNDNLREFLGREPSEEAFLKELGL 724

>SAKL0C00550g Chr3 (48410..50608) [2199 bp, 732 aa] {ON} highly
           similar to gnl|GLV|KLLA0C00572g Kluyveromyces lactis
           KLLA0C00572g and similar to YCL057W uniprot|P25375
           Saccharomyces cerevisiae YCL057W PRD1 Zinc
           metalloendopeptidase found in the cytoplasm and
           intermembrane space of mitochondria
          Length = 732

 Score =  922 bits (2382), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 432/685 (63%), Positives = 543/685 (79%), Gaps = 5/685 (0%)

Query: 28  ANTTSFPIAPQAPPNWSFTPSDISGKTNEIINNSNNFYDSMSKVESPSVSNFVEPFMKFE 87
           A  ++  + PQA P+W ++P DI   TNE I +++  +D+++ VE+P+V + V+PF++ E
Sbjct: 50  ATMSATLVPPQAAPSWKYSPEDILQLTNETIASTSALHDALAGVENPTVESLVKPFLEHE 109

Query: 88  NELGPIINQLTFLQHVSSDKEIRDASVNSSMKLDELNIDLSLRHDIFLQFARVWQDVQSK 147
           N   P+INQLTFLQHVS+DKE+RDAS  ++  L +  I+ SLRHD+F+QF +VWQ  +  
Sbjct: 110 NTTQPLINQLTFLQHVSADKEVRDASTKATELLQDFEIEASLRHDLFVQFDKVWQACKDD 169

Query: 148 ADSVER--ETFKYVEKSYKDYIHSGLELDEGNRLKIKEIKKKISVNSINFSKNLGEQKEY 205
           A   +   E +K+VEK +KDY+ +GL L E  R ++KE++KKIS NS+ FSKNLGEQKE+
Sbjct: 170 AKFKKEHFELYKFVEKCHKDYVRAGLNLPEEKRNEVKELQKKISNNSLQFSKNLGEQKEF 229

Query: 206 ITFTKEQLEGVPDSILTQFETIKSDKDSNETLYKVTFKYPDIFPVMKLASSAQTRKQAFL 265
           + FT E+L+GV  S++ QFE   +D D  E  +KV+FKYPDI PV+K A + +TRK+AF 
Sbjct: 230 VAFTTEELDGVSASVMDQFEKF-TDTDGVEK-HKVSFKYPDILPVLKTAKNPETRKRAFG 287

Query: 266 ADQNKVPENEAILLDTLKLRDELASLLGYDTYANYNLYDKMAEDSTTVMNFLNDLKDKLI 325
            DQNKVP+NE + L+TL+LRDELA LLGY TYANYNL  KMA+   TV+ FL DLK+KL 
Sbjct: 288 GDQNKVPQNEVLFLETLRLRDELAGLLGYSTYANYNLDIKMAKKQETVLAFLEDLKNKLK 347

Query: 326 PLGRKELQVLQDMKAEDVKKLNQGADPNYYIWDHRYYDNKYLLENFNVDLEKISEYFPLE 385
           PLG KE++ L+ +K +D K+L    D +YYIWD+RYYDNKYL EN+NVD EKISEYFPLE
Sbjct: 348 PLGVKEIEALKSLKEKDCKELAIPFDNHYYIWDNRYYDNKYLKENYNVDEEKISEYFPLE 407

Query: 386 ATITGMLEIYETLFNLKFIETKDSQNKSVWHDDVKQIAVWNMDDPKSPNFVGWIYFDLHP 445
            TI GML+IYET+  LKF+E  D++ K VWH+DVKQ+AVW +D  +SP FVGWIYFDLHP
Sbjct: 408 PTIGGMLKIYETVLKLKFVEETDAEKKQVWHEDVKQLAVWKVDKAESPEFVGWIYFDLHP 467

Query: 446 RDGKYGHAANFGLSSSFMIDDTTRSYPVTALVCNFSKSTKDKPSLLKHNEIVTFFHELGH 505
           RDGKYGHAANFG++SS+ + D  RS+PVTALVCNFSK +  KP+LLKH+EI TFFHELGH
Sbjct: 468 RDGKYGHAANFGIASSY-VRDGARSHPVTALVCNFSKPSAKKPALLKHSEITTFFHELGH 526

Query: 506 GIHDLVGQNKESRFNGPGSVPWDFVEAPSQMLEFWTWNKNELINLSSHYKTGEKIPESLI 565
           GIHDLVG N   RFNGPG+ PWDFVEAPSQMLEFWTWNKNEL  LS HY+TGEKIPE L+
Sbjct: 527 GIHDLVGGNHIGRFNGPGATPWDFVEAPSQMLEFWTWNKNELSTLSQHYETGEKIPEQLL 586

Query: 566 NSLIKTKHVNGALFTLRQLHFGLFDMKVHTCKDLQNLSICDTWNQLRQDISLISNGGTLS 625
           +SLI TKHVNGALF LRQL FGLFDM VHTCKDL++L +   WN LRQ++SL+ NG  ++
Sbjct: 587 DSLIATKHVNGALFALRQLTFGLFDMTVHTCKDLESLDVTSLWNDLRQEVSLVENGDQVT 646

Query: 626 KGYDSFGHIMSDSYSAGYYGYLWAEVFATDMYHTKFAKDPLNAKNGIQYRDIVLARGGLY 685
           KG++SFGHIMS +YSAGYYGY+WAEVFA DMYHTKFA DPLN   G++YRDIVL+RGGLY
Sbjct: 647 KGFNSFGHIMSGAYSAGYYGYMWAEVFAADMYHTKFAADPLNGDVGVRYRDIVLSRGGLY 706

Query: 686 DINDNLKEFLGREPSKDAFLKELGL 710
           +I+DNL+EFLGREP+ +AFLKELGL
Sbjct: 707 EIDDNLREFLGREPNNEAFLKELGL 731

>KAFR0D00180 Chr4 (18900..21071) [2172 bp, 723 aa] {ON} Anc_1.9
           YCL057W
          Length = 723

 Score =  921 bits (2380), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 447/703 (63%), Positives = 563/703 (80%), Gaps = 10/703 (1%)

Query: 13  PVISPLLYTRSLYSMANTTSFPIAPQAPPNWSFTPSDISGKTNEIINNSNNFYDSMSKVE 72
           P  S L+Y R LYS    ++F IAPQA P+W++ PS +      +I+NSN  YD +S ++
Sbjct: 23  PATSYLVYNR-LYSNMTISAF-IAPQAAPSWNWNPSRLLFDAECVIDNSNRLYDELSSLK 80

Query: 73  SPSVSNFVEPFMKFENELGPIINQLTFLQHVSSDKEIRDASVNSSMKLDELNIDLSLRHD 132
            P+V N V P+M  EN++ P+IN+L FLQHVS D +IR+AS+ ++  L +  I+ SLRHD
Sbjct: 81  KPTVENLVRPYMIHENKISPLINKLCFLQHVSEDPKIREASLKATELLQKFEIEASLRHD 140

Query: 133 IFLQFARVWQDVQSKADSVERE----TFKYVEKSYKDYIHSGLELDEGNRLKIKEIKKKI 188
           +FLQF ++WQ++  K D   +E    T+K++EK +KDY+ SGL L E  R KIKEIK KI
Sbjct: 141 LFLQFDKIWQEISEKKDDFVKEYDFETWKFIEKVHKDYVRSGLNLPEDKREKIKEIKIKI 200

Query: 189 SVNSINFSKNLGEQKEYITFTKEQLEGVPDSILTQFETIKSDKDSNETLYKVTFKYPDIF 248
             NS+ +SKNLGEQKE I FT+E+L+GV D++  QFE    D+++ E  +KVTFKYPDIF
Sbjct: 201 GNNSLQYSKNLGEQKELIAFTREELDGVSDAVFEQFEKF-IDEETGEEKFKVTFKYPDIF 259

Query: 249 PVMKLASSAQTRKQAFLADQNKVPENEAILLDTLKLRDELASLLGYDTYANYNLYDKMAE 308
           PV+K A + +TR++AFLADQNKVP+NE + ++TLKLR+ELA+ L Y TYANYNL +KMA+
Sbjct: 260 PVLKTAKNPETRRKAFLADQNKVPQNEDLFVETLKLRNELATTLNYSTYANYNLEEKMAK 319

Query: 309 DSTTVMNFLNDLKDKLIPLGRKELQVLQDMKAEDVKKLNQGADPNYYIWDHRYYDNKYLL 368
              TV++FLNDLK +L PL  KE+ +L+D+K ++ K+LN+  D +YYI+DHRYYDNKYL 
Sbjct: 320 RQETVLDFLNDLKYRLKPLAMKEISILKDIKQKECKELNREYDSHYYIYDHRYYDNKYLK 379

Query: 369 ENFNVDLEKISEYFPLEATITGMLEIYETLFNLKFIETKDSQNKSVWHDDVKQIAVWNMD 428
           +NFNVDLE ISEY+PLE TI GML+IYE LF LKF E  +++NKSVWH+DVKQ+AVW MD
Sbjct: 380 DNFNVDLEAISEYYPLEHTINGMLKIYEELFKLKFNE--ETKNKSVWHEDVKQLAVWKMD 437

Query: 429 DPKSPNFVGWIYFDLHPRDGKYGHAANFGLSSSFM-IDDTTRSYPVTALVCNFSKSTKDK 487
           +P+ P FVGWIYFDLHPRDGKYGHAANFG+SSS++ I+   RSYPVTALVCNFSKST  +
Sbjct: 438 NPEKPEFVGWIYFDLHPRDGKYGHAANFGISSSYVDIETGKRSYPVTALVCNFSKSTATR 497

Query: 488 PSLLKHNEIVTFFHELGHGIHDLVGQNKESRFNGPGSVPWDFVEAPSQMLEFWTWNKNEL 547
           PSLLKHNEI TFFHELGHGIHDLVG+NK SRFNGPG+ PWDFVEAPSQMLEFWTWN NEL
Sbjct: 498 PSLLKHNEITTFFHELGHGIHDLVGKNKLSRFNGPGATPWDFVEAPSQMLEFWTWNANEL 557

Query: 548 INLSSHYKTGEKIPESLINSLIKTKHVNGALFTLRQLHFGLFDMKVHTCKDLQNLSICDT 607
            +LS HY++ EKIP+ L+ SLIKTKHVNGALF LRQLHFGLFDM VHT  ++++L++   
Sbjct: 558 KSLSCHYESNEKIPDDLLTSLIKTKHVNGALFALRQLHFGLFDMTVHTTNNVESLNLLKL 617

Query: 608 WNQLRQDISLISNGGTLSKGYDSFGHIMSDSYSAGYYGYLWAEVFATDMYHTKFAKDPLN 667
           WN+LR++I L+  G  LSKGYDSFGHIMSDSYSAGYYGY+WAEVFA DMYHTKF+ +PL+
Sbjct: 618 WNELREEICLVETGHELSKGYDSFGHIMSDSYSAGYYGYMWAEVFAADMYHTKFSPNPLD 677

Query: 668 AKNGIQYRDIVLARGGLYDINDNLKEFLGREPSKDAFLKELGL 710
           ++ G+QYRDIVLA GGLY+I DNL++FLGREPSK+AFLKELGL
Sbjct: 678 SEVGVQYRDIVLANGGLYEIADNLRDFLGREPSKNAFLKELGL 720

>TBLA0A07560 Chr1 complement(1871629..1873854) [2226 bp, 741 aa]
           {ON} Anc_1.9 YCL057W
          Length = 741

 Score =  919 bits (2375), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 437/681 (64%), Positives = 548/681 (80%), Gaps = 7/681 (1%)

Query: 36  APQAPPNWSFTPSDISGKTNEIINNSNNFYDSMSKVESPSVSNFVEPFMKFENELGPIIN 95
           APQA P W++TPS +     ++I+ SN+FYD+++ ++SP  +NF+ P+M +EN++G +IN
Sbjct: 61  APQAAPTWNWTPSQLVKDAEDLIDQSNHFYDALTNLKSPDFNNFLVPYMNYENKVGSLIN 120

Query: 96  QLTFLQHVSSDKEIRDASVNSSMKLDELNIDLSLRHDIFLQFARVWQDVQSKADSVER-- 153
           QLTFLQHVSS+K+IRDAS  ++  L    I+ SLR+ +FLQF ++W  ++   D  E+  
Sbjct: 121 QLTFLQHVSSEKDIRDASFKATDLLQNFEIETSLRYGLFLQFDKIWNQIKDSKDKYEKDP 180

Query: 154 ---ETFKYVEKSYKDYIHSGLELDEGNRLKIKEIKKKISVNSINFSKNLGEQKEYITFTK 210
              E +++V K ++D++ +GL LDE  R KIKEIKK I+ NS+ F+ NLGEQ E++ FTK
Sbjct: 181 KDLENYEFVRKVHRDFVRAGLNLDESKREKIKEIKKAIANNSLKFATNLGEQTEFVAFTK 240

Query: 211 EQLEGVPDSILTQFETIKSDKDSNETLYKVTFKYPDIFPVMKLASSAQTRKQAFLADQNK 270
           E+L+GV DS++ QFE    +K   E +YKVTFKYPDIFPV+K A + +TRK+AF  DQNK
Sbjct: 241 EELDGVSDSVMEQFEKFNDEKTGKE-MYKVTFKYPDIFPVLKTARNPETRKKAFAGDQNK 299

Query: 271 VPENEAILLDTLKLRDELASLLGYDTYANYNLYDKMAEDSTTVMNFLNDLKDKLIPLGRK 330
           V EN  +  +TLKLR++LA +LGY TYANYNL  KMA+   +V  FL DL D+L PLG K
Sbjct: 300 VSENTVLFTNTLKLRNQLADILGYSTYANYNLELKMAKAQDSVFKFLEDLIDRLKPLGSK 359

Query: 331 ELQVLQDMKAEDVKKLNQGADPNYYIWDHRYYDNKYLLENFNVDLEKISEYFPLEATITG 390
           E+++L+ +K ++ K+LN   D +YY+WDHRYYDNKYL +N+NVDLEKISEY+PL++TI G
Sbjct: 360 EIEILKSIKEKEFKELNLPFDNHYYVWDHRYYDNKYLKDNYNVDLEKISEYYPLDSTIEG 419

Query: 391 MLEIYETLFNLKFIETKD-SQNKSVWHDDVKQIAVWNMDDPKSPNFVGWIYFDLHPRDGK 449
           ML IYETL NLKFIE KD S+NK+VWH +VKQ+AVW MD+P++P FVGWIYFDLHPRDGK
Sbjct: 420 MLNIYETLLNLKFIEEKDDSKNKNVWHKEVKQLAVWKMDNPENPEFVGWIYFDLHPRDGK 479

Query: 450 YGHAANFGLSSSFMIDDTTRSYPVTALVCNFSKSTKDKPSLLKHNEIVTFFHELGHGIHD 509
           YGHAANFG+SSS++  +  RSYPVTALVCNFSK T DKP+LLKHNEI TFFHELGHGIHD
Sbjct: 480 YGHAANFGISSSYIKPNNERSYPVTALVCNFSKVTADKPALLKHNEITTFFHELGHGIHD 539

Query: 510 LVGQNKESRFNGPGSVPWDFVEAPSQMLEFWTWNKNELINLSSHYKTGEKIPESLINSLI 569
           LVG+N  SRFNGPG+VPWDFVEAPSQMLEFWTWNKNEL++LS HYKTGEKIP  L+NSL+
Sbjct: 540 LVGKNNNSRFNGPGAVPWDFVEAPSQMLEFWTWNKNELLSLSKHYKTGEKIPTELLNSLV 599

Query: 570 KTKHVNGALFTLRQLHFGLFDMKVHTCKDLQNLSICDTWNQLRQDISLISNGGTLSKGYD 629
            TKHVNGALF LRQLHFGLFDMKVHT KDL+NL     WN+LR+++SL+ NG   +KGYD
Sbjct: 600 ATKHVNGALFALRQLHFGLFDMKVHTSKDLENLDFLKLWNELREEVSLVENGDLFTKGYD 659

Query: 630 SFGHIMSDSYSAGYYGYLWAEVFATDMYHTKFAKDPLNAKNGIQYRDIVLARGGLYDIND 689
           SFGHIMSDSYSAGYYGY+WAEVFATDMY+TKFA +PL  K G++YRD VLARGGLY+I D
Sbjct: 660 SFGHIMSDSYSAGYYGYMWAEVFATDMYYTKFAANPLETKVGVEYRDWVLARGGLYEIED 719

Query: 690 NLKEFLGREPSKDAFLKELGL 710
           NL +FLGR+PS +AFLKELGL
Sbjct: 720 NLIQFLGRKPSNEAFLKELGL 740

>NDAI0A00180 Chr1 (14692..16914) [2223 bp, 740 aa] {ON} Anc_1.9
          Length = 740

 Score =  901 bits (2328), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 433/688 (62%), Positives = 551/688 (80%), Gaps = 6/688 (0%)

Query: 26  SMANTTSFPIAPQAPPNWSFTPSDISGKTNEIINNSNNFYDSMSKVESPSVSNFVEPFMK 85
           ++ N   F       P+W++TP  I  +T   I  +N +Y+S+S++ESPS+ N + P+M 
Sbjct: 56  TVNNKHGFIAPANTVPDWTWTPKQILDETKSYIEKTNKYYNSISEIESPSIENLIIPYMN 115

Query: 86  FENELGPIINQLTFLQHVSSDKEIRDASVNSSMKLDELNIDLSLRHDIFLQFARVWQDVQ 145
           +EN++G +INQLTFLQHVS+DK+IRDAS+ ++  L++ +I  SLR +I+ QF +VW+ VQ
Sbjct: 116 YENKMGLLINQLTFLQHVSADKKIRDASLEATRLLEDHDILTSLRWEIWEQFEKVWETVQ 175

Query: 146 SKADSVER---ETFKYVEKSYKDYIHSGLELDEGNRLKIKEIKKKISVNSINFSKNLGEQ 202
           +  D ++    ET+K++EK +KD + +GL+ +   +LK   IK KIS +++ FS NLGEQ
Sbjct: 176 NDDDFLKNHQFETYKFIEKIHKDSLRNGLKSERNYQLKY--IKGKISADALTFSSNLGEQ 233

Query: 203 KEYITFTKEQLEGVPDSILTQFETIKSDKDSNETLYKVTFKYPDIFPVMKLASSAQTRKQ 262
            EY++FTKE+L+GV ++++ QFE    D  +NE  YKVTFKYPDIFPV+K A + +TRK 
Sbjct: 234 NEYVSFTKEELDGVSETVMDQFEKF-IDPKTNEKKYKVTFKYPDIFPVLKTAKNPKTRKI 292

Query: 263 AFLADQNKVPENEAILLDTLKLRDELASLLGYDTYANYNLYDKMAEDSTTVMNFLNDLKD 322
           AFL DQNKVPENE +L + LKLR ELA+ LGY TYANYNL  KMA++  TV+ FLNDLK+
Sbjct: 293 AFLGDQNKVPENEKLLCNVLKLRKELANTLGYSTYANYNLDIKMAKNQETVLKFLNDLKE 352

Query: 323 KLIPLGRKELQVLQDMKAEDVKKLNQGADPNYYIWDHRYYDNKYLLENFNVDLEKISEYF 382
           KL PL  KE+++L+D+K ++ ++L    D +YYIWDHRYYDNKYL +NFNVD+EKISEY+
Sbjct: 353 KLKPLAEKEIKILKDLKKKECEELGIPYDGHYYIWDHRYYDNKYLKDNFNVDIEKISEYY 412

Query: 383 PLEATITGMLEIYETLFNLKFIETKDSQNKSVWHDDVKQIAVWNMDDPKSPNFVGWIYFD 442
           PLE+TI GML+IYET+ NLKFIE  D   K+VWH DVKQ++VWNMDD  +P FVGWIYFD
Sbjct: 413 PLESTIDGMLKIYETVLNLKFIEETDPLAKNVWHPDVKQLSVWNMDDRANPAFVGWIYFD 472

Query: 443 LHPRDGKYGHAANFGLSSSFMIDDTTRSYPVTALVCNFSKSTKDKPSLLKHNEIVTFFHE 502
           L+PRDGKYGHAANFG++SS++ ++  RSYPVTALVCNFSK TK+KP+LLKH+EI TFFHE
Sbjct: 473 LYPRDGKYGHAANFGIASSYITEENKRSYPVTALVCNFSKPTKNKPALLKHSEITTFFHE 532

Query: 503 LGHGIHDLVGQNKESRFNGPGSVPWDFVEAPSQMLEFWTWNKNELINLSSHYKTGEKIPE 562
           LGHGIHDLVGQNK +RFNGPGSVPWDFVEAPSQMLEFWTWNKNEL++LS HYKTGEKIPE
Sbjct: 533 LGHGIHDLVGQNKAARFNGPGSVPWDFVEAPSQMLEFWTWNKNELLSLSKHYKTGEKIPE 592

Query: 563 SLINSLIKTKHVNGALFTLRQLHFGLFDMKVHTCKDLQNLSICDTWNQLRQDISLISNGG 622
            L++SLI TKHVNGALF LRQLHFGLFDM VHT KD++NL +   WN+ R++I L+ NG 
Sbjct: 593 DLLDSLISTKHVNGALFALRQLHFGLFDMTVHTTKDIENLDLLKLWNESREEICLVENGE 652

Query: 623 TLSKGYDSFGHIMSDSYSAGYYGYLWAEVFATDMYHTKFAKDPLNAKNGIQYRDIVLARG 682
             +KGY+SFGHI+SDSYSAGYYGY+WAEVFA DMYHTKFA +PL+   GI+YRD++LA+G
Sbjct: 653 NFTKGYNSFGHIISDSYSAGYYGYMWAEVFAADMYHTKFAPNPLDVSVGIKYRDLILAKG 712

Query: 683 GLYDINDNLKEFLGREPSKDAFLKELGL 710
           GLY+INDNL EFLGREPS   FLKELGL
Sbjct: 713 GLYEINDNLLEFLGREPSNKPFLKELGL 740

>KLLA0C00572g Chr3 (42069..44207) [2139 bp, 712 aa] {ON} similar to
           uniprot|P25375 Saccharomyces cerevisiae YCL057W PRD1
           Zinc metalloendopeptidase found in the cytoplasm and
           intermembrane space of mitochondria
          Length = 712

 Score =  896 bits (2316), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 440/722 (60%), Positives = 550/722 (76%), Gaps = 22/722 (3%)

Query: 1   MRLLLCKNWFASP---VISPLLYTRS-----LYSMANTTSFPIAPQAPPNWSFTPSDISG 52
           MR +L    F S    V+ P L   S     + S+   T F + PQA P+W++T  ++  
Sbjct: 1   MRNVLANLRFKSATSLVVIPTLAFASFQFNAIRSIMTKTDF-VVPQAAPSWNYTTEELLK 59

Query: 53  KTNEIINNSNNFYDSMSKVESPSVSNFVEPFMKFENELGPIINQLTFLQHVSSDKEIRDA 112
           +T+E I++SN   DS+  + +PSV NFV P++  EN + P+ NQLTFLQHVSSDKE+RD 
Sbjct: 60  QTHEAIDSSNELLDSLESISNPSVENFVTPYLHHENTISPLFNQLTFLQHVSSDKELRDT 119

Query: 113 SVNSSMKLDELNIDLSLRHDIFLQFARVWQ----DVQSKADSVERETFKYVEKSYKDYIH 168
           S   +  ++   I+ SLR  +F QF  VW     D Q K D  E   +K+VEK +KD++ 
Sbjct: 120 STKVTELIENFGIESSLRFKLFRQFDIVWNQLKDDAQFKKDHFE--IYKFVEKCHKDFLR 177

Query: 169 SGLELDEGNRLKIKEIKKKISVNSINFSKNLGEQKEYITFTKEQLEGVPDSILTQFETIK 228
           SGL L E  R K+KEIKKKIS NS+ FSKNLGEQ E+ITFTKE+L GV ++++ QFET+ 
Sbjct: 178 SGLNLPEEQRDKVKEIKKKISNNSLQFSKNLGEQNEFITFTKEELIGVSENVMKQFETVD 237

Query: 229 SDKDSNETLYKVTFKYPDIFPVMKLASSAQTRKQAFLADQNKVPENEAILLDTLKLRDEL 288
            D     T YKVTFKYPDIFPV+K A +A+TRK+AF+ DQNKVP+NEA+ L+TL+LR++L
Sbjct: 238 ED---GITKYKVTFKYPDIFPVLKSAKNAETRKRAFIGDQNKVPQNEALFLETLQLRNDL 294

Query: 289 ASLLGYDTYANYNLYDKMAEDSTTVMNFLNDLKDKLIPLGRKELQVLQDMKAEDVKKLNQ 348
           A LL YD+YA+YNL  KMA+    V+ FLNDLK+KL PLG KEL  L+++K E+ K+LN 
Sbjct: 295 AELLNYDSYADYNLDIKMAKKEEAVLTFLNDLKNKLKPLGEKELTKLKNLKEEECKELNT 354

Query: 349 GADPNYYIWDHRYYDNKYLLENFNVDLEKISEYFPLEATITGMLEIYETLFNLKFIETKD 408
             D  YYIWD+RYYDN+YL +NF +D EKI+EYFPLE+TI GML+IYET+  LKFIE   
Sbjct: 355 PYDRRYYIWDNRYYDNQYLKKNFQIDEEKIAEYFPLESTIKGMLQIYETVLKLKFIE--- 411

Query: 409 SQNKSVWHDDVKQIAVWNMDDPKSPNFVGWIYFDLHPRDGKYGHAANFGLSSSFMIDDTT 468
             N   WH DVK+++VW MDD   P+FVGWIYFDLHPR+GKYGHAANFG+SSSF+  D +
Sbjct: 412 EDNGDTWHPDVKKLSVWKMDD-NFPSFVGWIYFDLHPREGKYGHAANFGISSSFLKSDGS 470

Query: 469 RSYPVTALVCNFSKSTKDKPSLLKHNEIVTFFHELGHGIHDLVGQNKESRFNGPGSVPWD 528
           RSYPVTALVCNFSK TKDKP+LLKH+E+ TFFHELGHGIHDLVG N   RFNGP + PWD
Sbjct: 471 RSYPVTALVCNFSKPTKDKPALLKHSELTTFFHELGHGIHDLVGGNDIGRFNGPSATPWD 530

Query: 529 FVEAPSQMLEFWTWNKNELINLSSHYKTGEKIPESLINSLIKTKHVNGALFTLRQLHFGL 588
           FVEAPSQMLEFWTWNK EL +LS HY+T EKIP+SL++SL++TKH+NGALF LRQLHFGL
Sbjct: 531 FVEAPSQMLEFWTWNKKELKSLSKHYQTEEKIPDSLLDSLVRTKHINGALFALRQLHFGL 590

Query: 589 FDMKVHTCKDLQNLSICDTWNQLRQDISLISNGGTLSKGYDSFGHIMSDSYSAGYYGYLW 648
           FDMKVHT KD+  L++ + WN LR++I LI NG   +KG++SFGHIMSDSYSAGYYGY+W
Sbjct: 591 FDMKVHTTKDISKLNVTELWNSLREEICLIDNGDIQTKGFNSFGHIMSDSYSAGYYGYMW 650

Query: 649 AEVFATDMYHTKFAKDPLNAKNGIQYRDIVLARGGLYDINDNLKEFLGREPSKDAFLKEL 708
           A+VFA+DMY+TKF +DPLN+  G+QYRDI+LARGGLY+I DNL EFLGR+P+  AFLKEL
Sbjct: 651 ADVFASDMYYTKFLEDPLNSDVGVQYRDIILARGGLYEIEDNLTEFLGRKPNNKAFLKEL 710

Query: 709 GL 710
           GL
Sbjct: 711 GL 712

>CAGL0B00418g Chr2 (26584..28815) [2232 bp, 743 aa] {ON} similar to
           uniprot|P25375 Saccharomyces cerevisiae YCL057w PRD1
           proteinase yscD
          Length = 743

 Score =  864 bits (2232), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 434/698 (62%), Positives = 541/698 (77%), Gaps = 12/698 (1%)

Query: 22  RSLYSMANT--TSFP--IAPQAPPNWSFTPSDISGKTNEIINNSNNFYDSMSKVESPSVS 77
           R+   +ANT  T+ P    PQ PP+W F P DI  +T E I N+  FYD +  +++P++ 
Sbjct: 50  RNYSQLANTRFTNMPSLTPPQYPPSWEFKPEDILSQTKEFIANTKLFYDDLVAIDNPTIE 109

Query: 78  NFVEPFMKFENELGPIINQLTFLQHVSSDKEIRDASVNSSMKLDELNIDLSLRHDIFLQF 137
           N + P++  ENE   +INQLTFLQHVS DK IRDAS+ ++M L +  I+   R D+F QF
Sbjct: 110 NLIVPYINHENENELLINQLTFLQHVSEDKTIRDASMEATMLLQDFEIESGSRVDLFKQF 169

Query: 138 ARVWQDVQSKADSVER-ETFKYVEKSYKDYIHSGLELDEGNRLKIKEIKKKISVNSINFS 196
             +W  ++ K D  E  E +++VEK +KDY+ +GL L      K+KEIKKKI+ N + FS
Sbjct: 170 DLIWNQIKDKKDEFEDFEIWRFVEKCHKDYVRAGLNLPADKLEKVKEIKKKIADNCLKFS 229

Query: 197 KNLGEQKEYITFTKEQLEGVPDSILTQFETIKSDKDSNETLYKVTFKYPDIFPVMKLASS 256
           KNLGEQKEYI FT E+L+GVP+S++ QFE + +D+   + L KVT+KYPDIFPV+K A +
Sbjct: 230 KNLGEQKEYILFTAEELKGVPESVIEQFEKV-NDEFGIQKL-KVTYKYPDIFPVLKNAQN 287

Query: 257 AQTRKQAFLADQNKVPENEAILLDTLKLRDELASLLGYDTYANYNLYDKMAEDSTTVMNF 316
            +TR +AF+ DQNKVPENE +  DTLKLR+ELA +LGYDTYANYNL  KMA+++ TV++F
Sbjct: 288 PETRMKAFMGDQNKVPENEHLFKDTLKLRNELALVLGYDTYANYNLDIKMAKNADTVLSF 347

Query: 317 LNDLKDKLIPLGRKELQVLQDMKAEDVK-KLNQGADPNYYIWDHRYYDNKYLLENFNVDL 375
           +NDL  KL    +KEL +L+++K ++ + + N   D +YYIWDHRYYDNKYL ENFNVD 
Sbjct: 348 VNDLIVKLQDPAKKELDILKNLKKQEFENEFNMVYDGDYYIWDHRYYDNKYLKENFNVDE 407

Query: 376 EKISEYFPLEATITGMLEIYETLFNLKFIETKDSQNKSVWHDDVKQIAVWNMDDPKSPNF 435
           EKI+EY+PLE+TI GML+IYETL  LKF+E K  +NK  WHDDVKQ+AVW +D P++P F
Sbjct: 408 EKIAEYYPLESTIDGMLKIYETLLKLKFVEVK--ENKKTWHDDVKQLAVWKLDTPENPEF 465

Query: 436 VGWIYFDLHPRDGKYGHAANFGLSSSFMIDDTTRSYPVTALVCNFSKSTKDKPSLLKHNE 495
           VGWI+FDLHPRDGKYGHAANFGLSSS++  + TRSYP+TALVCNFSKSTKDKPSLLKH+E
Sbjct: 466 VGWIFFDLHPRDGKYGHAANFGLSSSYISANGTRSYPITALVCNFSKSTKDKPSLLKHSE 525

Query: 496 IVTFFHELGHGIHDLVGQNKESRFNGPGSVPWDFVEAPSQMLEFWTWNKNELINLSSHYK 555
           I TFFHELGHGIHDLVG N+  RFNGPG+VPWDFVEAPSQMLEFWTWN  EL++LS +YK
Sbjct: 526 ITTFFHELGHGIHDLVGNNRIGRFNGPGAVPWDFVEAPSQMLEFWTWNTKELLSLSQNYK 585

Query: 556 TGEKIPESLINSLIKTKHVNGALFTLRQLHFGLFDMKVH--TCKDLQNLSICDTWNQLRQ 613
              KI   L+ SLIKTKHVNGALF LRQLHFGLFDMKVH  + ++L  L I   WN LR+
Sbjct: 586 DNAKIDTKLLESLIKTKHVNGALFALRQLHFGLFDMKVHMMSAEELDKLDIKKLWNDLRE 645

Query: 614 DISLISNGGTLSKGYDSFGHIMSDSYSAGYYGYLWAEVFATDMYHTKFAKDPLNAKNGIQ 673
            I LISNG   + GY+SFGHIMS SYSAGYYGY+WAEVFATDMY+TKF  DPLN + G++
Sbjct: 646 KICLISNGDQPTTGYNSFGHIMSGSYSAGYYGYMWAEVFATDMYYTKFKADPLNPEVGVK 705

Query: 674 YRDIVLARGGLYDINDNLKEFLGREPSKDAFLKELGLQ 711
           YRDIVLARGGLY+I+DNL+EFLGR+P+KDAFL+ELGL 
Sbjct: 706 YRDIVLARGGLYEIDDNLEEFLGRKPAKDAFLEELGLH 743

>Ecym_1011 Chr1 (19924..22074) [2151 bp, 716 aa] {ON} similar to
           Ashbya gossypii AGR406C/ AGR405C
          Length = 716

 Score =  798 bits (2061), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 383/691 (55%), Positives = 512/691 (74%), Gaps = 7/691 (1%)

Query: 22  RSLYSMANTTSFPIAPQAPPNWSFTPSDISGKTNEIINNSNNFYDSMSKVESPSVSNFVE 81
           RS+++     S  ++P+  P+W F   +I     + I+    FYDS++ +E+P + NFV 
Sbjct: 31  RSVHNQERNMSSLLSPKLAPSWDFAADEIVSLAQKAIDEGTKFYDSVASLETPDLENFVV 90

Query: 82  PFMKFENELGPIINQLTFLQHVSSDKEIRDASVNSSMKLDELNIDLSLRHDIFLQFARVW 141
             +  E+E    ++QLTFLQHVS+DKE+RDAS+ ++  + E  I+ S R+D++ QF++VW
Sbjct: 91  AVIDHEDETDGYMSQLTFLQHVSADKEVRDASIEATKLIQEWGIETSSRYDLYSQFSKVW 150

Query: 142 QDVQSKAD--SVERETFKYVEKSYKDYIHSGLELDEGNRLKIKEIKKKISVNSINFSKNL 199
           +  +   +    + E + Y+E   KDYIH+G+ L E +R KIKEIKKK++ NS+ FS NL
Sbjct: 151 EQYKDDENLKKNDPELYWYMENVNKDYIHAGMGLPEESRNKIKEIKKKLANNSLAFSNNL 210

Query: 200 GEQKEYITFTKEQLEGVPDSILTQFETIKSDKDSNETLYKVTFKYPDIFPVMKLASSAQT 259
           GEQ +YI FTK++L GV ++ L QFE +  D       YK+TFKYPDI PV+  A + +T
Sbjct: 211 GEQNDYIAFTKDELVGVSETTLGQFEKVIEDGVEK---YKMTFKYPDIHPVLNTAKNPET 267

Query: 260 RKQAFLADQNKVPENEAILLDTLKLRDELASLLGYDTYANYNLYDKMAEDSTTVMNFLND 319
           RK+A++ DQNKVP+NE IL++TLKLR+ELA + G+ TYA+Y L  KMA+   TV NFL D
Sbjct: 268 RKRAYIGDQNKVPQNEQILIETLKLRNELAEIHGHPTYASYQLEMKMAKKQETVFNFLYD 327

Query: 320 LKDKLIPLGRKELQVLQDMKAEDVKKLNQGADPNYYIWDHRYYDNKYLLENFNVDLEKIS 379
           LKDKL+P G+K+L+ L+ +K ++ K+L    + ++  WD+RYYD+KYL ENF+VD E+++
Sbjct: 328 LKDKLLPGGKKDLENLKSLKEQEYKELGLPYNGSFNSWDYRYYDDKYLKENFDVDEEELA 387

Query: 380 EYFPLEATITGMLEIYETLFNLKFIETKDSQNKSVWHDDVKQIAVWNMDDPKSPNFVGWI 439
           +YFPL+ TI GML IY+ LFNLKF+E      K+VWH+DVKQ AVW++D   +P FVGWI
Sbjct: 388 KYFPLQHTIDGMLNIYQKLFNLKFVEETRECGKNVWHEDVKQFAVWDLDKC-NPEFVGWI 446

Query: 440 YFDLHPRDGKYGHAANFGLSSSFMIDDTTRSYPVTALVCNFSKSTKDKPSLLKHNEIVTF 499
           YFDLHPR+GKYGHAANFGL S ++ ++ TR YPVT LVCNFSK +  +P+LLKH E+VTF
Sbjct: 447 YFDLHPREGKYGHAANFGLYSPYVTEEGTRHYPVTVLVCNFSKPSSTRPALLKHGEVVTF 506

Query: 500 FHELGHGIHDLVGQNKESRFNGPGSVPWDFVEAPSQMLEFWTWNKNELINLSSHYKTGEK 559
           FHELGHGIH LVG+++    NGP S+PWDFVEAPSQMLEFW WNK++++ LS HY+TGE+
Sbjct: 507 FHELGHGIHALVGKSRIGHLNGPSSIPWDFVEAPSQMLEFWPWNKDQILKLSKHYETGEQ 566

Query: 560 IPESLINSLIKTKHVNGALFTLRQLHFGLFDMKVHTCKDLQNLSICDTWNQLRQDISLIS 619
           IP+ L++SLIKTKHVN  L  LRQLHF LFDM VHT K+L  L I   WN LR++++LIS
Sbjct: 567 IPDELVDSLIKTKHVNAGLSNLRQLHFSLFDMTVHTDKELDKLDIKSLWNNLREEVTLIS 626

Query: 620 NGGTLSKGYDSFGHIMSDSYSAGYYGYLWAEVFATDMYHTKFAKDPLNAKNGIQYRDIVL 679
           NG  L+KGYDSF HIMS  YSAGYYGY+W+EVFA DMYHT FA +PL+   G +YRDI+L
Sbjct: 627 NGDVLTKGYDSFSHIMS-GYSAGYYGYMWSEVFAADMYHTMFAPNPLDTSVGTRYRDIIL 685

Query: 680 ARGGLYDINDNLKEFLGREPSKDAFLKELGL 710
           A+GGL DI D+L+EFLGREP+  AFLKELGL
Sbjct: 686 AKGGLRDIEDSLEEFLGREPNNKAFLKELGL 716

>AGR406C Chr7 complement(1472496..1474547) [2052 bp, 683 aa] {ON}
           Non-syntenic homolog of Saccharomyces cerevisiae YCL057W
           (PRD1); Tandem gene duplication in this genome
          Length = 683

 Score =  693 bits (1788), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 344/679 (50%), Positives = 471/679 (69%), Gaps = 7/679 (1%)

Query: 35  IAPQAPPNWSFTPSDISGKTNEIINNSNNFYDSMSKVESPSVSNFVEPFMKFENELGPII 94
           + PQA P+W+F+  D+   ++++IN +   Y ++ + + P++ N++ P +  E E   + 
Sbjct: 8   VPPQAAPSWNFSAQDVISLSHQLINQTEAVYHNVLQEKPPTIDNYIMPLIYHEEETDLLW 67

Query: 95  NQLTFLQHVSSDKEIRDASVNSSMKLDELNIDLSLRHDIFLQFARVWQDVQ--SKADSVE 152
           NQL FL++VS D EIR+AS N++  LD+  I L+ ++D++  F  VW   +   K     
Sbjct: 68  NQLVFLRNVSPDPEIREASKNATSMLDDWIIGLTSKYDLYQHFDEVWAQYKDDEKFKKEN 127

Query: 153 RETFKYVEKSYKDYIHSGLELDEGNRLKIKEIKKKISVNSINFSKNLGEQKEYITFTKEQ 212
            E ++Y+EK    Y  SG+++   NR ++ E+K KI+   + FS NLGE+ EYI FTKE+
Sbjct: 128 FELYRYMEKDADGYRRSGMKVPVENRKRLDEVKSKIAAAELEFSSNLGEEVEYIAFTKEE 187

Query: 213 LEGVPDSILTQFETIKSDKDSNETLYKVTFKYPDIFPVMKLASSAQTRKQAFLADQNKVP 272
           LEGVPD++L QFE I    +     +KVTFKYPDI PV++LAS+ +TR++A +AD+N+V 
Sbjct: 188 LEGVPDTVLNQFEKII---EGGVEKFKVTFKYPDIGPVLRLASNPETRRRASMADENRVA 244

Query: 273 ENEAILLDTLKLRDELASLLGYDTYANYNLYDKMAEDSTTVMNFLNDLKDKLIPLGRKEL 332
            NE +L +TL+LR ELA LLG+  +A YNL DKMA++  TV+ FLNDL +KL+P+G+ +L
Sbjct: 245 ANEPLLFETLELRRELADLLGFKNFAAYNLDDKMAKNEETVLKFLNDLVEKLLPVGKNDL 304

Query: 333 QVLQDMKAEDVKKLNQGADPNYYIWDHRYYDNKYLLENFNVDLEKISEYFPLEATITGML 392
           ++L+  KAED K  N   D  +Y WD  YY NK L E +NV+ + +++YFP+E+ I GML
Sbjct: 305 EILKKKKAEDYKSKNLTFDGEFYSWDTGYYTNKILRERYNVNPDDLAQYFPVESAIEGML 364

Query: 393 EIYETLFNLKFIETKDSQNKSVWHDDVKQIAVWNMDDPKSPNFVGWIYFDLHPRDGKYGH 452
            IY TLF LKF+E  D   KSVWH+DVKQ AVWN+DD  +P F GW+YFDLHPRDGKYGH
Sbjct: 365 NIYTTLFRLKFVEITDECEKSVWHEDVKQFAVWNIDDEDNPKFQGWLYFDLHPRDGKYGH 424

Query: 453 AANFGLSSSFMIDDTTRSYPVTALVCNFSKSTKDKPSLLKHNEIVTFFHELGHGIHDLVG 512
           AANFG+ S++   D ++SYPVT LV NFSK T  +P+LLK  E+ TFFHELGHGIHDLVG
Sbjct: 425 AANFGMVSAYRKRDGSKSYPVTILVTNFSKPTPTRPALLKLGELTTFFHELGHGIHDLVG 484

Query: 513 QNKESRFNGPGSVPWDFVEAPSQMLEFWTWNKNELINLSSHYKTGEKIPESLINSLIKTK 572
            N     NGPGSVPWDFVEAPSQMLE+WT  ++ L  LS HY+TGEKIP+SL+++     
Sbjct: 485 SNDLESLNGPGSVPWDFVEAPSQMLEYWTARRDVLTMLSKHYETGEKIPKSLLDAWFSVG 544

Query: 573 HVNGALFTLRQLHFGLFDMKVHTCKDLQNLSICDTWNQLRQDISLISNGGTLSKGYDSFG 632
            +N  L  L QL  GLFDM VHT +D +   +   WN L ++I L++     S GYDSFG
Sbjct: 545 GLNSGLANLGQLKLGLFDMYVHT-RDYKGAEVRKLWNDLTREIGLMNLKNYTSTGYDSFG 603

Query: 633 HIMSDSYSAGYYGYLWAEVFATDMYHTKFAKDPLNAKNGIQYRDIVLARGGLYDINDNLK 692
           HIM+   +  YYGYLW++VFA DMY TKF  +P NA  G++YRD +LA GGLYD+ DNL+
Sbjct: 604 HIMAGYAAG-YYGYLWSQVFAADMYDTKFKPNPFNATVGVEYRDTILATGGLYDMTDNLR 662

Query: 693 EFLGREPSKDAFLKELGLQ 711
           +FLGR+P+  AFL+ LGL+
Sbjct: 663 KFLGRDPNNKAFLRGLGLK 681

>AGR405C Chr7 complement(1469769..1471922) [2154 bp, 717 aa] {ON}
           Non-syntenic homolog of Saccharomyces cerevisiae YCL057W
           (PRD1); Tandem gene duplication in this genome
          Length = 717

 Score =  671 bits (1731), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 327/681 (48%), Positives = 461/681 (67%), Gaps = 11/681 (1%)

Query: 35  IAPQAPPNWSFTPSDISGKTNEIINNSNNFYDSM-SKVESPSVSNFVEPFMKFENELGPI 93
           + PQ PP W++T +++      +   S+  Y+S+ S+ +  ++ N++ P +  + E   +
Sbjct: 13  VPPQPPPVWNYTATEVIDLAYGLAQKSDAVYESVFSQKDEFTLDNYIWPLLYNDQETDLL 72

Query: 94  INQLTFLQHVSSDKEIRDASVNSSMKLDELNIDLSLRHDIFLQFARVWQDVQSKADS--- 150
            NQL FL++VS D ++R+AS+++   LD+   ++S ++D++  F  +W   Q K D    
Sbjct: 73  WNQLIFLRNVSPDPKVREASLSTGKILDQWVANISSKYDLYTNFEHIW--TQYKDDEEFK 130

Query: 151 -VERETFKYVEKSYKDYIHSGLELDEGNRLKIKEIKKKISVNSINFSKNLGEQKEYITFT 209
               E +KY+EK    Y  +   L     +++ ++ +KISV+++ FS NLGE+ EYITFT
Sbjct: 131 VTNYELYKYMEKDASYYNRNKRNLTNAESIELGQVTRKISVDTLQFSINLGEETEYITFT 190

Query: 210 KEQLEGVPDSILTQFETIKSDKDSNETLYKVTFKYPDIFPVMKLASSAQTRKQAFLADQN 269
           +E+LEGV   +L QFE I    +      KVTFKYPDI PV++ A++ +TR++A++ADQN
Sbjct: 191 EEELEGVSPLVLDQFERII---EGGVKKLKVTFKYPDIGPVLRTATNPETRRKAYVADQN 247

Query: 270 KVPENEAILLDTLKLRDELASLLGYDTYANYNLYDKMAEDSTTVMNFLNDLKDKLIPLGR 329
           +V  NE +L +TL LR  +A L GY  YA YNL DKMA++  TV+ FL DL ++L+P+G 
Sbjct: 248 RVAANEQLLFETLDLRRRMAQLRGYKNYAEYNLRDKMAKNEETVIPFLTDLVERLLPVGE 307

Query: 330 KELQVLQDMKAEDVKKLNQGADPNYYIWDHRYYDNKYLLENFNVDLEKISEYFPLEATIT 389
           K+ ++L+  KAED K  N   D   Y WD+ YY+NK L E + +D E +++YFP+E+ I 
Sbjct: 308 KDREILKSKKAEDYKSKNLTFDGEIYAWDNAYYNNKILQEKYQIDPEDMAQYFPIESVIE 367

Query: 390 GMLEIYETLFNLKFIETKDSQNKSVWHDDVKQIAVWNMDDPKSPNFVGWIYFDLHPRDGK 449
           GML+ Y+TLF LKF+E  D   K+VWH+DVKQ AVWN+DD   P F GWIYFDL+PRDGK
Sbjct: 368 GMLDTYQTLFRLKFVEVTDPSQKNVWHEDVKQFAVWNIDDEDCPEFQGWIYFDLYPRDGK 427

Query: 450 YGHAANFGLSSSFMIDDTTRSYPVTALVCNFSKSTKDKPSLLKHNEIVTFFHELGHGIHD 509
           Y HAANFG++S+F   D ++SYPVT LVCN +K T  + ++L+  EI T FHELGHGIH 
Sbjct: 428 YSHAANFGMASAFRKKDGSQSYPVTVLVCNLTKPTPTRTAILRPGEITTLFHELGHGIHH 487

Query: 510 LVGQNKESRFNGPGSVPWDFVEAPSQMLEFWTWNKNELINLSSHYKTGEKIPESLINSLI 569
           LV  NK +  N  GSVPWDFVEAPSQMLE+WT  ++ L  LS HY+TGEKIP SL+++  
Sbjct: 488 LVANNKLAAHNSLGSVPWDFVEAPSQMLEYWTGRRDVLTMLSKHYETGEKIPPSLLDAWF 547

Query: 570 KTKHVNGALFTLRQLHFGLFDMKVHTCKDLQNLSICDTWNQLRQDISLISNGGTLSKGYD 629
            +  +   L+ L QL  GLFDM VHT ++   L +   WN +R++ISLI++    S GY+
Sbjct: 548 NSSGLGSGLYYLGQLRLGLFDMYVHT-REYHGLEVRKLWNDMRREISLINSQNYTSTGYN 606

Query: 630 SFGHIMSDSYSAGYYGYLWAEVFATDMYHTKFAKDPLNAKNGIQYRDIVLARGGLYDIND 689
           +FGHIM+ SYSAGYYGYLW++VFA DMY TKF  +P N+  G QYRD +LA GGLYD+ND
Sbjct: 607 TFGHIMTGSYSAGYYGYLWSQVFAADMYQTKFKSNPFNSTVGRQYRDTILAPGGLYDMND 666

Query: 690 NLKEFLGREPSKDAFLKELGL 710
           NL++FLGREP+  AFL+ LG 
Sbjct: 667 NLRKFLGREPNNRAFLRGLGF 687

>ABR185W Chr2
           (758126..758380,758380..758709,758709..759029,
           759033..759122,759122..759499) [1374 bp, 457 aa] {ON}
           Non-syntenic homolog of Saccharomyces cerevisiae YCL057W
           (PRD1); 3-intron; artificial frameshift
          Length = 457

 Score =  375 bits (962), Expect = e-122,   Method: Compositional matrix adjust.
 Identities = 193/414 (46%), Positives = 268/414 (64%), Gaps = 7/414 (1%)

Query: 298 ANYNLYDKMAEDSTTVMNFLNDLKDKLIPLGRKELQVLQDMKAEDVKKLNQGADPNYYIW 357
           A Y L  K A++   V +FLNDL++KL P      + L+ +K ++ K+L    D   Y  
Sbjct: 49  AAYVLEVKTAKNVDNVNSFLNDLREKLKPASADNWRPLKKLKEQECKELGNFYDGELYSQ 108

Query: 358 DHRYYDNKYLLENFNVDLEKISEYFPLEATITGMLEIYETLFNLKFIETKDSQNKSVWHD 417
           D  YY+ K L +NF+VD E+ ++YFPLE TI  ML+ Y TLF   F+E  +   ++VWH+
Sbjct: 109 DLCYYEQKLLRDNFSVDEEETAQYFPLEHTIKFMLDTYNTLFRHNFVEETEPATRNVWHE 168

Query: 418 DVKQIAVWNMDDPKSPNFVGWIYFDLHPRDGKYGHAANFGLSSSFMIDDTTRSYPVTALV 477
           D KQ +VW MDD  +P F GW+YFDLHPRDGK+GH A F    + M ++ +R YPVT+LV
Sbjct: 169 DDKQYSVWKMDDWDAPQFTGWLYFDLHPRDGKFGHLACFDNVYTDMSEEGSRVYPVTSLV 228

Query: 478 CNFSKSTKDKPSLLKHNEIVTFFHELGHGIHDLVGQNKESRFNGPGSVPWDFVEAPSQML 537
           CNFS  +K+KP+LLKH E+  FFHELGHG H L+   +         VP DF+EAPSQML
Sbjct: 229 CNFSNPSKEKPALLKHYEVQAFFHELGHGSHKLLCAPELC--CSSSWVPRDFIEAPSQML 286

Query: 538 EFWTWNKNELINLSSHYKTGEKIPESLINSLIKTKHVNGALFTLRQLHFGLFDMKVHT-C 596
           E+W W K+ + +LS H +TGE+IPESL++ ++K+K  N A+  L Q+   L DM VH   
Sbjct: 287 EYWIWRKDVITDLSKH-ETGERIPESLVDCMVKSKRANAAIDNLIQV-LALLDMAVHKHV 344

Query: 597 KDLQNLSICDTWNQLRQDISLISNGGTLSKGYDSFGHIMSDSYSAGYYGYLWAEVFATDM 656
              + L +   WN L +D+ LI N    ++ Y SF HI+ + Y+AGYYGY W++VFA DM
Sbjct: 345 GSYETLDLNALWNNLCEDVILIKNPEP-TRAYCSFSHIV-EGYAAGYYGYQWSKVFAADM 402

Query: 657 YHTKFAKDPLNAKNGIQYRDIVLARGGLYDINDNLKEFLGREPSKDAFLKELGL 710
           Y ++F K  L+   G  Y D ++ARGGLY++ DNL EFL REP+ +A+L++ GL
Sbjct: 403 YFSRFEKAHLDPTLGKLYGDTIIARGGLYEMEDNLGEFLDREPNNEAYLRDQGL 456

>NDAI0E02010 Chr5 complement(404579..406915) [2337 bp, 778 aa] {ON}
           Anc_1.9 YCL057W
          Length = 778

 Score =  208 bits (529), Expect = 1e-56,   Method: Compositional matrix adjust.
 Identities = 174/675 (25%), Positives = 312/675 (46%), Gaps = 66/675 (9%)

Query: 48  SDIS-GKTNEIINNSNNFYDSMSKVESPSVSNFVEPFMKFENELGPIINQLTFLQHVSSD 106
           SD+S  K  +II+N  +      KV      NFV    +  + L  +I+   F++    +
Sbjct: 99  SDVSLAKAKKIIDNLKSDRSLDGKV------NFVIELDRLSDTLCRVIDLCEFIRSAHPE 152

Query: 107 KEIRDASVNSSMKLDELNIDLSLRHDIFLQFARVWQDVQSKAD-SVERETFKYVEKSYKD 165
           +   +A+ +   KL E    L+   ++        QD Q  +  S E +   Y+    +D
Sbjct: 153 EGFIEAAQDCHEKLFEFMNVLNTDRELCELLNETLQDEQVLSKLSEEEKKVGYI--LLQD 210

Query: 166 YIHSGLELDEGNRLKIKEIKKKISVNSINFSKNLGE-QKEYITFTKEQLE--GVPDSILT 222
           +I SG+ +D G + +   + + ISV    +  N+ +  + +I   + +L+  G+   +  
Sbjct: 211 FIKSGIYMDSGKKDQFITLSQDISVIGQEYINNINQLARNHIKVKRSELDNAGIEFDVAC 270

Query: 223 QFETIKSDKDSNETLYKVTFKYPDIFPVMKLASSAQTRKQAFLADQNKVPENEAILLDTL 282
           Q       KD     YK+       F ++K  +  + RK+ ++A  +   +    L + +
Sbjct: 271 QL-----GKDITGKYYKIPTYGHLPFLILKACTDPEIRKKIWVAMHDCSKQQIERLTNLV 325

Query: 283 KLRDELASLLGYDTYANYNLYDKMAEDSTTVMNFLNDLKDKLIPLGRKELQVLQDM---- 338
           K+R  LA  +G + YA Y +  KMA++   V  FL  L D L P   KEL+ + D+    
Sbjct: 326 KIRAFLAHTMGRECYAAYAIDGKMAKNPKDVDEFLKSLMDFLKPKAAKELKFISDLIHNE 385

Query: 339 ----KAEDVKKLNQGADP---NYYIWDHRYYDNKYLLENFNVDLEKISEYFPLEATITGM 391
                ++DV ++     P    YY   HR      LL+++ +D+     Y+PL   I G+
Sbjct: 386 KGEKPSDDVDEILTAVRPWDREYYTAIHRNKQKHLLLDDYALDV-----YYPLGNVIQGL 440

Query: 392 LEIYETLFNLKFIETKDSQNKSVWHDDVKQIAVWNMDDPKSPNFVGWIYFDLHPRDGKYG 451
            +I+E+++ ++F E   +     W  DV+++ V +    +    +G IY DL  R GK  
Sbjct: 441 SDIFESIYGIRF-EPAVAGKGETWSSDVRRLNVVS----EKEGLIGIIYCDLFRRQGKTN 495

Query: 452 HAANFGLSSSFMI----------------DDTTRSYPVTALVCNFSK---STKDKPSLLK 492
           +AA+F +  S  I                D T    P+ +L+CNF+    ++ +   LL 
Sbjct: 496 NAAHFTICCSRQIYPHEDDFSTIQLGTNVDGTKFQLPIISLLCNFNTRCLNSGETICLLA 555

Query: 493 HNEIVTFFHELGHGIHDLVGQNKESRFNGPGSVPWDFVEAPSQMLEFWTWNKNELINLSS 552
            NEI T FHE+GH IH ++G+ +    +G      DFVE PS ++E +  +   L  +  
Sbjct: 556 LNEIETLFHEMGHAIHSMLGRTRLQNVSGT-RCSTDFVELPSVLMEHFARDTRVLKRIGH 614

Query: 553 HYKTGEKIPESLINSLIKTKHVNGALFTLRQLHFGLFDMKVHTCKDLQNLSICDT---WN 609
           HYKTG+++P +L+N  ++         T  Q    + D +++    +QN+   D    ++
Sbjct: 615 HYKTGDRVPATLLNRYLEKARFLKDCETFSQAKMAMLDQRLYDKNIVQNIDSVDVVKIYH 674

Query: 610 QLRQDISLISNGGTLSKGYDSFGHIMSDSYSAGYYGYLWAEVFATDMYHTKFAKDPLNAK 669
           +L +++ ++ +    S     FGH+    Y A YY YL+    A+ ++   F KDP +  
Sbjct: 675 ELEKELEVLVDDE--SNWCAKFGHLF--GYGATYYCYLFDRAIASKVWKKLFEKDPYSRS 730

Query: 670 NGIQYRDIVLARGGL 684
            G ++++ VL  GGL
Sbjct: 731 GGEKFKNDVLKWGGL 745

>KAFR0D02950 Chr4 complement(581305..583638) [2334 bp, 777 aa] {ON}
           Anc_2.432 YKL134C
          Length = 777

 Score =  202 bits (514), Expect = 1e-54,   Method: Compositional matrix adjust.
 Identities = 172/634 (27%), Positives = 291/634 (45%), Gaps = 48/634 (7%)

Query: 85  KFENELGPIINQLTFLQHVSSDKEIRDASVNSSMKLDELNIDLSLRHDIFLQFARVWQDV 144
           +  + L  +I+   F++ V  DKE   A+     ++ E    L+   ++  +   +  D 
Sbjct: 129 QLSDTLCRVIDLCEFIRSVHPDKEFLSAAQQCHEEMFEFMNTLNTDVELCDKLKTLLHDN 188

Query: 145 QSKADSVERETFKYVEKSYKDYIHSGLELDEGNRLKIKEIKKKISVNSINFSKNLGEQK- 203
           +  +   E E  K      +D+  SG+ ++   R +  E+ ++IS+   +F  N  + K 
Sbjct: 189 EILSKLSEEE-IKVGRILLEDFEKSGIYMNPRIREQFIELSQEISLIGQDFINNANQPKT 247

Query: 204 EYITFTKEQLE--GVPDSILTQFETIKSDKDSNETLYKVTFKYPDIFPVMKLASSAQTRK 261
            YI     +LE  G+   +L   +     KD+    YK+    P  + V+K   + + R 
Sbjct: 248 NYIKVNASKLESAGLNRLLLNSLK-----KDAIRENYKIPTYGPTPYAVLKDCKNEEVRA 302

Query: 262 QAFLADQNKVPENEAILLDTLKLRDELASLLGYDTYANYNLYDKMAEDSTTVMNFLNDLK 321
             + A  +   E    L   +KLR  LA+L+G ++++ Y L  K+A+    V NF+  L 
Sbjct: 303 DIWTALHSCSSEQILRLSHLVKLRAMLANLMGAESFSQYQLKGKLAKAPKDVKNFIETLI 362

Query: 322 DKLIPLGRKELQVLQDMKAEDVKKLN----QGADPNYYIWDHRYYDNKYLLENFNVD--- 374
             + P   KEL+ + D+K ED  K+N     G       WD  YY + Y       +   
Sbjct: 363 KYVRPNTEKELKFIADLKREDQGKINCGEMDGVLSTVRPWDRDYYSSIYFKGKEKTEHEF 422

Query: 375 LEKISEYFPLEATITGMLEIYETLFNLKFIETKDSQNKSVWHDDVKQIAVWNMDDPKSPN 434
            E +S YF L     G+ ++   ++ +K +E     +   W +DV++I V + ++     
Sbjct: 423 TEPLSSYFTLGGVFEGLSDLLTQIYGIK-LEPAIPVSGETWFNDVRKINVISEEE----G 477

Query: 435 FVGWIYFDLHPRDGKYGHAANFGLSSSFMI----------------DDTTRSYPVTALVC 478
            +G IYFDL  R GK  + A+F +  S  +                D T    P+ +LVC
Sbjct: 478 IIGIIYFDLFERYGKTSNPAHFTVCCSREMYPEENADSIIQLGSKKDGTIFQLPIISLVC 537

Query: 479 NFSKST--KDKP-SLLKHNEIVTFFHELGHGIHDLVGQNKESRFNGPGSVPWDFVEAPSQ 535
           NFS+ T   DK   LL  +EI T FHE+GH IH ++G+      +G      DFVE PS 
Sbjct: 538 NFSRRTFQSDKTICLLTLSEIETLFHEMGHAIHSMLGRTTLQNVSGTRCAT-DFVELPSI 596

Query: 536 MLEFWTWNKNELINLSSHYKTGEKIPESLINSLIKTKHVNGALFTLRQLHFGLFDMKVHT 595
           ++E +  +   L  +S HY+TGEKI E  +   +K      +  T  Q    + D ++H+
Sbjct: 597 LMEHFASDTRVLKKMSCHYETGEKIAEKKLQFHLKEGEFLRSCETFSQAKMAMLDQELHS 656

Query: 596 CK---DLQNLSICDTWNQLRQDISLISNGGTLSKGYDSFGHIMSDSYSAGYYGYLWAEVF 652
            K   +L NL++ + +  L + + ++ +    S     FGH+    Y A YY YL+    
Sbjct: 657 DKIIHNLDNLNVVEIYQNLERRLQVLVDDR--SNWCGKFGHLF--GYGATYYSYLFDRAI 712

Query: 653 ATDMYHTKFAKDPLNAKNGIQYRDIVLARGGLYD 686
           A  +++  FA DP N  NG ++++ +L  GG  D
Sbjct: 713 ARKVWNHLFANDPFNKTNGEKFKESLLKWGGSKD 746

>SAKL0E03938g Chr5 (317017..319320) [2304 bp, 767 aa] {ON} similar
           to uniprot|P35999 Saccharomyces cerevisiae YKL134C OCT1
           Mitochondrial intermediate peptidase cleaves N-terminal
           residues of a subset of proteins upon import after their
           cleavage by mitochondrial processing peptidase
           (Mas1p-Mas2p) may contribute to mitochondrial iron
           homeostasis
          Length = 767

 Score =  195 bits (495), Expect = 3e-52,   Method: Compositional matrix adjust.
 Identities = 176/680 (25%), Positives = 311/680 (45%), Gaps = 62/680 (9%)

Query: 46  TPSDISGKTNEIINNSNNFYDSMSKVESP-SVSNFVEPFMKFENELGPIINQLTFLQHVS 104
           +P  +       +  +N   ++M    SP   +N++    +  + L  +I+   F++   
Sbjct: 80  SPQGLRKFCRHSLTQANELVETMRHDRSPKGYANYIANLDRLSDILCRVIDLAEFIRASH 139

Query: 105 SDKEIRDASVNSSMKLDE----LNIDLSLRHDIFLQFARVWQDVQSKADSVERETFKYVE 160
            D     A+ +   ++ E    LN D++L  DI      V  D  +    +  E  K  +
Sbjct: 140 PDPHFVQAAQDCHEEMFEIMNVLNTDVAL-CDIL---KHVLTD-PTILSELSPEEIKVGK 194

Query: 161 KSYKDYIHSGLELDEGNRLKIKEIKKKISVNSINFSKNLGEQKEYI--TFTKEQLEGVPD 218
              +D+  SG+ ++   R +   + ++ISV   +F  N     EY+   + K ++E +  
Sbjct: 195 ILLEDFEKSGIHMNPEVREQFIALSQQISVVGQDFINN----TEYVRSNYIKVEVEELNK 250

Query: 219 SILTQFETIKSDKDSNETLYKV-TFKYPDIFPVMKLASSAQTRKQAFLADQNKVPENEAI 277
           S + +    +  KD     YK+ TF Y   + +++       R + + A  +   +  A 
Sbjct: 251 SGINKIVLNQLSKDIKGRHYKIPTFGYIP-YSILRSCPDDNIRMKVWSALHSCSEKQIAR 309

Query: 278 LLDTLKLRDELASLLGYDTYANYNLYDKMAEDSTTVMNFLNDLKDKLIPLGRKELQVLQD 337
           L   +KLR  LA+++G  ++A+Y L  KMA+    V  F+  L D   P   +EL+ + D
Sbjct: 310 LDQLIKLRSVLANIMGKKSFAHYQLEGKMAKTPEYVRGFMQSLIDATKPKAAEELKFIAD 369

Query: 338 MKAEDVKKLNQGADPNYYI------WDHRYYDNKYLLEN---FNVDLEKISEYFPLEATI 388
           +KA+ V   N+ A+  + I      WD  +Y + + L+    FN   E+IS YF L   I
Sbjct: 370 LKAKHVPG-NKPAESMHEILEMVKPWDRDFYGSVHALQQRRPFNN--EQISSYFSLGVVI 426

Query: 389 TGMLEIYETLFNLKFIETKDSQNKSVWHDDVKQIAVWNMDDPKSPNFVGWIYFDLHPRDG 448
            G+  +++ ++ + ++E    +    W  +V++I V +    +    +G +Y DL  R G
Sbjct: 427 QGLSNLFKQIYGI-YLEPVVPKTGETWSPEVRRINVVS----EKEGVIGVVYCDLFERQG 481

Query: 449 KYGHAANFGLSSSFMIDDTTR----------------SYPVTALVCNFSKST---KDKPS 489
           K  + A+F +  S  I D                     PV +LVCNFS +T   +    
Sbjct: 482 KTANPAHFTVCCSRQIYDGETDLSTIQVGQNSKGEQFQLPVISLVCNFSPTTISQEQSIC 541

Query: 490 LLKHNEIVTFFHELGHGIHDLVGQNKESRFNGPGSVPWDFVEAPSQMLEFWTWNKNELIN 549
           LL+ +EI T FHE+GH +H ++G+ K    +G      DFVE PS ++E +  +   L  
Sbjct: 542 LLQLSEIETLFHEMGHAMHSMLGRTKLQNISGTRCAT-DFVELPSILMEHFARDHRVLQR 600

Query: 550 LSSHYKTGEKIPESLINSLIKTKHVNGALFTLRQLHFGLFDMKVH---TCKDLQNLSICD 606
           ++SHY TGE IPE L+ S               Q    + D ++H     K++Q L I  
Sbjct: 601 MASHYSTGESIPEQLLFSYQSEVKFLQHAEAFSQAKMAILDQELHGESIMKEMQYLDIVK 660

Query: 607 TWNQLRQDISLISNGGTLSKGYDSFGHIMSDSYSAGYYGYLWAEVFATDMYHTKFAKDPL 666
            ++ L + + ++S+  +   G   FGH+    Y A YY YL+    A+ ++   FA DP 
Sbjct: 661 LYHNLERQLEVLSDDKSNWCG--RFGHLF--GYGATYYSYLFDRAIASKIWQHLFANDPF 716

Query: 667 NAKNGIQYRDIVLARGGLYD 686
             ++G ++++ VL  GG  D
Sbjct: 717 CRRSGEKFKNSVLKWGGSRD 736

>Ecym_6099 Chr6 complement(186647..188968) [2322 bp, 773 aa] {ON}
           similar to Ashbya gossypii AFR198W
          Length = 773

 Score =  192 bits (489), Expect = 3e-51,   Method: Compositional matrix adjust.
 Identities = 152/564 (26%), Positives = 270/564 (47%), Gaps = 55/564 (9%)

Query: 164 KDYIHSGLELDEGNRLKIKEIKKKISVNSINFSKNLGEQKEYI--TFTKEQLEGVPDSIL 221
           +D+  SG+ ++   R +  E+ + IS+    F  N     EY+  +F + + + +  S +
Sbjct: 211 EDFEKSGIYMNPKVRERFIELSQVISIVGQEFITN----TEYVGTSFVEIETDVLEASGV 266

Query: 222 TQFETIKSDKDSNETLYKV-TFKYPDIFPVMKLASSAQTRKQAFLADQNKVPENEAILLD 280
           +Q    +  KD +   YK+ T+ Y   + +++   S   RK+ + A     PE +   L 
Sbjct: 267 SQMVLQQLSKDLSGKFYKIPTYGYLP-YSIIRTCPSEYIRKKVWTA-MYSCPEKQIKRLK 324

Query: 281 TL-KLRDELASLLGYDTYANYNLYDKMAEDSTTVMNFLNDLKDKLIPLGRKELQVLQDMK 339
            L +LR +LA ++G   YA Y L  KMA+    V NF+N L +   PL  +EL+ L DMK
Sbjct: 325 KLVRLRQQLAHIMGKPDYATYQLEGKMAKSPKNVKNFMNTLIEYTKPLAMEELKPLADMK 384

Query: 340 ----AEDVKKLNQGADPNYYIWDHRYYDNKYLLEN----FNVDLEKISEYFPLEATITGM 391
                +D  ++     P    WD  Y+ +  LL        +  + ++ YF L   I G+
Sbjct: 385 HDNHCKDASEILSSVRP----WDRDYFGSMSLLAQPRSVKTMSFQSLNCYFSLGVVIQGL 440

Query: 392 LEIYETLFNLKFIETKDSQNKSVWHDDVKQIAVWNMDDPKSPNFVGWIYFDLHPRDGKYG 451
            +++++++ ++ +E   ++    W  +V++I V +    ++   +G IY DL  R GK  
Sbjct: 441 SDLFQSIYGIR-LEPVVAKTGETWDPEVRKIQVIS----EANGVIGVIYCDLFERQGKTP 495

Query: 452 HAANFGLSSSFMI----------------DDTTRSYPVTALVCNFSKSTKDKPS--LLKH 493
           + A+F +  S  I                D +    PV +LVCNFS +  D  S  LL+ 
Sbjct: 496 NPAHFTVCCSRQIYPNETDYSTIQVGSHPDKSKFQMPVISLVCNFSHTQADDDSICLLQL 555

Query: 494 NEIVTFFHELGHGIHDLVGQNKESRFNGPGSVPWDFVEAPSQMLEFWTWNKNELINLSSH 553
           +E+ T FHE+GH +H ++G+ +    +G      DFVE PS ++E +  +   L  +SSH
Sbjct: 556 SEVETLFHEMGHAMHSMLGRTQLQNISGTRCAT-DFVELPSILMEHFAKDLRVLSRISSH 614

Query: 554 YKTGEKIPESLINSLIKTKHVNGALFTLRQLHFGLFDMKVHTCKDLQNLSICDTWNQLRQ 613
           Y TGE++P+ ++ +  +         T  Q+   + D ++H+  D  +  I   ++ L +
Sbjct: 615 YATGERVPKEMLVNYQQENRFLEHTETFSQIKMAMLDQRLHSLTD-NSEDIVTVYHGLEK 673

Query: 614 DISLISNGGTLSKGYDSFGHIMSDSYSAGYYGYLWAEVFATDMYHTKFAKDPLNAKNGIQ 673
           ++ ++ +  +   G   FGH+    Y A YY YL     A  +++  F  DP +   G +
Sbjct: 674 ELQVLVDDRSNWCG--RFGHLF--GYGASYYSYLMDRAIAAKVWNHLFQHDPFSRAGGEK 729

Query: 674 YRDIVLARGGLYD----INDNLKE 693
           +++ VL  GG  D    I D L E
Sbjct: 730 FKNSVLKWGGSRDPWRCIADALDE 753

>Smik_11.102 Chr11 complement(175013..177331) [2319 bp, 772 aa] {ON}
           YKL134C (REAL)
          Length = 772

 Score =  191 bits (484), Expect = 1e-50,   Method: Compositional matrix adjust.
 Identities = 170/635 (26%), Positives = 294/635 (46%), Gaps = 51/635 (8%)

Query: 85  KFENELGPIINQLTFLQHVSSDKEIRDASVNSSMKLDE----LNIDLSLRHDIFLQFARV 140
           +  + L  +I+   F++    + E   A+ +   ++ E    LN D+SL         + 
Sbjct: 125 RLSDTLCRVIDLCEFIRSTHPEDEFVKAAQDCHEQMFEFMNVLNTDVSL-----CNMLKS 179

Query: 141 WQDVQSKADSVERETFKYVEKSYKDYIHSGLELDEGNRLKIKEIKKKISVNSINFSKNLG 200
             +    A  +  E  K  +    D+  SG+ ++ G R K  ++ ++IS+    F  ++ 
Sbjct: 180 VLNNPEIAPKLSEEELKVGKILLDDFEKSGIYMNPGVREKFIQLSQEISLVGQEFINHID 239

Query: 201 EQKEYITFTKEQLEGVPDSILTQFETIKSDKDSNETLYKV-TFKYPDIFPVMKLASSAQT 259
                    K   + +  S ++ F   + +KD     YKV TF Y   F ++K       
Sbjct: 240 YPGS--NSVKIPCKDLDSSKVSTFLLKQLNKDVKGQNYKVPTFGYA-AFALLKSCEIEVV 296

Query: 260 RKQAFLADQNKVPENEAILLDTLKLRDELASLLGYDTYANYNLYDKMAEDSTTVMNFLND 319
           RK+ + A  +   +    L   +KLR  LA+L+   +YA Y L  KMA++   V +F+  
Sbjct: 297 RKKIWTALHSCSDKQIKRLDRLIKLRAVLANLMHKGSYAEYQLEGKMAKNPKDVQDFILT 356

Query: 320 LKDKLIPLGRKELQVLQDMKAEDVKK-LNQGADPNYYI---WDHRYYDNKYL-LENFNVD 374
           L +  I     EL+ + D+KA+D+KK L    D    +   WD  YY  KY+ L   NV 
Sbjct: 357 LMNNTIDKTANELKFIADLKAKDLKKPLTTNTDEILKLVRPWDRDYYTGKYIQLNPSNVP 416

Query: 375 LEK-ISEYFPLEATITGMLEIYETLFNLKFIETKDSQNKSVWHDDVKQIAVWNMDDPKSP 433
             K IS YF L   I G+ ++++ ++ ++ +E   +     W  DV+++ V + ++    
Sbjct: 417 SAKEISYYFTLGNVIQGLSDLFQQIYGIR-LEPAIADEGETWSPDVRRLNVISEEE---- 471

Query: 434 NFVGWIYFDLHPRDGKYGHAANFGLSSSFMI-------------DDTTRSY---PVTALV 477
             +G IY DL  R+GK  + A+F +  S  I             ++   SY   PV +LV
Sbjct: 472 GIIGIIYCDLFERNGKTSNPAHFTVCCSRQIYPHETDFSTIQVGENPNGSYFQLPVISLV 531

Query: 478 CNFSK---STKDKPSLLKHNEIVTFFHELGHGIHDLVGQNKESRFNGPGSVPWDFVEAPS 534
           CNFS    ++K     L+ +E+ T FHE+GH +H ++G+      +G      DFVE PS
Sbjct: 532 CNFSPVPIASKKSLCFLQLSEVETLFHEMGHAMHSMLGRTHMQNISGTRCAT-DFVELPS 590

Query: 535 QMLEFWTWNKNELINLSSHYKTGEKIPESLINSLIKTKHVNGALFTLRQLHFGLFDMKVH 594
            ++E +  +   L  +  HY+TGE I + ++   +KT +      T  Q    + D   H
Sbjct: 591 ILMEHFAKDIRVLTRIGKHYETGETIQKGMLQCFMKTTNFLQNCETYSQAKMAMLDQSFH 650

Query: 595 TCK---DLQNLSICDTWNQLRQDISLISNGGTLSKGYDSFGHIMSDSYSAGYYGYLWAEV 651
             K   D+ N ++ D +  L + + ++ +  +   G   FGH+    Y A YY YL+   
Sbjct: 651 DEKIMSDIDNFNVVDNYQALERHLKVLVDDQSNWCG--RFGHLF--GYGATYYSYLFDRT 706

Query: 652 FATDMYHTKFAKDPLNAKNGIQYRDIVLARGGLYD 686
            A+ +++T F  DP +  NG +++  +L  GGL D
Sbjct: 707 IASKIWYTLFDDDPYSRNNGDKFKKHLLKWGGLKD 741

>ZYRO0G20130g Chr7 (1666665..1669025) [2361 bp, 786 aa] {ON} similar
           to uniprot|P35999 Saccharomyces cerevisiae YKL134C OCT1
           Mitochondrial intermediate peptidase cleaves N-terminal
           residues of a subset of proteins upon import after their
           cleavage by mitochondrial processing peptidase
           (Mas1p-Mas2p) may contribute to mitochondrial iron
           homeostasis
          Length = 786

 Score =  189 bits (481), Expect = 3e-50,   Method: Compositional matrix adjust.
 Identities = 161/680 (23%), Positives = 304/680 (44%), Gaps = 60/680 (8%)

Query: 46  TPSDISGKTNEIINNSNNFYDSMSKVESP-SVSNFVEPFMKFENELGPIINQLTFLQHVS 104
           +P  +   + + +N +    + M   E+P  + N++    +  + L  +I+   F++   
Sbjct: 97  SPDGLRKFSRQSLNQAYELLEDMKNDETPQGLQNYILRLDQLSDTLCRVIDLCEFIRSSH 156

Query: 105 SDKEIRDASVNSSMKLDE----LNIDLSLRHDIFLQFARVWQDVQSKADSVERETFKYVE 160
            D    DA+ +   ++ E    LN D++L + +     R   +       +  E  K  +
Sbjct: 157 PDSHFVDAAQDCHEEMFEFMNVLNTDVNLCNKL-----RTVLNTPEVVCKLSSEEVKVGK 211

Query: 161 KSYKDYIHSGLELDEGNRLKIKEIKKKISVNSINFSKNLG-EQKEYITFTKEQLE--GVP 217
              +D+  SG+ ++   R +   + ++IS+   +F  N    +  YIT   E +   G+ 
Sbjct: 212 ILLEDFEKSGIYMNPEIREQFIALSQEISIVGQDFINNTDFVRTNYITVDCETIHNSGIN 271

Query: 218 DSILTQFETIKSDKDSNETLYKVTFKYPDIFPVMKLASSAQTRKQAFLADQNKVPENEAI 277
             IL+Q       KD     YK+       + V++       RK+ + A  +  P+ + +
Sbjct: 272 QLILSQLS-----KDIKGKHYKIPTHGYIAYSVLRACPDEIVRKKLWTA-MHSCPDKQIV 325

Query: 278 LLDTL-KLRDELASLLGYDTYANYNLYDKMAEDSTTVMNFLNDLKDKLIPLGRKELQVLQ 336
            LD L +LR  LA L+G  +YA Y L  KMA+    V +F++ L     P  ++EL  + 
Sbjct: 326 RLDQLVRLRAVLAFLMGKKSYAEYQLEGKMAKSPEEVTDFIDSLIKVTQPKAKQELGFIS 385

Query: 337 DMKAEDV-----KKLNQGADPNYYIWDHRYYDNKYLLENFN---VDLEKISEYFPLEATI 388
           D+K + +     +  N         WD  +Y   Y ++      +D ++IS YF L   +
Sbjct: 386 DLKRKHMDLPPSETSNLDTLDIVRPWDRDFYHTIYSIQQRRQSPIDDQQISMYFTLGNVM 445

Query: 389 TGMLEIYETLFNLKFIETKDSQNKSVWHDDVKQIAVWNMDDPKSPNFVGWIYFDLHPRDG 448
            G+ +++  ++ ++ +E   +Q    W  +V+++ V + ++      +G +Y DL  RDG
Sbjct: 446 QGLSDLFHQIYGIR-LEPVIAQKGETWSPEVRRLNVVSDEE----GVIGVVYCDLFERDG 500

Query: 449 KYGHAANFGLSSSFMI----------------DDTTRSYPVTALVCNFSKST---KDKPS 489
           K  + ++F +  S  I                D T    P+ +LVCNF+ S         
Sbjct: 501 KTSNPSHFTVCCSRQIYPKENDLSTIQIGTNKDGTKFQLPIISLVCNFASSVVSFGQSLC 560

Query: 490 LLKHNEIVTFFHELGHGIHDLVGQNKESRFNGPGSVPWDFVEAPSQMLEFWTWNKNELIN 549
           LL  +EI T FHE+GH +H ++G+ +    +G      DFVE PS ++E +  +   L  
Sbjct: 561 LLHISEIETLFHEMGHAMHSMLGRTRLQNLSGT-RCATDFVELPSILMEHFARDTRVLRQ 619

Query: 550 LSSHYKTGEKIPESLINSLIKTKHVNGALFTLRQLHFGLFDMKVH---TCKDLQNLSICD 606
           +  H  TGE +PESL+ + ++         T  Q    + D ++H       +  L +  
Sbjct: 620 IGKHCNTGEPVPESLLTNYLQDLQYMQYCETFSQAKMAMLDQRLHGKEIITGMDTLDVVA 679

Query: 607 TWNQLRQDISLISNGGTLSKGYDSFGHIMSDSYSAGYYGYLWAEVFATDMYHTKFAKDPL 666
            +  L +++ ++ +  +   G   FGH+    Y A YY YL+    A+ ++ + F +DP 
Sbjct: 680 LYQNLERELRVLVDDQSTWCG--RFGHLF--GYGATYYSYLFDRAIASKVWESLFQEDPF 735

Query: 667 NAKNGIQYRDIVLARGGLYD 686
           +   G ++++ VL  GG  D
Sbjct: 736 SRAGGQRFKEYVLKWGGAKD 755

>CAGL0D02112g Chr4 complement(216204..218489) [2286 bp, 761 aa] {ON}
           similar to uniprot|P35999 Saccharomyces cerevisiae
           YKL134c MIP1
          Length = 761

 Score =  188 bits (477), Expect = 8e-50,   Method: Compositional matrix adjust.
 Identities = 146/549 (26%), Positives = 259/549 (47%), Gaps = 43/549 (7%)

Query: 165 DYIHSGLELDEGNRLKIKEIKKKISVNSINFSKNLG-EQKEYITFTKEQLEGVPDSILTQ 223
           D+  SG+ +  G R +  E+ ++ISV    F  N     KE+I   +++++    S ++ 
Sbjct: 194 DFEKSGIYMKAGIREQFIELSQQISVIGQEFINNTDYVAKEFIKVKRDEMD---KSGISP 250

Query: 224 FETIKSDKDSNETLYKVTFKYPDIFPVMKLASSAQTRKQAFLADQNKVPENEAILLDTL- 282
             T + ++D     YK+         ++K       RK+ + A  N  P+ +   L+ L 
Sbjct: 251 LLTARLNRDLTGKYYKIPTYGQIPLQILKSCPDEDIRKEVWAALHN-CPKAQIQRLNQLV 309

Query: 283 KLRDELASLLGYDTYANYNLYDKMAEDSTTVMNFLNDLKDKLIPLGRKELQVLQ--DMKA 340
           +LR  L++LLG  +Y++Y L +KMA     V  F+  L +   PL  +EL+ +    + A
Sbjct: 310 RLRVILSNLLGKQSYSDYQLDNKMAGSPENVKGFIKTLMNVTKPLAARELEFIARDKLNA 369

Query: 341 EDVKKLNQGADPNYYI-WDHRYYDNKYLLEN--FNVDLEKISEYFPLEATITGMLEIYET 397
            D + ++     +    WD  Y+ +KY  +N    +  E++  YF L   I G+ E+++ 
Sbjct: 370 PDSRHMSDNEILSIVKPWDKNYFSSKYDSDNEMAMIRDEQLRYYFSLGNVINGLSELFKR 429

Query: 398 LFNLKFIETKDSQNKSVWHDDVKQIAVWNMDDPKSPNFVGWIYFDLHPRDGKYGHAANFG 457
           ++ +  ++   ++N   W  DV+++ V + ++      VG IY DL  R GK  + A+F 
Sbjct: 430 IYGIT-LQPSRTENGETWSPDVRRLDVISEEE----GLVGVIYCDLFERVGKISNPAHFT 484

Query: 458 LSSSFMI----------------DDTTRSYPVTALVCNFSKST---KDKPSLLKHNEIVT 498
           +  S  +                D T    PV +LVCNFS       ++   L  NEI T
Sbjct: 485 VCCSRQVYPDENDFTTIQTGQNSDGTVFQLPVISLVCNFSTVALPNGNRTCFLHMNEIET 544

Query: 499 FFHELGHGIHDLVGQNKESRFNGPGSVPWDFVEAPSQMLEFWTWNKNELINLSSHYKTGE 558
            FHE+GH +H ++G+ +    +G      DFVE PS ++E +  +   L  + SHY+T E
Sbjct: 545 LFHEMGHAMHSMLGRTRLQNISGTRCAT-DFVELPSILMEHFARDIRVLRTIGSHYETSE 603

Query: 559 KIPESLINSLIKTKHVNGALFTLRQLHFGLFDMKVH---TCKDLQNLSICDTWNQLRQDI 615
             PE+L+N  +          T  Q    + D K+H   +  D++ +     + +L   +
Sbjct: 604 PAPEALLNDYLDKTQFLQHCETYSQAKMAMLDQKLHGSFSLSDIERIDSAKIYQKLETRL 663

Query: 616 SLISNGGTLSKGYDSFGHIMSDSYSAGYYGYLWAEVFATDMYHTKFAKDPLNAKNGIQYR 675
            ++++  +   G   FGH+    Y A YY YL+    A+ ++ + F  DP N   G +++
Sbjct: 664 QVLADDESNWCG--RFGHLF--GYGATYYSYLFDRAIASKVWDSLFKDDPFNRTGGEKFK 719

Query: 676 DIVLARGGL 684
           + VL  GGL
Sbjct: 720 ERVLKWGGL 728

>TBLA0I00710 Chr9 (128272..130593) [2322 bp, 773 aa] {ON} Anc_2.432
           YKL134C
          Length = 773

 Score =  187 bits (475), Expect = 2e-49,   Method: Compositional matrix adjust.
 Identities = 165/655 (25%), Positives = 297/655 (45%), Gaps = 51/655 (7%)

Query: 76  VSNFVEPFMKFENELGPIINQLTFLQHVSSDKEIRDASVNSSMKL----DELNIDLSLRH 131
           ++N++    +  + L  +I+   F++    +K    A+      +    + LN D++L  
Sbjct: 120 LANYIIRLDQLSDTLCRVIDLCEFIRSCHPEKSFVQAAQECHEHMYAFMNTLNTDIALCD 179

Query: 132 DIFLQFARVWQDVQSKADSVERETFKYVEKSYKDYIHSGLELDEGNRLKIKEIKKKISVN 191
            +     R   D +     +  E  K  +   +D+  SG+++    R +   + + IS+ 
Sbjct: 180 RL-----RTVLDNKEVLKRLTDEEIKVGKLLLEDFEKSGIQMSPEIRDRFISLSQDISLA 234

Query: 192 SINFSKNLG-EQKEYITFTKEQLEGVPDSILTQFETIKSDKDSNETLYKVTFKYPDIFPV 250
             +F  N    +K+YI    ++ +   D    ++   K  KD +   YK+       +  
Sbjct: 235 GQDFLNNTSYTEKDYIKIKCDEFDKACDYPALKY---KLSKDLSGKYYKIPTYGKIPYTA 291

Query: 251 MKLASSAQTRKQAFLADQNKVPENEAILLDTLKLRDELASLLGYDTYANYNLYDKMAEDS 310
           +      + RK+ ++A  +   +    L   +K R ELA LL   +Y+ Y L  KMA+  
Sbjct: 292 LLKCKDEELRKKLWVAFHSCSNKQIERLTKIIKHRIELAKLLSKSSYSEYTLEGKMAKGP 351

Query: 311 TTVMNFLNDLKDKLIPLGRKELQVLQDMKAED----VKKLNQGADPNYYIWDHRYYDNKY 366
             V NFLN L   ++P   KEL+ + + K       ++   Q    N   WD  YY N  
Sbjct: 352 KEVNNFLNALLKSILPEVTKELEPISNKKCLSEGFSLETSEQSILNNIKPWDRDYY-NPI 410

Query: 367 LLENFNVDLEKISEYFPLEATITGMLEIYETLFNLKFIETKDSQNKSVWHDDVKQIAVWN 426
              +       I EYF L   I G+  ++ +++ ++F E    ++   W  DV+++ V +
Sbjct: 411 QATSEGAYQMLIMEYFTLGNIIHGLSNLFNSIYGIRF-EPGKIEDGETWSKDVRKLNVIS 469

Query: 427 MDDPKSPNFVGWIYFDLHPRDGKYGHAANFGLSSSFMI---------------DDTTRSY 471
            D+      +G IY DL  R+GK    +++ +  S  I               + T +++
Sbjct: 470 EDE----GLIGVIYCDLFEREGKSESPSHYTICCSREIYSEEHDLSTIQTGVNNKTGKNF 525

Query: 472 --PVTALVCNFSKSTKD---KPSLLKHNEIVTFFHELGHGIHDLVGQNKESRFNGPGSVP 526
             P+ +LVCNF  +      +   L+H+EI T FHE+GH +H ++G+ +    +G   V 
Sbjct: 526 QLPIVSLVCNFQVTNAKESRRICFLQHHEIETLFHEMGHAMHSMLGRTRFQTISGTRCVS 585

Query: 527 WDFVEAPSQMLEFWTWNKNELINLSSHYKTGEKIPESLINSLIKTKHVNGALFTLRQLHF 586
            DFVE PS ++EF+  N   LI++S HY +GE I   ++N  ++      A  T  Q   
Sbjct: 586 -DFVEIPSILMEFFANNPKVLIDISRHYDSGESIDIEVLNKYLENTKQFKACETYSQGKM 644

Query: 587 GLFDMKVHT--CKDLQNLSICDTWNQLRQDISLISNGGTLSKGYDSFGHIMSDSYSAGYY 644
            L D ++H      L N+ + + ++ L +++S++ +  T S     FGH+    Y A YY
Sbjct: 645 ALLDQRLHAENANSLDNIDVVEIYHNLEKELSVLPD--TESNWCGRFGHLY--GYGALYY 700

Query: 645 GYLWAEVFATDMYHTKFAKDPLNAKNGIQYRDIVLARGGLYDINDNLKEFLGREP 699
            YL+    AT ++ + F  DP + K G  +++ +L  GG  D    + + LG EP
Sbjct: 701 CYLFDRAIATKIWESLFQNDPFSRKGGNIFKEQLLKWGGSKDPWKCVADVLG-EP 754

>Skud_11.93 Chr11 complement(175243..177561) [2319 bp, 772 aa] {ON}
           YKL134C (REAL)
          Length = 772

 Score =  184 bits (467), Expect = 2e-48,   Method: Compositional matrix adjust.
 Identities = 168/638 (26%), Positives = 294/638 (46%), Gaps = 57/638 (8%)

Query: 85  KFENELGPIINQLTFLQHVSSDKEIRDASVNSSMKLDE----LNIDLSLRHDIFLQFARV 140
           +  + L  +I+   F++    D +   A+ +   ++ E    LN D+SL +   L+    
Sbjct: 125 RLSDTLCRVIDLCEFIRSTHPDDKFVKAAQDCHEQMFEFMNVLNTDVSLCN--ILKSVLN 182

Query: 141 WQDVQSKADSVERETFKYVEKSYKDYIHSGLELDEGNRLKIKEIKKKISVNS---INFSK 197
             +V SK    E +  K +     D+  SG+ ++   R K  E+ ++IS+     IN + 
Sbjct: 183 SPEVSSKLSDEELKVGKIL---LDDFEKSGIYMNPDVREKFIELSQEISLIGQEFINHTD 239

Query: 198 NLGEQKEYITFTKEQLEGVPDSILTQFETIKSDKDSNETLYKV-TFKYPDIFPVMKLASS 256
             G     I         V   +L Q      +KD     YK+ TF Y   + ++K    
Sbjct: 240 YPGSNSVKIPCKDLDNGNVSAFLLKQL-----NKDVKGQNYKIPTFGYA-AYALLKSCEK 293

Query: 257 AQTRKQAFLADQNKVPENEAILLDTLKLRDELASLLGYDTYANYNLYDKMAEDSTTVMNF 316
            + RK+ + A  +   +    L   +KLR  LA+L+  ++YA Y L  KMA++   V +F
Sbjct: 294 EEVRKKLWTALHSCSDKQIKRLSHLIKLRAILANLMNKESYAEYQLEGKMAKNPKDVQDF 353

Query: 317 LNDLKDKLIPLGRKELQVLQDMKAEDVKK-LNQGADPNYYI---WDHRYYDNKYLLENFN 372
           +  L +  I     EL+ + ++K +D+KK L    D    +   WD  YY  KYL  N +
Sbjct: 354 ILTLMNGTIDKTANELKFIAELKTKDLKKPLATKTDDILRLVRPWDRDYYTGKYLQLNPS 413

Query: 373 --VDLEKISEYFPLEATITGMLEIYETLFNLKFIETKDSQNKSVWHDDVKQIAVWNMDDP 430
              + ++IS YF L   I G+ ++++ ++ ++ +E + +     W  DV+++ V + ++ 
Sbjct: 414 DAPNAKEISYYFTLGNVIEGLSDLFQHIYGIR-LEPEIADEGETWSPDVRRLNVISEEE- 471

Query: 431 KSPNFVGWIYFDLHPRDGKYGHAANFGLSSSFMI----------------DDTTRSYPVT 474
                +G IY DL  R+GK  + A+F +  S  I                D +    PV 
Sbjct: 472 ---GIIGIIYCDLFERNGKTSNPAHFTVCCSRQIYPNETDFSTIQVGENPDGSYFQLPVI 528

Query: 475 ALVCNFSK---STKDKPSLLKHNEIVTFFHELGHGIHDLVGQNKESRFNGPGSVPWDFVE 531
           +LVCNF+    ++K     L+ +E+ T FHE+GH +H ++G+      +G      DFVE
Sbjct: 529 SLVCNFAPIPIASKKTLCFLQLSEVETLFHEMGHAMHSMLGRTHMQNISGTRCAT-DFVE 587

Query: 532 APSQMLEFWTWNKNELINLSSHYKTGEKIPESLINSLIKTKHVNGALFTLRQLHFGLFDM 591
            PS ++E +  +   L  +S HY+TGE I   ++ S ++T +      T  Q    + D 
Sbjct: 588 LPSILMEHFAKDIRILTKISKHYETGETIQAGMLQSFMRTTNFLQNCETYSQAKMAMLDQ 647

Query: 592 KVH---TCKDLQNLSICDTWNQLRQDISLISNGGTLSKGYDSFGHIMSDSYSAGYYGYLW 648
             H      D+ N  I   +  L + + ++ +  +   G   FGH+    Y A YY YL+
Sbjct: 648 SFHDEEIISDIDNFDIVKNYQALERRLKVLVDDQSNWCG--RFGHLF--GYGATYYSYLF 703

Query: 649 AEVFATDMYHTKFAKDPLNAKNGIQYRDIVLARGGLYD 686
               A+ +++  F  DP + KNG +++  +L  GGL D
Sbjct: 704 DRTIASKIWYALFEDDPYSRKNGDKFKKHLLKWGGLKD 741

>YKL134C Chr11 complement(189124..191442) [2319 bp, 772 aa] {ON}
           OCT1Mitochondrial intermediate peptidase, cleaves
           destabilizing N-terminal residues of a subset of
           proteins upon import, after their cleavage by
           mitochondrial processing peptidase (Mas1p-Mas2p); may
           contribute to mitochondrial iron homeostasis
          Length = 772

 Score =  184 bits (466), Expect = 3e-48,   Method: Compositional matrix adjust.
 Identities = 167/638 (26%), Positives = 295/638 (46%), Gaps = 57/638 (8%)

Query: 85  KFENELGPIINQLTFLQHVSSDKEIRDASVNSSMKLDE----LNIDLSLRHDIFLQFARV 140
           +  + L  +I+   F++    D     A+ +   ++ E    LN D+SL +   L+    
Sbjct: 125 RLSDTLCRVIDLCEFIRSTHPDDAFVRAAQDCHEQMFEFMNVLNTDVSLCN--ILKSVLN 182

Query: 141 WQDVQSKADSVERETFKYVEKSYKDYIHSGLELDEGNRLKIKEIKKKISVNS---INFSK 197
             +V SK  + E +  K +     D+  SG+ ++   R K  ++ ++IS+     IN + 
Sbjct: 183 NPEVSSKLSAEELKVGKIL---LDDFEKSGIYMNPDVREKFIQLSQEISLVGQEFINHTD 239

Query: 198 NLGEQKEYITFTKEQLEGVPDSILTQFETIKSDKDSNETLYKV-TFKYPDIFPVMKLASS 256
             G         K   + + +S ++ F   + +KD     YKV TF Y   + ++K   +
Sbjct: 240 YPGSNS-----VKIPCKDLDNSKVSTFLLKQLNKDVKGQNYKVPTFGYA-AYALLKSCEN 293

Query: 257 AQTRKQAFLADQNKVPENEAILLDTLKLRDELASLLGYDTYANYNLYDKMAEDSTTVMNF 316
              RK+ + A  +   +    L   +KLR  LA+L+   +YA Y L  KMA++   V +F
Sbjct: 294 EMVRKKLWTALHSCSDKQVKRLSHLIKLRAILANLMHKTSYAEYQLEGKMAKNPKDVQDF 353

Query: 317 LNDLKDKLIPLGRKELQVLQDMKAEDVKK-LNQGADPNYYI---WDHRYYDNKYLLEN-- 370
           +  L +  I     EL+ + ++KA+D+KK L    D    +   WD  YY  KY   N  
Sbjct: 354 ILTLMNNTIEKTANELKFIAELKAKDLKKPLTTNTDEILKLVRPWDRDYYTGKYFQLNPS 413

Query: 371 FNVDLEKISEYFPLEATITGMLEIYETLFNLKFIETKDSQNKSVWHDDVKQIAVWNMDDP 430
            + + ++IS YF L   I G+ ++++ ++ ++ +E   +     W  DV+++ V + ++ 
Sbjct: 414 NSPNAKEISYYFTLGNVIQGLSDLFQQIYGIR-LEPAITDEGETWSPDVRRLNVISEEE- 471

Query: 431 KSPNFVGWIYFDLHPRDGKYGHAANFGLSSSFMI----------------DDTTRSYPVT 474
                +G IY DL  R+GK  + A+F +  S  I                D T    PV 
Sbjct: 472 ---GIIGIIYCDLFERNGKTSNPAHFTVCCSRQIYPSETDFSTIQVGENPDGTYFQLPVI 528

Query: 475 ALVCNFSK---STKDKPSLLKHNEIVTFFHELGHGIHDLVGQNKESRFNGPGSVPWDFVE 531
           +LVCNFS    ++K     L+ +E+ T FHE+GH +H ++G+      +G      DFVE
Sbjct: 529 SLVCNFSPILIASKKSLCFLQLSEVETLFHEMGHAMHSMLGRTHMQNISGT-RCATDFVE 587

Query: 532 APSQMLEFWTWNKNELINLSSHYKTGEKIPESLINSLIKTKHVNGALFTLRQLHFGLFDM 591
            PS ++E +  +   L  +  HY TGE I   ++   +K+ +      T  Q    + D 
Sbjct: 588 LPSILMEHFAKDIRILTKIGKHYGTGETIQADMLQRFMKSTNFLQNCETYSQAKMAMLDQ 647

Query: 592 KVHTCK---DLQNLSICDTWNQLRQDISLISNGGTLSKGYDSFGHIMSDSYSAGYYGYLW 648
             H  K   D+ N  + + +  L + + ++ +  +   G   FGH+    Y A YY YL+
Sbjct: 648 SFHDEKIISDIDNFDVVENYQALERRLKVLVDDQSNWCG--RFGHLF--GYGATYYSYLF 703

Query: 649 AEVFATDMYHTKFAKDPLNAKNGIQYRDIVLARGGLYD 686
               A+ +++  F  DP + KNG +++  +L  GGL D
Sbjct: 704 DRTIASKIWYALFEDDPYSRKNGDKFKKHLLKWGGLKD 741

>Suva_11.91 Chr11 complement(175327..177654) [2328 bp, 775 aa] {ON}
           YKL134C (REAL)
          Length = 775

 Score =  182 bits (461), Expect = 1e-47,   Method: Compositional matrix adjust.
 Identities = 166/638 (26%), Positives = 289/638 (45%), Gaps = 57/638 (8%)

Query: 85  KFENELGPIINQLTFLQHVSSDKEIRDASVNSSMKLDE----LNIDLSLRHDIFLQFARV 140
           +  + L  +I+   F++    D     A+ +   ++ E    LN D+SL +   L+    
Sbjct: 128 RLSDTLCRVIDLCEFIRSTHPDDAFVKAAQDCHEQMFEFMNVLNTDVSLCN--MLKTVLN 185

Query: 141 WQDVQSKADSVERETFKYVEKSYKDYIHSGLELDEGNRLKIKEIKKKISVNS---INFSK 197
              + SK   +  E  K  +    D+  SG+ ++   R K  ++ ++IS+     IN + 
Sbjct: 186 SPKISSK---LSEEELKVGKILLDDFEKSGIYMNPDVREKFIQLSQEISLVGQEFINHTD 242

Query: 198 NLGEQKEYITFTKEQLEGVPDSILTQFETIKSDKDSNETLYKV-TFKYPDIFPVMKLASS 256
             G     I+  +     V   +L Q      +KD     YKV TF Y   + ++K    
Sbjct: 243 YPGSNSVKISCRELDNSNVSAFLLKQL-----NKDVKGQNYKVPTFGYA-AYALLKSCEK 296

Query: 257 AQTRKQAFLADQNKVPENEAILLDTLKLRDELASLLGYDTYANYNLYDKMAEDSTTVMNF 316
            Q RK+ + A  +   +    L   +KLR  LA L+   +YA Y L  KMA++   V +F
Sbjct: 297 EQVRKKIWTALHSCSDKQIKRLNHLIKLRANLADLMHKGSYAEYQLEGKMAKNPKDVQDF 356

Query: 317 LNDLKDKLIPLGRKELQVLQDMKAEDVKK-LNQGADPNYYI---WDHRYYDNKYLLENFN 372
           +  L +  I     EL+ + ++KA+D+KK L    D    +   WD  YY  KYL  N +
Sbjct: 357 ILTLMNDTIDKTATELKFIAELKAKDLKKPLATKTDEILKLVRPWDRDYYTGKYLQLNPS 416

Query: 373 --VDLEKISEYFPLEATITGMLEIYETLFNLKFIETKDSQNKSVWHDDVKQIAVWNMDDP 430
                ++IS YF L   I G+ ++++ ++ +K +E   +     W  DV+++ V + ++ 
Sbjct: 417 NAPSAKEISSYFTLGNVIQGLSDLFQHIYGIK-LEPAIADEGETWSPDVRRLNVISEEE- 474

Query: 431 KSPNFVGWIYFDLHPRDGKYGHAANFGLSSSFMI----------------DDTTRSYPVT 474
                +G IY DL  R GK  + A+F +  S  I                D +    PV 
Sbjct: 475 ---GIIGIIYCDLFERSGKTSNPAHFTVCCSRQIYPNETDFSTIQLGENADGSFFQLPVI 531

Query: 475 ALVCNFSK---STKDKPSLLKHNEIVTFFHELGHGIHDLVGQNKESRFNGPGSVPWDFVE 531
           +LVCNF+    ++K     L+ +E+ T FHE+GH +H ++G+      +G      DFVE
Sbjct: 532 SLVCNFAPIPIASKKSLCFLQLSEVETLFHEMGHAMHSMLGRTHMQNISGTRCAT-DFVE 590

Query: 532 APSQMLEFWTWNKNELINLSSHYKTGEKIPESLINSLIKTKHVNGALFTLRQLHFGLFDM 591
            PS ++E +  +   L  +  HY+TGE +   ++ S ++T +      T  Q    + D 
Sbjct: 591 LPSILMEHFAKDIRILTRIGKHYETGETVEPDMLQSFMRTTNFLQNCETYSQAKMAMLDQ 650

Query: 592 KVH---TCKDLQNLSICDTWNQLRQDISLISNGGTLSKGYDSFGHIMSDSYSAGYYGYLW 648
             H      ++ N  +   +  L + + ++ +  +   G   FGH+    Y A YY YL+
Sbjct: 651 SFHDEEVISNIDNYDVVKNYQALERRLKVLVDDQSNWCG--RFGHLF--GYGATYYSYLF 706

Query: 649 AEVFATDMYHTKFAKDPLNAKNGIQYRDIVLARGGLYD 686
               A+ +++  F  DP + KNG +++  +L  GGL D
Sbjct: 707 DRTIASKIWYALFEDDPYSRKNGDKFKKHLLKWGGLKD 744

>NCAS0A04280 Chr1 complement(864327..866648) [2322 bp, 773 aa] {ON}
           Anc_2.432
          Length = 773

 Score =  181 bits (459), Expect = 2e-47,   Method: Compositional matrix adjust.
 Identities = 174/686 (25%), Positives = 310/686 (45%), Gaps = 74/686 (10%)

Query: 46  TPSDISGKTNEIINNSNNFYDSMSKVES-PSVSNFVEPFMKFENELGPIINQLTFLQHVS 104
           +P  +   +N+ +  + +  D+M    S      F+    +  + L  +I+   F++   
Sbjct: 86  SPKGLKEFSNKSLEKARSLVDTMKNDRSFKGEMGFIMNLDRLSDTLCRVIDLCEFIRSTH 145

Query: 105 SDKEIRDASVNSSMKLDE----LNIDLSLRHDIFLQFARVWQDVQSKADSVERETFKYVE 160
            D+    A+ +   ++ E    LN D+ L  DI L+      ++ SK    E +  K + 
Sbjct: 146 PDEAFVKAAQDCHEQMFEFMNVLNTDVVL-CDI-LKHVLNDPNINSKLTPEEIKVGKLL- 202

Query: 161 KSYKDYIHSGLELDEGNRLKIKEIKKKISVNSINFSKNLGEQKE---YITFTKEQLEGVP 217
              +D+  SG+ +D   R +   + ++IS+   +F  N+   K     I  ++    GV 
Sbjct: 203 --LEDFEKSGIYMDPNIRKQFISLSQEISLTGQDFINNIDLIKSNHVKIKCSELNKSGVN 260

Query: 218 DSILTQFETIKSDKDSNETLYKVTFKYPDIFPVMKLASSAQTRKQAFLADQNKVPENEAI 277
             +L Q       KD     YK+         +++    A  R + + A  +  P ++  
Sbjct: 261 SLLLKQLP-----KDITGKYYKIPTSGYIPISLIRSCPDATIRAKVW-ASLHSCPNDQIR 314

Query: 278 LLDTL-KLRDELASLLGYDTYANYNLYDKMAEDSTTVMNFLNDLKDKLIPLGRKELQVLQ 336
            L  L KLR  LA LL   ++A Y L  KMA+    V +F+  L D + P   +EL+ + 
Sbjct: 315 RLTHLVKLRAILAHLLNKCSFAKYQLEGKMAKTPQNVRDFIKTLMDYMRPKAAQELKFMA 374

Query: 337 DMKAEDVKKLN-QGADPNYYI------WDHRYYDNKY-------LLENFNVDLEKISEYF 382
           D+K    K+LN   +D    I      WD  YY   +       L EN  +++     YF
Sbjct: 375 DLKC---KELNIPTSDSTTAILDLISPWDREYYTTIHSKAKDVNLYENHPINM-----YF 426

Query: 383 PLEATITGMLEIYETLFNLKFIETKDSQNKSVWHDDVKQIAVWNMDDPKSPNFVGWIYFD 442
            +   + G+  I++ ++ ++ +E    +    W  +V+++ V +    ++   +G +Y D
Sbjct: 427 TMGNIMKGLSHIFQRIYGIR-LEAVVPEEGETWSPEVRRLNVIS----ETEGLIGVVYCD 481

Query: 443 LHPRDGKYGHAANFGLSSSFMI----------------DDTTRSYPVTALVCNFSKS--T 484
           L  R GK  + A+F +  S  I                D T    PV +LVCNFS +  +
Sbjct: 482 LFERAGKTSNPAHFTVCCSRQIYPDENDLSTIQIGTNPDGTAFQLPVISLVCNFSSTLTS 541

Query: 485 KDKP-SLLKHNEIVTFFHELGHGIHDLVGQNKESRFNGPGSVPWDFVEAPSQMLEFWTWN 543
            DK   LL+ NEI T FHE+GH +H ++G+++    +G      DFVE PS ++E +  +
Sbjct: 542 NDKMICLLQLNEIETLFHEMGHAMHSMLGRSRLQNVSGTRCAT-DFVELPSILMEHFARD 600

Query: 544 KNELINLSSHYKTGEKIPESLINSLIKTKHVNGALFTLRQLHFGLFDMKVHT---CKDLQ 600
           K  L  +  HY+T E++ E +I + +K         T  Q    + D ++++    KDL 
Sbjct: 601 KRVLHEIGFHYETNERVSEYVIEAHLKKMKFLQDCETFSQGKMAMLDQELYSENIIKDLD 660

Query: 601 NLSICDTWNQLRQDISLISNGGTLSKGYDSFGHIMSDSYSAGYYGYLWAEVFATDMYHTK 660
           ++ +   +  L +D+ ++ +    S     FGH+    Y A YY YL+    A+ ++   
Sbjct: 661 HVDVVKIYQTLEEDLKVLVDNK--SNWCGKFGHLFG--YGASYYSYLFDRAIASKVWDQL 716

Query: 661 FAKDPLNAKNGIQYRDIVLARGGLYD 686
           FAKDP + + G ++++ VL  GGL D
Sbjct: 717 FAKDPFSREGGEKFKNCVLKWGGLRD 742

>KNAG0A06200 Chr1 complement(937577..939946) [2370 bp, 789 aa] {ON}
           Anc_2.432 YKL134C
          Length = 789

 Score =  179 bits (454), Expect = 1e-46,   Method: Compositional matrix adjust.
 Identities = 143/568 (25%), Positives = 261/568 (45%), Gaps = 53/568 (9%)

Query: 153 RETFKYVEKSYKDYIHSGLELDEGNRLKIKEIKKKISVNSINFSKNLG-EQKEYITFTKE 211
           +E  K  +   +D+  SG+ +    R +  E+ + IS+   +F  N    + E+I    E
Sbjct: 210 QEELKVGKILLEDFEKSGIYMSTDTRDRFIEMSQDISLVGQDFINNTNWLRSEFIEIASE 269

Query: 212 QLE--GVPDSILTQFETIKSDKDSNETLYKVTFKYPDIFPVMKLASSAQTRKQAFLADQN 269
           +L+  GV   +L Q  T         T YKV       + +++   +   RK  + A  +
Sbjct: 270 ELDNSGVSPILLRQLTTTVRG-----THYKVPAYGTAPYIILRSCKNENARKAVWTALHS 324

Query: 270 KVPENEAILLDTLKLRDELASLLGYDTYANYNLYDKMAEDSTTVMNFLNDLKDKLIPLGR 329
              +    L   +K+R  L++++G   +A Y L  KMA+    V+NF+  L +   P+  
Sbjct: 325 CPDKQINRLTHMVKMRSVLSNIMGKVGFAVYQLQGKMAKSPENVLNFITRLMEHTKPMAA 384

Query: 330 KELQVLQDMKAEDV--------KKLNQGADPNYYIWDHRYYDNK----YLLENFNVDLEK 377
           +EL++L +MK  D+        K++ +   P    WD  YY  K       +N   + E 
Sbjct: 385 EELKLLANMKLNDLGLPEANSEKEILETVRP----WDRDYYVAKSQQTRKAKNQLTNHEP 440

Query: 378 ISEYFPLEATITGMLEIYETLFNLKFIETKDSQNKSVWHDDVKQIAVWNMDDPKSPNFVG 437
           I+ YF L + + G+  ++++++ +  +E   S     W  +V+++ V   ++    N +G
Sbjct: 441 INAYFTLGSVLEGLSNLFKSIYGIS-LEVVASIPGETWSSEVRRVNVKTENN----NIIG 495

Query: 438 WIYFDLHPRDGKYGHAANFGLSSSF----------MIDDTTRS------YPVTALVCNFS 481
            +Y DL  R  K    A+F +  S           ++     S       P+ +LVCNF+
Sbjct: 496 VVYCDLFERKAKTSSPAHFTVCCSRELYAEENDPSILQSGVNSRGEKFQLPIISLVCNFA 555

Query: 482 KSTKDKPSLLKHNEIVTFFHELGHGIHDLVGQNKESRFNGPGSVPWDFVEAPSQMLEFWT 541
           +++ ++  LL+ +EI T FHE+GH +H ++GQ K    +G      DFVE PS ++E + 
Sbjct: 556 RTSDNELCLLQLSEIETLFHEMGHAMHSMLGQTKLQNISGTRCTT-DFVELPSIIMEHFA 614

Query: 542 WNKNELINLSSHYKTGEKIPESLINSLIKTKHVNGALFTLRQLHFGLFDMKVH---TCKD 598
            +   L  +  HY T EK+PE L+   + +        T  Q    + D +++       
Sbjct: 615 RDPRVLKGIGRHYITKEKVPEDLLAEELNSTRYLQNCETFAQAKMAMLDQRLYDNNIIFH 674

Query: 599 LQNLSICDTWNQLRQDISLISNGGTLSKGYDSFGHIMSDSYSAGYYGYLWAEVFATDMYH 658
           +++L + + ++ L +++ ++ +  T   G   FGH+    Y A YY YL     A  ++ 
Sbjct: 675 VRDLDVVELYHDLERNLEVLVDDQTNWCG--KFGHLF--GYGATYYSYLLDRAIAAKIWD 730

Query: 659 TKFAKDPLNAKNGIQYRDIVLARGGLYD 686
             F  DP +   G  +++ VL  GGL D
Sbjct: 731 CLFVNDPFSRTGGENFKNAVLKWGGLRD 758

>AFR198W Chr6 (797448..799778) [2331 bp, 776 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YKL134C (OCT1)
          Length = 776

 Score =  178 bits (452), Expect = 2e-46,   Method: Compositional matrix adjust.
 Identities = 164/638 (25%), Positives = 289/638 (45%), Gaps = 56/638 (8%)

Query: 90  LGPIINQLTFLQHVSSDKEIRDASVNSSMKLDE-LNIDLSLRHDIFL--QFARVWQDVQS 146
           L  +I+   FL+    D++   A+     ++ E +NI   L  D+ L  +  +V  D ++
Sbjct: 141 LCRVIDLCEFLRAAHPDEQFVAAAQECHEQMFEIMNI---LNTDVVLCKRLKQVLSD-EN 196

Query: 147 KADSVERETFKYVEKSYKDYIHSGLELDEGNRLKIKEIKKKISVNSINFSKNLGE-QKEY 205
            +  +  E  +      +D+  +G       R +  ++ + IS+   +F  N       Y
Sbjct: 197 ISSKLSSEEIRVGHILLEDFEKAGAYASPEVRKQFIQLSQNISIIGQDFINNTESLSSSY 256

Query: 206 ITFTKEQLE--GVPDSILTQFETIKSDKDSNETLYKVTFKYPDIFPVMKLASSAQTRKQA 263
           I    + LE  G    +L Q       KD+    YK+       + ++    S   R+Q 
Sbjct: 257 IKIPCKDLESSGTSHLVLRQL-----TKDTMGNNYKIPTSGYAPYTLLNACPSEAIRRQV 311

Query: 264 FLADQNKVPENEAILLDTLKLRDELASLLGYDTYANYNLYDKMAEDSTTVMNFLNDLKDK 323
           + A  +   +    L   L+LR +LA+++G   Y +Y L  KMA+    V NFLN L D 
Sbjct: 312 WTAMFSCSEKQVKRLKSLLQLRRKLANIMGATDYVSYQLEGKMAKSPENVKNFLNTLVDH 371

Query: 324 LIPLGRKELQVLQDMKAEDVKKLNQGADPNYYI-WDHRYYDN---KYLLENFNVD-LEKI 378
             PL   EL+ L  +K  +V+ L++         WD  YY +    +   N  VD    I
Sbjct: 372 TKPLAAGELEELAKLK-RNVENLSETNTLKLMRPWDRDYYSSLSPNFTRPNHRVDGFTSI 430

Query: 379 SEYFPLEATITGMLEIYETLFNLKFIETKDSQNKSVWHDDVKQIAVWNMDDPKSPNFVGW 438
           + YF L   + G+ +++  ++ +  ++   +Q    W  DV+++ V +    ++   +G 
Sbjct: 431 NTYFSLGVVMQGISDLFRDIYGIS-LKPVVAQAGETWAPDVRKLQVIS----ETEGIIGL 485

Query: 439 IYFDLHPRDGKYGHAANFGLSSSFMI----------------DDTTRSYPVTALVCNFSK 482
           IY DL  R GK    ++F +  S  I                D +    PV +L+CNF  
Sbjct: 486 IYCDLLERPGKTTSPSHFTVCCSRQIYPEENDFSTIQVGENPDGSRFQMPVISLICNFRA 545

Query: 483 STKDKP---SLLKHNEIVTFFHELGHGIHDLVGQNKESRFNGPGSVPWDFVEAPSQMLEF 539
           +   K     LL+ +++ T FHE+GH +H ++G+ +    +G   V  DFVE PS ++E 
Sbjct: 546 TRHGKNKSLCLLELSDVETLFHEMGHALHSMLGRTQLQNLSGTRCVT-DFVELPSILMEH 604

Query: 540 WTWNKNELINLSSHYKTGEKIPESLINSLIKTKHVNGALFTLRQLHFGLFDMKVHTCKDL 599
           +  ++  L+ +SS+Y TGE IPE L+++  +  +      T  Q+   + D ++H+  D 
Sbjct: 605 FAKDRRVLLRISSNYATGEPIPEELLSAFQEQNNFLKNTETFSQIKMSMLDQRLHSITDQ 664

Query: 600 QNLSICDTWNQLRQDISLISNGGTLSKGYDSFGHIMSDSYSAGYYGYLWAEVFATDMYHT 659
            +  I   ++ L +++ ++ +  T   G   FGH+    Y A YY YL     A  ++  
Sbjct: 665 DD--IIAVYHGLEREMEVLVDDQTNWCG--RFGHLF--GYGASYYSYLMDRAIAAKIWDH 718

Query: 660 KFAKDPLNAKNGIQYRDIVLARGGLYD----INDNLKE 693
            F KDP +  +G ++++ VL  GG  D    I D L E
Sbjct: 719 LFKKDPFSRSSGEKFKEGVLKWGGSRDAWQCIADALDE 756

>TDEL0A02080 Chr1 complement(373425..375788) [2364 bp, 787 aa] {ON}
           Anc_2.432 YKL134C
          Length = 787

 Score =  178 bits (451), Expect = 2e-46,   Method: Compositional matrix adjust.
 Identities = 144/554 (25%), Positives = 263/554 (47%), Gaps = 50/554 (9%)

Query: 164 KDYIHSGLELDEGNRLKIKEIKKKISVNSINFSKNLGEQKEYI--TFTKEQLEGVPDSIL 221
           +D+  SG+ ++   R +   + ++IS+    F  N     +Y+   + K + E V +S +
Sbjct: 216 EDFEKSGIYMNPEVRDQFIALSQEISLVGQEFINN----TDYVRSNYIKIKCEEVDNSGI 271

Query: 222 TQFETIKSDKDSNETLYKVTFKYPDIFPVMKLASSAQTRKQAFLADQNKVPENEAILLDT 281
            +    +  KD     YK+       + +++     + R   + A  ++  + +   LD 
Sbjct: 272 NKLLISQLPKDVRGKYYKIPTHGYIAYSILRSCPDEEIRMNLWTA-MHRCSDKQINRLDQ 330

Query: 282 L-KLRDELASLLGYDTYANYNLYDKMAEDSTTVMNFLNDLKDKLIPLGRKELQVLQDMKA 340
           L +LR  LA L+G +++A Y L  KMA+    V +F+  L + + P   +EL+ + ++K+
Sbjct: 331 LLRLRAILAKLMGKESFAQYQLEGKMAQTPQQVRDFIGTLVNYMRPKTIEELKFIYELKS 390

Query: 341 EDVKKLNQGADPNYYI------WDHRYYDNKYLLENFN--VDLEKISEYFPLEATITGML 392
           +  K+  Q +     I      WD  YY + Y L+     +D E+IS YF L   I G+ 
Sbjct: 391 KQEKREIQPSPSEQDIASMVRPWDREYYTSMYSLQQRRDAIDDEQISSYFTLGNVIQGLS 450

Query: 393 EIYETLFNLKFIETKDSQNKSVWHDDVKQIAVWNMDDPKSPNFVGWIYFDLHPRDGKYGH 452
           +++E+++ ++ +E    +    +  +V+++ V      +    +G +Y DL  R GK  +
Sbjct: 451 DLFESIYGIR-LEPVVPKTGETFSPEVRRLNVV----CEQEGVIGVVYCDLFERAGKTSN 505

Query: 453 AANFGLSSSFMI----------------DDTTRSYPVTALVCNFSKSTKDKP---SLLKH 493
            ++F +  S  I                +      PV ALVCNFS ST  +     LL+ 
Sbjct: 506 PSHFTVCCSRQIYPKETEFSTIQTGFNSEGLMFQLPVIALVCNFSSSTDSEGKSICLLQL 565

Query: 494 NEIVTFFHELGHGIHDLVGQNKESRFNGPGSVPWDFVEAPSQMLEFWTWNKNELINLSSH 553
           NE+ T FHE+GH +H ++G+ +    +G      DFVE PS ++E +  +   L  +  H
Sbjct: 566 NEVETLFHEMGHAMHSMLGRTRLQNISGT-RCATDFVELPSILMEHFARDVRVLERIGKH 624

Query: 554 YKTGEKIPES-LINSLIKTKHVNGALFTLRQLHFGLFDMKVH---TCKDLQNLSICDTWN 609
           ++TG  I E  L+N L +TK +     T  Q    + D  +H     KD  +  +   + 
Sbjct: 625 HRTGAPISEKLLLNYLEETKFMQHCE-TFSQAKMAMLDQDLHGEKVIKDFDHFDVTAAYQ 683

Query: 610 QLRQDISLISNGGTLSKGYDSFGHIMSDSYSAGYYGYLWAEVFATDMYHTKFAKDPLNAK 669
           QL +D+ ++ +  +   G   FGH+    Y A YY YL+    A+ ++ + F+ DP +  
Sbjct: 684 QLERDMKVLVDDKSNWCG--KFGHLF--GYGATYYSYLFDRAIASKVWDSLFSSDPYSRV 739

Query: 670 NGIQYRDIVLARGG 683
           NG ++++ VL  GG
Sbjct: 740 NGEKFKECVLKWGG 753

>Kwal_26.7616 s26 (444266..446578) [2313 bp, 770 aa] {ON} YKL134C
           (OCT1) - 1:1 [contig 55] FULL
          Length = 770

 Score =  176 bits (447), Expect = 8e-46,   Method: Compositional matrix adjust.
 Identities = 148/569 (26%), Positives = 266/569 (46%), Gaps = 54/569 (9%)

Query: 164 KDYIHSGLELDEGNRLKIKEIKKKISVNSINFSKNLG-EQKEYITFTKEQLE--GVPDSI 220
           +D+  SG++++     +   I ++IS+    F  N    + +Y+    ++L+  GV   +
Sbjct: 203 EDFEKSGIDMEPKVGEQFINISQQISIVGQEFINNTDFPRSDYVKIPCKELDSSGVSTLL 262

Query: 221 LTQFETIKSDKDSNETLYKVTFKYPDIFPVMKLASSAQTRKQAFLADQNKVPENEAILLD 280
           L Q       +D     YKV       F +++   +   R + + A  +  PE +   L 
Sbjct: 263 LNQL-----SRDLKNQNYKVPAYGYAAFSILRSCPNENVRMKIWTA-MHSCPEKQISRLK 316

Query: 281 TL-KLRDELASLLGYDTYANYNLYDKMAEDSTTVMNFLNDLKDKLIPLGRKELQVLQDMK 339
            L  LR  LAS++G  +YA Y L  KMA+    V  F+  L D   PL  +EL+VL  +K
Sbjct: 317 QLVMLRGLLASIMGKKSYAEYQLSGKMAKSPVYVRGFVQSLVDVTKPLAAEELRVLAKLK 376

Query: 340 AE--DVKKLNQGADPNYYI--WDHRYYDNKYLLENFNVDL--EKISEYFPLEATITGMLE 393
           +    V      AD   ++  WD  +Y     L+     L  E IS YF L   + G+  
Sbjct: 377 SGHLGVNVPQSDADVLRFVRPWDRDFYSTLNALQQQRKTLENEHISSYFSLGTVMQGLSR 436

Query: 394 IYETLFNLKFIETKDSQNKSVWHDDVKQIAVWNMDDPKSPNFVGWIYFDLHPRDGKYGHA 453
           ++E ++ ++ +E   ++    W  +V++I V +    +    +G +Y DL  R GK  + 
Sbjct: 437 LFEDIYGIR-LEPVVAKAGETWSPEVRRINVVS----EKEGIIGVVYCDLFERQGKTSNP 491

Query: 454 ANFGLSSSFMI--DDTTRS--------------YPVTALVCNFSK--STKDKPSLLKHNE 495
           A+F +  S  I   +T  S               PV +LVC+F++  +++    LL+ ++
Sbjct: 492 AHFTVCCSRTIYPGETDLSTIQVGQLPSGEKFQLPVISLVCSFAQNSASRQGVCLLQLSD 551

Query: 496 IVTFFHELGHGIHDLVGQNKESRFNGPGSVPWDFVEAPSQMLEFWTWNKNELINLSSHYK 555
           + T FHE+GH +H ++G+      +G      DFVE PS ++E +  +   L  +  HY 
Sbjct: 552 VDTLFHEMGHAMHSMLGRTSLQNISGT-RCATDFVELPSILMEHFARDSRVLSRIGRHYA 610

Query: 556 TGEKIPESLI----NSLIKTKHVNGALFTLRQLHFGLFDMKVHTCKDLQN--LSICDTWN 609
           T + IP  L+      +   +H      T  Q    + D ++H+ K L +  L +   ++
Sbjct: 611 TDQPIPTELLKLNQTEMNYLQHTE----TFSQAKMAMLDQELHSSKALTDGKLDVVKLYH 666

Query: 610 QLRQDISLISNGGTLSKGYDSFGHIMSDSYSAGYYGYLWAEVFATDMYHTKFAKDPLNAK 669
            + +D+ ++++    S     FGH++   Y A YY YL+    A+ ++   FA+DP N +
Sbjct: 667 GVEKDMEVLADDQ--SNWCGRFGHLL--GYGASYYSYLFDRAIASKIWQHLFAEDPFNRE 722

Query: 670 NGIQYRDIVLARGGLYDINDNLKEFLGRE 698
           NG ++++ VL  GG  D  + + + L R+
Sbjct: 723 NGEKFKESVLKWGGSKDPWECVADALDRK 751

>KLTH0D04730g Chr4 (432572..434890) [2319 bp, 772 aa] {ON} similar
           to uniprot|P35999 Saccharomyces cerevisiae YKL134C OCT1
           Mitochondrial intermediate peptidase cleaves N-terminal
           residues of a subset of proteins upon import after their
           cleavage by mitochondrial processing peptidase
           (Mas1p-Mas2p) may contribute to mitochondrial iron
           homeostasis
          Length = 772

 Score =  176 bits (445), Expect = 1e-45,   Method: Compositional matrix adjust.
 Identities = 158/646 (24%), Positives = 300/646 (46%), Gaps = 60/646 (9%)

Query: 78  NFVEPFMKFENELGPIINQLTFLQHVSSDKE-IRDASVNSSMKLDELNIDLSLRHDIFLQ 136
           N++    +  + L  +I+   F++    D + +R A +      + +N+ L+    +   
Sbjct: 119 NYIRNLDRLSDMLCRVIDLCEFIRASHPDSQFVRAAQLCHEEMFEFMNV-LNTDSTLCEI 177

Query: 137 FARVWQDVQSKADSVERETFKYVEKSYKDYIHSGLELDEGNRLKIKEIKKKISVNSINFS 196
             RV  D    A  +  E  K  +   +D+  SG+++      +   + ++IS+    F 
Sbjct: 178 LKRVLSD-DLIASKLSEEELKVGKILLEDFEKSGIDMAPEVGEQFINLSQQISIVGQEFI 236

Query: 197 KNLG-EQKEYITFTKEQLE--GVPDSILTQFETIKSDKDSNETLYKV-TFKYPDIFPVMK 252
            N    + EY+  +  +LE  G+   +L         +D+    YKV T+ Y   F +++
Sbjct: 237 SNTDFPKSEYVKVSCNELETSGISPLLLNHL-----SRDTKGQNYKVPTYGYI-AFSILR 290

Query: 253 LASSAQTRKQAFLADQNKVPENEAILLDTL-KLRDELASLLGYDTYANYNLYDKMAEDST 311
              S   R + + A  +  PE +   L  L KLR  LA ++G ++Y++Y L  KMA+   
Sbjct: 291 SCPSENIRMKVWTA-VHSCPEKQITRLKHLVKLRGLLAQIMGKNSYSDYQLEGKMAKSPV 349

Query: 312 TVMNFLNDLKDKLIPLGRKELQVLQDMKAED----VKKLNQGADPNYYIWDHRYYDNKYL 367
            V  F+  L + + PL  +EL+ L ++K+      + K ++        WD  +Y     
Sbjct: 350 YVRGFVESLAEAIKPLAMRELRALANLKSSHLDLPIPKTDEEVLKFVRPWDRDFYSTLIS 409

Query: 368 LENFNVDL--EKISEYFPLEATITGMLEIYETLFNLKFIETKDSQNKSVWHDDVKQIAVW 425
           L+     L  E+I+ YF L   + G+  + E ++ ++ +E   ++    W  +V++I V 
Sbjct: 410 LQQQRKTLENEQINSYFSLGTVMQGLSSLLEDIYGIR-LEPAVAKVGETWSPEVRRINVV 468

Query: 426 NMDDPKSPNFVGWIYFDLHPRDGKYGHAANFGLSSSFMI--DDTTRS------------- 470
           +  +      +G +Y DL  R GK  + A+F +  S  I  ++T  S             
Sbjct: 469 SDQE----GVIGVVYCDLFERQGKTSNPAHFTVCCSRQIYPEETDLSTIQVGQQPSSGQI 524

Query: 471 --YPVTALVCNFSKSTKDKP--SLLKHNEIVTFFHELGHGIHDLVGQNKESRFNGPGSVP 526
              PV +LVC+FS+++  K    LL+ +E+ T FHE+GH IH ++G+      +G     
Sbjct: 525 FQLPVISLVCSFSQNSGSKKDVCLLQLSEVDTLFHEMGHAIHSMLGRTSLQNISGT-RCA 583

Query: 527 WDFVEAPSQMLEFWTWNKNELINLSSHYKTGEKIPESLI----NSLIKTKHVNGALFTLR 582
            DFVE PS ++E +  +   L  +  HY T E +P+ L+    N L   ++      T  
Sbjct: 584 TDFVELPSILMEHFAHDSRVLSRIGKHYITNEPVPDELLHLNQNELKYLQNTE----TFS 639

Query: 583 QLHFGLFDMKVHTCKDLQN--LSICDTWNQLRQDISLISNGGTLSKGYDSFGHIMSDSYS 640
           Q    + D ++H+ + L +  + + + ++++ + + ++++    S     FGH++   Y 
Sbjct: 640 QAKMAMLDQEMHSPRMLTDGPVDVVEIYHEVEKQMGVLTDDK--SNWCGRFGHLL--GYG 695

Query: 641 AGYYGYLWAEVFATDMYHTKFAKDPLNAKNGIQYRDIVLARGGLYD 686
           A YY YL+    A+ ++   FA DP + K+G ++++ VL  GG  D
Sbjct: 696 ASYYSYLFDRAIASKVWQHLFANDPFSRKSGEKFKNSVLRWGGSRD 741

>Kpol_297.8 s297 complement(11648..14011) [2364 bp, 787 aa] {ON}
           complement(11648..14011) [2364 nt, 788 aa]
          Length = 787

 Score =  172 bits (437), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 154/576 (26%), Positives = 258/576 (44%), Gaps = 57/576 (9%)

Query: 148 ADSVERETFKYVEKSYKDYIHSGLELDEGNRLKIKEIKKKISVNSINFSKNLGEQKEY-I 206
           A  +  E  +      +D+  SG+ +    R +   + + ISV    F  N    K+  +
Sbjct: 201 ASKLSEEELRVGRILLEDFEKSGIYMKPEVREQFITLSQSISVIGQEFISNTDFVKDNNV 260

Query: 207 TFTKEQLE--GVPDSILTQFETIKSDKDSNETLYKV-TFKYPDIFPVMKLASSAQTRKQA 263
             +  QL+  G+   +L+Q E     KD     YK+ T+ Y   F ++K   S + R++ 
Sbjct: 261 VVSCNQLDSLGIDPELLSQIE-----KDIAGKNYKIPTYGYIP-FALLKSCPSEEIREKI 314

Query: 264 FLADQNKVPENEAILLDTLKLRDELASLLGYDTYANYNLYDKMAEDSTTVMNFLNDLKDK 323
           ++A  N   E    L D +KLR  L+ LLG  +YA Y L  KMA++   V+ F+  L D 
Sbjct: 315 WVAVHNCSNEQIKRLTDLVKLRAVLSQLLGKKSYAEYQLEGKMAKNPKEVIEFIKTLMDF 374

Query: 324 LIPLGRKELQVLQDMKAE--------DVKKLNQGADPNYYIWDHRYYDNKYLLENFNVDL 375
             P+  KEL  + + K           V  + +   P    WD  YY      +    +L
Sbjct: 375 TKPMAAKELDGIAEKKLTIKSNGSNLSVCDILKTVRP----WDRDYYSAIEREQTSAKNL 430

Query: 376 ---EKISEYFPLEATITGMLEIYETLFNLKFIETKDSQNKSVWHDDVKQIAVWNMDDPKS 432
              E++ +YF L   + G+  +++ ++ +K +E    +    W  +V++I V + D+   
Sbjct: 431 YGSEEVLKYFTLGNVMQGLSNLFQKIYGIK-LELDVPKIGETWSPEVRKINVISEDE--- 486

Query: 433 PNFVGWIYFDLHPRDGKYGHAANFGLSSSFMI------DDTTR----------SYPVTAL 476
              +G IY DL  R GK  +AA+F +  S  I      D TT+            P+ +L
Sbjct: 487 -GLIGIIYCDLFERSGKTSNAAHFTICCSRDISPYETEDSTTQIAIDSKGTRFQLPIISL 545

Query: 477 VCNFSK---STKDKPSLLKHNEIVTFFHELGHGIHDLVGQNKESRFNGPGSVPWDFVEAP 533
           VCNFSK   S  D    L   E+ T FHE+GH +H ++G+ K    +G      DFVE P
Sbjct: 546 VCNFSKTMISETDSVCFLHLPEVETLFHEMGHAMHSMLGRTKLQNISGTRCAT-DFVELP 604

Query: 534 SQMLEFWTWNKNELINLSSHYKTGEKIPESLINSLIKTKHVNGALFTLRQLHFGLFDMKV 593
           S ++E++  +   L  +  HY T E +   ++   ++         T  Q    + D  +
Sbjct: 605 SILMEYFARDPRVLETIGKHYLTKETVKREMLEPHLQDLKYLQHCETYSQAKMAMLDQTL 664

Query: 594 H---TCKDLQNLSICDTWNQLRQDISLISNGGTLSKGYDSFGHIMSDSYSAGYYGYLWAE 650
           H       L +L +   +  L + + ++ +  +   G   FGH+    YSA YY YL+  
Sbjct: 665 HGETISSHLDHLDVVKLYQDLERQLGVLVDDKSNWCG--KFGHLF--GYSAVYYSYLFDR 720

Query: 651 VFATDMYHTKFAKDPLNAKNGIQYRDIVLARGGLYD 686
             A+ ++   F ++P +  +G +YR+ VL  GG  D
Sbjct: 721 AIASKIWGALFERNPFSRASGDKYRNSVLQWGGSRD 756

>TPHA0G02390 Chr7 complement(486025..488412) [2388 bp, 795 aa] {ON}
           Anc_2.432 YKL134C
          Length = 795

 Score =  167 bits (424), Expect = 8e-43,   Method: Compositional matrix adjust.
 Identities = 157/567 (27%), Positives = 272/567 (47%), Gaps = 53/567 (9%)

Query: 154 ETFKYVEKSYKDYIHSGLELDEGNRLKIKEIKKKISVNSINFSKNLG-EQKEYITFTKEQ 212
           E +K  +   +D+  SG+ ++   R K  E+ ++IS+    F  N     K  I   +E 
Sbjct: 214 EEYKVGKILLEDFEKSGIYMEPNTREKFIELSQEISLVGQEFISNTDYVTKNNILIDRES 273

Query: 213 LEGVPDSILTQFE---TIKSDKDSNETLYKVTFKYPDIFPVMKLASSAQTRKQAFLADQN 269
           L       L++ E   T +   D     YK+    P  + ++   S+   RK+ +    +
Sbjct: 274 LN------LSELELPFTYQLKTDITGKHYKIPTTGPIPYSILTNCSNETIRKKIWTELHS 327

Query: 270 KVPENEAILLDTLKLRDELASLLGYDTYANYNLYDKMAEDSTTVMNFLNDLKDKLIPLGR 329
              E    L   + LR +LA LL   ++A Y L  KMA++   V  F++ L D   PL  
Sbjct: 328 CSQEQIERLKKMVTLRYKLAKLLKKKSFAEYQLQGKMAKNPEEVKKFISTLLDFTKPLAI 387

Query: 330 KELQVLQDMKAEDVKKLNQGADPNYYI-----WDHRYYD--NKYLLENFNVDLEKISEYF 382
           KEL  L ++KA D+  L    D N+ +     WD  YY   N+Y  +    DL ++  YF
Sbjct: 388 KELTSLAEVKAADL-GLAFKNDSNFIVNLIRPWDRNYYSKINRYENKQTMEDLNELPYYF 446

Query: 383 PLEATITGMLEIYETLFNLKFIETKDSQNKSVWHDDVKQIAVWNMDDPKSPNFVGWIYFD 442
            L   I G+  ++  ++ ++F E    + +  W  +V+++ V +    +S   +G +Y D
Sbjct: 447 SLGNVIAGLSNLFHNIYGIRF-ELAVPKLEETWLPEVRKLNVIS----ESEGLIGIVYCD 501

Query: 443 LHPRDGKYGHAANFGLSSSFMI----DDTTRSY-----------PVTALVCNFSKS---T 484
           L  R  K  +AA+F +  S  I    D +T              P+ +L+CNFSKS    
Sbjct: 502 LFERPSKKTNAAHFTICCSREIGKGEDISTMQVGMNSKGNMFQLPIISLICNFSKSHLFE 561

Query: 485 KDKPSLLKHNEIVTFFHELGHGIHDLVGQNKESRFNGPGSVPWDFVEAPSQMLEFWTWNK 544
           ++ P  L+ +EI T FHE+GH +H ++G+ +    +G      DFVE PS ++E +  + 
Sbjct: 562 ENGPCFLQLHEIETLFHEMGHAMHSVLGRTRLQNTSGTRCAT-DFVELPSILMEHFAKDV 620

Query: 545 NELINLSSHYKTGEKI-PESLINSLIKTKHV-NGALFTLRQLHFGLFDMKVHT---CKDL 599
             + ++SSHY + E   PE L   L  T ++ N  L+T  Q    + D  +H+    +D 
Sbjct: 621 RVMESISSHYISQEPASPELLQTWLHSTDNLQNLELYT--QAKMSMLDQILHSNEIFEDQ 678

Query: 600 QNLSICDTWNQLRQDISLISNGGTLSKGYDSFGHIMSDSYSAGYYGYLWAEVFATDMYHT 659
           +++++  ++N L + + L S+  +   G   FGH+    Y A YY YL+    A+ ++ +
Sbjct: 679 KDINVVKSYNDLEKKLELFSDDQSNWCG--KFGHLF--GYGASYYSYLFDRAIASKVWES 734

Query: 660 KFAKDPLNAKNGIQYRDIVLARGGLYD 686
            F ++P +  +G++++D VL  GG  D
Sbjct: 735 LFKQNPFSRTSGLKFKDSVLRWGGSRD 761

>KLLA0B12397g Chr2 complement(1084129..1086468) [2340 bp, 779 aa]
           {ON} similar to uniprot|P35999 Saccharomyces cerevisiae
           YKL134C OCT1 Mitochondrial intermediate peptidase
           cleaves N-terminal residues of a subset of proteins upon
           import after their cleavage by mitochondrial processing
           peptidase (Mas1p-Mas2p) may contribute to mitochondrial
           iron homeostasis
          Length = 779

 Score =  156 bits (395), Expect = 4e-39,   Method: Compositional matrix adjust.
 Identities = 163/652 (25%), Positives = 287/652 (44%), Gaps = 70/652 (10%)

Query: 79  FVEPFMKFENELGPIINQLTFLQHVSSDKEIRDASVNSSMKLDE----LNIDLSLRHDIF 134
           +++   +  + L  +I+   F++    DK+    +     K+ E    LN D+ L  D+ 
Sbjct: 122 YIKDLDQLSDVLCRVIDLCEFIRATHPDKKFVQTAQQCHEKMFEIMNILNTDVRL-CDLL 180

Query: 135 LQFARVWQDVQSKADSVERETFKYVEKSYKDYIHSGLELDEGNRLKIKEIKKKISVNSIN 194
            Q  R     +S    ++ E  +  +   +D+  SG+ +    R K  ++ ++ISV   +
Sbjct: 181 TQCLR-----ESDVLGLDSEEIRTGKILLEDFEKSGIYMKPEIREKFIQLSQEISVIGQD 235

Query: 195 FSKNLG-EQKEYITFTKEQLEGVPDSILTQFETIKSDKDSNETLYKV-TFKYPDIFPVMK 252
           F  N    +  YI  + E +    D+ + +    +  KD     YKV T+ Y     +++
Sbjct: 236 FINNTEYVRSNYIKISCELM----DAHVNKMVCSQMKKDITGEYYKVPTYGYIP-HTLLR 290

Query: 253 LASSAQTRKQAFLADQNKVPENEAILLDTLKLRDELASLLGYDTYANYNLYDKMAEDSTT 312
             S    R + +    +        L   + LR ELA LLG   +A Y L+ KMA+    
Sbjct: 291 TCSDEVIRMKIWTEMHSCSDAQIERLTKLISLRVELAKLLGSQNFAQYQLHGKMAKTPEN 350

Query: 313 VMNFLNDLKDKLIPLGRKELQVLQDMKAEDVKKLNQGADPN--------YYIWDHRYYDN 364
           V  FL  L          EL+ L  +K+E    L     P+           WD  YY +
Sbjct: 351 VSGFLESLVHSTRIKAASELKPLAVLKSE----LTGTQTPHTSEEVLELMKPWDRDYYGS 406

Query: 365 -KYLLENFNVDL---EKISEYFPLEATITGMLEIYETLFNLKFIETKDSQNKSVWHDDVK 420
            + L +  +  L   E IS  F L   + G+ +++E ++ +K +       ++ W  DV+
Sbjct: 407 IQALAQRRSSSLDNGESISSSFSLGVVMQGLSDLFEKIYGIKLVPATPKTGET-WSPDVR 465

Query: 421 QIAVWNMDDPKSPNFVGWIYFDLHPRDGKYGHAANFGLSSSFMI----DDTTR------- 469
           +I V +  D      +G +Y DL  R+GK  + A+F +  S  +     DT+        
Sbjct: 466 RIDVVDEHD----GLIGVMYCDLFEREGKTPNPAHFTVCCSRNMYLNEADTSTIQVGVNS 521

Query: 470 -----SYPVTALVCNF-------SKSTKDKPSLLKHNEIVTFFHELGHGIHDLVGQNKES 517
                  PV +LVC+F             +  LL+ NEI T FHE+GH +H ++G+ +  
Sbjct: 522 NGQKFQLPVISLVCDFRWVEVNMGDGKHQQMCLLQLNEIETLFHEMGHAMHSMLGRTQLQ 581

Query: 518 RFNGPGSVPWDFVEAPSQMLEFWTWNKNELINLSSHYKTGEKIP-ESLINSLIKTKHVNG 576
             +G      DFVE PS ++E +  +   L ++SSHYKTG+ +  E L N  ++ + +  
Sbjct: 582 NVSGTRCAT-DFVELPSILMEHFARDTRVLSSISSHYKTGKSLDVEVLKNHQLENQFLQN 640

Query: 577 ALFTLRQLHFGLFDMKVHTCKDLQNLSI--CDTWNQLRQDISLISNGGTLSKGYDSFGHI 634
              T  Q+     D ++H      + SI     +++L + ++++ +  +   G   FGH+
Sbjct: 641 CE-TFSQIKMSFLDQELHNLDHTTDGSIDVIAIYHRLERRLAVLPDDQSNWCG--KFGHL 697

Query: 635 MSDSYSAGYYGYLWAEVFATDMYHTKFAKDPLNAKNGIQYRDIVLARGGLYD 686
               Y A YY YL+    A+ ++   F +DP N  NG ++++ +L  GG  D
Sbjct: 698 F--GYGASYYSYLFDRAIASKIWDHLFEQDPFNRTNGTKFKEGLLQWGGSRD 747

>Kwal_23.4370 s23 complement(689686..691764) [2079 bp, 692 aa] {ON}
           YHR178W (STB5) - Zinc finger (6-Cys) [contig 1] FULL
          Length = 692

 Score = 33.5 bits (75), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 20/80 (25%), Positives = 35/80 (43%), Gaps = 4/80 (5%)

Query: 32  SFPIAPQAPPNWSFTPSDISGKTNEIINNSNNFYDSMSKVESPSVSNFVEPFMKFENELG 91
           S PI   A    + T     G+T  ++    NF      +E P    F+  + K  +   
Sbjct: 214 SIPIRASAIQIETVTSVFKGGRTTSMLTPEGNF----KHIERPLYDRFIAAYFKHNHRSY 269

Query: 92  PIINQLTFLQHVSSDKEIRD 111
           P+IN++ FL  VS+ ++  +
Sbjct: 270 PLINKIEFLNKVSTIRQFEE 289

>Kpol_1032.42 s1032 (94902..97223) [2322 bp, 773 aa] {ON}
           (94902..97223) [2322 nt, 774 aa]
          Length = 773

 Score = 32.3 bits (72), Expect = 5.5,   Method: Compositional matrix adjust.
 Identities = 25/82 (30%), Positives = 42/82 (51%), Gaps = 9/82 (10%)

Query: 49  DISGKTNEIINNSNNFYDSMSKVESPSVSNFVEPFMKFENELGPIINQLTFLQHVSSDKE 108
           DIS  TNE IN++N  +    KV    +   +  F+++   L PI+ +   L+H +S   
Sbjct: 105 DISKDTNEFINDTNQLHGEYIKV--SKLHEAIPEFLQYFESLDPIMRR---LKHATSANI 159

Query: 109 IRDASVNSSMKLDELNIDLSLR 130
           +R  S  + M    +NI+ SL+
Sbjct: 160 VRKDSFKTLM----VNIEQSLQ 177

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.317    0.134    0.397 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 84,270,862
Number of extensions: 4136594
Number of successful extensions: 15840
Number of sequences better than 10.0: 205
Number of HSP's gapped: 16411
Number of HSP's successfully gapped: 211
Length of query: 712
Length of database: 53,481,399
Length adjustment: 117
Effective length of query: 595
Effective length of database: 40,065,477
Effective search space: 23838958815
Effective search space used: 23838958815
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 69 (31.2 bits)