Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
YCL057C-A (MOS1)1.8ON97974962e-66
Smik_3.171.8ON97974755e-63
Skud_3.61.8ON97974531e-59
Suva_3.1551.8ON97974531e-59
TPHA0E039801.8ON86973132e-38
TBLA0A049601.8ON96973081e-37
CAGL0B00396g1.8ON88743036e-37
SAKL0C00528g1.8ON110943031e-36
NCAS0B090801.8ON93903011e-36
Kpol_2002.111.8ON86972992e-36
ZYRO0F18414g1.8ON87962992e-36
AFR743W1.8ON82962983e-36
KLLA0C00550g1.8ON82932913e-35
Ecym_10101.8ON82962904e-35
KLTH0F00550g1.8ON82692852e-34
Kwal_33.130161.8ON82792696e-32
KAFR0D001701.8ON90972568e-30
TDEL0C069401.8ON86962532e-29
NDAI0A001701.8ON96992491e-28
KNAG0C002501.8ON94892464e-28
Kpol_221.32.56ON80157650.90
Skud_15.2415.680ON74136641.6
TBLA0A042208.368ON200636641.6
KNAG0J022103.285ON58164631.7
NCAS0A100803.37ON42459613.2
NDAI0E038207.62ON46236596.2
SAKL0H08184gna 1ON59877596.9
TPHA0D033203.504ON90429597.8
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= YCL057C-A
         (97 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

YCL057C-A Chr3 complement(24032..24325) [294 bp, 97 aa] {ON}  MO...   195   2e-66
Smik_3.17 Chr3 complement(25487..25777) [291 bp, 97 aa] {ON} YCL...   187   5e-63
Skud_3.6 Chr3 complement(12034..12324) [291 bp, 97 aa] {ON} YCL0...   179   1e-59
Suva_3.155 Chr3 complement(233792..234085) [294 bp, 97 aa] {ON} ...   179   1e-59
TPHA0E03980 Chr5 (837161..837421) [261 bp, 86 aa] {ON} Anc_1.8 Y...   125   2e-38
TBLA0A04960 Chr1 complement(1220183..1220473) [291 bp, 96 aa] {O...   123   1e-37
CAGL0B00396g Chr2 complement(24498..24764) [267 bp, 88 aa] {ON} ...   121   6e-37
SAKL0C00528g Chr3 complement(47403..47735) [333 bp, 110 aa] {ON}...   121   1e-36
NCAS0B09080 Chr2 (1744147..1744428) [282 bp, 93 aa] {ON} Anc_1.8...   120   1e-36
Kpol_2002.11 s2002 complement(19864..20124) [261 bp, 86 aa] {ON}...   119   2e-36
ZYRO0F18414g Chr6 (1521776..1522039) [264 bp, 87 aa] {ON} simila...   119   2e-36
AFR743W Chr6 (1800868..1801116) [249 bp, 82 aa] {ON} Syntenic ho...   119   3e-36
KLLA0C00550g Chr3 complement(40901..41149) [249 bp, 82 aa] {ON} ...   116   3e-35
Ecym_1010 Chr1 complement(19126..19374) [249 bp, 82 aa] {ON} sim...   116   4e-35
KLTH0F00550g Chr6 complement(42092..42340) [249 bp, 82 aa] {ON} ...   114   2e-34
Kwal_33.13016 s33 complement(41816..42064) [249 bp, 82 aa] {ON} ...   108   6e-32
KAFR0D00170 Chr4 complement(18220..18492) [273 bp, 90 aa] {ON} A...   103   8e-30
TDEL0C06940 Chr3 (1261913..1262173) [261 bp, 86 aa] {ON} Anc_1.8...   102   2e-29
NDAI0A00170 Chr1 complement(13975..14265) [291 bp, 96 aa] {ON} A...   100   1e-28
KNAG0C00250 Chr3 complement(38677..38961) [285 bp, 94 aa] {ON} A...    99   4e-28
Kpol_221.3 s221 complement(4113..6518) [2406 bp, 801 aa] {ON} co...    30   0.90 
Skud_15.241 Chr15 complement(425796..428021) [2226 bp, 741 aa] {...    29   1.6  
TBLA0A04220 Chr1 complement(1042262..1048282) [6021 bp, 2006 aa]...    29   1.6  
KNAG0J02210 Chr10 complement(409847..411592) [1746 bp, 581 aa] {...    29   1.7  
NCAS0A10080 Chr1 complement(2016171..2017445) [1275 bp, 424 aa] ...    28   3.2  
NDAI0E03820 Chr5 (835913..837301) [1389 bp, 462 aa] {ON} Anc_7.6...    27   6.2  
SAKL0H08184g Chr8 (704748..706544) [1797 bp, 598 aa] {ON} simila...    27   6.9  
TPHA0D03320 Chr4 (686270..688984) [2715 bp, 904 aa] {ON} Anc_3.5...    27   7.8  

>YCL057C-A Chr3 complement(24032..24325) [294 bp, 97 aa] {ON}
          MOS1Mitochondrial protein essential for proper inner
          membrane organization; conserved component of the
          mitochondrial inner membrane organizing system (MICOS,
          MINOS, or MitOS), a scaffold-like structure on the
          intermembrane space side of the inner membrane which
          has a role in the maintenance of crista junctions and
          inner membrane architecture; ortholog of human MINOS1
          Length = 97

 Score =  195 bits (496), Expect = 2e-66,   Method: Compositional matrix adjust.
 Identities = 97/97 (100%), Positives = 97/97 (100%)

Query: 1  MSEQAQTQQPAKSTPSKDSNKNGSSVSTILDTKWDIVLSNMLVKTAMGFGVGVFTSVLFF 60
          MSEQAQTQQPAKSTPSKDSNKNGSSVSTILDTKWDIVLSNMLVKTAMGFGVGVFTSVLFF
Sbjct: 1  MSEQAQTQQPAKSTPSKDSNKNGSSVSTILDTKWDIVLSNMLVKTAMGFGVGVFTSVLFF 60

Query: 61 KRRAFPVWLGIGFGVGRGYAEGDAIFRSSAGLRSSKV 97
          KRRAFPVWLGIGFGVGRGYAEGDAIFRSSAGLRSSKV
Sbjct: 61 KRRAFPVWLGIGFGVGRGYAEGDAIFRSSAGLRSSKV 97

>Smik_3.17 Chr3 complement(25487..25777) [291 bp, 97 aa] {ON}
          YCL057C-A (REAL)
          Length = 97

 Score =  187 bits (475), Expect = 5e-63,   Method: Compositional matrix adjust.
 Identities = 92/97 (94%), Positives = 94/97 (96%)

Query: 1  MSEQAQTQQPAKSTPSKDSNKNGSSVSTILDTKWDIVLSNMLVKTAMGFGVGVFTSVLFF 60
          MSEQAQ QQPAK TPSKDS+KNGS VST+LDTKWDIVLSNMLVKTAMGFGVGVFTSVLFF
Sbjct: 1  MSEQAQAQQPAKVTPSKDSSKNGSGVSTVLDTKWDIVLSNMLVKTAMGFGVGVFTSVLFF 60

Query: 61 KRRAFPVWLGIGFGVGRGYAEGDAIFRSSAGLRSSKV 97
          KRRAFPVWLGIGFGVGRGYAEGDAIFRSSAGLRSSKV
Sbjct: 61 KRRAFPVWLGIGFGVGRGYAEGDAIFRSSAGLRSSKV 97

>Skud_3.6 Chr3 complement(12034..12324) [291 bp, 97 aa] {ON}
          YCL057C-A (REAL)
          Length = 97

 Score =  179 bits (453), Expect = 1e-59,   Method: Compositional matrix adjust.
 Identities = 88/97 (90%), Positives = 92/97 (94%)

Query: 1  MSEQAQTQQPAKSTPSKDSNKNGSSVSTILDTKWDIVLSNMLVKTAMGFGVGVFTSVLFF 60
          MSEQA+ Q+PAKST S DS KNGS+VSTILD KWDIV+SNMLVKTAMGFGVGVFTSVLFF
Sbjct: 1  MSEQAKLQEPAKSTSSNDSIKNGSAVSTILDAKWDIVMSNMLVKTAMGFGVGVFTSVLFF 60

Query: 61 KRRAFPVWLGIGFGVGRGYAEGDAIFRSSAGLRSSKV 97
          KRRAFPVWLGIGFGVGRGYAEGDAIFRSSAGLRSSKV
Sbjct: 61 KRRAFPVWLGIGFGVGRGYAEGDAIFRSSAGLRSSKV 97

>Suva_3.155 Chr3 complement(233792..234085) [294 bp, 97 aa] {ON}
          YCL057C-A (REAL)
          Length = 97

 Score =  179 bits (453), Expect = 1e-59,   Method: Compositional matrix adjust.
 Identities = 86/97 (88%), Positives = 91/97 (93%)

Query: 1  MSEQAQTQQPAKSTPSKDSNKNGSSVSTILDTKWDIVLSNMLVKTAMGFGVGVFTSVLFF 60
          MSEQAQ   PAKSTPS +SN+NGS+VST+LD KWDIVLSNMLVKTAMGFG+GVFTSVLFF
Sbjct: 1  MSEQAQAPAPAKSTPSTNSNENGSAVSTVLDAKWDIVLSNMLVKTAMGFGIGVFTSVLFF 60

Query: 61 KRRAFPVWLGIGFGVGRGYAEGDAIFRSSAGLRSSKV 97
          KRRAFP WLGIGFGVGRGYAEGDAIFRSSAGLRSSKV
Sbjct: 61 KRRAFPAWLGIGFGVGRGYAEGDAIFRSSAGLRSSKV 97

>TPHA0E03980 Chr5 (837161..837421) [261 bp, 86 aa] {ON} Anc_1.8
          YCL057C-A
          Length = 86

 Score =  125 bits (313), Expect = 2e-38,   Method: Compositional matrix adjust.
 Identities = 60/97 (61%), Positives = 73/97 (75%), Gaps = 11/97 (11%)

Query: 1  MSEQAQTQQPAKSTPSKDSNKNGSSVSTILDTKWDIVLSNMLVKTAMGFGVGVFTSVLFF 60
          MSEQ        ++P            +IL+ KWD+VLSNMLVKT +GFGVGV TS+L F
Sbjct: 1  MSEQKNNNNLELTSPK-----------SILNDKWDVVLSNMLVKTGLGFGVGVVTSILLF 49

Query: 61 KRRAFPVWLGIGFGVGRGYAEGDAIFRSSAGLRSSKV 97
          KRRAFPVWLGIGFGVGRGY++GDAIFRS+AGLRS+++
Sbjct: 50 KRRAFPVWLGIGFGVGRGYSDGDAIFRSAAGLRSTRI 86

>TBLA0A04960 Chr1 complement(1220183..1220473) [291 bp, 96 aa]
          {ON} Anc_1.8 YCL057C-A
          Length = 96

 Score =  123 bits (308), Expect = 1e-37,   Method: Compositional matrix adjust.
 Identities = 62/97 (63%), Positives = 76/97 (78%), Gaps = 1/97 (1%)

Query: 1  MSEQAQTQQPAKSTPSKDSNKNGSSVSTILDTKWDIVLSNMLVKTAMGFGVGVFTSVLFF 60
          MSEQ   QQ    T ++ ++   +S  +IL+ KWDIV+SNMLVKT  GFG GV  SV+FF
Sbjct: 1  MSEQI-AQQTTTPTTTESASTAVTSNRSILNDKWDIVISNMLVKTTFGFGAGVLASVIFF 59

Query: 61 KRRAFPVWLGIGFGVGRGYAEGDAIFRSSAGLRSSKV 97
          KRRAFPVWLG+GFG+GRGY+EGDAIFRS+AGLRS +V
Sbjct: 60 KRRAFPVWLGVGFGLGRGYSEGDAIFRSTAGLRSFQV 96

>CAGL0B00396g Chr2 complement(24498..24764) [267 bp, 88 aa] {ON}
          highly similar to uniprot|Q96VH5 Saccharomyces
          cerevisiae YCL057ca
          Length = 88

 Score =  121 bits (303), Expect = 6e-37,   Method: Compositional matrix adjust.
 Identities = 56/74 (75%), Positives = 66/74 (89%)

Query: 24 SSVSTILDTKWDIVLSNMLVKTAMGFGVGVFTSVLFFKRRAFPVWLGIGFGVGRGYAEGD 83
          + V +IL+ KWD+VLSNM+VK  +GFGVGV TSVLFFKRR+FPVWLG+GFG GRGY+EGD
Sbjct: 15 TPVRSILNDKWDVVLSNMIVKMGLGFGVGVVTSVLFFKRRSFPVWLGVGFGAGRGYSEGD 74

Query: 84 AIFRSSAGLRSSKV 97
          AIFRS+AGLRS KV
Sbjct: 75 AIFRSTAGLRSVKV 88

>SAKL0C00528g Chr3 complement(47403..47735) [333 bp, 110 aa] {ON}
           similar to uniprot|Q96VH5 Saccharomyces cerevisiae
           YCL057C-A
          Length = 110

 Score =  121 bits (303), Expect = 1e-36,   Method: Compositional matrix adjust.
 Identities = 59/94 (62%), Positives = 69/94 (73%), Gaps = 15/94 (15%)

Query: 1   MSEQAQTQQPAKSTPSKDSNKNGSSVSTILDTKWDIVLSNMLVKTAMGFGVGVFTSVLFF 60
           MSEQ Q  +P KS               IL+ KWD+VLSN++VKT +GFG G+  SVL F
Sbjct: 29  MSEQLQVSKPNKS---------------ILNDKWDVVLSNVVVKTGLGFGAGIVASVLLF 73

Query: 61  KRRAFPVWLGIGFGVGRGYAEGDAIFRSSAGLRS 94
           KRRAFPVWLG+GFG+GRGYAEGDAIFRSSAGLR+
Sbjct: 74  KRRAFPVWLGVGFGLGRGYAEGDAIFRSSAGLRT 107

>NCAS0B09080 Chr2 (1744147..1744428) [282 bp, 93 aa] {ON} Anc_1.8
          YCL057C-A
          Length = 93

 Score =  120 bits (301), Expect = 1e-36,   Method: Compositional matrix adjust.
 Identities = 59/90 (65%), Positives = 70/90 (77%), Gaps = 1/90 (1%)

Query: 8  QQPAKSTPSKDSNKNGSSVSTILDTKWDIVLSNMLVKTAMGFGVGVFTSVLFFKRRAFPV 67
            P +STP+  +    +   +IL+ KWD+VLSNMLVK  +GF VGV  SV+FFKRR FPV
Sbjct: 5  NNPNQSTPTSTA-VTPTIDRSILNDKWDVVLSNMLVKVGLGFSVGVVASVIFFKRRTFPV 63

Query: 68 WLGIGFGVGRGYAEGDAIFRSSAGLRSSKV 97
          WLGIGFGVGRGYAEGDAIFRS AGLR++KV
Sbjct: 64 WLGIGFGVGRGYAEGDAIFRSPAGLRTAKV 93

>Kpol_2002.11 s2002 complement(19864..20124) [261 bp, 86 aa] {ON}
          complement(19864..20124) [261 nt, 87 aa]
          Length = 86

 Score =  119 bits (299), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 60/97 (61%), Positives = 73/97 (75%), Gaps = 11/97 (11%)

Query: 1  MSEQAQTQQPAKSTPSKDSNKNGSSVSTILDTKWDIVLSNMLVKTAMGFGVGVFTSVLFF 60
          MS+Q+Q  Q   S P++          +IL+ KWD+VLSN LVKT++GFG GV  SV+ F
Sbjct: 1  MSQQSQELQ-ITSAPTR----------SILNDKWDVVLSNFLVKTSLGFGAGVLASVILF 49

Query: 61 KRRAFPVWLGIGFGVGRGYAEGDAIFRSSAGLRSSKV 97
          KRRAFPVWLGIGFG+GRGY+EGDAIFRS+AGLR S V
Sbjct: 50 KRRAFPVWLGIGFGIGRGYSEGDAIFRSAAGLRKSTV 86

>ZYRO0F18414g Chr6 (1521776..1522039) [264 bp, 87 aa] {ON} similar
          to uniprot|Q96VH5 Saccharomyces cerevisiae YCL057C-A
          Length = 87

 Score =  119 bits (299), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 62/96 (64%), Positives = 74/96 (77%), Gaps = 10/96 (10%)

Query: 1  MSEQAQTQQPAKSTPSKDSNKNGSSVSTILDTKWDIVLSNMLVKTAMGFGVGVFTSVLFF 60
          M+EQ Q  Q   + P+K          +IL+ KWD+VLSN+LVK+ +GFGVGV  SVL F
Sbjct: 1  MAEQQQQAQLQVTAPNK----------SILNDKWDVVLSNLLVKSGLGFGVGVVASVLIF 50

Query: 61 KRRAFPVWLGIGFGVGRGYAEGDAIFRSSAGLRSSK 96
          KRRAFPVWLGIGFG+GRGYAEGDAIFRS+AGLR+SK
Sbjct: 51 KRRAFPVWLGIGFGLGRGYAEGDAIFRSAAGLRTSK 86

>AFR743W Chr6 (1800868..1801116) [249 bp, 82 aa] {ON} Syntenic
          homolog of Saccharomyces cerevisiae YCL057C-A
          Length = 82

 Score =  119 bits (298), Expect = 3e-36,   Method: Compositional matrix adjust.
 Identities = 58/96 (60%), Positives = 70/96 (72%), Gaps = 15/96 (15%)

Query: 1  MSEQAQTQQPAKSTPSKDSNKNGSSVSTILDTKWDIVLSNMLVKTAMGFGVGVFTSVLFF 60
          MS Q +   P++S               IL+ KWD+VLSN++VKT +GFG GVF SVLFF
Sbjct: 1  MSGQLEVSAPSRS---------------ILNDKWDVVLSNLVVKTGLGFGAGVFASVLFF 45

Query: 61 KRRAFPVWLGIGFGVGRGYAEGDAIFRSSAGLRSSK 96
          KRRAFPVWLG+GFG+GRGYAEGDAIFRS AGLR+ +
Sbjct: 46 KRRAFPVWLGVGFGLGRGYAEGDAIFRSHAGLRAVR 81

>KLLA0C00550g Chr3 complement(40901..41149) [249 bp, 82 aa] {ON}
          similar to uniprot|Q96VH5 Saccharomyces cerevisiae
          YCL057C-A
          Length = 82

 Score =  116 bits (291), Expect = 3e-35,   Method: Compositional matrix adjust.
 Identities = 58/93 (62%), Positives = 70/93 (75%), Gaps = 15/93 (16%)

Query: 1  MSEQAQTQQPAKSTPSKDSNKNGSSVSTILDTKWDIVLSNMLVKTAMGFGVGVFTSVLFF 60
          MSEQ QT    K+ PS            ILD +WD+VLSN++ KTA+G GVG+  SVLFF
Sbjct: 1  MSEQVQT---TKAVPS------------ILDKRWDVVLSNVVAKTALGAGVGIVASVLFF 45

Query: 61 KRRAFPVWLGIGFGVGRGYAEGDAIFRSSAGLR 93
          KRRAFPVW+G+GFG+GRGYAEGDAIFR++AGLR
Sbjct: 46 KRRAFPVWVGVGFGLGRGYAEGDAIFRTNAGLR 78

>Ecym_1010 Chr1 complement(19126..19374) [249 bp, 82 aa] {ON}
          similar to Ashbya gossypii AFR743W
          Length = 82

 Score =  116 bits (290), Expect = 4e-35,   Method: Compositional matrix adjust.
 Identities = 57/96 (59%), Positives = 68/96 (70%), Gaps = 15/96 (15%)

Query: 1  MSEQAQTQQPAKSTPSKDSNKNGSSVSTILDTKWDIVLSNMLVKTAMGFGVGVFTSVLFF 60
          M E+ +   P++S               IL+ KWD+VLSN++VK  +GF VGV  SVLFF
Sbjct: 1  MGEKLEVAAPSRS---------------ILNDKWDVVLSNLVVKAGLGFSVGVLASVLFF 45

Query: 61 KRRAFPVWLGIGFGVGRGYAEGDAIFRSSAGLRSSK 96
          KRRAFPVWLGIGFG+GRGYAEGDAIFRS AGLR+ K
Sbjct: 46 KRRAFPVWLGIGFGLGRGYAEGDAIFRSHAGLRTMK 81

>KLTH0F00550g Chr6 complement(42092..42340) [249 bp, 82 aa] {ON}
          similar to uniprot|Q96VH5 Saccharomyces cerevisiae
          YCL057C-A
          Length = 82

 Score =  114 bits (285), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 51/69 (73%), Positives = 62/69 (89%)

Query: 28 TILDTKWDIVLSNMLVKTAMGFGVGVFTSVLFFKRRAFPVWLGIGFGVGRGYAEGDAIFR 87
          ++L+ KWD+VLSN++VKT +GFG GV  SVL FKRRAFPVW+G+GFG+GRGYAEGDAIFR
Sbjct: 13 SLLNDKWDVVLSNLVVKTGLGFGAGVVASVLLFKRRAFPVWIGVGFGLGRGYAEGDAIFR 72

Query: 88 SSAGLRSSK 96
          SSAGLR+ K
Sbjct: 73 SSAGLRTVK 81

>Kwal_33.13016 s33 complement(41816..42064) [249 bp, 82 aa] {ON}
          YCL057C-A - Hypothetical ORF, has similarity to
          proteins in S. pombe, C. elegans, D. melanogaster.
          [contig 123] FULL
          Length = 82

 Score =  108 bits (269), Expect = 6e-32,   Method: Compositional matrix adjust.
 Identities = 50/79 (63%), Positives = 62/79 (78%)

Query: 18 DSNKNGSSVSTILDTKWDIVLSNMLVKTAMGFGVGVFTSVLFFKRRAFPVWLGIGFGVGR 77
          D  K      ++L+ KWD+VLSN++VK  +GFG GV  SVL FKRRA PVW+G+GFG+GR
Sbjct: 3  DQAKIAPVSRSLLNDKWDVVLSNLVVKVGLGFGAGVVASVLLFKRRAAPVWIGVGFGLGR 62

Query: 78 GYAEGDAIFRSSAGLRSSK 96
          GY+EGDAIFRSSAGLR+ K
Sbjct: 63 GYSEGDAIFRSSAGLRTVK 81

>KAFR0D00170 Chr4 complement(18220..18492) [273 bp, 90 aa] {ON}
          Anc_1.8 YCL057C-A
          Length = 90

 Score =  103 bits (256), Expect = 8e-30,   Method: Compositional matrix adjust.
 Identities = 60/97 (61%), Positives = 75/97 (77%), Gaps = 7/97 (7%)

Query: 1  MSEQAQTQQPAKSTPSKDSNKNGSSVSTILDTKWDIVLSNMLVKTAMGFGVGVFTSVLFF 60
          MSE+ +  +PA+ +       N S   +IL+ KWD+VLSNMLVK  +GFGVGV TSV+FF
Sbjct: 1  MSEEDKVGKPAEYS-------NNSIDRSILNDKWDLVLSNMLVKVGLGFGVGVVTSVIFF 53

Query: 61 KRRAFPVWLGIGFGVGRGYAEGDAIFRSSAGLRSSKV 97
          KRRAFPVWLGIG+G GR Y+EGDAIFRS+AGLRS ++
Sbjct: 54 KRRAFPVWLGIGYGFGRAYSEGDAIFRSNAGLRSVQI 90

>TDEL0C06940 Chr3 (1261913..1262173) [261 bp, 86 aa] {ON} Anc_1.8
          YCL057C-A
          Length = 86

 Score =  102 bits (253), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 65/96 (67%), Positives = 75/96 (78%), Gaps = 11/96 (11%)

Query: 1  MSEQAQTQQPAKSTPSKDSNKNGSSVSTILDTKWDIVLSNMLVKTAMGFGVGVFTSVLFF 60
          MSE++Q Q    + PS+          +IL+ KWD+VLSNMLVKT +GFGVGV  SVLFF
Sbjct: 1  MSEKSQAQLQV-AAPSR----------SILNDKWDVVLSNMLVKTGLGFGVGVVGSVLFF 49

Query: 61 KRRAFPVWLGIGFGVGRGYAEGDAIFRSSAGLRSSK 96
          KRRAFPVWLGIGFG+GRGYAEGDAIFRS+AGLRS K
Sbjct: 50 KRRAFPVWLGIGFGLGRGYAEGDAIFRSAAGLRSVK 85

>NDAI0A00170 Chr1 complement(13975..14265) [291 bp, 96 aa] {ON}
          Anc_1.8 YCL057C-A
          Length = 96

 Score =  100 bits (249), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 63/99 (63%), Positives = 72/99 (72%), Gaps = 5/99 (5%)

Query: 1  MSEQAQ--TQQPAKSTPSKDSNKNGSSVSTILDTKWDIVLSNMLVKTAMGFGVGVFTSVL 58
          MSEQ      Q A + P +   +  +   +IL+ KWDIVLSN LVK  +GFGVGV TSV+
Sbjct: 1  MSEQVNKTEHQNAVAPPQQ---QLATIDKSILNDKWDIVLSNTLVKVGLGFGVGVVTSVI 57

Query: 59 FFKRRAFPVWLGIGFGVGRGYAEGDAIFRSSAGLRSSKV 97
          FFKRR FPVWLGIGFG GRGYAEGDAIFRSSAG+RS  V
Sbjct: 58 FFKRRTFPVWLGIGFGAGRGYAEGDAIFRSSAGIRSVNV 96

>KNAG0C00250 Chr3 complement(38677..38961) [285 bp, 94 aa] {ON}
          Anc_1.8 YCL057C-A
          Length = 94

 Score = 99.4 bits (246), Expect = 4e-28,   Method: Compositional matrix adjust.
 Identities = 59/89 (66%), Positives = 69/89 (77%), Gaps = 4/89 (4%)

Query: 13 STPSKDSNKNGSSVSTI----LDTKWDIVLSNMLVKTAMGFGVGVFTSVLFFKRRAFPVW 68
          +T     N NG   + I    L+ KWD+VLSNMLVK  MGFGVGV TSVL F+RRAFPVW
Sbjct: 6  ATDGATQNNNGQLATKIDRSLLNDKWDVVLSNMLVKVGMGFGVGVVTSVLLFRRRAFPVW 65

Query: 69 LGIGFGVGRGYAEGDAIFRSSAGLRSSKV 97
          LGIGFGVGRGY+EGDAIFRS++G+R+ KV
Sbjct: 66 LGIGFGVGRGYSEGDAIFRSTSGIRTVKV 94

>Kpol_221.3 s221 complement(4113..6518) [2406 bp, 801 aa] {ON}
           complement(4113..6518) [2406 nt, 802 aa]
          Length = 801

 Score = 29.6 bits (65), Expect = 0.90,   Method: Composition-based stats.
 Identities = 18/57 (31%), Positives = 32/57 (56%), Gaps = 4/57 (7%)

Query: 9   QPAKSTPSKDSNKNGSSVSTILDTKWDIVLSNMLVKTAMGFGVGVFTSVLFFKRRAF 65
           +P +STP+K+  KN S +  ++  K D+VL+   +K     G+ V  S   F+ ++F
Sbjct: 388 KPQQSTPNKNDRKNPSRIDPLIQFK-DLVLNESEIKYVTMMGLLVSCS---FEHKSF 440

>Skud_15.241 Chr15 complement(425796..428021) [2226 bp, 741 aa] {ON}
           YOR076C (REAL)
          Length = 741

 Score = 29.3 bits (64), Expect = 1.6,   Method: Composition-based stats.
 Identities = 14/36 (38%), Positives = 19/36 (52%), Gaps = 8/36 (22%)

Query: 2   SEQAQTQQPAKSTPSKDSNKNGSSVSTILDTKWDIV 37
           SE A++Q PAK  P        S+V T L   WD++
Sbjct: 101 SESAESQSPAKGRP--------SNVDTNLQDSWDVI 128

>TBLA0A04220 Chr1 complement(1042262..1048282) [6021 bp, 2006 aa]
           {ON} Anc_8.368 YDR170C
          Length = 2006

 Score = 29.3 bits (64), Expect = 1.6,   Method: Composition-based stats.
 Identities = 14/36 (38%), Positives = 20/36 (55%)

Query: 2   SEQAQTQQPAKSTPSKDSNKNGSSVSTILDTKWDIV 37
           S+Q Q QQP    P K +    S++S I DT  D++
Sbjct: 206 SKQQQKQQPVIDKPKKQTPNLTSNISLIKDTLTDLL 241

>KNAG0J02210 Chr10 complement(409847..411592) [1746 bp, 581 aa] {ON}
           
          Length = 581

 Score = 28.9 bits (63), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 23/64 (35%), Positives = 30/64 (46%), Gaps = 5/64 (7%)

Query: 23  GSSVSTILDTKWDIVLSNMLVKTAMGF---GVGVFTSVLFFKRRAFPVWLGIGFGVGRGY 79
           G ++S +   +W IVL   LV  AM      VGV   V  F   +F V + I  G  RGY
Sbjct: 167 GFAISFLYTIQWMIVLPLQLVTAAMTIQFWNVGVNLDV--FVLASFVVVVLINLGGARGY 224

Query: 80  AEGD 83
            E +
Sbjct: 225 VEAE 228

>NCAS0A10080 Chr1 complement(2016171..2017445) [1275 bp, 424 aa]
           {ON} Anc_3.37 YNL309W
          Length = 424

 Score = 28.1 bits (61), Expect = 3.2,   Method: Compositional matrix adjust.
 Identities = 19/59 (32%), Positives = 29/59 (49%), Gaps = 7/59 (11%)

Query: 9   QPAKSTPSKDSNKNGSSVSTILDTKWDIVLSNMLVKTAMGFGVGVFTSVLFFKRRAFPV 67
           Q   +TPS+D+N NGS       T+  I  ++ L+KT   F +G +   LF      P+
Sbjct: 323 QQVPTTPSRDNNNNGSG------TQTGITSNHTLLKTP-NFNMGDYIHNLFSPSPRVPL 374

>NDAI0E03820 Chr5 (835913..837301) [1389 bp, 462 aa] {ON} Anc_7.62
           YOR334W
          Length = 462

 Score = 27.3 bits (59), Expect = 6.2,   Method: Composition-based stats.
 Identities = 12/36 (33%), Positives = 23/36 (63%)

Query: 23  GSSVSTILDTKWDIVLSNMLVKTAMGFGVGVFTSVL 58
           G +V+T+L   + + L N + ++ +GFG  VF S++
Sbjct: 330 GFTVATLLPAFYGMNLKNFIEESYLGFGAVVFLSIV 365

>SAKL0H08184g Chr8 (704748..706544) [1797 bp, 598 aa] {ON} similar
           to uniprot|P48813 Saccharomyces cerevisiae YDR508C GNP1
           High-affinity glutamine permease also transports Leu Ser
           Thr Cys Met and Asn expression is fully dependent on
           Grr1p and modulated by the Ssy1p-Ptr3p-Ssy5p (SPS)
           sensor of extracellular amino acids
          Length = 598

 Score = 27.3 bits (59), Expect = 6.9,   Method: Compositional matrix adjust.
 Identities = 21/77 (27%), Positives = 34/77 (44%), Gaps = 13/77 (16%)

Query: 23  GSSVSTILDTKWDIVLSNMLVKTAM-------GFGVGVFTSVLFFKRRAFPVWLGIGFGV 75
           G +V+ +   +W IVL   LV  +M            +F ++ +       + LGI F  
Sbjct: 153 GFTVAWLFCLQWQIVLPLELVTASMTIKYWNNSLNPSIFVAIFY------SLILGISFFG 206

Query: 76  GRGYAEGDAIFRSSAGL 92
            RGYA+ + +F  S  L
Sbjct: 207 ARGYADAEFLFNLSKVL 223

>TPHA0D03320 Chr4 (686270..688984) [2715 bp, 904 aa] {ON} Anc_3.504
           YGR140W
          Length = 904

 Score = 27.3 bits (59), Expect = 7.8,   Method: Composition-based stats.
 Identities = 12/29 (41%), Positives = 18/29 (62%)

Query: 16  SKDSNKNGSSVSTILDTKWDIVLSNMLVK 44
           SKDSN N   ++T  D K +++  N+ VK
Sbjct: 74  SKDSNDNNDKITTTNDDKENLIAENIGVK 102

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.317    0.132    0.381 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 9,266,338
Number of extensions: 312092
Number of successful extensions: 1237
Number of sequences better than 10.0: 34
Number of HSP's gapped: 1237
Number of HSP's successfully gapped: 34
Length of query: 97
Length of database: 53,481,399
Length adjustment: 68
Effective length of query: 29
Effective length of database: 45,684,111
Effective search space: 1324839219
Effective search space used: 1324839219
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 59 (27.3 bits)