Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
YCL056C (PEX34)1.10ON1441447341e-101
Smik_3.191.10ON1441446234e-84
Skud_3.81.10ON1441446088e-82
Suva_3.1571.10ON1441445949e-80
KAFR0D001901.10ON1851651083e-06
TDEL0C069301.10ON184159971e-04
KLLA0C00594g1.10ON194134926e-04
KNAG0C002701.10ON174166830.007
SAKL0C00572g1.10ON338162790.041
ZYRO0F18370g1.10ON220124652.0
NCAS0B090601.10ON167152642.6
Kwal_33.130231.10ON193134643.0
ZYRO0F17776g1.37ON46840644.2
TBLA0C040504.113ON120734635.2
CAGL0A02596g5.414ON87231618.7
NOTE: 6 genes in the same pillar as YCL056C were not hit in these BLAST results
LIST: Kpol_2002.13 TBLA0A04970 KLTH0F00572g Ecym_1012 TPHA0E03960 NDAI0A00190

BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= YCL056C
         (144 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

YCL056C Chr3 complement(26925..27359) [435 bp, 144 aa] {ON}  PEX...   287   e-101
Smik_3.19 Chr3 complement(28371..28805) [435 bp, 144 aa] {ON} YC...   244   4e-84
Skud_3.8 Chr3 complement(14921..15355) [435 bp, 144 aa] {ON} YCL...   238   8e-82
Suva_3.157 Chr3 complement(236677..237111) [435 bp, 144 aa] {ON}...   233   9e-80
KAFR0D00190 Chr4 complement(21149..21706) [558 bp, 185 aa] {ON} ...    46   3e-06
TDEL0C06930 Chr3 (1260938..1261492) [555 bp, 184 aa] {ON} Anc_1....    42   1e-04
KLLA0C00594g Chr3 complement(44220..44804) [585 bp, 194 aa] {ON}...    40   6e-04
KNAG0C00270 Chr3 complement(41823..42347) [525 bp, 174 aa] {ON} ...    37   0.007
SAKL0C00572g Chr3 complement(51031..52047) [1017 bp, 338 aa] {ON...    35   0.041
ZYRO0F18370g Chr6 (1518178..1518840) [663 bp, 220 aa] {ON} conse...    30   2.0  
NCAS0B09060 Chr2 (1741161..1741664) [504 bp, 167 aa] {ON} Anc_1....    29   2.6  
Kwal_33.13023 s33 complement(43697..44278) [582 bp, 193 aa] {ON}...    29   3.0  
ZYRO0F17776g Chr6 complement(1471832..1473238) [1407 bp, 468 aa]...    29   4.2  
TBLA0C04050 Chr3 complement(980010..983633) [3624 bp, 1207 aa] {...    29   5.2  
CAGL0A02596g Chr1 (278467..281085) [2619 bp, 872 aa] {ON} simila...    28   8.7  

>YCL056C Chr3 complement(26925..27359) [435 bp, 144 aa] {ON}
           PEX34Peroxisomal integral membrane protein that
           regulates peroxisome populations; interacts with Pex11p,
           Pex25p, and Pex27p to control both constitutive
           peroxisome division and peroxisome morphology and
           abundance during peroxisome proliferation
          Length = 144

 Score =  287 bits (734), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 144/144 (100%), Positives = 144/144 (100%)

Query: 1   MVSKKNTAEISAKDIWENIWSGVSSLLDFFAVLENLGVVNDKLYVSGLLRKVWLCYSCIS 60
           MVSKKNTAEISAKDIWENIWSGVSSLLDFFAVLENLGVVNDKLYVSGLLRKVWLCYSCIS
Sbjct: 1   MVSKKNTAEISAKDIWENIWSGVSSLLDFFAVLENLGVVNDKLYVSGLLRKVWLCYSCIS 60

Query: 61  VIKCVWKLIKLCKVKFKIDQRLDGEGNGLVKDKLINFKKKYNEHIRHITAALLQDLSYLM 120
           VIKCVWKLIKLCKVKFKIDQRLDGEGNGLVKDKLINFKKKYNEHIRHITAALLQDLSYLM
Sbjct: 61  VIKCVWKLIKLCKVKFKIDQRLDGEGNGLVKDKLINFKKKYNEHIRHITAALLQDLSYLM 120

Query: 121 VLIYPGTRLFKRLSNIITLCRIIV 144
           VLIYPGTRLFKRLSNIITLCRIIV
Sbjct: 121 VLIYPGTRLFKRLSNIITLCRIIV 144

>Smik_3.19 Chr3 complement(28371..28805) [435 bp, 144 aa] {ON}
           YCL056C (REAL)
          Length = 144

 Score =  244 bits (623), Expect = 4e-84,   Method: Compositional matrix adjust.
 Identities = 119/144 (82%), Positives = 134/144 (93%)

Query: 1   MVSKKNTAEISAKDIWENIWSGVSSLLDFFAVLENLGVVNDKLYVSGLLRKVWLCYSCIS 60
           MVS+K +AE+S K++W N+W+GVSSLLDFFAVLENLGVV+DKLYVSG+LRKVWLCYS IS
Sbjct: 1   MVSEKKSAEVSGKNLWINVWNGVSSLLDFFAVLENLGVVDDKLYVSGVLRKVWLCYSWIS 60

Query: 61  VIKCVWKLIKLCKVKFKIDQRLDGEGNGLVKDKLINFKKKYNEHIRHITAALLQDLSYLM 120
           VIKCVWKLI LCKVKFKIDQRL+G GNGLVK+KL+NFKK+Y + IR ITA LLQDLSYLM
Sbjct: 61  VIKCVWKLINLCKVKFKIDQRLNGPGNGLVKEKLMNFKKRYRDQIRQITATLLQDLSYLM 120

Query: 121 VLIYPGTRLFKRLSNIITLCRIIV 144
           VLIYPGTRLFKRLSNIITLCRII+
Sbjct: 121 VLIYPGTRLFKRLSNIITLCRIII 144

>Skud_3.8 Chr3 complement(14921..15355) [435 bp, 144 aa] {ON}
           YCL056C (REAL)
          Length = 144

 Score =  238 bits (608), Expect = 8e-82,   Method: Compositional matrix adjust.
 Identities = 112/144 (77%), Positives = 132/144 (91%)

Query: 1   MVSKKNTAEISAKDIWENIWSGVSSLLDFFAVLENLGVVNDKLYVSGLLRKVWLCYSCIS 60
           MV KK+TAEI  KDIW NIW+  SSLLDFFAVLENLGVV+DKLY+SG+LRKVWLCYS +S
Sbjct: 1   MVPKKSTAEIGGKDIWTNIWNSASSLLDFFAVLENLGVVDDKLYLSGILRKVWLCYSWVS 60

Query: 61  VIKCVWKLIKLCKVKFKIDQRLDGEGNGLVKDKLINFKKKYNEHIRHITAALLQDLSYLM 120
           V++C+WKLIKLCKVKFKID+RL+G+GNGL+K+KL+NF+K YN+ IR I A LLQDLSYLM
Sbjct: 61  VVRCIWKLIKLCKVKFKIDERLNGQGNGLIKEKLVNFRKMYNDQIRQIIANLLQDLSYLM 120

Query: 121 VLIYPGTRLFKRLSNIITLCRIIV 144
           VLIYPGTRLF+RLSNI+TLCRII+
Sbjct: 121 VLIYPGTRLFRRLSNIMTLCRIII 144

>Suva_3.157 Chr3 complement(236677..237111) [435 bp, 144 aa] {ON}
           YCL056C (REAL)
          Length = 144

 Score =  233 bits (594), Expect = 9e-80,   Method: Compositional matrix adjust.
 Identities = 110/144 (76%), Positives = 130/144 (90%)

Query: 1   MVSKKNTAEISAKDIWENIWSGVSSLLDFFAVLENLGVVNDKLYVSGLLRKVWLCYSCIS 60
           MV K+N  EI  +D W  +W+GVSSLLDFFAVLENLGVV+DKLY+SG+LRKVWLCYS IS
Sbjct: 1   MVPKENAGEIGGRDPWTKVWNGVSSLLDFFAVLENLGVVDDKLYLSGILRKVWLCYSWIS 60

Query: 61  VIKCVWKLIKLCKVKFKIDQRLDGEGNGLVKDKLINFKKKYNEHIRHITAALLQDLSYLM 120
           V++CVWKLIKLC+VKFKI++RL+G+GNGL+K+KLINF K YN+ I+ ITA LLQDLSYLM
Sbjct: 61  VVRCVWKLIKLCRVKFKINERLNGQGNGLIKEKLINFGKMYNDQIKQITANLLQDLSYLM 120

Query: 121 VLIYPGTRLFKRLSNIITLCRIIV 144
           VLIYPGTRLFKRLSN+ITLCRII+
Sbjct: 121 VLIYPGTRLFKRLSNVITLCRIII 144

>KAFR0D00190 Chr4 complement(21149..21706) [558 bp, 185 aa] {ON}
           Anc_1.10 YCL056C
          Length = 185

 Score = 46.2 bits (108), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 48/165 (29%), Positives = 76/165 (46%), Gaps = 30/165 (18%)

Query: 10  ISAKDIWENIWSGVSSLLDFFAVLENLGVVND------KLYVSGLLRKVWLCYSCISVIK 63
           I+ +DI  +   G+ ++ D    L+NLGV+ +      KL    L  K+WL    +S+ +
Sbjct: 17  ITLEDILIDKLEGICTVFDNIYFLKNLGVIKEDNFIYKKLNKGNLGSKIWLVSLILSIRR 76

Query: 64  CVWKLIKLCKVKFKIDQRL------------DGEGNGLVKDKLINFKKKYNEHIRHITAA 111
           C   L  + + + K    L            +G  NG++KDKL+   +K N  IR +   
Sbjct: 77  CFKNLTHMYRTRRKYVTELSIVSKKRNQSSENGLVNGILKDKLLQSLQKCNSIIRDLLLE 136

Query: 112 LLQDLSYLMVLIYP------------GTRLFKRLSNIITLCRIIV 144
            LQ L YL+++I              G R  + LSN+IT+ RII 
Sbjct: 137 FLQVLLYLIIVIIEVFKVKSLERYVKGIRNLEILSNLITVTRIIT 181

>TDEL0C06930 Chr3 (1260938..1261492) [555 bp, 184 aa] {ON} Anc_1.10
           YCL056C
          Length = 184

 Score = 42.0 bits (97), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 36/159 (22%), Positives = 74/159 (46%), Gaps = 25/159 (15%)

Query: 11  SAKDIWENIWSGVSSLLDFFA---VLENLGVVND------KLYVSGLLRKVWLCYSCISV 61
           S     +N+ +G+ S+  FF      ++LG++ +      +L   G   K+W     +SV
Sbjct: 18  SKTSFEDNLIAGLESVCSFFDNVYFAKSLGIIGENNFLYRRLNKGGWGSKLWFVTLLLSV 77

Query: 62  IKCVWKLIKLCKVKFKIDQRLDG---EGNGLV----KDKLINFKKKYNEHIRHITAALLQ 114
            KC+ ++ ++ + + ++   + G    G GL+    K+K++   +K N  +R     LLQ
Sbjct: 78  RKCLRQIFQIVRNRIRLKTEIKGMDKNGKGLMNDVLKEKILLMLQKSNAMMRETLLDLLQ 137

Query: 115 DLSYLMVLIYP---------GTRLFKRLSNIITLCRIIV 144
           +  YLM+++             ++ + LSN +T+ R   
Sbjct: 138 NSVYLMIVVIDVFKLNIPKRARQILEPLSNFVTIMRFFT 176

>KLLA0C00594g Chr3 complement(44220..44804) [585 bp, 194 aa] {ON}
           conserved hypothetical protein
          Length = 194

 Score = 40.0 bits (92), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 33/134 (24%), Positives = 64/134 (47%), Gaps = 13/134 (9%)

Query: 1   MVSKKNTAEISAKDIWENIWSGVSSLLDFFAVLENLGVVND------KLYVSGLLRKVWL 54
           +++ ++    S +D+  +  + VSS  D   +L + G+++D      KL    +  KVWL
Sbjct: 22  LIANEDAPSNSLEDLLIDSLTSVSSFFDDLYLLRSFGIISDTNFLYQKLNKGDIGSKVWL 81

Query: 55  CYSCISVIKCVWKLIKLCKVKFK-------IDQRLDGEGNGLVKDKLINFKKKYNEHIRH 107
               +S+ + + +L  L ++K K       I          LVK+K++    + +  IR 
Sbjct: 82  VSLLLSIRRSLTRLYTLIRLKLKLRKECMNIASTYSPGFKKLVKEKILAESNQLSLKIRS 141

Query: 108 ITAALLQDLSYLMV 121
           +   LLQDL Y+++
Sbjct: 142 LCMDLLQDLLYMII 155

>KNAG0C00270 Chr3 complement(41823..42347) [525 bp, 174 aa] {ON}
           Anc_1.10 YCL056C
          Length = 174

 Score = 36.6 bits (83), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 44/166 (26%), Positives = 79/166 (47%), Gaps = 26/166 (15%)

Query: 5   KNTAEISAKDIWENIWSGVSSLLDFFAVLENLGVVND------KLYVSGLLRKVWLCYSC 58
           K  A +S +D+       + S+ D   +L++LG+++       KL    +  KVW     
Sbjct: 2   KTAASLSWEDVLLGKLESICSIFDNIYLLKSLGIISKENFLYRKLNKGNVGSKVWFLTLI 61

Query: 59  ISVIKCVWKLIKLCKVKFK----IDQRL------DGEGNGLVKDKLINFKKKYNEHIRHI 108
           +S+ K + +L++L + +FK    I+Q L      D   N +V +KL    +K +  I   
Sbjct: 62  LSIRKNLKRLVRLVQTRFKLVFEIEQILRQKKLDDSLVNNVVLNKLSTNLRKCHFMIIDT 121

Query: 109 TAALLQDLSYLMVL------IYPGTRLFKR----LSNIITLCRIIV 144
              L Q L YL ++      I P  + FK+    +SN++T+ R++V
Sbjct: 122 FLDLAQLLIYLFIVSGDCFNIPPRFKKFKKYLGPMSNVVTILRMLV 167

>SAKL0C00572g Chr3 complement(51031..52047) [1017 bp, 338 aa] {ON}
           conserved hypothetical protein
          Length = 338

 Score = 35.0 bits (79), Expect = 0.041,   Method: Compositional matrix adjust.
 Identities = 33/162 (20%), Positives = 72/162 (44%), Gaps = 22/162 (13%)

Query: 4   KKNTAEISAKDIWENIWSGVSSLLDFFAVLENLGVVNDKLYV------SGLLRKVWLCYS 57
           K      S +DI       ++++ D   +L+N G++ +  +V       GL  K+WL   
Sbjct: 168 KGKQQPASFEDILIGGLESLTNVFDDVYLLKNFGIIGETNFVYRHLNKGGLGSKLWLATL 227

Query: 58  CISVIKCVWKLIKLCKVKFKIDQRLDGEGNG-------LVKDKLINFKKKYNEHIRHITA 110
            +S+ K + +L +L + +  + +      +        ++ DK      + +  I+ +  
Sbjct: 228 VLSLRKSLGQLFRLARARHMLQKERRSTPHKCSKTFAKIIADKFTQKIGQLDRQIKDVLL 287

Query: 111 ALLQDLSYLMV---------LIYPGTRLFKRLSNIITLCRII 143
            +LQ+L+YL+V         L +   RL + +S+++T+ R  
Sbjct: 288 DVLQNLAYLLVVAVDVFKLKLPHRWRRLLEWVSSLVTVSRFF 329

>ZYRO0F18370g Chr6 (1518178..1518840) [663 bp, 220 aa] {ON}
           conserved hypothetical protein
          Length = 220

 Score = 29.6 bits (65), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 31/124 (25%), Positives = 63/124 (50%), Gaps = 17/124 (13%)

Query: 17  ENIWSGVSS---LLDFFAVLENLGVVN-DKLYVSGLLR-----KVWLCYSCISVIKCVWK 67
           + + +G+ S   L D   +L+ LG+++ D L    L +     K+W     +S  K   +
Sbjct: 59  DTLIAGLESICGLFDNVYLLKTLGIISEDNLLYRRLNKGEWGSKLWFVTLLLSARKSFSR 118

Query: 68  LIKLCKVKFKIDQ-----RLDGEGN---GLVKDKLINFKKKYNEHIRHITAALLQDLSYL 119
           L+K+ K K K+ +     R +G+ +    ++++K  +  KK +  I+ +   LLQ L+YL
Sbjct: 119 LLKIMKAKSKLKEEMKELRTEGDEDLVKQVLRNKFTDALKKCSIIIKDVVLELLQTLAYL 178

Query: 120 MVLI 123
            +++
Sbjct: 179 AIVV 182

>NCAS0B09060 Chr2 (1741161..1741664) [504 bp, 167 aa] {ON} Anc_1.10
           YCL056C
          Length = 167

 Score = 29.3 bits (64), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 38/152 (25%), Positives = 68/152 (44%), Gaps = 25/152 (16%)

Query: 18  NIWSGVSSLLDFFAVLENLGVVNDK--LYVS----GLLRKVWLCYSCISVIKCVWKLIKL 71
           N    + ++ D     +++GV+++K  LY +        K+W     +S  K + +L K 
Sbjct: 10  NALESICNIFDNVYFFKSIGVLSEKNILYRTLNKGDFGSKLWFLTLLLSSKKLITRLTKS 69

Query: 72  CKVKFKIDQRLDGEG----------NGLVKDKLINFKKKYNEHIRHITAALLQDLSYLMV 121
            K++ KI + +D             N L+++KL     K  + IR+    LLQ + YL +
Sbjct: 70  LKIRAKIKKEIDESPKENDEDKSLVNSLLREKLELSLAKCMDIIRNNVLELLQTMMYLSI 129

Query: 122 LI-------YPGT--RLFKRLSNIITLCRIIV 144
                     P     L ++LSNIIT+ R+ +
Sbjct: 130 AFINVFKVKVPQKWKHLLEQLSNIITIIRVFI 161

>Kwal_33.13023 s33 complement(43697..44278) [582 bp, 193 aa] {ON}
           [contig 123] FULL
          Length = 193

 Score = 29.3 bits (64), Expect = 3.0,   Method: Compositional matrix adjust.
 Identities = 29/134 (21%), Positives = 58/134 (43%), Gaps = 13/134 (9%)

Query: 2   VSKKNTAEISAKDIWENIWSGVSSLLDFFAVLENLGVVNDKLYV------SGLLRKVWLC 55
           V+K N    + ++   +    V+ L D   +L++ G++++  YV      SG   KVWL 
Sbjct: 23  VTKTNKGGEAIENFCISGMESVAGLFDDIHLLKSFGIISESNYVYRKLNKSGFCSKVWLL 82

Query: 56  YSCISVIKCVWKL-------IKLCKVKFKIDQRLDGEGNGLVKDKLINFKKKYNEHIRHI 108
              +S  KC+  L        +L K +              + DK+    K  N  +  +
Sbjct: 83  SLVLSTRKCIRDLNNLWMSRSRLRKEEVHFTMHSSNSLRRALSDKIALKIKDVNRRLILV 142

Query: 109 TAALLQDLSYLMVL 122
              ++Q+++YL+++
Sbjct: 143 ALEIMQNIAYLIIV 156

>ZYRO0F17776g Chr6 complement(1471832..1473238) [1407 bp, 468 aa]
           {ON} similar to uniprot|P25370 Saccharomyces cerevisiae
           YDR514C Hypothetical ORF and similar to YCL036w
          Length = 468

 Score = 29.3 bits (64), Expect = 4.2,   Method: Composition-based stats.
 Identities = 15/40 (37%), Positives = 22/40 (55%)

Query: 100 KYNEHIRHITAALLQDLSYLMVLIYPGTRLFKRLSNIITL 139
           K+N+ +    AA ++D  Y MV  +PG   F+ L N I L
Sbjct: 140 KHNQKLFQKVAAQIKDEHYPMVHAFPGNTNFEYLCNCIRL 179

>TBLA0C04050 Chr3 complement(980010..983633) [3624 bp, 1207 aa] {ON}
           Anc_4.113 YGL013C
          Length = 1207

 Score = 28.9 bits (63), Expect = 5.2,   Method: Compositional matrix adjust.
 Identities = 13/34 (38%), Positives = 22/34 (64%), Gaps = 1/34 (2%)

Query: 88  GLVKDKLI-NFKKKYNEHIRHITAALLQDLSYLM 120
           GL+K KL+ NF    N H+ H T++ ++ L+ L+
Sbjct: 381 GLMKQKLLSNFNSTNNNHLNHSTSSSMESLTSLL 414

>CAGL0A02596g Chr1 (278467..281085) [2619 bp, 872 aa] {ON} similar
           to uniprot|P32380 Saccharomyces cerevisiae YDR356w NUF1
          Length = 872

 Score = 28.1 bits (61), Expect = 8.7,   Method: Composition-based stats.
 Identities = 11/31 (35%), Positives = 18/31 (58%)

Query: 77  KIDQRLDGEGNGLVKDKLINFKKKYNEHIRH 107
           ++D  +    N  + DKL  +K KYN+ +RH
Sbjct: 721 RMDPSISTSANTTLADKLDYYKLKYNDEVRH 751

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.326    0.142    0.434 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 15,536,849
Number of extensions: 633202
Number of successful extensions: 2419
Number of sequences better than 10.0: 24
Number of HSP's gapped: 2412
Number of HSP's successfully gapped: 24
Length of query: 144
Length of database: 53,481,399
Length adjustment: 99
Effective length of query: 45
Effective length of database: 42,129,465
Effective search space: 1895825925
Effective search space used: 1895825925
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.7 bits)
S2: 60 (27.7 bits)