Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
YCL024W (KCC4)1.52ON1037103747650.0
Smik_3.541.52ON1032103934290.0
Skud_3.391.52ON1017104233220.0
Suva_3.1901.52ON102435516510.0
Suva_2.6871.52ON112835814700.0
Skud_4.7831.52ON113535814650.0
KAFR0D041001.52ON111735314630.0
Smik_4.7891.52ON113635814630.0
NCAS0B086001.52ON111735814610.0
YDR507C (GIN4)1.52ON114235814550.0
CAGL0K05709g1.52ON110337214420.0
Kpol_2002.461.52ON112335514420.0
NDAI0A006601.52ON102235914320.0
KNAG0F002901.52ON112535314291e-179
TDEL0C064901.52ON115335714181e-177
TPHA0E036401.52ON113737014161e-177
TBLA0A071501.52ON139135614341e-177
KLTH0F01672g1.52ON116435514111e-176
KLLA0C01650g1.52ON111235313941e-174
SAKL0C01716g1.52ON121535613841e-172
AFR696C1.52ON114235213741e-171
ZYRO0F17402g1.52ON118935813771e-171
Ecym_10581.52ON116435213691e-170
SAKL0E02860g2.479ON13773709981e-115
KLTH0D05566g2.479ON11283749851e-115
Ecym_73922.479ON14343549921e-114
ABL034W2.479ON14253569911e-114
KLLA0F13552g2.479ON12673639791e-113
Kwal_26.77882.479ON12673549671e-111
YKL101W (HSL1)2.479ON15184069761e-111
KNAG0A065402.479ON14323759731e-111
Skud_11.1262.479ON15184069701e-111
Suva_11.1232.479ON15264039701e-111
Kpol_431.92.479ON15524119691e-110
KAFR0D032002.479ON14483949621e-110
Smik_11.1392.479ON15344069581e-109
TDEL0A025502.479ON13693959431e-108
NCAS0A057702.479ON14613959441e-107
TBLA0I011502.479ON17453959461e-107
ZYRO0G03366g2.479ON16164139391e-106
CAGL0K08514g2.479ON14894009271e-105
TPHA0G032002.479ON15344279061e-102
NDAI0D027502.479ON15152988163e-90
TPHA0C004705.611ON6312716141e-67
CAGL0M08910g5.611ON6122776112e-67
KLLA0A03806g5.611ON6023256084e-67
Kpol_495.145.611ON6242766104e-67
Kwal_33.132251.52ON9641676264e-67
NCAS0A080805.611ON6232776061e-66
TBLA0E033605.611ON6542806053e-66
YDR477W (SNF1)5.611ON6332776025e-66
Smik_4.7545.611ON6322696018e-66
Suva_2.6515.611ON6332775991e-65
Skud_4.7515.611ON6342775991e-65
TDEL0A047805.611ON6212715937e-65
KLTH0G05698g5.611ON5972695891e-64
AEL230W5.611ON6082835901e-64
KAFR0C058605.611ON6442655912e-64
Kwal_33.13222singletonOFF1481205482e-64
Kpol_1018.655.611ON6012655873e-64
NDAI0H009405.611ON6852695923e-64
Kwal_47.182335.611ON5982695847e-64
SAKL0G06952g5.611ON5992695831e-63
KNAG0B032305.611ON6412655842e-63
TPHA0D028405.611ON6342715832e-63
ZYRO0A05544g5.611ON6312715832e-63
Ecym_55885.611ON6132695794e-63
KNAG0J015908.654ON8053265082e-52
CAGL0M11396g8.279ON11922915098e-52
NDAI0J012508.279ON11763115043e-51
Kpol_1072.298.654ON8932835003e-51
TDEL0A060008.654ON7902914964e-51
TPHA0G017108.654ON8052864956e-51
Kpol_1012.68.654ON6282914878e-51
NDAI0E023208.654ON9322884988e-51
NCAS0C015908.654ON8642924923e-50
ZYRO0F06842g8.654ON8432944904e-50
SAKL0H07084g8.654ON9192794907e-50
KAFR0A037308.654ON7883054868e-50
TPHA0J008208.279ON12182894929e-50
Ecym_42918.279ON11452914921e-49
Smik_4.3678.279ON10662844901e-49
Kpol_1066.468.279ON12252934911e-49
Skud_4.3838.279ON10652844901e-49
NCAS0B050908.279ON12102924902e-49
Smik_15.4178.654ON8062884842e-49
NDAI0B020708.279ON12583374892e-49
TBLA0C046008.279ON13152874893e-49
NCAS0B037408.279ON10492904864e-49
Suva_2.2838.279ON10893074864e-49
Suva_8.2848.654ON8083184805e-49
TDEL0F040608.279ON11262874855e-49
SAKL0H16632g8.279ON10622914846e-49
Suva_16.1698.654ON8582924809e-49
YDR122W (KIN1)8.279ON10642844821e-48
AGR058W8.279ON10713114821e-48
Suva_10.1808.279ON11593744831e-48
CAGL0M02519g8.654ON7563024751e-48
KAFR0B028008.279ON10953034812e-48
Smik_12.1558.279ON11623744812e-48
Skud_15.3998.654ON8073154752e-48
YPL141C (FRK1)8.654ON8652924763e-48
Skud_16.1408.654ON8652894763e-48
KLLA0F19536g8.279ON11042914793e-48
Skud_12.1648.279ON11602894793e-48
KNAG0G021108.279ON11923034793e-48
KLTH0D10714g8.654ON8722854744e-48
Kwal_26.87098.654ON8292854735e-48
CAGL0J03872g8.654ON6612974675e-48
Smik_6.3398.654ON8652894736e-48
YOR233W (KIN4)8.654ON8002904726e-48
YLR096W (KIN2)8.279ON11473744777e-48
KAFR0H025408.654ON8173354727e-48
NDAI0E012908.654ON7293084662e-47
KLTH0G13288g8.279ON11422894732e-47
Ecym_83398.654ON9202824693e-47
ZYRO0D06776g8.279ON12042864705e-47
TBLA0B039708.654ON12082874696e-47
ACR119W8.654ON9312994641e-46
CAGL0B01925g8.279ON9442914613e-46
KNAG0A030408.654ON6443024523e-46
TPHA0D011408.654ON6223074513e-46
TBLA0C017508.654ON9813154605e-46
CAGL0M02299g8.668ON8932804585e-46
KNAG0H031408.279ON9362844595e-46
KNAG0D010906.222ON3722734302e-45
SAKL0H06754g8.668ON8842714542e-45
NDAI0E023908.668ON8832764542e-45
NCAS0B014708.654ON7272844474e-45
NCAS0C016708.668ON8962714514e-45
ZYRO0F07194g8.668ON9382884444e-44
KLLA0F11319g8.668ON8433564399e-44
KLLA0D07348g8.654ON9092824363e-43
KNAG0J016708.668ON10092754356e-43
TBLA0B038608.668ON9882764302e-42
Kwal_26.87518.668ON8482724273e-42
KLTH0D11242g8.676ON7952864245e-42
Kwal_26.87968.676ON7962864211e-41
KLTH0D11044g8.668ON8492684211e-41
TPHA0G016308.668ON8712714202e-41
TDEL0A061408.668ON8612794192e-41
Suva_16.1608.668ON9182904203e-41
CAGL0M02233g8.676ON7672924173e-41
TPHA0E028206.222ON3842583931e-40
SAKL0D07656g1.374ON4322813962e-40
YPL150W8.668ON9012884096e-40
CAGL0L07326g2.352ON5063163968e-40
Smik_6.3508.676ON8222834068e-40
SAKL0H06534g8.676ON8042764069e-40
YPL209C (IPL1)6.222ON3672683861e-39
Ecym_24058.668ON8552764061e-39
Kpol_1072.198.668ON8962714061e-39
Skud_16.1328.668ON9242944061e-39
KLLA0F11143g8.676ON8132724041e-39
YPL153C (RAD53)8.676ON8212814042e-39
Smik_6.3478.668ON9172894052e-39
CAGL0E05720g6.222ON3582723832e-39
TBLA0A020506.222ON4342733882e-39
Skud_16.706.222ON3672673832e-39
KAFR0H024308.676ON7842774023e-39
Suva_16.1578.676ON8322814023e-39
Kwal_56.240916.222ON3812583843e-39
Smik_4.1352.352ON5133173913e-39
NDAI0G053001.374ON4372913864e-39
Kpol_1065.36.222ON3762683824e-39
Skud_16.1298.676ON8272834005e-39
KNAG0J017008.676ON8202804005e-39
NDAI0E021108.676ON9032863981e-38
Kwal_56.237178.279ON8581893981e-38
ACR133C8.668ON8512733971e-38
Smik_6.4146.222ON3672673771e-38
NCAS0A088801.374ON4222913783e-38
TPHA0O011201.374ON4292833784e-38
KAFR0K002806.222ON3602573717e-38
Kpol_1072.168.676ON7952773881e-37
TBLA0B038408.676ON8582763891e-37
TDEL0A062208.676ON7942773881e-37
NCAS0B044906.222ON3492563681e-37
Suva_16.976.222ON3682683701e-37
Ecym_23978.676ON8722793891e-37
ACR142W8.676ON8372813881e-37
NDAI0F016006.222ON4122583721e-37
NCAS0C013708.676ON7992783882e-37
YFR014C (CMK1)1.374ON4462833742e-37
YDL101C (DUN1)2.352ON5133233772e-37
ZYRO0E07018g6.222ON3672583682e-37
KLTH0H11396g1.374ON4372853723e-37
NCAS0D021006.31ON7262073833e-37
Suva_4.1452.352ON5143033754e-37
KAFR0K003306.214ON3732833664e-37
NCAS0A011006.214ON3542823655e-37
KNAG0I014801.374ON4402733705e-37
Kpol_1004.192.352ON4942973727e-37
CAGL0J11638g6.31ON7462153801e-36
KLTH0H03982g6.222ON3982573651e-36
Skud_10.501.182ON3972693641e-36
SAKL0E05984g2.352ON5053253701e-36
KAFR0H025108.668ON8792733811e-36
Suva_15.1551.374ON4522693672e-36
TPHA0G016008.676ON8452773802e-36
Skud_4.1542.352ON5133063702e-36
Suva_6.781.374ON4452843662e-36
ZYRO0F07370g8.676ON7622763782e-36
KLLA0B02332g6.222ON3612813602e-36
Skud_15.1441.374ON4492693662e-36
YJL164C (TPK1)1.182ON3973013632e-36
SAKL0A04246g6.222ON4002573632e-36
Smik_7.3191.374ON4462883653e-36
YPL203W (TPK2)6.214ON3802833613e-36
Skud_6.891.374ON4462833653e-36
KLTH0C10912g6.31ON6972133753e-36
CAGL0F04741g1.374ON4422713643e-36
Skud_16.766.214ON3822833604e-36
Smik_10.661.182ON3972693614e-36
KLLA0E01585g2.352ON5123043674e-36
Smik_6.4086.214ON3812833604e-36
TBLA0D050101.374ON4342863634e-36
KLTH0H04180g6.214ON3532833574e-36
TBLA0A020306.214ON4032933614e-36
Kwal_0.961.374ON4272733624e-36
TDEL0E053106.222ON3742623585e-36
TDEL0D053203.92ON10572943775e-36
KAFR0K024502.352ON5112933666e-36
Kwal_56.224766.31ON6972133726e-36
YOL016C (CMK2)1.374ON4472693618e-36
KLLA0F23155g1.374ON4272823608e-36
Smik_15.1531.374ON4422693619e-36
Ecym_30356.31ON7402133729e-36
NCAS0D006301.374ON4272943609e-36
ACL006W6.31ON7082133719e-36
CAGL0K10604g1.374ON4462673601e-35
KLLA0B07205g1.182ON4552763601e-35
Suva_6.2451.182ON3942693561e-35
Suva_16.1046.214ON3832833552e-35
KLLA0D03190g6.214ON3723093542e-35
ZYRO0G08844g6.214ON3622813532e-35
KLLA0C06138g6.31ON7082063692e-35
Kwal_56.240596.214ON3532833522e-35
NDAI0H035201.374ON4582773592e-35
NDAI0F016506.214ON3672813522e-35
Skud_13.1546.31ON7052133673e-35
Suva_11.561.182ON3982763543e-35
Kpol_1069.131.374ON4272873553e-35
CAGL0G09020g6.214ON3612833513e-35
YMR001C (CDC5)6.31ON7052133663e-35
Ecym_21946.222ON3662773514e-35
KNAG0D011406.214ON3952833534e-35
Suva_13.1636.31ON7052093655e-35
SAKL0A04466g6.214ON3732833506e-35
Smik_13.1596.31ON7052133646e-35
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= YCL024W
         (1037 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

YCL024W Chr3 (79162..82275) [3114 bp, 1037 aa] {ON}  KCC4Protein...  1840   0.0  
Smik_3.54 Chr3 (80309..83407) [3099 bp, 1032 aa] {ON} YCL024W (R...  1325   0.0  
Skud_3.39 Chr3 (66201..69254) [3054 bp, 1017 aa] {ON} YCL024W (R...  1284   0.0  
Suva_3.190 Chr3 (288639..288813,288870..291766) [3072 bp, 1024 a...   640   0.0  
Suva_2.687 Chr2 complement(1215095..1218481) [3387 bp, 1128 aa] ...   570   0.0  
Skud_4.783 Chr4 complement(1382552..1385959) [3408 bp, 1135 aa] ...   568   0.0  
KAFR0D04100 Chr4 complement(809681..813034) [3354 bp, 1117 aa] {...   568   0.0  
Smik_4.789 Chr4 complement(1385209..1388619) [3411 bp, 1136 aa] ...   568   0.0  
NCAS0B08600 Chr2 (1649375..1652728) [3354 bp, 1117 aa] {ON} Anc_...   567   0.0  
YDR507C Chr4 complement(1462358..1465786) [3429 bp, 1142 aa] {ON...   565   0.0  
CAGL0K05709g Chr11 complement(556732..560043) [3312 bp, 1103 aa]...   560   0.0  
Kpol_2002.46 s2002 (95107..98478) [3372 bp, 1123 aa] {ON} (95107...   560   0.0  
NDAI0A00660 Chr1 (121773..124841) [3069 bp, 1022 aa] {ON} Anc_1.52    556   0.0  
KNAG0F00290 Chr6 (31750..35127) [3378 bp, 1125 aa] {ON} Anc_1.52...   555   e-179
TDEL0C06490 Chr3 complement(1191461..1194922) [3462 bp, 1153 aa]...   550   e-177
TPHA0E03640 Chr5 complement(769962..773375) [3414 bp, 1137 aa] {...   550   e-177
TBLA0A07150 Chr1 (1776160..1780335) [4176 bp, 1391 aa] {ON} Anc_...   556   e-177
KLTH0F01672g Chr6 (127277..130771) [3495 bp, 1164 aa] {ON} simil...   548   e-176
KLLA0C01650g Chr3 (128119..131457) [3339 bp, 1112 aa] {ON} simil...   541   e-174
SAKL0C01716g Chr3 (143880..147527) [3648 bp, 1215 aa] {ON} simil...   537   e-172
AFR696C Chr6 complement(1722130..1725558) [3429 bp, 1142 aa] {ON...   533   e-171
ZYRO0F17402g Chr6 complement(1445685..1449254) [3570 bp, 1189 aa...   535   e-171
Ecym_1058 Chr1 (105835..109329) [3495 bp, 1164 aa] {ON} similar ...   531   e-170
SAKL0E02860g Chr5 complement(228726..232859) [4134 bp, 1377 aa] ...   389   e-115
KLTH0D05566g Chr4 (498055..501441) [3387 bp, 1128 aa] {ON} weakl...   384   e-115
Ecym_7392 Chr7 complement(803240..807544) [4305 bp, 1434 aa] {ON...   386   e-114
ABL034W Chr2 (333432..337709) [4278 bp, 1425 aa] {ON} Syntenic h...   386   e-114
KLLA0F13552g Chr6 complement(1252906..1256709) [3804 bp, 1267 aa...   381   e-113
Kwal_26.7788 s26 (511530..515333) [3804 bp, 1267 aa] {ON} YKL101...   377   e-111
YKL101W Chr11 (248920..253476) [4557 bp, 1518 aa] {ON}  HSL1Nim1...   380   e-111
KNAG0A06540 Chr1 (1002435..1006733) [4299 bp, 1432 aa] {ON} Anc_...   379   e-111
Skud_11.126 Chr11 (235011..239567) [4557 bp, 1518 aa] {ON} YKL10...   378   e-111
Suva_11.123 Chr11 (235064..239644) [4581 bp, 1526 aa] {ON} YKL10...   378   e-111
Kpol_431.9 s431 complement(22310..26968) [4659 bp, 1552 aa] {ON}...   377   e-110
KAFR0D03200 Chr4 (628993..633339) [4347 bp, 1448 aa] {ON} Anc_2....   375   e-110
Smik_11.139 Chr11 (235511..240115) [4605 bp, 1534 aa] {ON} YKL10...   373   e-109
TDEL0A02550 Chr1 (457841..461950) [4110 bp, 1369 aa] {ON} Anc_2....   367   e-108
NCAS0A05770 Chr1 (1132854..1137239) [4386 bp, 1461 aa] {ON} Anc_...   368   e-107
TBLA0I01150 Chr9 complement(235187..240424) [5238 bp, 1745 aa] {...   369   e-107
ZYRO0G03366g Chr7 (261014..265864) [4851 bp, 1616 aa] {ON} simil...   366   e-106
CAGL0K08514g Chr11 complement(854143..858612) [4470 bp, 1489 aa]...   361   e-105
TPHA0G03200 Chr7 (683296..687900) [4605 bp, 1534 aa] {ON} Anc_2....   353   e-102
NDAI0D02750 Chr4 (639802..644349) [4548 bp, 1515 aa] {ON} Anc_2....   318   3e-90
TPHA0C00470 Chr3 (81482..83377) [1896 bp, 631 aa] {ON} Anc_5.611...   241   1e-67
CAGL0M08910g Chr13 complement(887703..889541) [1839 bp, 612 aa] ...   239   2e-67
KLLA0A03806g Chr1 complement(338807..340615) [1809 bp, 602 aa] {...   238   4e-67
Kpol_495.14 s495 (33810..35684) [1875 bp, 624 aa] {ON} (33810..3...   239   4e-67
Kwal_33.13225 s33 (127676..130570) [2895 bp, 964 aa] {ON} YFR016...   245   4e-67
NCAS0A08080 Chr1 complement(1594221..1596092) [1872 bp, 623 aa] ...   238   1e-66
TBLA0E03360 Chr5 complement(838512..840476) [1965 bp, 654 aa] {O...   237   3e-66
YDR477W Chr4 (1412373..1414274) [1902 bp, 633 aa] {ON}  SNF1AMP-...   236   5e-66
Smik_4.754 Chr4 (1333667..1335565) [1899 bp, 632 aa] {ON} YDR477...   236   8e-66
Suva_2.651 Chr2 (1164264..1166165) [1902 bp, 633 aa] {ON} YDR477...   235   1e-65
Skud_4.751 Chr4 (1332135..1334039) [1905 bp, 634 aa] {ON} YDR477...   235   1e-65
TDEL0A04780 Chr1 (842715..844580) [1866 bp, 621 aa] {ON} Anc_5.6...   233   7e-65
KLTH0G05698g Chr7 (453530..455323) [1794 bp, 597 aa] {ON} simila...   231   1e-64
AEL230W Chr5 (198401..200227) [1827 bp, 608 aa] {ON} Syntenic ho...   231   1e-64
KAFR0C05860 Chr3 (1160586..1162520) [1935 bp, 644 aa] {ON} Anc_5...   232   2e-64
Kwal_33.13222 s33 (127342..127788) [447 bp, 148 aa] {OFF} YDR507...   215   2e-64
Kpol_1018.65 s1018 (189779..191584) [1806 bp, 601 aa] {ON} (1897...   230   3e-64
NDAI0H00940 Chr8 complement(209645..211702) [2058 bp, 685 aa] {O...   232   3e-64
Kwal_47.18233 s47 complement(743846..745642) [1797 bp, 598 aa] {...   229   7e-64
SAKL0G06952g Chr7 (570584..572383) [1800 bp, 599 aa] {ON} simila...   229   1e-63
KNAG0B03230 Chr2 complement(625072..626997) [1926 bp, 641 aa] {O...   229   2e-63
TPHA0D02840 Chr4 (591733..593637) [1905 bp, 634 aa] {ON}              229   2e-63
ZYRO0A05544g Chr1 (450809..452704) [1896 bp, 631 aa] {ON} highly...   229   2e-63
Ecym_5588 Chr5 complement(1205102..1206943) [1842 bp, 613 aa] {O...   227   4e-63
KNAG0J01590 Chr10 (292565..294982) [2418 bp, 805 aa] {ON} Anc_8....   200   2e-52
CAGL0M11396g Chr13 (1122109..1125687) [3579 bp, 1192 aa] {ON} si...   200   8e-52
NDAI0J01250 Chr10 complement(291314..294844) [3531 bp, 1176 aa] ...   198   3e-51
Kpol_1072.29 s1072 complement(61987..64668) [2682 bp, 893 aa] {O...   197   3e-51
TDEL0A06000 Chr1 (1053427..1055799) [2373 bp, 790 aa] {ON} Anc_8...   195   4e-51
TPHA0G01710 Chr7 complement(350452..352869) [2418 bp, 805 aa] {O...   195   6e-51
Kpol_1012.6 s1012 (11581..13467) [1887 bp, 628 aa] {ON} (11581.....   192   8e-51
NDAI0E02320 Chr5 (480203..483001) [2799 bp, 932 aa] {ON}              196   8e-51
NCAS0C01590 Chr3 (293327..295921) [2595 bp, 864 aa] {ON} Anc_8.654    194   3e-50
ZYRO0F06842g Chr6 (561269..563800) [2532 bp, 843 aa] {ON} simila...   193   4e-50
SAKL0H07084g Chr8 complement(619288..622047) [2760 bp, 919 aa] {...   193   7e-50
KAFR0A03730 Chr1 (761946..764312) [2367 bp, 788 aa] {ON} Anc_8.6...   191   8e-50
TPHA0J00820 Chr10 (193408..197064) [3657 bp, 1218 aa] {ON} Anc_8...   194   9e-50
Ecym_4291 Chr4 complement(620549..623986) [3438 bp, 1145 aa] {ON...   194   1e-49
Smik_4.367 Chr4 (655941..659141) [3201 bp, 1066 aa] {ON} YDR122W...   193   1e-49
Kpol_1066.46 s1066 (82874..86551) [3678 bp, 1225 aa] {ON} (82874...   193   1e-49
Skud_4.383 Chr4 (666354..669551) [3198 bp, 1065 aa] {ON} YDR122W...   193   1e-49
NCAS0B05090 Chr2 (946126..949758) [3633 bp, 1210 aa] {ON}             193   2e-49
Smik_15.417 Chr15 (725513..727933) [2421 bp, 806 aa] {ON} YOR233...   191   2e-49
NDAI0B02070 Chr2 (514024..517800) [3777 bp, 1258 aa] {ON}             192   2e-49
TBLA0C04600 Chr3 (1112043..1115990) [3948 bp, 1315 aa] {ON} Anc_...   192   3e-49
NCAS0B03740 Chr2 complement(668231..671380) [3150 bp, 1049 aa] {...   191   4e-49
Suva_2.283 Chr2 (489490..492759) [3270 bp, 1089 aa] {ON} YDR122W...   191   4e-49
Suva_8.284 Chr8 (514891..517317) [2427 bp, 808 aa] {ON} YOR233W ...   189   5e-49
TDEL0F04060 Chr6 (749896..753276) [3381 bp, 1126 aa] {ON} Anc_8....   191   5e-49
SAKL0H16632g Chr8 complement(1461613..1464801) [3189 bp, 1062 aa...   191   6e-49
Suva_16.169 Chr16 complement(292738..295314) [2577 bp, 858 aa] {...   189   9e-49
YDR122W Chr4 (694700..697894) [3195 bp, 1064 aa] {ON}  KIN1Serin...   190   1e-48
AGR058W Chr7 (823626..826841) [3216 bp, 1071 aa] {ON} Syntenic h...   190   1e-48
Suva_10.180 Chr10 (337364..340843) [3480 bp, 1159 aa] {ON} YLR09...   190   1e-48
CAGL0M02519g Chr13 complement(290723..292993) [2271 bp, 756 aa] ...   187   1e-48
KAFR0B02800 Chr2 (571295..574582) [3288 bp, 1095 aa] {ON} Anc_8....   189   2e-48
Smik_12.155 Chr12 (312480..315968) [3489 bp, 1162 aa] {ON} YLR09...   189   2e-48
Skud_15.399 Chr15 (714789..717212) [2424 bp, 807 aa] {ON} YOR233...   187   2e-48
YPL141C Chr16 complement(283464..286061) [2598 bp, 865 aa] {ON} ...   187   3e-48
Skud_16.140 Chr16 complement(255090..257687) [2598 bp, 865 aa] {...   187   3e-48
KLLA0F19536g Chr6 (1808263..1811577) [3315 bp, 1104 aa] {ON} sim...   189   3e-48
Skud_12.164 Chr12 (315700..319182) [3483 bp, 1160 aa] {ON} YLR09...   189   3e-48
KNAG0G02110 Chr7 (477260..480838) [3579 bp, 1192 aa] {ON} Anc_8....   189   3e-48
KLTH0D10714g Chr4 (880389..883007) [2619 bp, 872 aa] {ON} simila...   187   4e-48
Kwal_26.8709 s26 (907885..910374) [2490 bp, 829 aa] {ON} YPL141C...   186   5e-48
CAGL0J03872g Chr10 (368472..370457) [1986 bp, 661 aa] {ON} simil...   184   5e-48
Smik_6.339 Chr6 (538177..540774) [2598 bp, 865 aa] {ON} YPL141C ...   186   6e-48
YOR233W Chr15 (775846..778248) [2403 bp, 800 aa] {ON}  KIN4Serin...   186   6e-48
YLR096W Chr12 (332590..336033) [3444 bp, 1147 aa] {ON}  KIN2Seri...   188   7e-48
KAFR0H02540 Chr8 complement(483399..485852) [2454 bp, 817 aa] {O...   186   7e-48
NDAI0E01290 Chr5 complement(255593..257782) [2190 bp, 729 aa] {O...   184   2e-47
KLTH0G13288g Chr7 complement(1139058..1142486) [3429 bp, 1142 aa...   186   2e-47
Ecym_8339 Chr8 (684113..686875) [2763 bp, 920 aa] {ON} similar t...   185   3e-47
ZYRO0D06776g Chr4 complement(583027..586641) [3615 bp, 1204 aa] ...   185   5e-47
TBLA0B03970 Chr2 complement(904167..907793) [3627 bp, 1208 aa] {...   185   6e-47
ACR119W Chr3 (560761..563556) [2796 bp, 931 aa] {ON} Syntenic ho...   183   1e-46
CAGL0B01925g Chr2 (176316..179150) [2835 bp, 944 aa] {ON} simila...   182   3e-46
KNAG0A03040 Chr1 complement(372150..374084) [1935 bp, 644 aa] {O...   178   3e-46
TPHA0D01140 Chr4 (238656..240524) [1869 bp, 622 aa] {ON} Anc_8.6...   178   3e-46
TBLA0C01750 Chr3 (412762..415707) [2946 bp, 981 aa] {ON} Anc_8.6...   181   5e-46
CAGL0M02299g Chr13 (273725..276406) [2682 bp, 893 aa] {ON} simil...   181   5e-46
KNAG0H03140 Chr8 complement(589553..592363) [2811 bp, 936 aa] {O...   181   5e-46
KNAG0D01090 Chr4 complement(183319..184437) [1119 bp, 372 aa] {O...   170   2e-45
SAKL0H06754g Chr8 (594995..597649) [2655 bp, 884 aa] {ON} simila...   179   2e-45
NDAI0E02390 Chr5 complement(496256..498907) [2652 bp, 883 aa] {O...   179   2e-45
NCAS0B01470 Chr2 (241003..243186) [2184 bp, 727 aa] {ON} Anc_8.654    176   4e-45
NCAS0C01670 Chr3 complement(306682..309372) [2691 bp, 896 aa] {O...   178   4e-45
ZYRO0F07194g Chr6 complement(581438..584254) [2817 bp, 938 aa] {...   175   4e-44
KLLA0F11319g Chr6 (1042436..1044967) [2532 bp, 843 aa] {ON} simi...   173   9e-44
KLLA0D07348g Chr4 (626999..629728) [2730 bp, 909 aa] {ON} simila...   172   3e-43
KNAG0J01670 Chr10 complement(304021..307050) [3030 bp, 1009 aa] ...   172   6e-43
TBLA0B03860 Chr2 (887855..890821) [2967 bp, 988 aa] {ON} Anc_8.6...   170   2e-42
Kwal_26.8751 s26 complement(928853..931399) [2547 bp, 848 aa] {O...   169   3e-42
KLTH0D11242g Chr4 (918232..920619) [2388 bp, 795 aa] {ON} simila...   167   5e-42
Kwal_26.8796 s26 (946406..948796) [2391 bp, 796 aa] {ON} YPL153C...   166   1e-41
KLTH0D11044g Chr4 complement(901388..903937) [2550 bp, 849 aa] {...   166   1e-41
TPHA0G01630 Chr7 (336511..339126) [2616 bp, 871 aa] {ON} Anc_8.6...   166   2e-41
TDEL0A06140 Chr1 complement(1074016..1076601) [2586 bp, 861 aa] ...   166   2e-41
Suva_16.160 Chr16 (277393..280149) [2757 bp, 918 aa] {ON} YPL150...   166   3e-41
CAGL0M02233g Chr13 complement(267332..269635) [2304 bp, 767 aa] ...   165   3e-41
TPHA0E02820 Chr5 complement(589816..590970) [1155 bp, 384 aa] {O...   155   1e-40
SAKL0D07656g Chr4 complement(627469..628767) [1299 bp, 432 aa] {...   157   2e-40
YPL150W Chr16 (268188..270893) [2706 bp, 901 aa] {ON} Protein ki...   162   6e-40
CAGL0L07326g Chr12 (810529..812049) [1521 bp, 506 aa] {ON} simil...   157   8e-40
Smik_6.350 Chr6 (559997..562465) [2469 bp, 822 aa] {ON} YPL153C ...   160   8e-40
SAKL0H06534g Chr8 complement(575439..577853) [2415 bp, 804 aa] {...   160   9e-40
YPL209C Chr16 complement(156490..157593) [1104 bp, 367 aa] {ON} ...   153   1e-39
Ecym_2405 Chr2 (788655..791222) [2568 bp, 855 aa] {ON} similar t...   160   1e-39
Kpol_1072.19 s1072 (44906..47596) [2691 bp, 896 aa] {ON} (44906....   160   1e-39
Skud_16.132 Chr16 (239797..242571) [2775 bp, 924 aa] {ON} YPL150...   160   1e-39
KLLA0F11143g Chr6 complement(1026129..1028570) [2442 bp, 813 aa]...   160   1e-39
YPL153C Chr16 complement(261727..264192) [2466 bp, 821 aa] {ON} ...   160   2e-39
Smik_6.347 Chr6 complement(553316..556069) [2754 bp, 917 aa] {ON...   160   2e-39
CAGL0E05720g Chr5 (569265..570341) [1077 bp, 358 aa] {ON} simila...   152   2e-39
TBLA0A02050 Chr1 (495735..497039) [1305 bp, 434 aa] {ON}              154   2e-39
Skud_16.70 Chr16 complement(129918..131021) [1104 bp, 367 aa] {O...   152   2e-39
KAFR0H02430 Chr8 complement(464446..466800) [2355 bp, 784 aa] {O...   159   3e-39
Suva_16.157 Chr16 complement(270891..273389) [2499 bp, 832 aa] {...   159   3e-39
Kwal_56.24091 s56 (845680..846825) [1146 bp, 381 aa] {ON} YPL209...   152   3e-39
Smik_4.135 Chr4 complement(256861..258402) [1542 bp, 513 aa] {ON...   155   3e-39
NDAI0G05300 Chr7 (1289208..1290521) [1314 bp, 437 aa] {ON} Anc_1...   153   4e-39
Kpol_1065.3 s1065 complement(4445..5575) [1131 bp, 376 aa] {ON} ...   151   4e-39
Skud_16.129 Chr16 complement(233341..235824) [2484 bp, 827 aa] {...   158   5e-39
KNAG0J01700 Chr10 (309962..312424) [2463 bp, 820 aa] {ON}             158   5e-39
NDAI0E02110 Chr5 complement(430989..433700) [2712 bp, 903 aa] {O...   157   1e-38
Kwal_56.23717 s56 complement(674222..676798) [2577 bp, 858 aa] {...   157   1e-38
ACR133C Chr3 complement(581468..584023) [2556 bp, 851 aa] {ON} S...   157   1e-38
Smik_6.414 Chr6 (666806..667909) [1104 bp, 367 aa] {ON} YPL209C ...   149   1e-38
NCAS0A08880 Chr1 (1756271..1757539) [1269 bp, 422 aa] {ON} Anc_1...   150   3e-38
TPHA0O01120 Chr15 complement(217462..218751) [1290 bp, 429 aa] {...   150   4e-38
KAFR0K00280 Chr11 complement(64906..65988) [1083 bp, 360 aa] {ON...   147   7e-38
Kpol_1072.16 s1072 complement(37585..39972) [2388 bp, 795 aa] {O...   154   1e-37
TBLA0B03840 Chr2 complement(881914..884490) [2577 bp, 858 aa] {O...   154   1e-37
TDEL0A06220 Chr1 (1088622..1091006) [2385 bp, 794 aa] {ON} Anc_8...   154   1e-37
NCAS0B04490 Chr2 (814474..815523) [1050 bp, 349 aa] {ON} Anc_8.141    146   1e-37
Suva_16.97 Chr16 complement(165977..167083) [1107 bp, 368 aa] {O...   147   1e-37
Ecym_2397 Chr2 complement(771343..773961) [2619 bp, 872 aa] {ON}...   154   1e-37
ACR142W Chr3 (597519..600032) [2514 bp, 837 aa] {ON} Syntenic ho...   154   1e-37
NDAI0F01600 Chr6 complement(392424..393662) [1239 bp, 412 aa] {O...   147   1e-37
NCAS0C01370 Chr3 complement(250693..253092) [2400 bp, 799 aa] {O...   154   2e-37
YFR014C Chr6 complement(172537..173877) [1341 bp, 446 aa] {ON}  ...   148   2e-37
YDL101C Chr4 complement(280307..281848) [1542 bp, 513 aa] {ON}  ...   149   2e-37
ZYRO0E07018g Chr5 (531316..532419) [1104 bp, 367 aa] {ON} simila...   146   2e-37
KLTH0H11396g Chr8 complement(973355..974668) [1314 bp, 437 aa] {...   147   3e-37
NCAS0D02100 Chr4 (385878..388058) [2181 bp, 726 aa] {ON} Anc_6.31     152   3e-37
Suva_4.145 Chr4 complement(268826..270370) [1545 bp, 514 aa] {ON...   149   4e-37
KAFR0K00330 Chr11 (74162..75283) [1122 bp, 373 aa] {ON} Anc_6.21...   145   4e-37
NCAS0A01100 Chr1 (218400..219464) [1065 bp, 354 aa] {ON}              145   5e-37
KNAG0I01480 Chr9 (287733..289055) [1323 bp, 440 aa] {ON} Anc_1.3...   147   5e-37
Kpol_1004.19 s1004 (36090..36101,36217..37689) [1485 bp, 494 aa]...   147   7e-37
CAGL0J11638g Chr10 complement(1130744..1132984) [2241 bp, 746 aa...   150   1e-36
KLTH0H03982g Chr8 complement(363432..364628) [1197 bp, 398 aa] {...   145   1e-36
Skud_10.50 Chr10 complement(84697..85890) [1194 bp, 397 aa] {ON}...   144   1e-36
SAKL0E05984g Chr5 complement(485895..487391,487462..487482) [151...   147   1e-36
KAFR0H02510 Chr8 complement(476574..479213) [2640 bp, 879 aa] {O...   151   1e-36
Suva_15.155 Chr15 complement(267680..269038) [1359 bp, 452 aa] {...   145   2e-36
TPHA0G01600 Chr7 complement(329313..331850) [2538 bp, 845 aa] {O...   150   2e-36
Skud_4.154 Chr4 complement(275783..277324) [1542 bp, 513 aa] {ON...   147   2e-36
Suva_6.78 Chr6 (135988..137325) [1338 bp, 445 aa] {ON} YFR014C (...   145   2e-36
ZYRO0F07370g Chr6 (595931..598219) [2289 bp, 762 aa] {ON} simila...   150   2e-36
KLLA0B02332g Chr2 complement(206863..207948) [1086 bp, 361 aa] {...   143   2e-36
Skud_15.144 Chr15 complement(254620..255969) [1350 bp, 449 aa] {...   145   2e-36
YJL164C Chr10 complement(109966..111159) [1194 bp, 397 aa] {ON} ...   144   2e-36
SAKL0A04246g Chr1 complement(396019..397221) [1203 bp, 400 aa] {...   144   2e-36
Smik_7.319 Chr7 complement(534132..535472) [1341 bp, 446 aa] {ON...   145   3e-36
YPL203W Chr16 (166256..167398) [1143 bp, 380 aa] {ON}  TPK2cAMP-...   143   3e-36
Skud_6.89 Chr6 (166257..167594) [1338 bp, 446 aa] {ON} YFR014C (...   145   3e-36
KLTH0C10912g Chr3 (898372..900465) [2094 bp, 697 aa] {ON} highly...   149   3e-36
CAGL0F04741g Chr6 (478256..479584) [1329 bp, 442 aa] {ON} simila...   144   3e-36
Skud_16.76 Chr16 (139571..140719) [1149 bp, 382 aa] {ON} YPL203W...   143   4e-36
Smik_10.66 Chr10 complement(108043..109236) [1194 bp, 397 aa] {O...   143   4e-36
KLLA0E01585g Chr5 (149305..149370,149488..150960) [1539 bp, 512 ...   145   4e-36
Smik_6.408 Chr6 complement(657018..658163) [1146 bp, 381 aa] {ON...   143   4e-36
TBLA0D05010 Chr4 complement(1234934..1236238) [1305 bp, 434 aa] ...   144   4e-36
KLTH0H04180g Chr8 (381111..382172) [1062 bp, 353 aa] {ON} highly...   142   4e-36
TBLA0A02030 Chr1 complement(491365..492576) [1212 bp, 403 aa] {O...   143   4e-36
Kwal_0.96 s0 complement(46082..47365) [1284 bp, 427 aa] {ON} YOL...   144   4e-36
TDEL0E05310 Chr5 (972769..973893) [1125 bp, 374 aa] {ON} Anc_6.2...   142   5e-36
TDEL0D05320 Chr4 complement(965082..968255) [3174 bp, 1057 aa] {...   149   5e-36
KAFR0K02450 Chr11 (504087..504131,504190..505680) [1536 bp, 511 ...   145   6e-36
Kwal_56.22476 s56 complement(145039..147132) [2094 bp, 697 aa] {...   147   6e-36
YOL016C Chr15 complement(294777..296120) [1344 bp, 447 aa] {ON} ...   143   8e-36
KLLA0F23155g Chr6 (2157146..2158429) [1284 bp, 427 aa] {ON} simi...   143   8e-36
Smik_15.153 Chr15 complement(261920..263248) [1329 bp, 442 aa] {...   143   9e-36
Ecym_3035 Chr3 complement(70391..72613) [2223 bp, 740 aa] {ON} s...   147   9e-36
NCAS0D00630 Chr4 complement(107310..108593) [1284 bp, 427 aa] {O...   143   9e-36
ACL006W Chr3 (344395..346521) [2127 bp, 708 aa] {ON} Syntenic ho...   147   9e-36
CAGL0K10604g Chr11 complement(1030055..1031395) [1341 bp, 446 aa...   143   1e-35
KLLA0B07205g Chr2 complement(624606..625973) [1368 bp, 455 aa] {...   143   1e-35
Suva_6.245 Chr6 (438131..439315) [1185 bp, 394 aa] {ON} YJL164C ...   141   1e-35
Suva_16.104 Chr16 (176201..177352) [1152 bp, 383 aa] {ON} YPL203...   141   2e-35
KLLA0D03190g Chr4 (267933..269051) [1119 bp, 372 aa] {ON} highly...   140   2e-35
ZYRO0G08844g Chr7 complement(711678..712766) [1089 bp, 362 aa] {...   140   2e-35
KLLA0C06138g Chr3 (540409..542535) [2127 bp, 708 aa] {ON} simila...   146   2e-35
Kwal_56.24059 s56 complement(829673..830734) [1062 bp, 353 aa] {...   140   2e-35
NDAI0H03520 Chr8 (860096..861472) [1377 bp, 458 aa] {ON}              142   2e-35
NDAI0F01650 Chr6 (403635..404738) [1104 bp, 367 aa] {ON} Anc_6.214    140   2e-35
Skud_13.154 Chr13 complement(255263..257380) [2118 bp, 705 aa] {...   145   3e-35
Suva_11.56 Chr11 complement(119479..120675) [1197 bp, 398 aa] {O...   140   3e-35
Kpol_1069.13 s1069 complement(27223..28506) [1284 bp, 427 aa] {O...   141   3e-35
CAGL0G09020g Chr7 (860266..861351) [1086 bp, 361 aa] {ON} highly...   139   3e-35
YMR001C Chr13 complement(269019..271136) [2118 bp, 705 aa] {ON} ...   145   3e-35
Ecym_2194 Chr2 complement(381633..382733) [1101 bp, 366 aa] {ON}...   139   4e-35
KNAG0D01140 Chr4 (192308..193495) [1188 bp, 395 aa] {ON}              140   4e-35
Suva_13.163 Chr13 complement(259136..261253) [2118 bp, 705 aa] {...   145   5e-35
SAKL0A04466g Chr1 (413816..414937) [1122 bp, 373 aa] {ON} highly...   139   6e-35
Smik_13.159 Chr13 complement(260249..262366) [2118 bp, 705 aa] {...   144   6e-35
KNAG0C01060 Chr3 complement(205965..207374) [1410 bp, 469 aa] {O...   141   7e-35
SAKL0E01584g Chr5 complement(121830..123917) [2088 bp, 695 aa] {...   144   7e-35
NDAI0C02680 Chr3 complement(621951..624203) [2253 bp, 750 aa] {O...   145   7e-35
KLTH0F04840g Chr6 complement(427194..428339) [1146 bp, 381 aa] {...   139   8e-35
Skud_11.58 Chr11 complement(120855..122042) [1188 bp, 395 aa] {O...   139   8e-35
AFL090W Chr6 (274336..275376) [1041 bp, 346 aa] {ON} Syntenic ho...   138   8e-35
TPHA0E02840 Chr5 (594381..595589) [1209 bp, 402 aa] {ON} Anc_6.2...   139   9e-35
KAFR0B05410 Chr2 complement(1111152..1112771) [1620 bp, 539 aa] ...   141   1e-34
Kpol_1033.50 s1033 complement(126043..127197) [1155 bp, 384 aa] ...   138   2e-34
KNAG0E00850 Chr5 complement(158992..161127) [2136 bp, 711 aa] {O...   143   2e-34
TBLA0B00490 Chr2 complement(94755..97118) [2364 bp, 787 aa] {ON}...   143   2e-34
TDEL0B06320 Chr2 (1118534..1119868) [1335 bp, 444 aa] {ON} Anc_1...   139   2e-34
KNAG0A05670 Chr1 complement(847460..849016) [1557 bp, 518 aa] {O...   140   2e-34
NDAI0A00960 Chr1 complement(197205..198431) [1227 bp, 408 aa] {O...   138   2e-34
Kwal_33.13846 s33 complement(419630..420757) [1128 bp, 375 aa] {...   137   3e-34
KLLA0C12485g Chr3 (1060167..1062944) [2778 bp, 925 aa] {ON} simi...   144   3e-34
Smik_11.62 Chr11 complement(120153..121346) [1194 bp, 397 aa] {O...   137   3e-34
KNAG0C02440 Chr3 complement(475652..476857) [1206 bp, 401 aa] {O...   137   3e-34
ZYRO0A07546g Chr1 complement(619278..620747,620833..620847) [148...   140   3e-34
Ecym_2203 Chr2 (401590..402648) [1059 bp, 352 aa] {ON} similar t...   136   4e-34
TPHA0F02430 Chr6 complement(535865..538261) [2397 bp, 798 aa] {O...   143   4e-34
TBLA0B08250 Chr2 complement(1968879..1972922) [4044 bp, 1347 aa]...   144   4e-34
YKL166C Chr11 complement(134509..135705) [1197 bp, 398 aa] {ON} ...   137   5e-34
KAFR0G02690 Chr7 complement(555573..557714) [2142 bp, 713 aa] {O...   142   5e-34
TPHA0C04570 Chr3 (985491..987071) [1581 bp, 526 aa] {ON} Anc_2.3...   139   6e-34
Kpol_1037.20 s1037 (41658..43772) [2115 bp, 704 aa] {ON} (41658....   141   7e-34
Ecym_5624 Chr5 (1256658..1258022) [1365 bp, 454 aa] {ON} similar...   138   7e-34
TDEL0E05220 Chr5 complement(957515..958597) [1083 bp, 360 aa] {O...   135   7e-34
AFL101C Chr6 complement(249144..250247) [1104 bp, 367 aa] {ON} S...   135   8e-34
KAFR0F01800 Chr6 complement(350480..351754) [1275 bp, 424 aa] {O...   137   9e-34
SAKL0C05368g Chr3 complement(510576..511832) [1257 bp, 418 aa] {...   136   1e-33
NCAS0B05910 Chr2 (1120092..1121645) [1554 bp, 517 aa] {ON} Anc_2...   138   1e-33
KAFR0C04480 Chr3 (894906..896213) [1308 bp, 435 aa] {ON} Anc_1.3...   137   1e-33
TDEL0G02820 Chr7 complement(543911..545377,545450..545476) [1494...   138   1e-33
AFL188C Chr6 complement(88793..90211) [1419 bp, 472 aa] {ON} Syn...   137   1e-33
AAR009W Chr1 (358947..360308) [1362 bp, 453 aa] {ON} Syntenic ho...   137   2e-33
TDEL0C03710 Chr3 (653934..655169) [1236 bp, 411 aa] {ON} Anc_1.1...   135   2e-33
CAGL0M08404g Chr13 complement(836791..838179) [1389 bp, 462 aa] ...   137   2e-33
TDEL0G04380 Chr7 (792278..794446) [2169 bp, 722 aa] {ON} Anc_6.3...   140   2e-33
NCAS0I02840 Chr9 (528136..529344) [1209 bp, 402 aa] {ON} Anc_1.2...   135   2e-33
KNAG0C01820 Chr3 (355604..357376) [1773 bp, 590 aa] {ON}              138   3e-33
Kwal_56.22693 s56 complement(239982..242936) [2955 bp, 984 aa] {...   140   3e-33
Skud_7.92 Chr7 complement(169006..170697) [1692 bp, 563 aa] {ON}...   137   4e-33
NCAS0B08280 Chr2 (1579804..1581033) [1230 bp, 409 aa] {ON} Anc_1...   134   4e-33
KAFR0G00480 Chr7 complement(131066..132268) [1203 bp, 400 aa] {O...   134   4e-33
KAFR0I02010 Chr9 complement(411589..412887) [1299 bp, 432 aa] {O...   135   5e-33
TBLA0C05830 Chr3 complement(1408930..1410210) [1281 bp, 426 aa] ...   135   5e-33
KAFR0C04280 Chr3 (848308..849912) [1605 bp, 534 aa] {ON} Anc_1.3...   137   5e-33
TBLA0B07330 Chr2 complement(1745229..1746821,1746990..1747013) [...   137   5e-33
NCAS0C04940 Chr3 (1006185..1009535) [3351 bp, 1116 aa] {ON} Anc_...   140   7e-33
Ecym_1275 Chr1 complement(560481..561836) [1356 bp, 451 aa] {ON}...   134   8e-33
Kpol_1023.26 s1023 (51805..54024) [2220 bp, 739 aa] {ON} (51805....   138   8e-33
ZYRO0C07480g Chr3 (565426..567750) [2325 bp, 774 aa] {ON} highly...   138   1e-32
ZYRO0G18502g Chr7 (1528075..1529265) [1191 bp, 396 aa] {ON} simi...   133   1e-32
NCAS0C04120 Chr3 complement(840008..842755) [2748 bp, 915 aa] {O...   138   1e-32
NDAI0B00210 Chr2 (27983..29185) [1203 bp, 400 aa] {ON} Anc_1.182      133   1e-32
Kpol_2002.75 s2002 complement(168123..169394) [1272 bp, 423 aa] ...   133   1e-32
ZYRO0E05588g Chr5 (430271..431686) [1416 bp, 471 aa] {ON} simila...   134   2e-32
TPHA0B03850 Chr2 (909219..910841) [1623 bp, 540 aa] {ON} Anc_1.4...   135   2e-32
TPHA0J00420 Chr10 complement(96445..98568) [2124 bp, 707 aa] {ON...   137   2e-32
CAGL0I09504g Chr9 (909589..911175) [1587 bp, 528 aa] {ON} simila...   134   3e-32
Suva_7.83 Chr7 complement(159329..161038) [1710 bp, 569 aa] {ON}...   135   3e-32
NDAI0B03190 Chr2 complement(815759..817309) [1551 bp, 516 aa] {O...   134   4e-32
YOL100W Chr15 (129237..132482) [3246 bp, 1081 aa] {ON}  PKH2Seri...   137   4e-32
KAFR0I02440 Chr9 complement(493668..495128) [1461 bp, 486 aa] {O...   132   6e-32
Suva_15.65 Chr15 (102271..105513) [3243 bp, 1080 aa] {ON} YOL100...   136   7e-32
KLTH0C09548g Chr3 (792218..795199) [2982 bp, 993 aa] {ON} simila...   136   7e-32
KLTH0F09988g Chr6 complement(868693..869931) [1239 bp, 412 aa] {...   131   8e-32
Smik_7.93 Chr7 complement(158441..160132) [1692 bp, 563 aa] {ON}...   133   8e-32
Ecym_8095 Chr8 (205952..207106) [1155 bp, 384 aa] {ON} similar t...   130   8e-32
Smik_4.767 Chr4 complement(1353354..1355630) [2277 bp, 758 aa] {...   135   1e-31
Kpol_1054.2 s1054 complement(4365..7655) [3291 bp, 1096 aa] {ON}...   135   1e-31
CAGL0C03509g Chr3 complement(350846..353533) [2688 bp, 895 aa] {...   135   1e-31
TPHA0P01050 Chr16 complement(212259..215624) [3366 bp, 1121 aa] ...   135   2e-31
NDAI0H02470 Chr8 complement(597707..601942) [4236 bp, 1411 aa] {...   135   3e-31
ZYRO0A03894g Chr1 (307915..309273) [1359 bp, 452 aa] {ON} simila...   130   4e-31
YDR490C Chr4 complement(1431968..1434268) [2301 bp, 766 aa] {ON}...   133   4e-31
Skud_4.764 Chr4 complement(1351725..1353995) [2271 bp, 756 aa] {...   133   4e-31
TDEL0A07860 Chr1 (1365985..1368498) [2514 bp, 837 aa] {ON} Anc_6...   133   4e-31
AER264C Chr5 complement(1120017..1124468) [4452 bp, 1483 aa] {ON...   134   5e-31
NDAI0G04290 Chr7 complement(1030530..1033871) [3342 bp, 1113 aa]...   134   5e-31
Suva_2.666 Chr2 complement(1183839..1186133) [2295 bp, 764 aa] {...   132   6e-31
NDAI0B04700 Chr2 complement(1164332..1165918) [1587 bp, 528 aa] ...   130   6e-31
Kwal_23.3590 s23 complement(353755..355254) [1500 bp, 499 aa] {O...   130   7e-31
KNAG0G01250 Chr7 complement(280791..283364) [2574 bp, 857 aa] {O...   132   7e-31
CAGL0I07513g Chr9 (722045..725275) [3231 bp, 1076 aa] {ON} simil...   133   7e-31
Kwal_47.17263 s47 complement(321115..324498) [3384 bp, 1127 aa] ...   133   8e-31
NDAI0G03470 Chr7 complement(829975..832455) [2481 bp, 826 aa] {O...   132   9e-31
TBLA0C00720 Chr3 (149299..151149) [1851 bp, 616 aa] {ON} Anc_1.4...   130   1e-30
KLLA0C17160g Chr3 (1498959..1501454) [2496 bp, 831 aa] {ON} simi...   132   1e-30
KAFR0D01220 Chr4 (246927..250094) [3168 bp, 1055 aa] {ON} Anc_7....   132   1e-30
KLLA0D09328g Chr4 complement(788565..791705) [3141 bp, 1046 aa] ...   132   1e-30
Kpol_1018.54 s1018 (163688..166192) [2505 bp, 834 aa] {ON} (1636...   132   1e-30
NDAI0G03450 Chr7 (822716..825562) [2847 bp, 948 aa] {ON} Anc_8.141    132   2e-30
Ecym_3586 Chr3 complement(1112070..1115303) [3234 bp, 1077 aa] {...   132   2e-30
SAKL0A01254g Chr1 (119884..124560) [4677 bp, 1558 aa] {ON} simil...   132   2e-30
KNAG0J01290 Chr10 complement(230493..232019) [1527 bp, 508 aa] {...   128   2e-30
Smik_14.377 Chr14 (666338..669025) [2688 bp, 895 aa] {ON} YNR047...   131   2e-30
YNR047W Chr14 (708523..711204) [2682 bp, 893 aa] {ON}  FPK1Ser/T...   131   3e-30
ZYRO0B06512g Chr2 complement(521075..524410) [3336 bp, 1111 aa] ...   131   3e-30
AEL115C Chr5 complement(405062..406222) [1161 bp, 386 aa] {ON} S...   125   3e-30
KNAG0C02080 Chr3 complement(404332..405588) [1257 bp, 418 aa] {O...   126   3e-30
Skud_15.54 Chr15 (88576..91824) [3249 bp, 1082 aa] {ON} YOL100W ...   130   5e-30
YGL158W Chr7 (207033..208571) [1539 bp, 512 aa] {ON}  RCK1Protei...   127   5e-30
Smik_3.173 Chr3 complement(242285..246307) [4023 bp, 1340 aa] {O...   130   5e-30
TPHA0E03300 Chr5 (703575..704912) [1338 bp, 445 aa] {ON} Anc_1.1...   126   6e-30
KAFR0C01440 Chr3 complement(295468..298755) [3288 bp, 1095 aa] {...   130   6e-30
NCAS0F01580 Chr6 complement(313801..317949) [4149 bp, 1382 aa] {...   130   7e-30
TDEL0D03950 Chr4 (720229..721710) [1482 bp, 493 aa] {ON} Anc_3.2...   126   7e-30
KLTH0A07458g Chr1 (620459..623080) [2622 bp, 873 aa] {ON} simila...   129   9e-30
TPHA0D02740 Chr4 (566279..568819) [2541 bp, 846 aa] {ON} Anc_5.5...   129   1e-29
TPHA0M02080 Chr13 (426966..429635) [2670 bp, 889 aa] {ON} Anc_6....   129   1e-29
KLTH0D06006g Chr4 complement(532589..535453) [2865 bp, 954 aa] {...   129   1e-29
SAKL0D06534g Chr4 complement(538606..540091,540155..540237) [156...   126   1e-29
Skud_14.379 Chr14 (677081..679774) [2694 bp, 897 aa] {ON} YNR047...   129   1e-29
CAGL0G04609g Chr7 complement(437162..440059) [2898 bp, 965 aa] {...   129   1e-29
Kwal_0.155 s0 (84856..86619) [1764 bp, 587 aa] {ON} YLR248W (RCK...   127   1e-29
KNAG0K00680 Chr11 (120919..124206) [3288 bp, 1095 aa] {ON} Anc_3...   129   1e-29
SAKL0H24706g Chr8 (2145552..2149100) [3549 bp, 1182 aa] {ON} sim...   129   1e-29
SAKL0D08294g Chr4 (692455..693966) [1512 bp, 503 aa] {ON} some s...   125   2e-29
Kpol_1028.16 s1028 complement(45186..47825) [2640 bp, 879 aa] {O...   128   2e-29
Kwal_23.6458 s23 (1592349..1594955) [2607 bp, 868 aa] {ON} YNR04...   128   2e-29
SAKL0H24750g Chr8 complement(2152673..2155420) [2748 bp, 915 aa]...   128   2e-29
TDEL0B05820 Chr2 complement(1031136..1032863) [1728 bp, 575 aa] ...   126   2e-29
Kpol_1037.6 s1037 (12601..15534) [2934 bp, 977 aa] {ON} (12601.....   128   2e-29
ZYRO0B09196g Chr2 complement(721019..722569) [1551 bp, 516 aa] {...   125   2e-29
Smik_15.57 Chr15 (92331..95576) [3246 bp, 1081 aa] {ON} YOL100W ...   128   2e-29
NCAS0B07380 Chr2 complement(1396315..1397898) [1584 bp, 527 aa] ...   125   2e-29
Suva_7.106 Chr7 (202969..204540) [1572 bp, 523 aa] {ON} YGL158W ...   125   3e-29
KLLA0E03587g Chr5 complement(323764..325707) [1944 bp, 647 aa] {...   126   3e-29
Kpol_541.49 s541 complement(156530..159514) [2985 bp, 994 aa] {O...   127   4e-29
Suva_14.402 Chr14 (690198..692915) [2718 bp, 905 aa] {ON} YNR047...   127   4e-29
SAKL0C09174g Chr3 complement(833618..836833) [3216 bp, 1071 aa] ...   127   4e-29
NCAS0C04100 Chr3 (834997..837714) [2718 bp, 905 aa] {ON} Anc_8.141    127   4e-29
Kwal_47.17252 s47 (318148..320766) [2619 bp, 872 aa] {ON} YGL180...   127   5e-29
NCAS0A05570 Chr1 (1093653..1096409) [2757 bp, 918 aa] {ON} Anc_6...   127   5e-29
KNAG0E01390 Chr5 (275055..276776) [1722 bp, 573 aa] {ON} Anc_1.4...   124   7e-29
NDAI0K02390 Chr11 (537260..539920) [2661 bp, 886 aa] {ON} Anc_6....   126   8e-29
TBLA0B02310 Chr2 (539362..541821) [2460 bp, 819 aa] {ON} Anc_3.9...   126   8e-29
CAGL0C05005g Chr3 complement(467626..470856) [3231 bp, 1076 aa] ...   126   8e-29
KLTH0A06776g Chr1 complement(562932..567503) [4572 bp, 1523 aa] ...   127   8e-29
KLTH0H10318g Chr8 complement(888661..890128,890228..890316) [155...   124   8e-29
Kwal_23.6325 s23 complement(1533223..1537851) [4629 bp, 1542 aa]...   127   9e-29
Kwal_26.7861 s26 complement(544126..546993) [2868 bp, 955 aa] {O...   126   1e-28
ZYRO0A05214g Chr1 complement(418443..421268) [2826 bp, 941 aa] {...   125   1e-28
NCAS0J00960 Chr10 (157010..159121) [2112 bp, 703 aa] {ON}             125   1e-28
CAGL0B04301g Chr2 (420544..422172) [1629 bp, 542 aa] {ON} simila...   123   1e-28
KLTH0E06776g Chr5 complement(622147..625575) [3429 bp, 1142 aa] ...   126   1e-28
Skud_3.165 Chr3 (258916..261066) [2151 bp, 716 aa] {ON} YCR091W ...   125   1e-28
KAFR0B02140 Chr2 (417972..420662) [2691 bp, 896 aa] {ON} Anc_8.1...   125   2e-28
YGL179C Chr7 complement(163409..165091) [1683 bp, 560 aa] {ON}  ...   123   2e-28
KLTH0E06754g Chr5 (619163..621784) [2622 bp, 873 aa] {ON} simila...   125   2e-28
TPHA0H02630 Chr8 complement(614048..618151) [4104 bp, 1367 aa] {...   125   2e-28
KLLA0C08525g Chr3 (744554..749209) [4656 bp, 1551 aa] {ON} simil...   125   2e-28
YCR073C Chr3 complement(242588..246583) [3996 bp, 1331 aa] {ON} ...   125   2e-28
Kpol_183.1 s183 (158..2257) [2100 bp, 699 aa] {ON} (158..2257) [...   124   2e-28
TPHA0O01030 Chr15 complement(191875..193890) [2016 bp, 671 aa] {...   124   2e-28
CAGL0B03509g Chr2 complement(349638..351431) [1794 bp, 597 aa] {...   123   3e-28
ZYRO0G19074g Chr7 complement(1580648..1583413) [2766 bp, 921 aa]...   124   3e-28
KNAG0D00210 Chr4 complement(22721..25222) [2502 bp, 833 aa] {ON}...   124   3e-28
Skud_3.146 Chr3 complement(227229..231233) [4005 bp, 1334 aa] {O...   125   3e-28
KAFR0E01040 Chr5 complement(214744..216252) [1509 bp, 502 aa] {O...   121   3e-28
YCR091W Chr3 (274404..276566) [2163 bp, 720 aa] {ON}  KIN82Putat...   124   3e-28
KAFR0J02620 Chr10 complement(502187..504265) [2079 bp, 692 aa] {...   123   4e-28
NCAS0A05050 Chr1 complement(1002107..1004788) [2682 bp, 893 aa] ...   124   4e-28
Ecym_2499 Chr2 complement(976395..981020) [4626 bp, 1541 aa] {ON...   124   4e-28
Skud_1.44 Chr1 (95573..99643) [4071 bp, 1356 aa] {ON} YAL017W (R...   124   4e-28
Kpol_1037.52 s1037 complement(128841..130379) [1539 bp, 512 aa] ...   121   5e-28
TBLA0C01320 Chr3 complement(289223..290626) [1404 bp, 467 aa] {O...   120   5e-28
ZYRO0D17468g Chr4 (1439376..1441958) [2583 bp, 860 aa] {ON} weak...   124   5e-28
Kpol_1042.20 s1042 (45090..47261) [2172 bp, 723 aa] {ON} (45090....   123   5e-28
Kpol_1014.8 s1014 (13007..14368) [1362 bp, 453 aa] {ON} (13007.....   120   6e-28
NCAS0C03690 Chr3 (741930..744881) [2952 bp, 983 aa] {ON}              123   7e-28
NDAI0K02100 Chr11 complement(469575..472304) [2730 bp, 909 aa] {...   123   7e-28
AFR335C Chr6 complement(1046756..1049857) [3102 bp, 1033 aa] {ON...   123   7e-28
Skud_2.406 Chr2 (718522..720105) [1584 bp, 527 aa] {ON} YBR274W ...   121   7e-28
Ecym_2744 Chr2 complement(1442759..1444465) [1707 bp, 568 aa] {O...   121   7e-28
Kpol_1050.13 s1050 (34788..36578) [1791 bp, 596 aa] {ON} (34788....   122   7e-28
TPHA0B00240 Chr2 complement(44468..46525) [2058 bp, 685 aa] {ON}...   122   7e-28
Suva_3.110 Chr3 complement(160016..164146) [4131 bp, 1376 aa] {O...   124   7e-28
KLLA0F14190g Chr6 (1311121..1315137) [4017 bp, 1338 aa] {ON} uni...   123   8e-28
Smik_2.417 Chr2 (735214..736797) [1584 bp, 527 aa] {ON} YBR274W ...   120   9e-28
TDEL0D04460 Chr4 complement(813075..815816) [2742 bp, 913 aa] {O...   123   9e-28
KAFR0C03010 Chr3 (598970..601342) [2373 bp, 790 aa] {ON} Anc_8.1...   122   9e-28
TDEL0B04700 Chr2 (834336..836996) [2661 bp, 886 aa] {ON} Anc_8.1...   122   1e-27
TPHA0O01400 Chr15 complement(277678..279258) [1581 bp, 526 aa] {...   120   1e-27
SAKL0A00484g Chr1 complement(57938..60544) [2607 bp, 868 aa] {ON...   122   1e-27
KAFR0A01760 Chr1 complement(363462..366119) [2658 bp, 885 aa] {O...   122   1e-27
Kpol_1055.24 s1055 complement(57430..60243) [2814 bp, 937 aa] {O...   122   1e-27
YAL017W Chr1 (120225..124295) [4071 bp, 1356 aa] {ON}  PSK1One o...   123   1e-27
ZYRO0G02530g Chr7 (194463..196577) [2115 bp, 704 aa] {ON} highly...   122   1e-27
TBLA0A04720 Chr1 (1168895..1172683) [3789 bp, 1262 aa] {ON} Anc_...   123   1e-27
TDEL0H03640 Chr8 complement(600211..603924) [3714 bp, 1237 aa] {...   123   1e-27
KNAG0D00390 Chr4 (53459..58429) [4971 bp, 1656 aa] {ON} Anc_6.34...   123   1e-27
KLLA0B12716g Chr2 (1109939..1112089) [2151 bp, 716 aa] {ON} simi...   122   1e-27
NCAS0A12350 Chr1 complement(2446237..2447236,2447319..2448559) [...   122   1e-27
KAFR0C04780 Chr3 (948771..951131) [2361 bp, 786 aa] {ON} Anc_6.3...   122   2e-27
CAGL0F00913g Chr6 (97023..100643) [3621 bp, 1206 aa] {ON} simila...   122   2e-27
YKL126W Chr11 (205707..207749) [2043 bp, 680 aa] {ON}  YPK1Serin...   121   2e-27
Sklu_YGOB_Anc_2.496 Chr5 (185447..187306) [1860 bp, 619 aa] {ON}...   121   2e-27
CAGL0H06259g Chr8 (615045..619055) [4011 bp, 1336 aa] {ON} simil...   122   2e-27
YBR274W Chr2 (749594..751177) [1584 bp, 527 aa] {ON}  CHK1Serine...   120   2e-27
NCAS0A10290 Chr1 complement(2051582..2053111) [1530 bp, 509 aa] ...   119   2e-27
TBLA0C02940 Chr3 complement(706091..711022) [4932 bp, 1643 aa] {...   122   2e-27
Kwal_26.7154 s26 (237387..241028) [3642 bp, 1213 aa] {ON} YOL045...   122   2e-27
Ecym_6040 Chr6 complement(77854..80544) [2691 bp, 896 aa] {ON} s...   122   2e-27
CAGL0K07458g Chr11 complement(737165..739279) [2115 bp, 704 aa] ...   121   2e-27
CAGL0L06006g Chr12 complement(672704..675532) [2829 bp, 942 aa] ...   122   2e-27
NCAS0A05370 Chr1 complement(1061671..1066197) [4527 bp, 1508 aa]...   122   2e-27
TBLA0E02790 Chr5 complement(693136..695562) [2427 bp, 808 aa] {O...   121   2e-27
TDEL0E01710 Chr5 complement(330667..332706) [2040 bp, 679 aa] {O...   120   2e-27
TPHA0A04170 Chr1 (937692..939233) [1542 bp, 513 aa] {ON} Anc_3.2...   119   2e-27
Skud_11.103 Chr11 (192587..194629) [2043 bp, 680 aa] {ON} YMR104...   120   2e-27
TPHA0G03290 Chr7 (702953..705874) [2922 bp, 973 aa] {ON} Anc_2.4...   121   3e-27
KLLA0F12188g Chr6 (1122745..1124385) [1641 bp, 546 aa] {ON} some...   119   3e-27
KAFR0A01420 Chr1 (276454..280650) [4197 bp, 1398 aa] {ON} Anc_1....   122   3e-27
KLLA0B13607g Chr2 (1191592..1194561) [2970 bp, 989 aa] {ON} simi...   121   3e-27
NCAS0A09470 Chr1 complement(1883183..1887730) [4548 bp, 1515 aa]...   122   3e-27
KLLA0C18568g Chr3 (1639958..1642282) [2325 bp, 774 aa] {ON} simi...   120   3e-27
Smik_11.113 Chr11 (191688..193730) [2043 bp, 680 aa] {ON} YMR104...   120   3e-27
KLLA0F24618g Chr6 complement(2288943..2290613) [1671 bp, 556 aa]...   119   3e-27
AFR377C Chr6 complement(1116589..1118769) [2181 bp, 726 aa] {ON}...   120   4e-27
ACL053C Chr3 complement(273163..276708) [3546 bp, 1181 aa] {ON} ...   121   4e-27
TBLA0I02400 Chr9 complement(548975..554167) [5193 bp, 1730 aa] {...   121   4e-27
KAFR0I02100 Chr9 (431876..433258) [1383 bp, 460 aa] {ON} Anc_1.3...   117   4e-27
TDEL0F00930 Chr6 complement(160181..163573) [3393 bp, 1130 aa] {...   121   4e-27
TBLA0D02230 Chr4 (557816..561280) [3465 bp, 1154 aa] {ON} Anc_8....   121   4e-27
Kpol_1018.162 s1018 (414868..416904) [2037 bp, 678 aa] {ON} (414...   120   4e-27
TPHA0H00410 Chr8 (79426..82197) [2772 bp, 923 aa] {ON} Anc_8.141...   120   4e-27
SAKL0E03608g Chr5 complement(291806..294007) [2202 bp, 733 aa] {...   120   5e-27
YGL180W Chr7 (160065..162758) [2694 bp, 897 aa] {ON}  ATG1Protei...   120   5e-27
TBLA0D02240 Chr4 complement(561856..566547) [4692 bp, 1563 aa] {...   121   5e-27
Skud_7.114 Chr7 (211645..213153) [1509 bp, 502 aa] {ON} YGL158W ...   118   5e-27
ABL028W Chr2 (345953..348121) [2169 bp, 722 aa] {ON} Syntenic ho...   120   5e-27
TBLA0F00240 Chr6 complement(45510..49256) [3747 bp, 1248 aa] {ON...   120   5e-27
KAFR0A06190 Chr1 complement(1251546..1253690) [2145 bp, 714 aa] ...   119   6e-27
Kpol_1033.55 s1033 (138831..140555,140557..140895) [2064 bp, 687...   119   6e-27
NDAI0I00250 Chr9 (42174..44867) [2694 bp, 897 aa] {ON} Anc_3.177...   120   6e-27
Kwal_56.22788 s56 complement(281404..282951) [1548 bp, 515 aa] {...   117   7e-27
NCAS0D04710 Chr4 complement(901442..903856) [2415 bp, 804 aa] {O...   120   7e-27
Suva_11.99 Chr11 (192143..194197) [2055 bp, 684 aa] {ON} YMR104C...   119   7e-27
SAKL0D09240g Chr4 (764130..765761) [1632 bp, 543 aa] {ON} some s...   118   8e-27
TBLA0E02290 Chr5 complement(563483..567385) [3903 bp, 1300 aa] {...   120   8e-27
NDAI0K01370 Chr11 (313672..315714) [2043 bp, 680 aa] {ON}             119   8e-27
KNAG0D04810 Chr4 (867817..872139) [4323 bp, 1440 aa] {ON} Anc_7....   120   9e-27
NDAI0D04110 Chr4 (966439..967560) [1122 bp, 373 aa] {ON} Anc_4.192    115   9e-27
Smik_7.115 Chr7 (201140..202663) [1524 bp, 507 aa] {ON} YGL158W ...   117   9e-27
KNAG0I02670 Chr9 complement(524008..526734) [2727 bp, 908 aa] {O...   119   9e-27
TPHA0L00500 Chr12 (83710..86589) [2880 bp, 959 aa] {ON} Anc_7.86...   119   1e-26
ZYRO0B01166g Chr2 complement(97168..100059) [2892 bp, 963 aa] {O...   119   1e-26
Smik_1.50 Chr1 (103132..107205) [4074 bp, 1357 aa] {ON} YAL017W ...   120   1e-26
KLLA0F07623g Chr6 (720246..723935) [3690 bp, 1229 aa] {ON} simil...   120   1e-26
NCAS0A08770 Chr1 complement(1733181..1734890) [1710 bp, 569 aa] ...   118   1e-26
Kwal_55.20326 s55 complement(351010..353262) [2253 bp, 750 aa] {...   119   1e-26
TPHA0I00920 Chr9 (204753..209057) [4305 bp, 1434 aa] {ON} Anc_1....   120   1e-26
ZYRO0G15290g Chr7 complement(1237119..1241582) [4464 bp, 1487 aa...   120   1e-26
Smik_3.189 Chr3 (273885..276044) [2160 bp, 719 aa] {ON} YCR091W ...   119   1e-26
Suva_1.50 Chr1 (96474..100556) [4083 bp, 1360 aa] {ON} YAL017W (...   119   1e-26
Kwal_26.7635 s26 (451306..453381) [2076 bp, 691 aa] {ON} YKL126W...   118   1e-26
TBLA0B01630 Chr2 (360963..364850) [3888 bp, 1295 aa] {ON} Anc_3....   119   1e-26
CAGL0K03399g Chr11 complement(311316..313427) [2112 bp, 703 aa] ...   118   1e-26
ACL054W Chr3 (269703..272621) [2919 bp, 972 aa] {ON} Syntenic ho...   119   1e-26
Suva_4.223 Chr4 complement(395869..397719) [1851 bp, 616 aa] {ON...   118   1e-26
YJL095W Chr10 (247255..251691) [4437 bp, 1478 aa] {ON}  BCK1Mito...   119   1e-26
KNAG0C06060 Chr3 (1183766..1186654) [2889 bp, 962 aa] {ON} Anc_5...   119   1e-26
Kpol_487.14 s487 complement(56520..58394) [1875 bp, 624 aa] {ON}...   117   2e-26
CAGL0K02673g Chr11 complement(241338..244085) [2748 bp, 915 aa] ...   119   2e-26
KLTH0D03454g Chr4 (327039..331340) [4302 bp, 1433 aa] {ON} simil...   119   2e-26
TDEL0D02040 Chr4 (395555..397138) [1584 bp, 527 aa] {ON} Anc_1.3...   117   2e-26
KLTH0H12650g Chr8 (1072961..1074592) [1632 bp, 543 aa] {ON} simi...   117   2e-26
Suva_15.411 Chr15 (716095..718542) [2448 bp, 815 aa] {ON} YHR205...   118   2e-26
Suva_8.47 Chr8 complement(91615..94557) [2943 bp, 980 aa] {ON} Y...   119   2e-26
NDAI0I00340 Chr9 (65047..70557) [5511 bp, 1836 aa] {ON} Anc_6.341     119   2e-26
KNAG0I01360 Chr9 complement(262712..264556) [1845 bp, 614 aa] {O...   117   2e-26
Suva_4.535 Chr4 (921278..922861) [1584 bp, 527 aa] {ON} YBR274W ...   116   2e-26
Suva_7.82 Chr7 (156049..158751) [2703 bp, 900 aa] {ON} YGL180W (...   119   2e-26
Suva_14.385 Chr14 complement(661987..666732) [4746 bp, 1581 aa] ...   119   2e-26
Skud_4.225 Chr4 complement(400160..401992) [1833 bp, 610 aa] {ON...   117   2e-26
TBLA0I01370 Chr9 complement(294202..296526) [2325 bp, 774 aa] {O...   118   2e-26
Skud_8.39 Chr8 complement(76730..79501) [2772 bp, 923 aa] {ON} Y...   118   2e-26
Smik_8.42 Chr8 complement(74075..76894) [2820 bp, 939 aa] {ON} Y...   118   2e-26
KLTH0E04334g Chr5 complement(391495..393723) [2229 bp, 742 aa] {...   118   2e-26
NDAI0H02340 Chr8 complement(568767..570887) [2121 bp, 706 aa] {O...   117   3e-26
NCAS0A08610 Chr1 complement(1700839..1702704) [1866 bp, 621 aa] ...   117   3e-26
Smik_8.295 Chr8 (484074..486548) [2475 bp, 824 aa] {ON} YHR205W ...   118   3e-26
Kpol_1035.17 s1035 complement(39908..41503) [1596 bp, 531 aa] {O...   116   3e-26
TDEL0B06160 Chr2 complement(1086672..1088327) [1656 bp, 551 aa] ...   116   3e-26
YHR205W Chr8 (509363..511837) [2475 bp, 824 aa] {ON}  SCH9AGC fa...   117   3e-26
YNR031C Chr14 complement(680694..685433) [4740 bp, 1579 aa] {ON}...   118   3e-26
Smik_3.94 Chr3 (128344..130155) [1812 bp, 603 aa] {ON} YCR008W (...   116   3e-26
AER195C Chr5 complement(1005431..1006945) [1515 bp, 504 aa] {ON}...   115   3e-26
KLTH0H11858g Chr8 (1013677..1015374) [1698 bp, 565 aa] {ON} some...   116   3e-26
CAGL0M10153g Chr13 complement(1010688..1013291) [2604 bp, 867 aa...   117   3e-26
KAFR0K00700 Chr11 complement(153981..158126) [4146 bp, 1381 aa] ...   118   4e-26
KAFR0F03970 Chr6 (777047..778201) [1155 bp, 384 aa] {ON} Anc_4.1...   113   4e-26
KNAG0E00360 Chr5 (54187..55563) [1377 bp, 458 aa] {ON}                115   4e-26
KNAG0B05350 Chr2 complement(1034166..1036676) [2511 bp, 836 aa] ...   117   4e-26
TPHA0H00760 Chr8 complement(152442..155384) [2943 bp, 980 aa] {O...   118   4e-26
ZYRO0E04246g Chr5 complement(322215..324035) [1821 bp, 606 aa] {...   116   4e-26
Suva_3.33 Chr3 (42176..44020) [1845 bp, 614 aa] {ON} YCR008W (REAL)   116   4e-26
KAFR0D04950 Chr4 (971956..974982) [3027 bp, 1008 aa] {ON} Anc_5....   117   4e-26
TPHA0G02910 Chr7 (624676..626727) [2052 bp, 683 aa] {ON} Anc_2.4...   117   4e-26
ZYRO0A06446g Chr1 complement(513126..515957) [2832 bp, 943 aa] {...   117   4e-26
YHL007C Chr8 complement(95118..97937) [2820 bp, 939 aa] {ON}  ST...   117   4e-26
NCAS0A06440 Chr1 (1270771..1273020) [2250 bp, 749 aa] {ON} Anc_4...   117   4e-26
CAGL0K02167g Chr11 complement(192297..195785) [3489 bp, 1162 aa]...   118   4e-26
Kpol_463.8 s463 complement(18696..23039) [4344 bp, 1447 aa] {ON}...   118   4e-26
TPHA0C00160 Chr3 complement(17339..19603) [2265 bp, 754 aa] {ON}...   117   4e-26
NCAS0A02180 Chr1 (410419..411489) [1071 bp, 356 aa] {ON} Anc_4.192    112   5e-26
CAGL0L03520g Chr12 complement(403100..407443) [4344 bp, 1447 aa]...   118   5e-26
Skud_8.272 Chr8 (478199..480706) [2508 bp, 835 aa] {ON} YHR205W ...   117   5e-26
TDEL0A07560 Chr1 complement(1316498..1321225) [4728 bp, 1575 aa]...   118   5e-26
NDAI0A03870 Chr1 (867910..870597) [2688 bp, 895 aa] {ON} Anc_2.496    117   5e-26
YCR008W Chr3 (128470..130281) [1812 bp, 603 aa] {ON}  SAT4Ser/Th...   116   5e-26
Kwal_47.16761 s47 (100315..102549) [2235 bp, 744 aa] {ON} YHR205...   117   5e-26
KLTH0D04818g Chr4 (439491..441566) [2076 bp, 691 aa] {ON} simila...   116   5e-26
YDL025C Chr4 complement(405344..407206) [1863 bp, 620 aa] {ON}  ...   116   5e-26
NCAS0A04360 Chr1 (880768..882822) [2055 bp, 684 aa] {ON} Anc_2.446    116   6e-26
KLLA0C00979g Chr3 (73295..74746) [1452 bp, 483 aa] {ON} similar ...   114   6e-26
KLTH0D17204g Chr4 complement(1426818..1429085) [2268 bp, 755 aa]...   116   6e-26
Smik_7.92 Chr7 (155049..157742) [2694 bp, 897 aa] {ON} YGL180W (...   117   7e-26
NDAI0G05470 Chr7 (1340175..1344842) [4668 bp, 1555 aa] {ON} Anc_...   117   7e-26
TPHA0G02480 Chr7 (509815..511860) [2046 bp, 681 aa] {ON} Anc_2.4...   116   7e-26
TBLA0I00280 Chr9 (42870..46820) [3951 bp, 1316 aa] {ON} Anc_2.49...   117   7e-26
TDEL0D00330 Chr4 complement(55638..57872) [2235 bp, 744 aa] {ON}...   116   7e-26
SAKL0B12364g Chr2 (1060853..1063021) [2169 bp, 722 aa] {ON} high...   116   8e-26
Smik_4.209 Chr4 complement(385530..386995,387230..387623) [1860 ...   115   8e-26
Skud_7.91 Chr7 (165681..168374) [2694 bp, 897 aa] {ON} YGL180W (...   116   8e-26
Ecym_8399 Chr8 (821221..824766) [3546 bp, 1181 aa] {ON} similar ...   117   9e-26
NDAI0D03420 Chr4 (806856..809261) [2406 bp, 801 aa] {ON} Anc_4.384    116   9e-26
TDEL0E01820 Chr5 complement(348423..349403) [981 bp, 326 aa] {ON...   111   9e-26
KLTH0C08932g Chr3 (749308..750867) [1560 bp, 519 aa] {ON} simila...   114   9e-26
TPHA0H02390 Chr8 (561244..563436) [2193 bp, 730 aa] {ON} Anc_6.3...   115   1e-25
ZYRO0B07854g Chr2 complement(613992..616007) [2016 bp, 671 aa] {...   115   1e-25
TDEL0A02220 Chr1 (402496..404565) [2070 bp, 689 aa] {ON} Anc_2.4...   115   1e-25
Kwal_0.307 s0 (145676..147145) [1470 bp, 490 aa] {OFF} YCR008W (...   114   1e-25
KNAG0M00190 Chr13 complement(25224..27602) [2379 bp, 792 aa] {ON...   116   1e-25
TBLA0E04970 Chr5 (1272310..1273944) [1635 bp, 544 aa] {ON} Anc_4...   114   1e-25
Kwal_YGOB_0.307 s0 (145676..147175) [1500 bp, 500 aa] {ON} ANNOT...   114   1e-25
AFR092W Chr6 (595092..599363) [4272 bp, 1423 aa] {ON} Syntenic h...   117   1e-25
Suva_6.169 Chr6 complement(300200..304654) [4455 bp, 1484 aa] {O...   117   1e-25
Ecym_2434 Chr2 complement(843308..846676) [3369 bp, 1122 aa] {ON...   116   1e-25
KLLA0E11947g Chr5 complement(1060048..1061892) [1845 bp, 614 aa]...   115   1e-25
Skud_3.73 Chr3 (110742..112556) [1815 bp, 604 aa] {ON} YCR008W (...   115   1e-25
Ecym_6307 Chr6 (578677..580227) [1551 bp, 516 aa] {ON} similar t...   114   1e-25
NDAI0G05060 Chr7 complement(1227369..1229495) [2127 bp, 708 aa] ...   115   1e-25
KAFR0B06980 Chr2 (1452754..1455081) [2328 bp, 775 aa] {ON} Anc_4...   115   1e-25
Skud_10.119 Chr10 (215299..219744) [4446 bp, 1481 aa] {ON} YJL09...   116   1e-25
TBLA0A10690 Chr1 (2642723..2645632) [2910 bp, 969 aa] {ON} Anc_4...   116   1e-25
CAGL0K11550g Chr11 (1118971..1120587) [1617 bp, 538 aa] {ON} sim...   114   1e-25
TBLA0I01800 Chr9 complement(401728..403617) [1890 bp, 629 aa] {O...   115   1e-25
CAGL0B02739g Chr2 complement(262590..264620) [2031 bp, 676 aa] {...   115   2e-25
NDAI0H03460 Chr8 complement(836849..838726) [1878 bp, 625 aa] {O...   114   2e-25
NCAS0F01460 Chr6 complement(290441..292465) [2025 bp, 674 aa] {O...   115   2e-25
Skud_14.362 Chr14 complement(648801..653540) [4740 bp, 1579 aa] ...   116   2e-25
Ecym_6344 Chr6 complement(664647..668840) [4194 bp, 1397 aa] {ON...   116   2e-25
KLLA0C04191g Chr3 (384198..386591) [2394 bp, 797 aa] {ON} weakly...   115   2e-25
TPHA0M01840 Chr13 complement(380953..385818) [4866 bp, 1621 aa] ...   116   2e-25
KNAG0A06750 Chr1 (1053919..1056294) [2376 bp, 791 aa] {ON} Anc_2...   115   2e-25
Ecym_8400 Chr8 complement(825315..828515) [3201 bp, 1066 aa] {ON...   115   2e-25
SAKL0B09856g Chr2 complement(830531..834355) [3825 bp, 1274 aa] ...   115   2e-25
AEL083W Chr5 (470964..472574) [1611 bp, 536 aa] {ON} Syntenic ho...   113   3e-25
Kpol_1028.40 s1028 (95617..100392) [4776 bp, 1591 aa] {ON} (9561...   115   3e-25
NDAI0C01700 Chr3 complement(367077..370139) [3063 bp, 1020 aa] {...   115   3e-25
KAFR0D03390 Chr4 (667896..670292) [2397 bp, 798 aa] {ON} Anc_2.4...   114   3e-25
KLTH0G05214g Chr7 (423793..425754) [1962 bp, 653 aa] {ON} weakly...   114   3e-25
KAFR0D03020 Chr4 (596365..598398) [2034 bp, 677 aa] {ON} Anc_2.4...   114   3e-25
ADL389W Chr4 (27641..29776) [2136 bp, 711 aa] {ON} Syntenic homo...   114   3e-25
Kwal_26.7355 s26 (326867..331207) [4341 bp, 1446 aa] {ON} YJL095...   115   3e-25
KAFR0D03100 Chr4 complement(610106..611635) [1530 bp, 509 aa] {O...   112   3e-25
Suva_15.124 Chr15 (215781..219101) [3321 bp, 1106 aa] {ON} YOL04...   115   4e-25
KNAG0A06290 Chr1 (958438..960516) [2079 bp, 692 aa] {ON} Anc_2.4...   114   4e-25
Smik_13.290 Chr13 complement(457921..459951) [2031 bp, 676 aa] {...   114   4e-25
ZYRO0D05500g Chr4 (473262..477050) [3789 bp, 1262 aa] {ON} weakl...   115   4e-25
Ecym_4523 Chr4 (1039929..1042070) [2142 bp, 713 aa] {ON} similar...   114   4e-25
Ecym_3547 Chr3 complement(1034494..1036107) [1614 bp, 537 aa] {O...   112   4e-25
ZYRO0G00506g Chr7 complement(38488..40854) [2367 bp, 788 aa] {ON...   114   4e-25
TBLA0B08520 Chr2 complement(2038517..2041321) [2805 bp, 934 aa] ...   114   4e-25
KAFR0A05090 Chr1 (1011918..1013924) [2007 bp, 668 aa] {ON}            114   4e-25
KAFR0A08360 Chr1 complement(1677561..1680050) [2490 bp, 829 aa] ...   114   5e-25
ACR281C Chr3 complement(864528..868307) [3780 bp, 1259 aa] {ON} ...   114   5e-25
KNAG0B01780 Chr2 (326438..331180) [4743 bp, 1580 aa] {ON} Anc_1....   114   5e-25
YMR104C Chr13 complement(473420..475453) [2034 bp, 677 aa] {ON} ...   113   5e-25
TDEL0D01400 Chr4 (269367..273656) [4290 bp, 1429 aa] {ON} Anc_1....   114   5e-25
CAGL0F00649g Chr6 (71961..73505) [1545 bp, 514 aa] {ON} similar ...   112   5e-25
KNAG0I02830 Chr9 (549811..554358) [4548 bp, 1515 aa] {ON} Anc_1....   114   5e-25
KNAG0B04320 Chr2 complement(821265..824348) [3084 bp, 1027 aa] {...   114   6e-25
CAGL0F09075g Chr6 (894761..897001) [2241 bp, 746 aa] {ON} simila...   113   6e-25
NDAI0A07190 Chr1 (1636773..1638380) [1608 bp, 535 aa] {ON} Anc_3...   112   6e-25
NDAI0G05190 Chr7 complement(1258638..1260452) [1815 bp, 604 aa] ...   112   7e-25
Smik_14.360 Chr14 complement(638655..643406) [4752 bp, 1583 aa] ...   114   7e-25
KLTH0D02486g Chr4 (247566..251237) [3672 bp, 1223 aa] {ON} simil...   114   7e-25
Kpol_265.1 s265 (4826..7099) [2274 bp, 757 aa] {ON} (4826..7099)...   113   7e-25
KAFR0F04340 Chr6 (848844..853628) [4785 bp, 1594 aa] {ON} Anc_6....   114   8e-25
Suva_2.642 Chr2 (1147428..1148865,1149541..1150805) [2703 bp, 90...   113   8e-25
ZYRO0C02288g Chr3 complement(181604..184327) [2724 bp, 907 aa] {...   113   8e-25
NDAI0G03030 Chr7 (704910..708269) [3360 bp, 1119 aa] {ON}             114   8e-25
TPHA0H01630 Chr8 (371333..374443) [3111 bp, 1036 aa] {ON} Anc_5....   113   8e-25
KAFR0C00930 Chr3 complement(186877..189687) [2811 bp, 936 aa] {O...   113   9e-25
Smik_10.147 Chr10 (239101..243537) [4437 bp, 1478 aa] {ON} YJL09...   114   9e-25
KLLA0F01276g Chr6 complement(120001..121560) [1560 bp, 519 aa] {...   111   9e-25
Suva_13.281 Chr13 complement(455094..457136) [2043 bp, 680 aa] {...   112   1e-24
Ecym_2640 Chr2 complement(1232617..1236594) [3978 bp, 1325 aa] {...   114   1e-24
Skud_5.249 Chr5 complement(400867..404310) [3444 bp, 1147 aa] {O...   113   1e-24
SAKL0G06402g Chr7 (535632..537986) [2355 bp, 784 aa] {ON} simila...   112   1e-24
SAKL0D05522g Chr4 (437018..441442) [4425 bp, 1474 aa] {ON} simil...   113   1e-24
NCAS0D04600 Chr4 (875553..880604) [5052 bp, 1683 aa] {ON} Anc_6....   113   1e-24
NCAS0A07990 Chr1 complement(1578473..1581346) [2874 bp, 957 aa] ...   113   1e-24
SAKL0G01848g Chr7 (154547..157204) [2658 bp, 885 aa] {ON} weakly...   112   1e-24
CAGL0L07810g Chr12 complement(859653..861443) [1791 bp, 596 aa] ...   111   1e-24
TBLA0D04420 Chr4 complement(1097314..1099356) [2043 bp, 680 aa] ...   112   1e-24
YNL298W Chr14 (68915..71443) [2529 bp, 842 aa] {ON}  CLA4Cdc42p-...   112   1e-24
ADR167W Chr4 (994581..997202) [2622 bp, 873 aa] {ON} Syntenic ho...   112   1e-24
Ecym_7473 Chr7 (963826..966045) [2220 bp, 739 aa] {ON} similar t...   112   1e-24
Skud_2.141 Chr2 complement(264097..265677) [1581 bp, 526 aa] {ON...   110   1e-24
Skud_13.262 Chr13 complement(448758..450791) [2034 bp, 677 aa] {...   112   1e-24
KLTH0E16126g Chr5 complement(1427208..1429814) [2607 bp, 868 aa]...   112   1e-24
SAKL0B05082g Chr2 (436707..438896) [2190 bp, 729 aa] {ON} simila...   112   2e-24
KAFR0C05130 Chr3 (1018035..1019402) [1368 bp, 455 aa] {ON} Anc_7...   110   2e-24
KLLA0B13112g Chr2 complement(1146006..1148198) [2193 bp, 730 aa]...   112   2e-24
Ecym_6301 Chr6 complement(566248..567324) [1077 bp, 358 aa] {ON}...   108   2e-24
YOL045W Chr15 (243497..246802) [3306 bp, 1101 aa] {ON}  PSK2One ...   112   2e-24
Kpol_1044.3 s1044 (4910..5845,5849..7711) [2799 bp, 932 aa] {ON}...   112   2e-24
Suva_10.345 Chr10 (601536..603365) [1830 bp, 609 aa] {ON} YLR248...   111   2e-24
KLTH0G12738g Chr7 complement(1085500..1086804) [1305 bp, 434 aa]...   109   2e-24
ZYRO0E05170g Chr5 complement(390866..392593) [1728 bp, 575 aa] {...   110   2e-24
TBLA0I01310 Chr9 (279407..281245) [1839 bp, 612 aa] {ON} Anc_2.4...   111   2e-24
KLLA0B03586g Chr2 complement(326871..329075) [2205 bp, 734 aa] {...   111   2e-24
Smik_14.34 Chr14 (53272..55788) [2517 bp, 838 aa] {ON} YNL298W (...   112   2e-24
ZYRO0G19052g Chr7 (1576638..1580033) [3396 bp, 1131 aa] {ON} sim...   112   2e-24
AAL029W Chr1 (289989..291593) [1605 bp, 534 aa] {ON} Syntenic ho...   110   3e-24
ACL104C Chr3 complement(157357..160200) [2844 bp, 947 aa] {ON} S...   111   3e-24
NCAS0E02230 Chr5 (429499..430176,430250..431104) [1533 bp, 510 a...   109   3e-24
TPHA0O00670 Chr15 (125331..127088) [1758 bp, 585 aa] {ON} Anc_1....   110   3e-24
Smik_12.321 Chr12 (579087..580919) [1833 bp, 610 aa] {ON} YLR248...   110   3e-24
Kwal_27.9763 s27 (54483..57089) [2607 bp, 868 aa] {ON} YAR019C (...   111   3e-24
Ecym_2457 Chr2 (888054..890165) [2112 bp, 703 aa] {ON} similar t...   110   4e-24
SAKL0C12386g Chr3 complement(1108341..1110923) [2583 bp, 860 aa]...   111   4e-24
TBLA0A08290 Chr1 complement(2039328..2041376) [2049 bp, 682 aa] ...   110   4e-24
TDEL0A02720 Chr1 complement(491618..494365) [2748 bp, 915 aa] {O...   111   4e-24
KLTH0D01386g Chr4 (129448..130053,130132..130974) [1449 bp, 482 ...   108   5e-24
SAKL0C08844g Chr3 (811712..813307) [1596 bp, 531 aa] {ON} simila...   109   5e-24
Kwal_33.13112 s33 (76807..78324) [1518 bp, 505 aa] {ON} YDR523C ...   108   5e-24
CAGL0L12474g Chr12 complement(1347340..1348248) [909 bp, 302 aa]...   105   5e-24
KNAG0A02310 Chr1 complement(216545..217453) [909 bp, 302 aa] {ON...   105   6e-24
NDAI0A08560 Chr1 complement(1969778..1973731) [3954 bp, 1317 aa]...   111   6e-24
KAFR0K02490 Chr11 (515669..518356) [2688 bp, 895 aa] {ON} Anc_5....   110   6e-24
YLR362W Chr12 (849866..852019) [2154 bp, 717 aa] {ON}  STE11Sign...   110   6e-24
TPHA0P01270 Chr16 complement(254480..257137) [2658 bp, 885 aa] {...   110   6e-24
Suva_2.157 Chr2 complement(275484..277064) [1581 bp, 526 aa] {ON...   108   7e-24
Smik_15.122 Chr15 (209665..212970) [3306 bp, 1101 aa] {ON} YOL04...   110   7e-24
Skud_4.742 Chr4 (1315170..1317881) [2712 bp, 903 aa] {ON} YDR466...   110   8e-24
KNAG0L00520 Chr12 (79786..80892) [1107 bp, 368 aa] {ON} Anc_7.86...   106   8e-24
TBLA0A03570 Chr1 (892930..895857) [2928 bp, 975 aa] {ON} Anc_5.4...   110   8e-24
KAFR0C04590 Chr3 complement(917915..922321) [4407 bp, 1468 aa] {...   110   9e-24
Kwal_23.5290 s23 complement(1095011..1097470) [2460 bp, 819 aa] ...   110   9e-24
Kpol_1040.20 s1040 (57057..60950) [3894 bp, 1297 aa] {ON} (57057...   110   1e-23
Kpol_1031.10 s1031 (25064..28447) [3384 bp, 1127 aa] {ON} (25064...   110   1e-23
CAGL0M11748g Chr13 (1168856..1170199) [1344 bp, 447 aa] {ON} hig...   107   1e-23
Skud_14.40 Chr14 (62496..65006) [2511 bp, 836 aa] {ON} YNL298W (...   109   1e-23
KLTH0H08316g Chr8 (730027..731094) [1068 bp, 355 aa] {ON} simila...   105   1e-23
Skud_12.329 Chr12 (580813..582645) [1833 bp, 610 aa] {ON} YLR248...   108   1e-23
YLR248W Chr12 (634252..636084) [1833 bp, 610 aa] {ON}  RCK2Prote...   108   1e-23
KLTH0A01320g Chr1 (118671..121115) [2445 bp, 814 aa] {ON} simila...   109   1e-23
Kpol_1007.17 s1007 (32671..32687,32861..33767) [924 bp, 307 aa] ...   104   1e-23
TPHA0C01780 Chr3 complement(407048..407965) [918 bp, 305 aa] {ON...   104   1e-23
KNAG0F02900 Chr6 (549477..551426) [1950 bp, 649 aa] {ON}              108   1e-23
TPHA0H00420 Chr8 complement(82575..85691) [3117 bp, 1038 aa] {ON...   109   1e-23
CAGL0L11550g Chr12 (1232015..1235233) [3219 bp, 1072 aa] {ON} si...   109   1e-23
Suva_5.250 Chr5 (392904..396323) [3420 bp, 1139 aa] {ON} YER129W...   109   1e-23
Skud_15.112 Chr15 (202308..205613) [3306 bp, 1101 aa] {ON} YOL04...   109   2e-23
CAGL0M03729g Chr13 complement(420316..422901) [2586 bp, 861 aa] ...   109   2e-23
ABL011C Chr2 complement(378257..380362) [2106 bp, 701 aa] {ON} S...   108   2e-23
KNAG0K01240 Chr11 (243154..246096) [2943 bp, 980 aa] {ON} Anc_3....   109   2e-23
YHR102W Chr8 (316572..319814) [3243 bp, 1080 aa] {ON}  KIC1Prote...   109   2e-23
NCAS0H01940 Chr8 (374913..377960) [3048 bp, 1015 aa] {ON} Anc_5....   109   2e-23
KNAG0I00590 Chr9 (100275..102068) [1794 bp, 597 aa] {ON}              108   2e-23
Kwal_56.23841 s56 (732202..733500) [1299 bp, 432 aa] {ON} YLR113...   106   2e-23
TDEL0D04560 Chr4 (835822..837885) [2064 bp, 687 aa] {ON} Anc_3.1...   108   2e-23
SAKL0H11638g Chr8 complement(994049..994946,995016..995032) [915...   103   2e-23
NDAI0J01990 Chr10 (491491..493758) [2268 bp, 755 aa] {ON} Anc_4....   108   2e-23
NDAI0K01480 Chr11 complement(337108..338706) [1599 bp, 532 aa] {...   107   2e-23
ZYRO0D04752g Chr4 complement(397364..398215,398290..398907) [147...   107   2e-23
KLTH0F16676g Chr6 complement(1351362..1353998) [2637 bp, 878 aa]...   108   3e-23
KLLA0F20053g Chr6 (1867209..1868543) [1335 bp, 444 aa] {ON} high...   106   3e-23
KAFR0A03710 Chr1 (758918..760399) [1482 bp, 493 aa] {ON} Anc_8.6...   106   3e-23
YDR466W Chr4 (1395121..1397817) [2697 bp, 898 aa] {ON}  PKH3Prot...   108   3e-23
Kpol_530.41 s530 (94710..96326) [1617 bp, 538 aa] {ON} (94710..9...   107   3e-23
TDEL0E02180 Chr5 complement(408232..411195) [2964 bp, 987 aa] {O...   108   3e-23
KLTH0E11220g Chr5 (1005953..1005969,1006040..1006931) [909 bp, 3...   103   3e-23
ZYRO0C06776g Chr3 complement(508813..511485) [2673 bp, 890 aa] {...   108   3e-23
Kpol_1045.46 s1045 complement(106567..108372) [1806 bp, 601 aa] ...   107   3e-23
Kwal_55.21545 s55 complement(882294..884891) [2598 bp, 865 aa] {...   108   3e-23
Kwal_17.2687 s17 complement(6084..7172) [1089 bp, 362 aa] {ON} Y...   104   3e-23
SAKL0C07722g Chr3 (717419..720157) [2739 bp, 912 aa] {ON} simila...   108   3e-23
KAFR0H01530 Chr8 complement(283589..284509) [921 bp, 306 aa] {ON...   102   4e-23
TPHA0C04650 Chr3 complement(1006190..1007119) [930 bp, 309 aa] {...   102   4e-23
AFR019W Chr6 (471481..472560) [1080 bp, 359 aa] {ON} Syntenic ho...   103   4e-23
TBLA0H01330 Chr8 complement(297718..299163) [1446 bp, 481 aa] {O...   105   4e-23
SAKL0E03344g Chr5 (272024..273754) [1731 bp, 576 aa] {ON} simila...   106   4e-23
AEL185C Chr5 complement(291129..292676) [1548 bp, 515 aa] {ON} S...   106   5e-23
TPHA0B01010 Chr2 complement(229538..231634) [2097 bp, 698 aa] {O...   107   5e-23
NCAS0B04580 Chr2 (831695..835255) [3561 bp, 1186 aa] {ON} Anc_8....   108   5e-23
KNAG0B05880 Chr2 (1155395..1157695) [2301 bp, 766 aa] {ON} Anc_4...   107   5e-23
AGL242C Chr7 complement(246896..247790,247838..247854) [912 bp, ...   102   5e-23
Kpol_1066.45 s1066 complement(76786..79428) [2643 bp, 880 aa] {O...   107   5e-23
Kpol_1000.14 s1000 complement(36018..38015) [1998 bp, 665 aa] {O...   107   5e-23
NDAI0A06130 Chr1 complement(1391744..1394203) [2460 bp, 819 aa] ...   107   6e-23
AEL205W Chr5 (246871..249252) [2382 bp, 793 aa] {ON} Syntenic ho...   107   6e-23
KNAG0K02370 Chr11 complement(475088..477739) [2652 bp, 883 aa] {...   107   6e-23
Suva_15.297 Chr15 (518854..520850,520945..522172) [3225 bp, 1074...   107   7e-23
KLLA0E14785g Chr5 complement(1323743..1324675) [933 bp, 310 aa] ...   102   7e-23
Smik_12.173 Chr12 (351727..353034) [1308 bp, 435 aa] {ON} YLR113...   104   7e-23
Skud_12.181 Chr12 (354407..355702) [1296 bp, 431 aa] {ON} YLR113...   104   8e-23
KLTH0F00946g Chr6 (73412..74950) [1539 bp, 512 aa] {ON} similar ...   105   8e-23
ZYRO0D08184g Chr4 (706856..711601) [4746 bp, 1581 aa] {ON} simil...   107   8e-23
NCAS0A04440 Chr1 complement(895181..896935) [1755 bp, 584 aa] {O...   105   8e-23
CAGL0D02244g Chr4 complement(229504..230967) [1464 bp, 487 aa] {...   105   8e-23
Suva_10.202 Chr10 (380079..381386) [1308 bp, 435 aa] {ON} YLR113...   104   8e-23
AEL284C Chr5 complement(106480..107919) [1440 bp, 479 aa] {ON} S...   105   8e-23
Ecym_3525 Chr3 (993328..995784) [2457 bp, 818 aa] {ON} similar t...   107   9e-23
TDEL0E00690 Chr5 (144269..146770) [2502 bp, 833 aa] {ON} Anc_3.6...   107   9e-23
Ecym_6136 Chr6 complement(248721..250187) [1467 bp, 488 aa] {ON}...   104   1e-22
NCAS0C02470 Chr3 complement(460460..461378,461483..461499) [936 ...   102   1e-22
TDEL0B01540 Chr2 complement(272561..273458,273562..273578) [915 ...   101   1e-22
NCAS0C03380 Chr3 complement(664012..665310) [1299 bp, 432 aa] {O...   103   1e-22
Smik_4.745 Chr4 (1316457..1319201) [2745 bp, 914 aa] {ON} YDR466...   106   1e-22
Skud_4.97 Chr4 (168099..169670) [1572 bp, 523 aa] {ON} YDL159W (...   105   1e-22
ABR014W Chr2 (417708..420623) [2916 bp, 971 aa] {ON} Syntenic ho...   106   1e-22
Kpol_541.48 s541 (152877..153692,153695..156046) [3168 bp, 1055 ...   106   1e-22
KNAG0D02140 Chr4 complement(362745..365357) [2613 bp, 870 aa] {O...   106   1e-22
SAKL0H16038g Chr8 complement(1401627..1402931) [1305 bp, 434 aa]...   103   1e-22
Skud_4.146 Chr4 (263181..263196,263281..264173) [909 bp, 302 aa]...   101   1e-22
KLTH0G18194g Chr7 (1570885..1572132) [1248 bp, 415 aa] {ON} weak...   103   2e-22
Smik_12.450 Chr12 (788896..791106) [2211 bp, 736 aa] {ON} YLR362...   105   2e-22
Suva_14.42 Chr14 (65645..68239) [2595 bp, 864 aa] {ON} YNL298W (...   106   2e-22
ADR379C Chr4 complement(1386598..1388076) [1479 bp, 492 aa] {ON}...   104   2e-22
CAGL0I05390g Chr9 complement(508677..510041) [1365 bp, 454 aa] {...   103   2e-22
TBLA0F00820 Chr6 (209607..211844) [2238 bp, 745 aa] {ON} Anc_3.1...   105   2e-22
NCAS0A09960 Chr1 complement(1993554..1995926) [2373 bp, 790 aa] ...   105   2e-22
Skud_8.163 Chr8 (290415..293645) [3231 bp, 1076 aa] {ON} YHR102W...   106   2e-22
Kpol_543.55 s543 (126256..127533) [1278 bp, 425 aa] {ON} (126256...   103   2e-22
Kwal_14.1273 s14 complement(259953..261200) [1248 bp, 415 aa] {O...   102   2e-22
KNAG0A03060 Chr1 complement(375640..377142) [1503 bp, 500 aa] {O...   103   2e-22
Suva_16.286 Chr16 complement(495354..496254,496351..496367) [918...   100   2e-22
NCAS0I00470 Chr9 (74336..77584) [3249 bp, 1082 aa] {ON} Anc_7.86      105   2e-22
Skud_11.113 Chr11 complement(207796..209355) [1560 bp, 519 aa] {...   103   2e-22
Smik_4.79 Chr4 (149246..150796) [1551 bp, 516 aa] {ON} YDL159W (...   103   2e-22
Smik_8.180 Chr8 (292993..296214) [3222 bp, 1073 aa] {ON} YHR102W...   105   3e-22
Kwal_47.18307 s47 complement(776521..778386) [1866 bp, 621 aa] {...   104   3e-22
Ecym_6425 Chr6 (825834..828095) [2262 bp, 753 aa] {ON} similar t...   105   3e-22
ADR300C Chr4 complement(1222344..1225016) [2673 bp, 890 aa] {ON}...   105   3e-22
TDEL0A04580 Chr1 (816247..818331) [2085 bp, 694 aa] {ON} Anc_5.5...   104   3e-22
NDAI0H01020 Chr8 complement(225366..228566) [3201 bp, 1066 aa] {...   105   3e-22
NDAI0A00940 Chr1 complement(193710..195800) [2091 bp, 696 aa] {O...   104   3e-22
Skud_16.251 Chr16 complement(457106..458006,458108..458124) [918...   100   3e-22
Ecym_4266 Chr4 complement(564935..566329) [1395 bp, 464 aa] {ON}...   103   3e-22
YPL031C Chr16 complement(492018..492918,493021..493037) [918 bp,...   100   3e-22
Smik_10.65 Chr10 complement(104987..107545) [2559 bp, 852 aa] {O...   105   3e-22
Smik_4.128 Chr4 (244339..244354,244439..245331) [909 bp, 302 aa]...   100   3e-22
YBR028C Chr2 complement(294425..296002) [1578 bp, 525 aa] {ON}  ...   103   3e-22
CAGL0K01661g Chr11 complement(147781..149229) [1449 bp, 482 aa] ...   103   4e-22
Ecym_6196 Chr6 (364576..365652) [1077 bp, 358 aa] {ON} similar t...   101   4e-22
SAKL0H07128g Chr8 complement(623681..625141) [1461 bp, 486 aa] {...   103   4e-22
Smik_5.275 Chr5 (426176..429601) [3426 bp, 1141 aa] {ON} YER129W...   105   4e-22
NCAS0D00710 Chr4 (122875..124737) [1863 bp, 620 aa] {ON}              103   4e-22
TBLA0H01660 Chr8 complement(377521..380511) [2991 bp, 996 aa] {O...   105   4e-22
YER129W Chr5 (417281..420709) [3429 bp, 1142 aa] {ON}  SAK1Upstr...   105   4e-22
ZYRO0F08074g Chr6 (654009..654025,654107..655004) [915 bp, 304 a...   100   4e-22
TBLA0F02350 Chr6 complement(578797..580467) [1671 bp, 556 aa] {O...   103   4e-22
YPL140C Chr16 complement(287514..289034) [1521 bp, 506 aa] {ON} ...   103   5e-22
KLLA0D11990g Chr4 complement(1022895..1023792,1023928..1023944) ...   100   5e-22
NDAI0E03170 Chr5 complement(677441..678392,678524..678543) [972 ...   100   5e-22
NDAI0B02500 Chr2 (625206..629036) [3831 bp, 1276 aa] {ON} Anc_8....   104   5e-22
ZYRO0D06182g Chr4 complement(529121..530416) [1296 bp, 431 aa] {...   102   5e-22
AGR048C Chr7 complement(807464..808825) [1362 bp, 453 aa] {ON} S...   102   6e-22
ZYRO0C13156g Chr3 complement(1041022..1042068) [1047 bp, 348 aa]...   100   6e-22
KNAG0G02300 Chr7 (528489..529748) [1260 bp, 419 aa] {ON} Anc_8.3...   101   6e-22
KLTH0G17512g Chr7 complement(1518329..1519426) [1098 bp, 365 aa]...   100   6e-22
Smik_2.146 Chr2 complement(275270..276850) [1581 bp, 526 aa] {ON...   102   6e-22
TDEL0C02110 Chr3 (364853..366340) [1488 bp, 495 aa] {ON} Anc_7.3...   102   6e-22
TDEL0H04100 Chr8 complement(706443..707306,707369..707974) [1470...   102   6e-22
KNAG0A05580 Chr1 (830643..831560) [918 bp, 305 aa] {ON} Anc_2.33...    99   6e-22
YDL108W Chr4 (267698..267725,267807..268699) [921 bp, 306 aa] {O...    99   6e-22
KLLA0C14278g Chr3 (1240990..1242615) [1626 bp, 541 aa] {ON} simi...   102   7e-22
AGR334W Chr7 (1355098..1356693) [1596 bp, 531 aa] {ON} Syntenic ...   102   7e-22
Kwal_14.2497 s14 complement(784224..785480) [1257 bp, 418 aa] {O...   101   7e-22
Ecym_5505 Chr5 (1027605..1030616) [3012 bp, 1003 aa] {ON} simila...   103   8e-22
TPHA0N00370 Chr14 (68298..69650) [1353 bp, 450 aa] {ON} Anc_7.41...   101   8e-22
Kpol_1041.9 s1041 (27806..29059) [1254 bp, 417 aa] {ON} (27806.....   100   9e-22
CAGL0H10318g Chr8 complement(1006299..1007222) [924 bp, 307 aa] ...    99   1e-21
Skud_12.447 Chr12 (790003..792210) [2208 bp, 735 aa] {ON} YLR362...   103   1e-21
KLLA0E06447g Chr5 complement(577669..581154) [3486 bp, 1161 aa] ...   103   1e-21
Suva_10.464 Chr10 (809505..811721) [2217 bp, 738 aa] {ON} YLR362...   103   1e-21
Suva_8.405 Chr8 complement(730738..732348) [1611 bp, 536 aa] {ON...   102   1e-21
YKL116C Chr11 complement(221344..222900) [1557 bp, 518 aa] {ON} ...   102   1e-21
Suva_4.87 Chr4 (160236..161810) [1575 bp, 524 aa] {ON} YDL159W (...   102   1e-21
TPHA0L01240 Chr12 (263357..264814) [1458 bp, 485 aa] {ON} Anc_8....   101   1e-21
NCAS0B05560 Chr2 complement(1050313..1051371) [1059 bp, 352 aa] ...    99   1e-21
KLLA0A07403g Chr1 (661261..663900) [2640 bp, 879 aa] {ON} simila...   103   1e-21
NCAS0B06000 Chr2 complement(1134919..1135808,1135909..1135957) [...    99   1e-21
Suva_14.158 Chr14 complement(289281..291650) [2370 bp, 789 aa] {...   102   1e-21
KNAG0G01430 Chr7 complement(322758..323822) [1065 bp, 354 aa] {O...    99   1e-21
Skud_15.519 Chr15 complement(932720..934216) [1497 bp, 498 aa] {...   101   1e-21
TPHA0B01520 Chr2 complement(336164..339616) [3453 bp, 1150 aa] {...   103   1e-21
KNAG0C04310 Chr3 complement(842994..846503) [3510 bp, 1169 aa] {...   103   1e-21
Kwal_26.7682 s26 complement(470565..472121) [1557 bp, 518 aa] {O...   101   1e-21
SAKL0F11110g Chr6 (868447..869832) [1386 bp, 461 aa] {ON} simila...   100   1e-21
SAKL0H11748g Chr8 complement(1002207..1003541) [1335 bp, 444 aa]...   100   2e-21
CAGL0K06479g Chr11 (637125..640100) [2976 bp, 991 aa] {ON} some ...   103   2e-21
KAFR0G01080 Chr7 complement(243965..247417) [3453 bp, 1150 aa] {...   103   2e-21
Suva_16.170 Chr16 complement(296877..298406) [1530 bp, 509 aa] {...   101   2e-21
NCAS0C02510 Chr3 complement(468113..469390) [1278 bp, 425 aa] {O...   100   2e-21
KLLA0E21693g Chr5 complement(1936438..1939488) [3051 bp, 1016 aa...   102   2e-21
Suva_11.108 Chr11 complement(207520..209070) [1551 bp, 516 aa] {...   101   2e-21
ZYRO0G02816g Chr7 complement(213421..214980) [1560 bp, 519 aa] {...   101   2e-21
Ecym_2531 Chr2 (1034031..1034047,1034135..1035023) [906 bp, 301 ...    98   2e-21
Kwal_27.10004 s27 complement(156153..158360) [2208 bp, 735 aa] {...   102   2e-21
NDAI0B02900 Chr2 complement(737651..738709) [1059 bp, 352 aa] {O...    99   2e-21
Kwal_14.1416 s14 (315842..316939) [1098 bp, 365 aa] {ON} YGR040W...    99   2e-21
KLLA0E17073g Chr5 complement(1515721..1518279) [2559 bp, 852 aa]...   102   2e-21
TBLA0A08430 Chr1 complement(2075682..2076773) [1092 bp, 363 aa] ...    99   2e-21
YLR113W Chr12 (371620..372927) [1308 bp, 435 aa] {ON}  HOG1Mitog...   100   2e-21
TDEL0C03050 Chr3 (545862..549299) [3438 bp, 1145 aa] {ON} Anc_7....   102   3e-21
ZYRO0B04796g Chr2 (385611..387683) [2073 bp, 690 aa] {ON} simila...   101   3e-21
NDAI0G02700 Chr7 complement(618268..619611) [1344 bp, 447 aa] {O...   100   3e-21
YBL105C Chr2 complement(14241..17696) [3456 bp, 1151 aa] {ON}  P...   102   3e-21
Smik_11.125 Chr11 complement(208208..209764) [1557 bp, 518 aa] {...   100   3e-21
Ecym_4647 Chr4 (1261859..1263511) [1653 bp, 550 aa] {ON} similar...   100   3e-21
Kwal_33.14434 s33 complement(672031..674310) [2280 bp, 759 aa] {...   101   3e-21
TBLA0F01550 Chr6 complement(385184..386716) [1533 bp, 510 aa] {O...   100   3e-21
KLTH0B07106g Chr2 (571005..573260) [2256 bp, 751 aa] {ON} simila...   101   3e-21
NCAS0A14050 Chr1 complement(2763082..2764551) [1470 bp, 489 aa] ...   100   3e-21
Suva_2.11 Chr2 complement(17473..18858) [1386 bp, 461 aa] {ON} Y...   100   3e-21
Suva_6.246 Chr6 (439815..442373) [2559 bp, 852 aa] {ON} YJL165C ...   101   4e-21
Skud_16.141 Chr16 complement(259166..260707) [1542 bp, 513 aa] {...   100   4e-21
KAFR0B02980 Chr2 (623470..624804) [1335 bp, 444 aa] {ON} Anc_8.3...    99   4e-21
Skud_15.397 Chr15 (711559..713082) [1524 bp, 507 aa] {ON} YOR231...   100   4e-21
Skud_1.72 Chr1 (141337..144261) [2925 bp, 974 aa] {ON} YAR019C (...   101   4e-21
ZYRO0F13310g Chr6 (1092612..1096322) [3711 bp, 1236 aa] {ON} som...   102   4e-21
YDL159W Chr4 (172481..174028) [1548 bp, 515 aa] {ON}  STE7Signal...   100   5e-21
Kpol_520.17 s520 complement(37953..41447) [3495 bp, 1164 aa] {ON...   101   5e-21
NCAS0I02060 Chr9 (386630..388573) [1944 bp, 647 aa] {ON} Anc_3.1...   100   5e-21
KLTH0B09042g Chr2 (736520..738112) [1593 bp, 530 aa] {ON} simila...   100   5e-21
NCAS0E03010 Chr5 (599358..602810) [3453 bp, 1150 aa] {ON} Anc_7....   101   5e-21
Smik_15.535 Chr15 complement(940569..942050) [1482 bp, 493 aa] {...   100   5e-21
CAGL0J04290g Chr10 complement(403542..404615) [1074 bp, 357 aa] ...    98   5e-21
Skud_10.49 Chr10 complement(81651..84206) [2556 bp, 851 aa] {ON}...   101   6e-21
KLTH0F04730g Chr6 complement(417013..419133) [2121 bp, 706 aa] {...   100   6e-21
Kpol_1031.67 s1031 (174170..175663) [1494 bp, 497 aa] {ON} (1741...    99   7e-21
Ecym_1508 Chr1 (1045857..1050941) [5085 bp, 1694 aa] {ON} simila...   101   7e-21
ADR058C Chr4 complement(810939..811826) [888 bp, 295 aa] {ON} Sy...    96   7e-21
Smik_6.338 Chr6 (535192..536727) [1536 bp, 511 aa] {ON} YPL140C ...    99   7e-21
NCAS0B08300 Chr2 (1582859..1584796) [1938 bp, 645 aa] {ON} Anc_1...   100   8e-21
TBLA0I00910 Chr9 complement(170526..173945) [3420 bp, 1139 aa] {...   100   8e-21
Ecym_3371 Chr3 (706573..706597,706675..707570) [921 bp, 306 aa] ...    96   8e-21
Ecym_4652 Chr4 (1272725..1276156) [3432 bp, 1143 aa] {ON} simila...   100   8e-21
KLLA0A02497g Chr1 (218592..219680) [1089 bp, 362 aa] {ON} highly...    97   8e-21
NDAI0E04610 Chr5 (1042690..1046154) [3465 bp, 1154 aa] {ON} Anc_...   100   9e-21
ABL055C Chr2 complement(295495..297105) [1611 bp, 536 aa] {ON} S...    99   9e-21
Suva_8.282 Chr8 (511665..513185) [1521 bp, 506 aa] {ON} YOR231W ...    99   1e-20
TPHA0A01630 Chr1 complement(328040..329347) [1308 bp, 435 aa] {O...    98   1e-20
CAGL0K04301g Chr11 (405248..406315) [1068 bp, 355 aa] {ON} simil...    97   1e-20
TPHA0C02880 Chr3 (623723..624778) [1056 bp, 351 aa] {ON} Anc_8.1...    97   1e-20
ACL191C Chr3 complement(26475..27572) [1098 bp, 365 aa] {ON} Syn...    97   1e-20
ADL283W Chr4 (205173..205197,205250..206145) [921 bp, 306 aa] {O...    96   1e-20
Smik_15.415 Chr15 (722292..723815) [1524 bp, 507 aa] {ON} YOR231...    99   1e-20
ACR191C Chr3 complement(680398..683847) [3450 bp, 1149 aa] {ON} ...   100   1e-20
KNAG0G01240 Chr7 (277868..280597) [2730 bp, 909 aa] {ON} Anc_8.1...   100   1e-20
KLLA0D08415g Chr4 (714473..716797) [2325 bp, 774 aa] {ON} simila...   100   1e-20
TDEL0G02620 Chr7 (501589..501613,501677..502566) [915 bp, 304 aa...    96   1e-20
SAKL0C07458g Chr3 complement(687452..689395) [1944 bp, 647 aa] {...    99   1e-20
NDAI0E01310 Chr5 complement(260484..262094) [1611 bp, 536 aa] {O...    99   1e-20
TDEL0A02330 Chr1 complement(420205..421662) [1458 bp, 485 aa] {O...    98   1e-20
Kpol_1002.111 s1002 (277615..278664) [1050 bp, 349 aa] {ON} (277...    96   1e-20
Smik_2.13 Chr2 complement(14021..17473) [3453 bp, 1150 aa] {ON} ...   100   1e-20
Smik_2.14 Chr2 complement(14021..17473) [3453 bp, 1150 aa] {ON} ...   100   1e-20
NCAS0F02190 Chr6 complement(435844..437706) [1863 bp, 620 aa] {O...    99   2e-20
KLLA0C04213g Chr3 (386815..387999) [1185 bp, 394 aa] {ON} simila...    97   2e-20
NDAI0C05340 Chr3 (1236394..1237296) [903 bp, 300 aa] {ON}              95   2e-20
Kwal_27.10581 s27 complement(403249..406713) [3465 bp, 1154 aa] ...   100   2e-20
ZYRO0F06798g Chr6 (558198..559676) [1479 bp, 492 aa] {ON} simila...    98   2e-20
Smik_2.101 Chr2 (186008..187069) [1062 bp, 353 aa] {ON} YBL016W ...    96   2e-20
TBLA0B09590 Chr2 (2272405..2273328) [924 bp, 307 aa] {ON} Anc_2....    95   2e-20
Kwal_26.8703 s26 (905007..906341) [1335 bp, 444 aa] {ON} YOR231W...    97   2e-20
TDEL0F00840 Chr6 (144884..146875) [1992 bp, 663 aa] {ON} Anc_2.9...    99   2e-20
Ecym_7414 Chr7 (848665..850440) [1776 bp, 591 aa] {ON} similar t...    99   2e-20
Skud_2.4 Chr2 complement(4805..8260) [3456 bp, 1151 aa] {ON} YBL...   100   2e-20
TPHA0O01620 Chr15 (321912..324359) [2448 bp, 815 aa] {ON} Anc_2....    99   2e-20
KAFR0C02840 Chr3 (559821..560873) [1053 bp, 350 aa] {ON} Anc_8.1...    96   2e-20
KAFR0A06790 Chr1 complement(1371892..1372806) [915 bp, 304 aa] {...    95   2e-20
KLLA0A06820g Chr1 complement(615686..618004) [2319 bp, 772 aa] {...    99   2e-20
KLTH0D05082g Chr4 complement(457124..458680) [1557 bp, 518 aa] {...    98   2e-20
KLTH0F06578g Chr6 complement(568519..570309) [1791 bp, 596 aa] {...    98   2e-20
SAKL0F13618g Chr6 (1085967..1089494) [3528 bp, 1175 aa] {ON} sim...    99   2e-20
Ecym_1030 Chr1 (56043..57365) [1323 bp, 440 aa] {ON} similar to ...    97   2e-20
TDEL0G00630 Chr7 complement(128151..129764) [1614 bp, 537 aa] {O...    98   3e-20
Smik_1.79 Chr1 complement(149839..152763) [2925 bp, 974 aa] {ON}...    99   3e-20
Kpol_534.14 s534 (34465..34591,34724..35616) [1020 bp, 339 aa] {...    96   3e-20
YOR231W Chr15 (772601..774127) [1527 bp, 508 aa] {ON}  MKK1Mitog...    97   3e-20
KNAG0E03200 Chr5 complement(641437..646020) [4584 bp, 1527 aa] {...    99   3e-20
ZYRO0A07062g Chr1 (576600..576615,576675..577561) [903 bp, 300 a...    94   3e-20
ADR174C Chr4 complement(1008796..1010811) [2016 bp, 671 aa] {ON}...    98   3e-20
KAFR0B04630 Chr2 (964764..966302) [1539 bp, 512 aa] {ON} Anc_1.3...    97   3e-20
Kwal_27.11803 s27 (952938..953678) [741 bp, 246 aa] {ON} YPL031C...    93   3e-20
Smik_11.60 Chr11 complement(116793..118970) [2178 bp, 725 aa] {O...    98   3e-20
YOR351C Chr15 complement(995018..996511) [1494 bp, 497 aa] {ON} ...    97   3e-20
TDEL0F04290 Chr6 (801456..802739) [1284 bp, 427 aa] {ON} Anc_8.3...    96   3e-20
NCAS0B02350 Chr2 complement(394128..395018) [891 bp, 296 aa] {ON...    94   3e-20
TPHA0G02990 Chr7 complement(640488..642098) [1611 bp, 536 aa] {O...    97   4e-20
SAKL0H19668g Chr8 (1736301..1737674) [1374 bp, 457 aa] {ON} high...    97   4e-20
ACR196C Chr3 complement(692321..693913) [1593 bp, 530 aa] {ON} S...    97   4e-20
KAFR0A07560 Chr1 (1525225..1527504) [2280 bp, 759 aa] {ON} Anc_2...    98   4e-20
KLTH0C05478g Chr3 complement(471760..475254) [3495 bp, 1164 aa] ...    99   4e-20
SAKL0B11044g Chr2 complement(962142..962940,963019..963086,96315...    97   5e-20
ZYRO0F11418g Chr6 complement(936573..938117) [1545 bp, 514 aa] {...    97   5e-20
YAR019C Chr1 complement(172211..175135) [2925 bp, 974 aa] {ON}  ...    98   5e-20
ACR218W Chr3 (731433..736142) [4710 bp, 1569 aa] {ON} Syntenic h...    99   5e-20
TDEL0A05980 Chr1 (1049221..1050771) [1551 bp, 516 aa] {ON} Anc_8...    97   5e-20
YJL165C Chr10 complement(106894..109461) [2568 bp, 855 aa] {ON} ...    98   5e-20
NCAS0B01450 Chr2 (237824..239341) [1518 bp, 505 aa] {ON} Anc_8.652     97   5e-20
NCAS0D00400 Chr4 complement(61545..63716) [2172 bp, 723 aa] {ON}...    98   5e-20
SAKL0G08250g Chr7 (703212..705707) [2496 bp, 831 aa] {ON} simila...    98   6e-20
SAKL0C00946g Chr3 (84995..86689) [1695 bp, 564 aa] {ON} similar ...    97   7e-20
NDAI0B03310 Chr2 complement(844616..845557) [942 bp, 313 aa] {ON...    94   7e-20
TPHA0D03940 Chr4 (825250..826989) [1740 bp, 579 aa] {ON} Anc_3.4...    97   7e-20
Kpol_1033.63 s1033 complement(158652..160205) [1554 bp, 517 aa] ...    96   7e-20
Kwal_33.14192 s33 complement(563582..565315) [1734 bp, 577 aa] {...    97   7e-20
KLTH0F09504g Chr6 (824743..824770,824831..825729) [927 bp, 308 a...    93   7e-20
CAGL0M09361g Chr13 complement(928484..931918) [3435 bp, 1144 aa]...    98   7e-20
KAFR0C03020 Chr3 complement(601565..603121) [1557 bp, 518 aa] {O...    96   8e-20
Ecym_2566 Chr2 (1105239..1106126) [888 bp, 295 aa] {ON} similar ...    93   8e-20
Ecym_6145 Chr6 complement(266766..267863) [1098 bp, 365 aa] {ON}...    94   8e-20
KNAG0A06390 Chr1 complement(974644..976254) [1611 bp, 536 aa] {O...    96   8e-20
TPHA0F02870 Chr6 complement(636574..638259) [1686 bp, 561 aa] {O...    96   8e-20
Ecym_2357 Chr2 (700079..701914) [1836 bp, 611 aa] {ON} similar t...    97   9e-20
Kpol_1072.31 s1072 complement(67104..68684) [1581 bp, 526 aa] {O...    96   9e-20
Skud_16.398 Chr16 (712145..713827) [1683 bp, 560 aa] {ON} YPR111...    96   9e-20
CAGL0H07535g Chr8 (736241..737137) [897 bp, 298 aa] {ON} highly ...    93   9e-20
YKL168C Chr11 complement(131288..133462) [2175 bp, 724 aa] {ON} ...    97   9e-20
SAKL0E12958g Chr5 (1066434..1068653) [2220 bp, 739 aa] {ON} simi...    97   9e-20
ADR313W Chr4 (1255930..1257666) [1737 bp, 578 aa] {ON} Syntenic ...    96   9e-20
KLTH0C02662g Chr3 complement(240347..242674) [2328 bp, 775 aa] {...    97   1e-19
Suva_6.26 Chr6 complement(42811..48072) [5262 bp, 1753 aa] {ON} ...    98   1e-19
KAFR0E03030 Chr5 (606567..607457) [891 bp, 296 aa] {ON} Anc_8.51...    93   1e-19
TDEL0B06900 Chr2 complement(1220590..1222257) [1668 bp, 555 aa] ...    96   1e-19
YBL016W Chr2 (192451..193512) [1062 bp, 353 aa] {ON}  FUS3Mitoge...    94   1e-19
TDEL0D02650 Chr4 complement(505536..506636) [1101 bp, 366 aa] {O...    94   1e-19
KLLA0E10539g Chr5 (929989..931104) [1116 bp, 371 aa] {ON} highly...    94   1e-19
TBLA0B03990 Chr2 complement(910314..912455) [2142 bp, 713 aa] {O...    97   1e-19
YFL033C Chr6 complement(69115..74427) [5313 bp, 1770 aa] {ON}  R...    97   1e-19
Suva_11.65 Chr11 complement(134606..136120) [1515 bp, 504 aa] {O...    96   1e-19
AER232C Chr5 complement(1066272..1067981) [1710 bp, 569 aa] {ON}...    96   1e-19
Ecym_7361 Chr7 complement(753862..755313) [1452 bp, 483 aa] {ON}...    95   1e-19
NDAI0A06630 Chr1 complement(1514165..1515943) [1779 bp, 592 aa] ...    96   1e-19
Suva_2.105 Chr2 (186428..187489) [1062 bp, 353 aa] {ON} YBL016W ...    94   1e-19
TDEL0B04490 Chr2 (792559..793629) [1071 bp, 356 aa] {ON} Anc_8.1...    94   1e-19
TDEL0C03740 Chr3 (658468..660702) [2235 bp, 744 aa] {ON} Anc_1.1...    96   1e-19
Kwal_27.11777 s27 (942591..943985) [1395 bp, 464 aa] {ON} YPL026...    95   1e-19
Smik_6.46 Chr6 complement(84451..89733) [5283 bp, 1760 aa] {ON} ...    97   1e-19
TBLA0F00860 Chr6 (219628..222570) [2943 bp, 980 aa] {ON} Anc_3.1...    96   2e-19
ZYRO0A12826g Chr1 (1014651..1015751) [1101 bp, 366 aa] {ON} high...    93   2e-19
TBLA0A01630 Chr1 complement(385348..386386,386496..386512) [1056...    93   2e-19
KNAG0K01710 Chr11 (360438..361931) [1494 bp, 497 aa] {ON} Anc_3....    95   2e-19
ZYRO0F12122g Chr6 complement(984069..985910) [1842 bp, 613 aa] {...    96   2e-19
TPHA0G01450 Chr7 (297855..299861) [2007 bp, 668 aa] {ON}               96   2e-19
NCAS0C01580 Chr3 (291554..292873) [1320 bp, 439 aa] {ON} Anc_8.652     94   2e-19
Ecym_5251 Chr5 (522785..525466) [2682 bp, 893 aa] {ON} similar t...    96   2e-19
Suva_16.439 Chr16 (755102..756796) [1695 bp, 564 aa] {ON} YPR111...    95   2e-19
Smik_16.204 Chr16 complement(369272..370021) [750 bp, 249 aa] {O...    91   2e-19
Skud_6.38 Chr6 complement(72416..77692) [5277 bp, 1758 aa] {ON} ...    96   2e-19
TPHA0A02770 Chr1 complement(597703..600129) [2427 bp, 808 aa] {O...    96   2e-19
NCAS0E01150 Chr5 complement(217594..219315) [1722 bp, 573 aa] {O...    95   2e-19
AFR724C Chr6 complement(1770338..1771660) [1323 bp, 440 aa] {ON}...    94   2e-19
SAKL0C05280g Chr3 complement(502205..504490) [2286 bp, 761 aa] {...    96   2e-19
Kwal_YGOB_23.3471 s23 (305207..305234,305298..306196) [927 bp, 3...    92   2e-19
KAFR0B01510 Chr2 complement(284425..286092) [1668 bp, 555 aa] {O...    95   3e-19
NCAS0A04220 Chr1 (855791..857353) [1563 bp, 520 aa] {ON} Anc_2.425     95   3e-19
Kpol_2001.30 s2001 (87817..90093) [2277 bp, 758 aa] {ON} (87817....    96   3e-19
KNAG0C02430 Chr3 complement(472213..474804) [2592 bp, 863 aa] {O...    96   3e-19
TDEL0C06780 Chr3 complement(1236767..1238173) [1407 bp, 468 aa] ...    94   3e-19
KLLA0C03938g Chr3 complement(358851..360632) [1782 bp, 593 aa] {...    95   3e-19
NCAS0I02850 Chr9 (529637..532042) [2406 bp, 801 aa] {ON} Anc_1.180     96   3e-19
Ecym_6044 Chr6 complement(84500..85756) [1257 bp, 418 aa] {ON} s...    93   3e-19
TBLA0C03140 Chr3 (759258..760763) [1506 bp, 501 aa] {ON} Anc_5.2...    94   3e-19
KAFR0A04070 Chr1 complement(817388..819325) [1938 bp, 645 aa] {O...    95   3e-19
Skud_2.90 Chr2 (176138..177199) [1062 bp, 353 aa] {ON} YBL016W (...    92   3e-19
Kpol_1018.137 s1018 complement(366178..367914) [1737 bp, 578 aa]...    95   3e-19
Kpol_1044.26 s1044 complement(60216..62666) [2451 bp, 816 aa] {O...    95   3e-19
CAGL0B04147g Chr2 (402798..404498) [1701 bp, 566 aa] {ON} highly...    94   4e-19
KLLA0B11902g Chr2 (1041657..1043144) [1488 bp, 495 aa] {ON} unip...    94   4e-19
AEL118C Chr5 complement(399738..401789) [2052 bp, 683 aa] {ON} S...    95   4e-19
Smik_6.136 Chr6 (219577..220686) [1110 bp, 369 aa] {ON} YGR052W ...    92   4e-19
Skud_11.56 Chr11 complement(117617..119776) [2160 bp, 719 aa] {O...    95   4e-19
YPR111W Chr16 (747306..749000) [1695 bp, 564 aa] {ON}  DBF20Ser/...    94   4e-19
Kpol_499.3 s499 complement(6075..7199) [1125 bp, 374 aa] {ON} co...    92   4e-19
YDL214C Chr4 complement(74446..76545) [2100 bp, 699 aa] {ON}  PR...    95   5e-19
ZYRO0B04906g Chr2 (395546..398089) [2544 bp, 847 aa] {ON} simila...    95   5e-19
NDAI0B00220 Chr2 (29825..32470) [2646 bp, 881 aa] {ON} Anc_1.180       95   5e-19
TPHA0H01500 Chr8 complement(336652..339639) [2988 bp, 995 aa] {O...    95   5e-19
KNAG0F00170 Chr6 (13778..15409) [1632 bp, 543 aa] {ON} Anc_1.24 ...    94   5e-19
YGR052W Chr7 (593596..594705) [1110 bp, 369 aa] {ON}  FMP48Putat...    92   6e-19
KLLA0B09790g Chr2 complement(855327..856214) [888 bp, 295 aa] {O...    91   6e-19
TPHA0F03520 Chr6 (755480..757756) [2277 bp, 758 aa] {ON} Anc_1.5...    94   6e-19
NCAS0C01110 Chr3 (207664..209664) [2001 bp, 666 aa] {ON} Anc_8.716     94   6e-19
Suva_4.138 Chr4 (256421..257197) [777 bp, 258 aa] {ON} YDL108W (...    89   6e-19
Smik_4.803 Chr4 complement(1408345..1409817) [1473 bp, 490 aa] {...    93   6e-19
CAGL0J11308g Chr10 (1099969..1102155) [2187 bp, 728 aa] {ON} sim...    94   6e-19
CAGL0C02893g Chr3 complement(286017..287966) [1950 bp, 649 aa] {...    94   6e-19
ZYRO0D07502g Chr4 complement(652782..654320) [1539 bp, 512 aa] {...    93   7e-19
SAKL0H10758g Chr8 complement(930403..931302) [900 bp, 299 aa] {O...    90   7e-19
KLTH0D04356g Chr4 (405904..405987,406076..407401) [1410 bp, 469 ...    93   7e-19
Skud_13.465 Chr13 (826172..827929) [1758 bp, 585 aa] {ON} YMR291...    94   7e-19
KNAG0K01250 Chr11 (246241..247467) [1227 bp, 408 aa] {ON} Anc_3....    92   7e-19
KLTH0E16104g Chr5 complement(1425822..1427042) [1221 bp, 406 aa]...    92   8e-19
NDAI0F03390 Chr6 (816047..818380) [2334 bp, 777 aa] {ON}               94   8e-19
TDEL0A02010 Chr1 (365325..366782) [1458 bp, 485 aa] {ON} Anc_2.4...    93   8e-19
Ecym_8004 Chr8 complement(5273..7957) [2685 bp, 894 aa] {ON} sim...    94   8e-19
KAFR0G00460 Chr7 complement(128077..130023) [1947 bp, 648 aa] {O...    94   8e-19
Suva_11.54 Chr11 complement(116221..118401) [2181 bp, 726 aa] {O...    94   9e-19
KLTH0D10670g Chr4 (877472..878806) [1335 bp, 444 aa] {ON} some s...    92   9e-19
AER223C Chr5 complement(1044971..1047679) [2709 bp, 902 aa] {ON}...    94   9e-19
Smik_15.39 Chr15 (72332..74314) [1983 bp, 660 aa] {ON} YOL113W (...    94   9e-19
TBLA0A08810 Chr1 (2161249..2162304) [1056 bp, 351 aa] {ON} Anc_8...    91   9e-19
TDEL0F03120 Chr6 (570471..572192) [1722 bp, 573 aa] {ON} Anc_3.4...    93   9e-19
KNAG0C01020 Chr3 (200271..202595) [2325 bp, 774 aa] {ON} Anc_1.1...    94   9e-19
KLLA0F23507g Chr6 complement(2198603..2200066) [1464 bp, 487 aa]...    92   9e-19
Smik_11.97 Chr11 (168854..170491) [1638 bp, 545 aa] {ON} YKL139W...    93   1e-18
NCAS0A11530 Chr1 (2281835..2283223) [1389 bp, 462 aa] {ON} Anc_3...    92   1e-18
YOR267C Chr15 complement(822588..824867) [2280 bp, 759 aa] {ON} ...    94   1e-18
Suva_8.316 Chr8 complement(561812..563914) [2103 bp, 700 aa] {ON...    94   1e-18
NDAI0K01150 Chr11 complement(264377..266527) [2151 bp, 716 aa] {...    94   1e-18
SAKL0B01210g Chr2 complement(109892..114658) [4767 bp, 1588 aa] ...    94   1e-18
KAFR0B03170 Chr2 complement(656163..658025) [1863 bp, 620 aa] {O...    93   1e-18
CAGL0J03828g Chr10 (365325..366728) [1404 bp, 467 aa] {ON} simil...    92   1e-18
Kwal_33.13831 s33 complement(413256..415358) [2103 bp, 700 aa] {...    93   1e-18
CAGL0G05720g Chr7 complement(547617..549833) [2217 bp, 738 aa] {...    94   1e-18
Smik_16.354 Chr16 (625456..627150) [1695 bp, 564 aa] {ON} YPR111...    93   1e-18
Kwal_23.3471 s23 (305414..306196) [783 bp, 260 aa] {OFF} YDL108W...    89   1e-18
Skud_11.67 Chr11 complement(135815..137341) [1527 bp, 508 aa] {O...    92   1e-18
SAKL0H01364g Chr8 complement(143450..145141) [1692 bp, 563 aa] {...    93   1e-18
KLLA0C16577g Chr3 complement(1451181..1452695) [1515 bp, 504 aa]...    92   1e-18
SAKL0G10978g Chr7 (929164..930729) [1566 bp, 521 aa] {ON} highly...    92   1e-18
KAFR0E01580 Chr5 (318991..320280) [1290 bp, 429 aa] {ON} Anc_5.2...    91   1e-18
Kwal_26.7552 s26 (416444..417829) [1386 bp, 461 aa] {ON} YKL139W...    92   1e-18
YMR291W Chr13 (852630..854390) [1761 bp, 586 aa] {ON}  TDA1Prote...    92   1e-18
KLTH0E11924g Chr5 (1059134..1060030) [897 bp, 298 aa] {ON} highl...    89   2e-18
Suva_2.703 Chr2 complement(1238496..1239953) [1458 bp, 485 aa] {...    92   2e-18
Kwal_27.11919 s27 (1003201..1003827) [627 bp, 209 aa] {OFF} YBR1...    87   2e-18
ZYRO0C12408g Chr3 (979857..981593) [1737 bp, 578 aa] {ON} highly...    92   2e-18
Smik_13.507 Chr13 (835298..837058) [1761 bp, 586 aa] {ON} YMR291...    92   2e-18
ZYRO0D10252g Chr4 (860458..863109) [2652 bp, 883 aa] {ON} simila...    93   2e-18
Ecym_8098 Chr8 (210698..212857) [2160 bp, 719 aa] {ON} similar t...    93   2e-18
Ecym_8337 Chr8 (679844..681460) [1617 bp, 538 aa] {ON} similar t...    92   2e-18
TBLA0C02310 Chr3 complement(546887..548596) [1710 bp, 569 aa] {O...    92   2e-18
KNAG0A03900 Chr1 complement(520500..521390) [891 bp, 296 aa] {ON...    89   2e-18
SAKL0B04488g Chr2 (395136..396242) [1107 bp, 368 aa] {ON} highly...    91   2e-18
KNAG0D04040 Chr4 (730581..731897) [1317 bp, 438 aa] {ON} Anc_4.1...    91   2e-18
TBLA0A01660 Chr1 complement(391368..392828) [1461 bp, 486 aa] {O...    92   2e-18
Suva_11.86 Chr11 (169096..170685) [1590 bp, 529 aa] {ON} YKL139W...    92   2e-18
SAKL0E04092g Chr5 complement(326532..327901,327970..327982) [138...    91   2e-18
KLTH0G06468g Chr7 complement(513119..518251) [5133 bp, 1710 aa] ...    94   2e-18
KAFR0C00920 Chr3 complement(185475..186674) [1200 bp, 399 aa] {O...    91   2e-18
CAGL0H01199g Chr8 (110610..115556) [4947 bp, 1648 aa] {ON} highl...    93   2e-18
Kwal_YGOB_27.11919 s27 (1003201..1003830,1004866..1005135) [900 ...    89   2e-18
Smik_15.449 Chr15 complement(772245..774437) [2193 bp, 730 aa] {...    92   2e-18
TPHA0B02440 Chr2 (560189..561592) [1404 bp, 467 aa] {ON} Anc_5.2...    91   2e-18
YNL183C Chr14 complement(293137..295509) [2373 bp, 790 aa] {ON} ...    93   2e-18
Suva_7.334 Chr7 (568847..569956) [1110 bp, 369 aa] {ON} YGR052W ...    90   2e-18
Smik_14.147 Chr14 complement(272373..274742) [2370 bp, 789 aa] {...    92   2e-18
YOL113W Chr15 (104326..106293) [1968 bp, 655 aa] {ON}  SKM1Membe...    92   2e-18
SAKL0E06534g Chr5 complement(533369..534267,534334..534358) [924...    89   3e-18
Suva_4.33 Chr4 complement(63334..65427) [2094 bp, 697 aa] {ON} Y...    92   3e-18
Kpol_513.7 s513 (14160..15050) [891 bp, 296 aa] {ON} (14160..150...    89   3e-18
ACR117W Chr3 (557738..559312) [1575 bp, 524 aa] {ON} Syntenic ho...    91   3e-18
Ecym_4773 Chr4 complement(1504949..1506541) [1593 bp, 530 aa] {O...    92   3e-18
YDR523C Chr4 complement(1485566..1487038) [1473 bp, 490 aa] {ON}...    91   3e-18
KAFR0F02220 Chr6 (432967..435210) [2244 bp, 747 aa] {ON} Anc_3.1...    92   3e-18
TBLA0B03590 Chr2 (834488..837022) [2535 bp, 844 aa] {ON} Anc_8.7...    92   3e-18
TBLA0B09740 Chr2 (2312062..2314815) [2754 bp, 917 aa] {ON} Anc_2...    92   3e-18
CAGL0I06248g Chr9 (600351..602792) [2442 bp, 813 aa] {ON} simila...    92   3e-18
KNAG0B01130 Chr2 complement(208528..210279) [1752 bp, 583 aa] {O...    92   3e-18
KLTH0G18612g Chr7 (1604066..1608640) [4575 bp, 1524 aa] {ON} sim...    92   4e-18
ZYRO0A02772g Chr1 complement(223226..224473) [1248 bp, 415 aa] {...    90   4e-18
ZYRO0F03014g Chr6 complement(255189..260003) [4815 bp, 1604 aa] ...    92   4e-18
TPHA0L01470 Chr12 (303604..304497) [894 bp, 297 aa] {ON} Anc_8.5...    88   4e-18
YKL139W Chr11 (182958..184544) [1587 bp, 528 aa] {ON}  CTK1Catal...    91   4e-18
SAKL0F06094g Chr6 (457709..459442) [1734 bp, 577 aa] {ON} unipro...    91   4e-18
KAFR0F01790 Chr6 complement(347491..349884) [2394 bp, 797 aa] {O...    92   4e-18
Skud_11.88 Chr11 (169115..170659) [1545 bp, 514 aa] {ON} YKL139W...    91   4e-18
KLTH0G06974g Chr7 (556626..558125) [1500 bp, 499 aa] {ON} highly...    91   4e-18
Suva_15.46 Chr15 (81948..83909) [1962 bp, 653 aa] {ON} YOL113W (...    91   4e-18
Suva_4.411 Chr4 (729465..730361) [897 bp, 298 aa] {ON} YBR160W (...    88   5e-18
Smik_13.338 Chr13 (528578..529690) [1113 bp, 370 aa] {ON} YMR139...    89   5e-18
NDAI0F04520 Chr6 complement(1098426..1099895) [1470 bp, 489 aa] ...    91   5e-18
YDL028C Chr4 complement(400997..403291) [2295 bp, 764 aa] {ON}  ...    92   5e-18
NDAI0A01970 Chr1 (440268..442184) [1917 bp, 638 aa] {ON} Anc_7.335     91   5e-18
KLLA0F01408g Chr6 (135424..136302) [879 bp, 292 aa] {ON} conserv...    87   5e-18
Kwal_26.8347 s26 complement(748254..750032) [1779 bp, 592 aa] {O...    91   5e-18
Skud_15.432 Chr15 complement(761490..763601) [2112 bp, 703 aa] {...    91   5e-18
NCAS0I02080 Chr9 (390551..392875) [2325 bp, 774 aa] {ON} Anc_3.162     91   5e-18
Suva_16.291 Chr16 complement(504006..505433) [1428 bp, 475 aa] {...    90   5e-18
Smik_2.300 Chr2 (546211..547107) [897 bp, 298 aa] {ON} YBR160W (...    87   5e-18
NDAI0H00610 Chr8 complement(141913..143022) [1110 bp, 369 aa] {O...    89   6e-18
CAGL0J00539g Chr10 (47095..48561) [1467 bp, 488 aa] {ON} highly ...    90   6e-18
Skud_4.797 Chr4 complement(1405618..1407075) [1458 bp, 485 aa] {...    90   6e-18
Ecym_5241 Chr5 complement(495748..497586) [1839 bp, 612 aa] {ON}...    91   6e-18
Suva_13.481 Chr13 (834531..836279) [1749 bp, 582 aa] {ON} YMR291...    91   6e-18
KNAG0G02780 Chr7 complement(615058..617202) [2145 bp, 714 aa] {O...    91   6e-18
Smik_8.97 Chr8 complement(148421..149857) [1437 bp, 478 aa] {ON}...    90   6e-18
TPHA0G01730 Chr7 complement(355001..356779) [1779 bp, 592 aa] {O...    91   7e-18
Skud_7.337 Chr7 (562750..563856) [1107 bp, 368 aa] {ON} YGR040W ...    89   7e-18
TBLA0A07460 Chr1 (1848207..1849757) [1551 bp, 516 aa] {ON} Anc_1...    90   7e-18
KAFR0B00920 Chr2 (170792..172300) [1509 bp, 502 aa] {ON} Anc_7.3...    90   7e-18
SAKL0D06666g Chr4 (551260..552522) [1263 bp, 420 aa] {ON} some s...    89   7e-18
TDEL0A06610 Chr1 complement(1151052..1152824) [1773 bp, 590 aa] ...    91   7e-18
KLLA0D07304g Chr4 (623352..624749) [1398 bp, 465 aa] {ON} some s...    90   7e-18
Suva_7.325 Chr7 (550760..551866) [1107 bp, 368 aa] {ON} YGR040W ...    89   7e-18
Kwal_23.5576 s23 complement(1223517..1225031) [1515 bp, 504 aa] ...    90   7e-18
Kwal_14.1159 s14 complement(219896..224461) [4566 bp, 1521 aa] {...    92   7e-18
Klac_YGOB_Anc_8.34 Chr6 (836287..839007,839010..841004) [4716 bp...    92   7e-18
KAFR0C03520 Chr3 (715667..720019) [4353 bp, 1450 aa] {ON} Anc_8....    91   8e-18
Smik_6.125 Chr6 (201071..202177) [1107 bp, 368 aa] {ON} YGR040W ...    88   8e-18
TDEL0E02510 Chr5 (486415..489156) [2742 bp, 913 aa] {ON} Anc_5.3...    91   8e-18
CAGL0M10829g Chr13 complement(1076233..1081236) [5004 bp, 1667 a...    91   8e-18
KLTH0E03652g Chr5 (330227..332671) [2445 bp, 814 aa] {ON} simila...    91   8e-18
NDAI0A06620 Chr1 complement(1510218..1512461) [2244 bp, 747 aa] ...    91   9e-18
KLLA0A02717g Chr1 (245082..246380) [1299 bp, 432 aa] {ON} weakly...    89   9e-18
Skud_8.86 Chr8 complement(149508..150953) [1446 bp, 481 aa] {ON}...    89   9e-18
TBLA0G03450 Chr7 (913497..919415) [5919 bp, 1972 aa] {ON} Anc_8....    91   9e-18
TDEL0D04450 Chr4 complement(811665..812924) [1260 bp, 419 aa] {O...    89   9e-18
ZYRO0C09768g Chr3 (740592..742925) [2334 bp, 777 aa] {ON} simila...    91   9e-18
TBLA0H03440 Chr8 (840759..841643) [885 bp, 294 aa] {ON} Anc_8.51...    87   9e-18
Kpol_1035.40 s1035 (101912..102910,102960..102968,103011..106556...    91   1e-17
Suva_15.216 Chr15 complement(376197..377624) [1428 bp, 475 aa] {...    89   1e-17
Kpol_1055.25 s1055 complement(62930..67933) [5004 bp, 1667 aa] {...    91   1e-17
Kwal_23.3992 s23 complement(515493..517208) [1716 bp, 571 aa] {O...    90   1e-17
Kwal_55.20189 s55 (288918..291356) [2439 bp, 812 aa] {ON} YHR082...    91   1e-17
KLTH0D08712g Chr4 complement(728072..729886) [1815 bp, 604 aa] {...    90   1e-17
TDEL0A01120 Chr1 complement(189217..191466) [2250 bp, 749 aa] {O...    91   1e-17
ZYRO0F01034g Chr6 (80328..82826) [2499 bp, 832 aa] {ON} similar ...    91   1e-17
Suva_1.86 Chr1 complement(150761..153685) [2925 bp, 974 aa] {ON}...    91   1e-17
KAFR0F03900 Chr6 (763094..764203) [1110 bp, 369 aa] {ON} Anc_4.1...    88   1e-17
TDEL0B01590 Chr2 complement(280143..281573) [1431 bp, 476 aa] {O...    89   1e-17
Kwal_23.5668 s23 (1263868..1268937) [5070 bp, 1689 aa] {ON} YDR2...    91   1e-17
Skud_2.287 Chr2 (527443..528339) [897 bp, 298 aa] {ON} YBR160W (...    87   1e-17
TBLA0B00770 Chr2 complement(168444..170519) [2076 bp, 691 aa] {O...    90   1e-17
Kpol_1072.1 s1072 (686..2683) [1998 bp, 665 aa] {ON} (686..2683)...    90   1e-17
Suva_7.375 Chr7 (643870..645591) [1722 bp, 573 aa] {ON} YGR092W ...    90   1e-17
SAKL0H05588g Chr8 (502752..504602) [1851 bp, 616 aa] {ON} simila...    90   1e-17
KAFR0G00440 Chr7 (124896..127328) [2433 bp, 810 aa] {ON} Anc_1.1...    90   1e-17
NDAI0D04050 Chr4 (952438..953538) [1101 bp, 366 aa] {ON} Anc_4.184     88   1e-17
Smik_6.178 Chr6 (291601..293322) [1722 bp, 573 aa] {ON} YGR092W ...    90   1e-17
ABL143C Chr2 complement(128215..130392) [2178 bp, 725 aa] {ON} S...    90   1e-17
KLLA0E12145g Chr5 (1080245..1081612) [1368 bp, 455 aa] {ON} simi...    89   1e-17
Smik_4.207 Chr4 complement(381159..383456) [2298 bp, 765 aa] {ON...    90   1e-17
CAGL0K12562g Chr11 (1235695..1240743) [5049 bp, 1682 aa] {ON} si...    91   1e-17
NDAI0E03760 Chr5 (817014..818765) [1752 bp, 583 aa] {ON} Anc_7.41      90   1e-17
YGR040W Chr7 (575398..576504) [1107 bp, 368 aa] {ON}  KSS1Mitoge...    88   1e-17
KLTH0F12012g Chr6 complement(1013169..1014881) [1713 bp, 570 aa]...    89   2e-17
KLLA0C07535g Chr3 (658746..660620) [1875 bp, 624 aa] {ON} some s...    89   2e-17
Skud_8.143 Chr8 complement(242422..245535) [3114 bp, 1037 aa] {O...    90   2e-17
Skud_7.391 Chr7 (652479..654200) [1722 bp, 573 aa] {ON} YGR092W ...    89   2e-17
NCAS0A06680 Chr1 (1320265..1321704) [1440 bp, 479 aa] {ON} Anc_5...    89   2e-17
YBR160W Chr2 (560078..560974) [897 bp, 298 aa] {ON}  CDC28Cataly...    86   2e-17
YGR092W Chr7 (668189..669907) [1719 bp, 572 aa] {ON}  DBF2Ser/Th...    89   2e-17
KLTH0F06468g Chr6 (559256..561769) [2514 bp, 837 aa] {ON} simila...    90   2e-17
Kwal_47.17868 s47 (587449..588546) [1098 bp, 365 aa] {ON} YMR139...    87   2e-17
ZYRO0G16082g Chr7 complement(1320266..1321714) [1449 bp, 482 aa]...    89   2e-17
Smik_4.494 Chr4 (900954..902321) [1368 bp, 455 aa] {ON} YDR247W ...    88   2e-17
YHR030C Chr8 complement(168890..170344) [1455 bp, 484 aa] {ON}  ...    89   2e-17
NDAI0C03900 Chr3 complement(883841..885310) [1470 bp, 489 aa] {O...    89   2e-17
CAGL0G03047g Chr7 (282299..283918) [1620 bp, 539 aa] {ON} highly...    89   2e-17
KLTH0E09658g Chr5 (869857..870957) [1101 bp, 366 aa] {ON} highly...    87   2e-17
TDEL0B01250 Chr2 complement(228145..229038) [894 bp, 297 aa] {ON...    86   2e-17
SAKL0D12628g Chr4 (1048973..1051429) [2457 bp, 818 aa] {ON} weak...    89   2e-17
Skud_7.350 Chr7 (580913..582022) [1110 bp, 369 aa] {ON} YGR052W ...    87   2e-17
KLTH0H01584g Chr8 (143065..144453) [1389 bp, 462 aa] {ON} simila...    88   2e-17
CAGL0K04169g Chr11 (384567..385763) [1197 bp, 398 aa] {ON} simil...    87   2e-17
TBLA0H01820 Chr8 (429920..433417) [3498 bp, 1165 aa] {ON} Anc_5....    90   2e-17
ZYRO0G20306g Chr7 complement(1675578..1677227) [1650 bp, 549 aa]...    89   3e-17
Kpol_185.2 s185 complement(1614..3704) [2091 bp, 696 aa] {ON} co...    89   3e-17
CAGL0K11275g Chr11 (1094626..1096203) [1578 bp, 525 aa] {ON} sim...    88   3e-17
Kpol_2002.24 s2002 (48405..49868) [1464 bp, 487 aa] {ON} (48405....    88   3e-17
Ecym_4448 Chr4 complement(917136..918872) [1737 bp, 578 aa] {ON}...    89   3e-17
NDAI0C01850 Chr3 (407978..411712) [3735 bp, 1244 aa] {ON}              89   3e-17
Suva_2.449 Chr2 complement(789612..794603) [4992 bp, 1663 aa] {O...    89   3e-17
KAFR0E01490 Chr5 (298209..303167) [4959 bp, 1652 aa] {ON} Anc_5....    89   3e-17
NDAI0G01280 Chr7 complement(281834..283573) [1740 bp, 579 aa] {O...    89   3e-17
YHR082C Chr8 complement(268459..271548) [3090 bp, 1029 aa] {ON} ...    89   3e-17
Kwal_33.14167 s33 (554863..557379) [2517 bp, 838 aa] {ON} YDL028...    89   3e-17
AER222C Chr5 complement(1043479..1044750) [1272 bp, 423 aa] {ON}...    87   3e-17
Skud_4.223 Chr4 complement(395836..398145) [2310 bp, 769 aa] {ON...    89   3e-17
Kpol_1065.6 s1065 (12266..12916,12918..13280,13332..13340,13394....    87   3e-17
ADR253W Chr4 (1141941..1143083) [1143 bp, 380 aa] {ON} Syntenic ...    87   3e-17
Kwal_27.9773 s27 (57252..58472) [1221 bp, 406 aa] {ON} YAR018C (...    87   3e-17
NCAS0A00280 Chr1 (40406..42013) [1608 bp, 535 aa] {ON} Anc_1.24        88   3e-17
TBLA0C06820 Chr3 (1645811..1647508) [1698 bp, 565 aa] {ON} Anc_5...    88   4e-17
ZYRO0F08778g Chr6 (702733..703626) [894 bp, 297 aa] {ON} highly ...    85   4e-17
CAGL0I03498g Chr9 (297344..298699) [1356 bp, 451 aa] {ON} simila...    87   4e-17
TPHA0H00750 Chr8 complement(150811..152043) [1233 bp, 410 aa] {O...    87   4e-17
AAL083W Chr1 (196774..201870) [5097 bp, 1698 aa] {ON} Syntenic h...    89   4e-17
KLTH0E11110g Chr5 (997486..998847) [1362 bp, 453 aa] {ON} simila...    87   4e-17
TPHA0D01770 Chr4 (365255..370279) [5025 bp, 1674 aa] {ON} Anc_5....    89   5e-17
ZYRO0F18062g Chr6 complement(1494752..1496167) [1416 bp, 471 aa]...    87   5e-17
Ecym_1313 Chr1 complement(633556..634455) [900 bp, 299 aa] {ON} ...    85   5e-17
NCAS0B00420 Chr2 complement(54562..56718) [2157 bp, 718 aa] {ON}...    88   5e-17
TDEL0D04600 Chr4 (843530..845917) [2388 bp, 795 aa] {ON} Anc_3.1...    88   5e-17
Ecym_5252 Chr5 (525687..526976) [1290 bp, 429 aa] {ON} similar t...    87   5e-17
KAFR0F00380 Chr6 complement(91358..92800) [1443 bp, 480 aa] {ON}...    87   5e-17
Skud_15.39 Chr15 (69445..71412) [1968 bp, 655 aa] {ON} YOL113W (...    88   6e-17
KAFR0K01540 Chr11 (320997..322706) [1710 bp, 569 aa] {ON} Anc_3....    87   6e-17
Smik_8.160 Chr8 complement(245207..248323) [3117 bp, 1038 aa] {O...    88   6e-17
Suva_13.319 Chr13 (525309..526421) [1113 bp, 370 aa] {ON} YMR139...    86   6e-17
Skud_13.300 Chr13 (519521..520633) [1113 bp, 370 aa] {ON} YMR139...    86   6e-17
TDEL0C00590 Chr3 complement(94223..99031) [4809 bp, 1602 aa] {ON...    89   6e-17
TPHA0P00640 Chr16 (132185..133963) [1779 bp, 592 aa] {ON} Anc_3....    87   6e-17
ZYRO0A08448g Chr1 complement(677122..678225) [1104 bp, 367 aa] {...    86   6e-17
Skud_14.151 Chr14 complement(284115..286490) [2376 bp, 791 aa] {...    88   6e-17
Suva_15.275 Chr15 complement(470782..473862) [3081 bp, 1026 aa] ...    88   7e-17
Smik_4.532 Chr4 complement(956572..961554) [4983 bp, 1660 aa] {O...    88   7e-17
KAFR0D04500 Chr4 (887515..889989) [2475 bp, 824 aa] {ON} Anc_1.5...    88   7e-17
ZYRO0G18546g Chr7 (1530693..1533050) [2358 bp, 785 aa] {ON} simi...    88   7e-17
Kpol_529.18 s529 (52782..55118) [2337 bp, 778 aa] {ON} (52782..5...    88   7e-17
Ecym_6056 Chr6 complement(107449..108888) [1440 bp, 479 aa] {ON}...    87   7e-17
YDR283C Chr4 complement(1025070..1030049) [4980 bp, 1659 aa] {ON...    88   7e-17
Kpol_1018.148 s1018 (393064..394413) [1350 bp, 449 aa] {ON} (393...    86   8e-17
KNAG0A02350 Chr1 complement(223757..225022) [1266 bp, 421 aa] {O...    86   8e-17
KLLA0F26983g Chr6 (2489326..2490729) [1404 bp, 467 aa] {ON} some...    86   9e-17
KAFR0D02900 Chr4 (575853..577313) [1461 bp, 486 aa] {ON} Anc_7.5...    86   9e-17
KLTH0D12166g Chr4 complement(987310..989061) [1752 bp, 583 aa] {...    87   9e-17
Skud_4.39 Chr4 complement(70857..72947) [2091 bp, 696 aa] {ON} Y...    87   9e-17
TPHA0G02090 Chr7 complement(429178..430527) [1350 bp, 449 aa] {O...    86   9e-17
Skud_16.256 Chr16 complement(465728..467362) [1635 bp, 544 aa] {...    87   1e-16
ADR033W Chr4 (764716..766449) [1734 bp, 577 aa] {ON} Syntenic ho...    87   1e-16
TDEL0E03520 Chr5 (657779..659251) [1473 bp, 490 aa] {ON} Anc_5.2...    86   1e-16
KNAG0B04460 Chr2 (856495..859461) [2967 bp, 988 aa] {ON} Anc_5.3...    87   1e-16
YMR139W Chr13 (546125..547237) [1113 bp, 370 aa] {ON}  RIM11Prot...    85   1e-16
TPHA0E03850 Chr5 complement(810694..812142) [1449 bp, 482 aa] {O...    86   1e-16
TPHA0D00360 Chr4 complement(55596..60206) [4611 bp, 1536 aa] {ON...    87   1e-16
KAFR0E01810 Chr5 complement(372094..373524) [1431 bp, 476 aa] {O...    86   1e-16
NCAS0H01780 Chr8 complement(341549..344773) [3225 bp, 1074 aa] {...    87   1e-16
NDAI0C04000 Chr3 (907842..912812) [4971 bp, 1656 aa] {ON} Anc_5....    87   1e-16
Kpol_1037.7 s1037 (15938..17182) [1245 bp, 414 aa] {ON} (15938.....    85   1e-16
KNAG0F03410 Chr6 (640115..645094) [4980 bp, 1659 aa] {ON}              87   1e-16
Kpol_365.3 s365 complement(2204..4177,4180..4206,4209..4874) [26...    87   1e-16
KNAG0C03830 Chr3 (751393..752877) [1485 bp, 494 aa] {ON} Anc_7.3...    86   1e-16
SAKL0E04950g Chr5 (401903..402994) [1092 bp, 363 aa] {ON} highly...    84   1e-16
CAGL0M13167g Chr13 complement(1293074..1294906) [1833 bp, 610 aa...    86   2e-16
NDAI0D01620 Chr4 (386654..388132) [1479 bp, 492 aa] {ON} Anc_5.274     86   2e-16
CAGL0F03311g Chr6 complement(327599..330736) [3138 bp, 1045 aa] ...    87   2e-16
Smik_16.209 Chr16 complement(377965..379425) [1461 bp, 486 aa] {...    86   2e-16
TBLA0A10420 Chr1 (2562614..2564092) [1479 bp, 492 aa] {ON} Anc_5...    86   2e-16
NCAS0A02120 Chr1 (401097..402230) [1134 bp, 377 aa] {ON} Anc_4.184     84   2e-16
NCAS0B02530 Chr2 complement(422882..424207) [1326 bp, 441 aa] {O...    85   2e-16
TPHA0J00630 Chr10 (139476..140600) [1125 bp, 374 aa] {ON} Anc_4....    84   2e-16
NDAI0C03610 Chr3 (829317..831476) [2160 bp, 719 aa] {ON} Anc_5.38      86   2e-16
Kpol_489.20 s489 complement(59150..60178) [1029 bp, 342 aa] {ON}...    84   2e-16
KLLA0C03828g Chr3 (349187..351568) [2382 bp, 793 aa] {ON} simila...    86   2e-16
Suva_8.111 Chr8 (204414..205433) [1020 bp, 339 aa] {ON} YOR061W ...    84   2e-16
ZYRO0D03344g Chr4 complement(278347..280326) [1980 bp, 659 aa] {...    86   2e-16
KNAG0F01240 Chr6 complement(223003..225591) [2589 bp, 862 aa] {O...    86   2e-16
NCAS0C03770 Chr3 complement(761101..765897) [4797 bp, 1598 aa] {...    87   2e-16
YPL026C Chr16 complement(500675..502183) [1509 bp, 502 aa] {ON} ...    85   2e-16
YDR247W Chr4 (956013..957398) [1386 bp, 461 aa] {ON}  VHS1Cytopl...    85   2e-16
NCAS0A09750 Chr1 (1940202..1942370) [2169 bp, 722 aa] {ON}             86   2e-16
KLLA0D14905g Chr4 (1256065..1257768) [1704 bp, 567 aa] {ON} simi...    86   2e-16
KAFR0H01570 Chr8 complement(290698..291897) [1200 bp, 399 aa] {O...    84   2e-16
NDAI0G06150 Chr7 (1519393..1521780) [2388 bp, 795 aa] {ON} Anc_1...    86   2e-16
Kwal_56.24584 s56 complement(1063271..1064578) [1308 bp, 435 aa]...    85   2e-16
SAKL0C07348g Chr3 (677348..679933) [2586 bp, 861 aa] {ON} some s...    86   3e-16
NCAS0G01820 Chr7 complement(323288..325690) [2403 bp, 800 aa] {O...    86   3e-16
KNAG0J01950 Chr10 complement(352815..354317) [1503 bp, 500 aa] {...    85   3e-16
Suva_4.221 Chr4 complement(391492..393789) [2298 bp, 765 aa] {ON...    86   3e-16
SAKL0B11308g Chr2 complement(984543..986369) [1827 bp, 608 aa] {...    86   3e-16
KAFR0D04800 Chr4 complement(942369..944690) [2322 bp, 773 aa] {O...    86   3e-16
ADR163W Chr4 (989728..991008) [1281 bp, 426 aa] {ON} Syntenic ho...    84   3e-16
NDAI0E03210 Chr5 complement(686073..687317) [1245 bp, 414 aa] {O...    84   3e-16
Skud_4.546 Chr4 complement(967636..972618) [4983 bp, 1660 aa] {O...    86   3e-16
NDAI0G03110 Chr7 complement(725984..731107) [5124 bp, 1707 aa] {...    86   3e-16
KAFR0E02850 Chr5 (575512..576786) [1275 bp, 424 aa] {ON} Anc_8.4...    84   3e-16
Ecym_5236 Chr5 (486270..488864) [2595 bp, 864 aa] {ON} similar t...    86   4e-16
CAGL0H01639g Chr8 (158967..160532) [1566 bp, 521 aa] {ON} simila...    84   4e-16
NCAS0F02520 Chr6 (495799..500631) [4833 bp, 1610 aa] {ON} Anc_5....    86   4e-16
NDAI0E01690 Chr5 (335849..337051) [1203 bp, 400 aa] {ON} Anc_2.391     84   5e-16
KAFR0G01200 Chr7 (273238..274761) [1524 bp, 507 aa] {ON} Anc_1.2...    84   5e-16
TDEL0E03300 Chr5 complement(621448..626409) [4962 bp, 1653 aa] {...    86   5e-16
Skud_15.228 Chr15 (403382..404401) [1020 bp, 339 aa] {ON} YOR061...    82   6e-16
Kwal_26.8941 s26 complement(1014543..1016528) [1986 bp, 661 aa] ...    85   6e-16
YOR061W Chr15 (441534..442553) [1020 bp, 339 aa] {ON}  CKA2Alpha...    82   6e-16
CAGL0M13541g Chr13 (1333846..1335714) [1869 bp, 622 aa] {ON} sim...    84   6e-16
KLLA0A09713g Chr1 (851952..853625) [1674 bp, 557 aa] {ON} simila...    84   7e-16
CAGL0K01617g Chr11 complement(143308..145632) [2325 bp, 774 aa] ...    85   7e-16
Kwal_55.21709 s55 (948619..949641) [1023 bp, 340 aa] {ON} YOR061...    82   7e-16
Kwal_23.4276 s23 complement(648061..649626) [1566 bp, 521 aa] {O...    84   7e-16
KAFR0H03330 Chr8 complement(635910..637019) [1110 bp, 369 aa] {O...    82   7e-16
SAKL0C07744g Chr3 (720519..721799) [1281 bp, 426 aa] {ON} simila...    83   8e-16
NDAI0H03740 Chr8 (912611..915373) [2763 bp, 920 aa] {ON} Anc_2.71      84   9e-16
NDAI0A04760 Chr1 complement(1088637..1090103) [1467 bp, 488 aa] ...    83   9e-16
ADR317C Chr4 complement(1263080..1265539) [2460 bp, 819 aa] {ON}...    84   9e-16
CAGL0I04422g Chr9 (394159..395427) [1269 bp, 422 aa] {ON} some s...    83   9e-16
CAGL0L05632g Chr12 (612478..614511) [2034 bp, 677 aa] {ON} simil...    84   1e-15
KNAG0A06140 Chr1 (931737..933437) [1701 bp, 566 aa] {ON} Anc_2.4...    84   1e-15
YNL020C Chr14 complement(595623..597539) [1917 bp, 638 aa] {ON} ...    84   1e-15
KAFR0K01310 Chr11 (270172..271191) [1020 bp, 339 aa] {ON} Anc_5....    81   1e-15
CAGL0F03707g Chr6 complement(359839..361665) [1827 bp, 608 aa] {...    84   1e-15
Smik_4.25 Chr4 complement(52454..54547) [2094 bp, 697 aa] {ON} Y...    84   1e-15
KNAG0A05920 Chr1 complement(883522..884742) [1221 bp, 406 aa] {O...    82   1e-15
Smik_4.157 Chr4 complement(289446..290605,290830..291250) [1581 ...    83   1e-15
CAGL0H09152g Chr8 complement(895722..898055) [2334 bp, 777 aa] {...    84   1e-15
NDAI0F00560 Chr6 complement(128674..129717) [1044 bp, 347 aa] {O...    81   1e-15
TBLA0J00990 Chr10 (224999..227335) [2337 bp, 778 aa] {ON} Anc_1....    84   1e-15
NDAI0E00960 Chr5 (195116..197251) [2136 bp, 711 aa] {ON} Anc_8.716     84   1e-15
Skud_4.509 Chr4 (910551..911945) [1395 bp, 464 aa] {ON} YDR247W ...    82   1e-15
TDEL0G03220 Chr7 complement(600259..601350) [1092 bp, 363 aa] {O...    82   1e-15
CAGL0D02002g Chr4 (207419..209080) [1662 bp, 553 aa] {ON} simila...    83   1e-15
Kpol_1064.31 s1064 complement(52651..54350) [1700 bp, 566.666666...    83   1e-15
Kpol_YGOB_1064.31 s1064 complement(52620..54350) [1731 bp, 577 a...    83   2e-15
Ecym_6092 Chr6 (178965..180299) [1335 bp, 444 aa] {ON} similar t...    82   2e-15
TPHA0G00730 Chr7 (139442..141364) [1923 bp, 640 aa] {ON} Anc_8.7...    83   2e-15
Kpol_448.13 s448 (25051..27063) [2013 bp, 670 aa] {ON} (25051..2...    83   2e-15
YAR018C Chr1 complement(170396..171703) [1308 bp, 435 aa] {ON}  ...    82   2e-15
CAGL0I08349g Chr9 complement(813998..816001) [2004 bp, 667 aa] {...    83   2e-15
KNAG0M01450 Chr13 (254622..256061) [1440 bp, 479 aa] {ON}              82   2e-15
NCAS0G03810 Chr7 complement(703842..705827) [1986 bp, 661 aa] {O...    83   2e-15
YKL161C Chr11 complement(149386..150687) [1302 bp, 433 aa] {ON} ...    82   2e-15
KNAG0H02020 Chr8 complement(357248..359026) [1779 bp, 592 aa] {O...    83   2e-15
YKL048C Chr11 complement(347214..349136) [1923 bp, 640 aa] {ON} ...    83   2e-15
SAKL0C12870g Chr3 (1145051..1146142) [1092 bp, 363 aa] {ON} high...    81   2e-15
AFR372W Chr6 (1109169..1111493) [2325 bp, 774 aa] {ON} Syntenic ...    83   2e-15
KLLA0E07437g Chr5 complement(672690..673787) [1098 bp, 365 aa] {...    81   2e-15
Kpol_1031.32 s1031 (76827..78821) [1995 bp, 664 aa] {ON} (76827....    83   2e-15
KLLA0E15313g Chr5 (1362851..1365025) [2175 bp, 724 aa] {ON} simi...    83   2e-15
TBLA0D05640 Chr4 (1380616..1383066) [2451 bp, 816 aa] {ON} Anc_1...    83   2e-15
TPHA0M00300 Chr13 (59377..61701) [2325 bp, 774 aa] {ON} Anc_3.16...    83   3e-15
Kpol_513.17 s513 (49097..50824) [1728 bp, 575 aa] {ON} (49097..5...    82   3e-15
TBLA0B01990 Chr2 complement(458264..461623) [3360 bp, 1119 aa] {...    83   3e-15
KAFR0F02710 Chr6 (528336..529493) [1158 bp, 385 aa] {ON} Anc_2.3...    81   3e-15
ZYRO0A05192g Chr1 complement(416951..418198) [1248 bp, 415 aa] {...    81   3e-15
AFR205C Chr6 complement(805580..806953) [1374 bp, 457 aa] {ON} S...    81   3e-15
CAGL0L06820g Chr12 (769035..770135) [1101 bp, 366 aa] {ON} highl...    80   3e-15
KAFR0B00520 Chr2 (105553..107502) [1950 bp, 649 aa] {ON} Anc_4.1...    82   3e-15
TPHA0L02180 Chr12 (453556..455538) [1983 bp, 660 aa] {ON} Anc_5....    82   3e-15
KLLA0C10802g Chr3 complement(926916..931934) [5019 bp, 1672 aa] ...    83   3e-15
CAGL0J04972g Chr10 (475587..476606) [1020 bp, 339 aa] {ON} some ...    80   3e-15
Kpol_1041.29 s1041 (73725..74876) [1152 bp, 383 aa] {ON} (73725....    80   3e-15
Suva_6.208 Chr6 (369853..371880) [2028 bp, 675 aa] {ON} YJL128C ...    82   3e-15
TDEL0H01070 Chr8 complement(192834..194624) [1791 bp, 596 aa] {O...    82   4e-15
SAKL0E07722g Chr5 complement(625066..627441) [2376 bp, 791 aa] {...    82   4e-15
NCAS0A12200 Chr1 (2417539..2419782) [2244 bp, 747 aa] {ON} Anc_1...    82   4e-15
KAFR0G01810 Chr7 (386620..389130) [2511 bp, 836 aa] {ON} Anc_1.2...    82   4e-15
KNAG0D03980 Chr4 (721049..722170) [1122 bp, 373 aa] {ON} Anc_4.1...    80   5e-15
Skud_1.73 Chr1 (144821..146128) [1308 bp, 435 aa] {ON} YAR018C (...    80   5e-15
Kwal_55.22001 s55 (1069907..1070998) [1092 bp, 363 aa] {ON} YNL3...    80   6e-15
Smik_15.241 Chr15 (407598..408617) [1020 bp, 339 aa] {ON} YOR061...    79   6e-15
Suva_1.84 Chr1 complement(148430..149737) [1308 bp, 435 aa] {ON}...    80   7e-15
AFL217C Chr6 complement(30765..32840) [2076 bp, 691 aa] {ON} Syn...    81   7e-15
NCAS0A04010 Chr1 complement(809163..810299) [1137 bp, 378 aa] {O...    80   7e-15
NCAS0C05490 Chr3 (1114733..1115755) [1023 bp, 340 aa] {ON} Anc_5...    79   7e-15
TBLA0D03740 Chr4 complement(926538..929057) [2520 bp, 839 aa] {O...    81   8e-15
KAFR0F02190 Chr6 (428623..430095) [1473 bp, 490 aa] {ON} Anc_3.1...    80   8e-15
ZYRO0G16632g Chr7 (1360854..1365827) [4974 bp, 1657 aa] {ON} hig...    82   9e-15
CAGL0M08360g Chr13 complement(833220..835520) [2301 bp, 766 aa] ...    81   9e-15
Skud_14.309 Chr14 complement(566344..568263) [1920 bp, 639 aa] {...    81   9e-15
NDAI0C05160 Chr3 (1199533..1201026) [1494 bp, 497 aa] {ON} Anc_8...    80   9e-15
Ecym_2042 Chr2 complement(67312..68397) [1086 bp, 361 aa] {ON} s...    79   1e-14
KNAG0K01740 Chr11 (364195..366492) [2298 bp, 765 aa] {ON} Anc_3....    80   1e-14
YJL128C Chr10 complement(178097..180103) [2007 bp, 668 aa] {ON} ...    80   1e-14
YPR161C Chr16 complement(864449..866422) [1974 bp, 657 aa] {ON} ...    80   1e-14
Smik_1.78 Chr1 complement(147996..149303) [1308 bp, 435 aa] {ON}...    79   1e-14
TBLA0D02730 Chr4 complement(674994..676427) [1434 bp, 477 aa] {O...    80   1e-14
KLLA0D07810g Chr4 complement(669095..671251) [2157 bp, 718 aa] {...    80   1e-14
KLTH0F18942g Chr6 (1535941..1537032) [1092 bp, 363 aa] {ON} high...    79   1e-14
TBLA0D00220 Chr4 (52218..54500) [2283 bp, 760 aa] {ON} Anc_2.96 ...    80   1e-14
TPHA0H01300 Chr8 (293254..294282) [1029 bp, 342 aa] {ON} Anc_5.6...    78   1e-14
TPHA0O01080 Chr15 complement(205407..207653) [2247 bp, 748 aa] {...    80   1e-14
ZYRO0G04488g Chr7 complement(360635..362545) [1911 bp, 636 aa] {...    80   1e-14
KNAG0C01040 Chr3 complement(203429..204976) [1548 bp, 515 aa] {O...    80   1e-14
YDL079C Chr4 complement(312951..314044,314337..314748) [1506 bp,...    79   2e-14
Skud_16.460 Chr16 complement(807116..809077) [1962 bp, 653 aa] {...    80   2e-14
SAKL0C06666g Chr3 complement(628448..630367) [1920 bp, 639 aa] {...    80   2e-14
KLLA0E08405g Chr5 complement(756205..758538) [2334 bp, 777 aa] {...    80   2e-14
TBLA0G00820 Chr7 complement(191559..192833) [1275 bp, 424 aa] {O...    79   2e-14
NDAI0A04040 Chr1 complement(907696..910041) [2346 bp, 781 aa] {O...    80   2e-14
Kpol_1033.1 s1033 complement(1..828) [828 bp, 276 aa] {ON} compl...    77   2e-14
CAGL0G02035g Chr7 (179911..180930) [1020 bp, 339 aa] {ON} highly...    78   2e-14
Skud_10.87 Chr10 complement(153140..155164) [2025 bp, 674 aa] {O...    80   2e-14
AEL179W Chr5 (302948..303817) [870 bp, 289 aa] {ON} NOHBY510; No...    77   2e-14
KNAG0L01860 Chr12 (336795..337817) [1023 bp, 340 aa] {ON} Anc_5....    78   2e-14
KAFR0I01570 Chr9 (330982..332574) [1593 bp, 530 aa] {ON} Anc_2.5...    79   2e-14
NCAS0H03070 Chr8 complement(590494..592440) [1947 bp, 648 aa] {O...    79   3e-14
Smik_10.106 Chr10 complement(175752..177776) [2025 bp, 674 aa] {...    79   3e-14
NDAI0G00640 Chr7 (139655..141520) [1866 bp, 621 aa] {ON} Anc_2.284     79   3e-14
Suva_14.32 Chr14 complement(52757..53884) [1128 bp, 375 aa] {ON}...    78   3e-14
SAKL0G00990g Chr7 complement(89700..90824) [1125 bp, 374 aa] {ON...    78   3e-14
TPHA0P01380 Chr16 (278259..279380) [1122 bp, 373 aa] {ON} Anc_3....    77   3e-14
Suva_14.327 Chr14 complement(578572..580470) [1899 bp, 632 aa] {...    79   3e-14
KNAG0B00260 Chr2 complement(36240..38477) [2238 bp, 745 aa] {ON}...    79   3e-14
TBLA0C03180 Chr3 complement(770462..775468) [5007 bp, 1668 aa] {...    80   3e-14
Ecym_4056 Chr4 complement(119406..120428) [1023 bp, 340 aa] {ON}...    77   3e-14
ADR204W Chr4 (1062593..1063612) [1020 bp, 339 aa] {ON} Syntenic ...    77   3e-14
Suva_3.129 Chr3 (193311..194282) [972 bp, 323 aa] {ON} YCR091W (...    77   4e-14
TBLA0D01200 Chr4 (303528..305198) [1671 bp, 556 aa] {ON} Anc_8.7...    79   4e-14
TDEL0B02610 Chr2 complement(470263..471282) [1020 bp, 339 aa] {O...    77   4e-14
TBLA0A09370 Chr1 complement(2310412..2311443) [1032 bp, 343 aa] ...    77   4e-14
SAKL0G10384g Chr7 complement(883824..888848) [5025 bp, 1674 aa] ...    79   4e-14
KNAG0J02660 Chr10 (495011..497425) [2415 bp, 804 aa] {ON} Anc_1....    79   4e-14
Suva_16.491 Chr16 complement(848824..850794) [1971 bp, 656 aa] {...    79   4e-14
Smik_11.200 Chr11 complement(333676..335592) [1917 bp, 638 aa] {...    79   4e-14
KLLA0D12100g Chr4 complement(1031728..1033161) [1434 bp, 477 aa]...    78   4e-14
KLTH0F17490g Chr6 (1413752..1414774) [1023 bp, 340 aa] {ON} high...    77   4e-14
KNAG0J00820 Chr10 complement(137927..141202) [3276 bp, 1091 aa] ...    79   5e-14
Kwal_33.14554 s33 (717776..719920) [2145 bp, 714 aa] {ON} YNL161...    79   5e-14
Ecym_3160 Chr3 complement(304537..306957) [2421 bp, 806 aa] {ON}...    79   5e-14
Suva_2.413 Chr2 (735541..736923) [1383 bp, 460 aa] {ON} YDR247W ...    77   5e-14
Smik_16.420 Chr16 complement(725685..727658) [1974 bp, 657 aa] {...    78   5e-14
NCAS0D01230 Chr4 complement(225213..226661) [1449 bp, 482 aa] {O...    78   5e-14
TPHA0N01450 Chr14 complement(318088..320340) [2253 bp, 750 aa] {...    79   5e-14
Ecym_4364 Chr4 (772870..773997) [1128 bp, 375 aa] {ON} similar t...    77   6e-14
NCAS0B06260 Chr2 complement(1180650..1182821) [2172 bp, 723 aa] ...    78   6e-14
KNAG0A01330 Chr1 complement(34784..35977) [1194 bp, 397 aa] {ON}...    77   6e-14
TBLA0D02070 Chr4 complement(522456..523958) [1503 bp, 500 aa] {O...    77   6e-14
TPHA0G02800 Chr7 (597211..598722) [1512 bp, 503 aa] {ON} Anc_2.4...    77   6e-14
Skud_10.283 Chr10 (503324..505765) [2442 bp, 813 aa] {ON} YJR059...    78   7e-14
Suva_12.148 Chr12 (223571..225982) [2412 bp, 804 aa] {ON} YJR059...    78   7e-14
Suva_11.178 Chr11 complement(330253..332184) [1932 bp, 643 aa] {...    78   7e-14
Kpol_1032.10 s1032 (24479..26854) [2376 bp, 791 aa] {ON} (24479....    78   8e-14
SAKL0B04752g Chr2 (416940..418259) [1320 bp, 439 aa] {ON} weakly...    77   8e-14
KLLA0F17006g Chr6 complement(1561859..1563106) [1248 bp, 415 aa]...    77   8e-14
TPHA0A05460 Chr1 (1233608..1235170) [1563 bp, 520 aa] {ON} Anc_5...    77   8e-14
NDAI0F03200 Chr6 complement(770618..772924) [2307 bp, 768 aa] {O...    78   9e-14
KLTH0B06424g Chr2 complement(518184..520328) [2145 bp, 714 aa] {...    77   9e-14
Suva_14.178 Chr14 (328862..331195) [2334 bp, 777 aa] {ON} YNL161...    78   1e-13
ABR088C Chr2 complement(546325..547920) [1596 bp, 531 aa] {ON} S...    77   1e-13
TBLA0C05800 Chr3 complement(1402262..1405207) [2946 bp, 981 aa] ...    78   1e-13
TPHA0B01150 Chr2 complement(259998..262070) [2073 bp, 690 aa] {O...    77   1e-13
YJR059W Chr10 (545787..548243) [2457 bp, 818 aa] {ON}  PTK2Putat...    77   1e-13
Suva_4.168 Chr4 complement(302527..303654) [1128 bp, 375 aa] {ON...    76   1e-13
KNAG0A04080 Chr1 complement(551409..552635) [1227 bp, 408 aa] {O...    76   1e-13
Ecym_6400 Chr6 complement(779716..781983) [2268 bp, 755 aa] {ON}...    77   1e-13
ZYRO0G05214g Chr7 (420482..422980) [2499 bp, 832 aa] {ON} some s...    77   1e-13
AFR035W Chr6 (498529..500688) [2160 bp, 719 aa] {ON} Syntenic ho...    77   1e-13
Kwal_55.21900 s55 complement(1027253..1029130) [1878 bp, 625 aa]...    77   2e-13
Smik_14.167 Chr14 (311655..312284,312591..314228) [2268 bp, 755 ...    77   2e-13
CAGL0E01683g Chr5 complement(166821..167948) [1128 bp, 375 aa] {...    75   2e-13
TPHA0L01350 Chr12 (282034..283884) [1851 bp, 616 aa] {ON}              77   2e-13
YNL161W Chr14 (332597..334867) [2271 bp, 756 aa] {ON}  CBK1Serin...    77   2e-13
Skud_11.181 Chr11 complement(326935..328845) [1911 bp, 636 aa] {...    77   2e-13
SAKL0E12342g Chr5 complement(1021369..1023795) [2427 bp, 808 aa]...    77   2e-13
KAFR0A07370 Chr1 complement(1487868..1490012) [2145 bp, 714 aa] ...    77   2e-13
TBLA0B08650 Chr2 (2065061..2066308) [1248 bp, 415 aa] {ON} Anc_3...    75   2e-13
KNAG0F01440 Chr6 (261403..263685) [2283 bp, 760 aa] {ON}               76   2e-13
CAGL0J06072g Chr10 complement(574501..576822) [2322 bp, 773 aa] ...    76   2e-13
SAKL0F15510g Chr6 complement(1251475..1253373) [1899 bp, 632 aa]...    76   2e-13
Skud_14.172 Chr14 (323327..325564) [2238 bp, 745 aa] {ON} YNL161...    76   2e-13
ZYRO0C12078g Chr3 (946320..948647) [2328 bp, 775 aa] {ON} simila...    76   3e-13
Ecym_5209 Chr5 complement(445530..448133) [2604 bp, 867 aa] {ON}...    76   3e-13
NCAS0G02070 Chr7 (372747..374960) [2214 bp, 737 aa] {ON} Anc_2.96      76   3e-13
Kpol_1031.76 s1031 (193193..194923) [1731 bp, 576 aa] {ON} (1931...    75   3e-13
KLTH0F05918g Chr6 complement(525566..527254) [1689 bp, 562 aa] {...    75   4e-13
Smik_14.311 Chr14 complement(558013..559926) [1914 bp, 637 aa] {...    75   4e-13
TDEL0F00530 Chr6 complement(88187..90517) [2331 bp, 776 aa] {ON}...    75   4e-13
Ecym_3323 Chr3 (618386..620632) [2247 bp, 748 aa] {ON} similar t...    75   4e-13
NDAI0J00420 Chr10 (73312..75606) [2295 bp, 764 aa] {ON} Anc_7.515      75   4e-13
TBLA0A07770 Chr1 complement(1916632..1917939) [1308 bp, 435 aa] ...    74   4e-13
TPHA0F02150 Chr6 complement(475516..477768) [2253 bp, 750 aa] {O...    75   4e-13
CAGL0H01837g Chr8 complement(176352..178736) [2385 bp, 794 aa] {...    75   5e-13
KAFR0A00840 Chr1 complement(151896..152894) [999 bp, 332 aa] {ON...    73   5e-13
KAFR0E00330 Chr5 complement(74619..76574) [1956 bp, 651 aa] {ON}...    75   5e-13
ZYRO0B16038g Chr2 (1300484..1301515) [1032 bp, 343 aa] {ON} high...    74   5e-13
NDAI0D01450 Chr4 (339780..341948) [2169 bp, 722 aa] {ON} Anc_1.507     75   5e-13
TDEL0A00600 Chr1 complement(101753..102877) [1125 bp, 374 aa] {O...    74   5e-13
NCAS0C04540 Chr3 complement(929920..931056) [1137 bp, 378 aa] {O...    74   6e-13
KAFR0C00430 Chr3 complement(88561..91410) [2850 bp, 949 aa] {ON}...    75   6e-13
KLLA0E04247g Chr5 (382874..383995) [1122 bp, 373 aa] {ON} simila...    74   6e-13
YKL198C Chr11 complement(68232..70220) [1989 bp, 662 aa] {ON}  P...    75   6e-13
KNAG0A02220 Chr1 complement(198240..199979) [1740 bp, 579 aa] {O...    75   6e-13
ADL168C Chr4 complement(398517..399605) [1089 bp, 362 aa] {ON} S...    73   7e-13
KAFR0H01460 Chr8 complement(269957..271705) [1749 bp, 582 aa] {O...    74   7e-13
KNAG0F03730 Chr6 complement(697517..699586) [2070 bp, 689 aa] {O...    75   7e-13
Smik_10.349 Chr10 (534756..537209) [2454 bp, 817 aa] {ON} YJR059...    75   7e-13
TPHA0I03100 Chr9 complement(681645..683666) [2022 bp, 673 aa] {O...    75   7e-13
Skud_4.176 Chr4 complement(308461..309594) [1134 bp, 377 aa] {ON...    73   9e-13
ABR177C Chr2 complement(735829..738090) [2262 bp, 753 aa] {ON} S...    74   9e-13
NCAS0C03560 Chr3 complement(710551..712476) [1926 bp, 641 aa] {O...    74   1e-12
TBLA0A01580 Chr1 complement(367370..369976) [2607 bp, 868 aa] {O...    74   1e-12
NCAS0G03420 Chr7 (628644..630668) [2025 bp, 674 aa] {ON} Anc_1.507     74   1e-12
KAFR0C01720 Chr3 (351078..352208) [1131 bp, 376 aa] {ON} Anc_3.4...    72   1e-12
Skud_14.32 Chr14 complement(49930..51057) [1128 bp, 375 aa] {ON}...    72   2e-12
Kpol_1039.33 s1039 complement(102096..104201) [2106 bp, 701 aa] ...    74   2e-12
Ecym_2650 Chr2 complement(1257641..1260325) [2685 bp, 894 aa] {O...    74   2e-12
KLTH0E11396g Chr5 (1018348..1020069) [1722 bp, 573 aa] {ON} simi...    73   2e-12
TBLA0B06940 Chr2 (1639189..1643520) [4332 bp, 1443 aa] {ON} Anc_...    74   2e-12
Ecym_7206 Chr7 complement(423402..425576) [2175 bp, 724 aa] {ON}...    73   2e-12
Smik_14.24 Chr14 complement(40883..42010) [1128 bp, 375 aa] {ON}...    72   2e-12
Smik_11.24 Chr11 complement(52600..54522) [1923 bp, 640 aa] {ON}...    73   2e-12
TPHA0C03380 Chr3 (740939..743032) [2094 bp, 697 aa] {ON} Anc_2.2...    73   2e-12
YNL307C Chr14 complement(56446..57573) [1128 bp, 375 aa] {ON}  M...    72   2e-12
Skud_11.20 Chr11 complement(51603..53558) [1956 bp, 651 aa] {ON}...    73   2e-12
Kpol_1067.14 s1067 (29413..31050) [1638 bp, 545 aa] {ON} (29413....    72   3e-12
TDEL0G02150 Chr7 (422718..424703) [1986 bp, 661 aa] {ON} Anc_2.2...    73   3e-12
ADL217W Chr4 (321491..323743) [2253 bp, 750 aa] {ON} Syntenic ho...    73   3e-12
ADL102C Chr4 complement(503667..504785) [1119 bp, 372 aa] {ON} S...    71   3e-12
NCAS0E01560 Chr5 (294095..295345) [1251 bp, 416 aa] {ON}               72   3e-12
TDEL0F02980 Chr6 (539327..541549) [2223 bp, 740 aa] {ON} Anc_1.1...    72   3e-12
NCAS0C02390 Chr3 complement(446642..448468) [1827 bp, 608 aa] {O...    72   4e-12
KNAG0G00280 Chr7 complement(43196..45262) [2067 bp, 688 aa] {ON}...    72   4e-12
Ecym_8164 Chr8 (342672..346076) [3405 bp, 1134 aa] {ON} similar ...    73   4e-12
KNAG0C02250 Chr3 complement(444156..446639) [2484 bp, 827 aa] {O...    72   4e-12
TBLA0E02590 Chr5 complement(651679..654864) [3186 bp, 1061 aa] {...    72   4e-12
NCAS0F02410 Chr6 complement(476683..478071) [1389 bp, 462 aa] {O...    72   4e-12
NCAS0G00490 Chr7 complement(83953..84996) [1044 bp, 347 aa] {ON}...    70   4e-12
ZYRO0F08272g Chr6 (668685..670508) [1824 bp, 607 aa] {ON} simila...    72   4e-12
KAFR0D04760 Chr4 complement(932849..936205) [3357 bp, 1118 aa] {...    72   5e-12
NDAI0E03080 Chr5 complement(653882..655798) [1917 bp, 638 aa] {O...    72   5e-12
TPHA0E02270 Chr5 (471696..472916) [1221 bp, 406 aa] {ON} Anc_5.2...    71   5e-12
CAGL0G02607g Chr7 complement(240244..242310) [2067 bp, 688 aa] {...    72   6e-12
Ecym_2540 Chr2 (1048071..1049792) [1722 bp, 573 aa] {ON} similar...    71   6e-12
Suva_9.104 Chr9 (178011..180428) [2418 bp, 805 aa] {ON} YIL095W ...    72   6e-12
Ecym_2302 Chr2 (587299..588951) [1653 bp, 550 aa] {ON} similar t...    71   6e-12
Kwal_27.12559 s27 (1273349..1274593) [1245 bp, 414 aa] {ON} YPR0...    70   6e-12
TPHA0C01810 Chr3 complement(413495..414790) [1296 bp, 431 aa] {O...    71   6e-12
TDEL0B01470 Chr2 complement(257397..259169) [1773 bp, 590 aa] {O...    71   6e-12
Kpol_161.2 s161 complement(3125..4246) [1122 bp, 373 aa] {ON} co...    70   7e-12
KLLA0F08877g Chr6 (825217..826182) [966 bp, 321 aa] {ON} uniprot...    70   7e-12
ZYRO0C02772g Chr3 (216325..217464) [1140 bp, 379 aa] {ON} highly...    70   7e-12
KLLA0F16467g Chr6 (1519800..1520822) [1023 bp, 340 aa] {ON} high...    70   7e-12
KLLA0B06501g Chr2 complement(576636..579089) [2454 bp, 817 aa] {...    72   8e-12
TDEL0H00560 Chr8 (94614..96500) [1887 bp, 628 aa] {ON} Anc_7.515...    71   8e-12
TPHA0B03130 Chr2 complement(719624..721372) [1749 bp, 582 aa] {O...    71   8e-12
Kpol_1056.20 s1056 complement(44529..46724) [2196 bp, 731 aa] {O...    71   8e-12
KLTH0G10318g Chr7 (872129..874501) [2373 bp, 790 aa] {ON} simila...    71   9e-12
KLTH0F18458g Chr6 complement(1491777..1493663) [1887 bp, 628 aa]...    71   1e-11
KAFR0A01040 Chr1 complement(197612..200350) [2739 bp, 912 aa] {O...    71   1e-11
Suva_11.24 Chr11 complement(52742..52930,52961..54523) [1752 bp,...    70   1e-11
SAKL0F07854g Chr6 (600324..601442) [1119 bp, 372 aa] {ON} highly...    70   1e-11
Kpol_1013.52 s1013 (123332..125881) [2550 bp, 849 aa] {ON} (1233...    71   1e-11
CAGL0L12650g Chr12 (1360085..1361788) [1704 bp, 567 aa] {ON} sim...    70   1e-11
YIL095W Chr9 (183937..186369) [2433 bp, 810 aa] {ON}  PRK1Protei...    70   1e-11
Skud_9.134 Chr9 complement(256610..257728) [1119 bp, 372 aa] {ON...    69   1e-11
KLLA0D11814g Chr4 complement(1007240..1009021) [1782 bp, 593 aa]...    70   2e-11
Skud_16.239 Chr16 complement(438063..439727) [1665 bp, 554 aa] {...    70   2e-11
Kwal_27.11830 s27 (964584..966311) [1728 bp, 575 aa] {ON} YPL042...    70   2e-11
KNAG0D02790 Chr4 (507235..508848) [1614 bp, 537 aa] {ON} Anc_5.3...    70   2e-11
ZYRO0G20570g Chr7 (1695518..1697305) [1788 bp, 595 aa] {ON} simi...    70   2e-11
YPL042C Chr16 complement(473040..474707) [1668 bp, 555 aa] {ON} ...    70   2e-11
SAKL0H11352g Chr8 complement(975064..976857) [1794 bp, 597 aa] {...    70   2e-11
Smik_16.193 Chr16 complement(350311..351978) [1668 bp, 555 aa] {...    70   2e-11
KNAG0H02860 Chr8 (531728..532843) [1116 bp, 371 aa] {ON}               69   2e-11
NCAS0A15040 Chr1 complement(2962030..2964036) [2007 bp, 668 aa] ...    70   3e-11
KLLA0F01507g Chr6 (144356..145774) [1419 bp, 472 aa] {ON} some s...    69   3e-11
Kwal_27.11542 s27 complement(841389..843764) [2376 bp, 791 aa] {...    70   3e-11
Smik_2.191 Chr2 complement(338792..342118) [3327 bp, 1108 aa] {O...    70   3e-11
TBLA0G01910 Chr7 complement(500551..502596) [2046 bp, 681 aa] {O...    69   3e-11
Kpol_1060.53 s1060 complement(126120..128330) [2211 bp, 736 aa] ...    69   3e-11
YIL035C Chr9 complement(287790..288908) [1119 bp, 372 aa] {ON}  ...    68   3e-11
KLLA0B11946g Chr2 complement(1048033..1049352) [1320 bp, 439 aa]...    69   3e-11
NDAI0G05790 Chr7 complement(1433294..1435252) [1959 bp, 652 aa] ...    69   3e-11
NDAI0G03920 Chr7 complement(934765..935889) [1125 bp, 374 aa] {O...    68   3e-11
TPHA0K02030 Chr11 (432238..434505) [2268 bp, 755 aa] {ON} Anc_4....    69   4e-11
Kpol_1035.34 s1035 (79914..80978) [1065 bp, 354 aa] {ON} (79914....    68   4e-11
Kwal_55.20221 s55 (304482..308006) [3525 bp, 1174 aa] {ON} YHR07...    69   4e-11
TPHA0B02780 Chr2 complement(633307..634449) [1143 bp, 380 aa] {O...    68   4e-11
TBLA0J01200 Chr10 (271800..275420) [3621 bp, 1206 aa] {ON} Anc_1...    69   5e-11
TPHA0H01470 Chr8 complement(329451..333578) [4128 bp, 1375 aa] {...    69   5e-11
Suva_16.274 Chr16 complement(476249..477916) [1668 bp, 555 aa] {...    68   6e-11
TBLA0J00250 Chr10 (42058..44457) [2400 bp, 799 aa] {ON} Anc_7.51...    69   6e-11
NDAI0B00400 Chr2 (74403..76643) [2241 bp, 746 aa] {ON} Anc_1.149       69   6e-11
Kwal_33.13681 s33 complement(350547..352694) [2148 bp, 715 aa] {...    69   6e-11
KAFR0A02560 Chr1 complement(532248..533351) [1104 bp, 367 aa] {O...    67   7e-11
ADL043C Chr4 complement(612088..614109) [2022 bp, 673 aa] {ON} S...    68   7e-11
TBLA0B10030 Chr2 (2399979..2402123) [2145 bp, 714 aa] {ON} Anc_4...    68   8e-11
TBLA0B05930 Chr2 (1400163..1402316) [2154 bp, 717 aa] {ON} Anc_2...    68   8e-11
NDAI0B03560 Chr2 complement(892839..895109) [2271 bp, 756 aa] {O...    68   9e-11
TBLA0H00370 Chr8 (71216..73393) [2178 bp, 725 aa] {ON} Anc_2.425...    68   9e-11
YBR059C Chr2 complement(356861..360187) [3327 bp, 1108 aa] {ON} ...    68   1e-10
NDAI0E01960 Chr5 (397897..399717) [1821 bp, 606 aa] {ON} Anc_2.425     68   1e-10
AGL249C Chr7 complement(234347..236092) [1746 bp, 581 aa] {ON} S...    67   1e-10
NDAI0A02720 Chr1 complement(612346..613455) [1110 bp, 369 aa] {O...    67   1e-10
KLLA0D10527g Chr4 (892955..894892) [1938 bp, 645 aa] {ON} simila...    68   1e-10
Kpol_1052.22 s1052 (72364..75669) [3306 bp, 1101 aa] {ON} (72364...    68   1e-10
Kwal_33.13825 s33 (409772..412477) [2706 bp, 901 aa] {ON} YKL171...    68   1e-10
Kwal_33.14081 s33 complement(519343..521085) [1743 bp, 580 aa] {...    67   1e-10
KNAG0B04500 Chr2 (865766..869089) [3324 bp, 1107 aa] {ON} Anc_5....    68   1e-10
TPHA0D01540 Chr4 complement(316471..318594) [2124 bp, 707 aa] {O...    67   1e-10
NCAS0A06000 Chr1 (1184842..1187133) [2292 bp, 763 aa] {ON} Anc_4...    67   1e-10
YOL128C Chr15 complement(78352..79479) [1128 bp, 375 aa] {ON}  Y...    66   1e-10
Skud_11.54 Chr11 (113775..116570) [2796 bp, 931 aa] {ON} YKL171W...    67   1e-10
CAGL0F03245g Chr6 complement(316924..320034) [3111 bp, 1036 aa] ...    67   2e-10
TPHA0M01120 Chr13 complement(223548..225914) [2367 bp, 788 aa] {...    67   2e-10
SAKL0H24288g Chr8 (2099353..2101317) [1965 bp, 654 aa] {ON} simi...    67   2e-10
KAFR0J01370 Chr10 complement(250424..252766) [2343 bp, 780 aa] {...    67   2e-10
TBLA0H02950 Chr8 complement(721123..723906) [2784 bp, 927 aa] {O...    67   2e-10
KLTH0F03916g Chr6 complement(348177..350282) [2106 bp, 701 aa] {...    67   2e-10
KNAG0H00560 Chr8 (89502..91268) [1767 bp, 588 aa] {ON} Anc_2.597...    67   2e-10
Smik_9.84 Chr9 (162983..165409) [2427 bp, 808 aa] {ON} YIL095W (...    67   2e-10
NDAI0G01760 Chr7 (384420..385700) [1281 bp, 426 aa] {ON}               66   2e-10
Kpol_1063.4 s1063 complement(10790..11932) [1143 bp, 380 aa] {ON...    66   2e-10
KLLA0B07579g Chr2 (659591..661759) [2169 bp, 722 aa] {ON} simila...    67   2e-10
CAGL0J03432g Chr10 (330031..331899) [1869 bp, 622 aa] {ON} simil...    67   2e-10
CAGL0I05192g Chr9 complement(493635..494756) [1122 bp, 373 aa] {...    65   2e-10
TPHA0A02630 Chr1 complement(562516..565164) [2649 bp, 882 aa] {O...    67   2e-10
ADR293C Chr4 complement(1207021..1210425) [3405 bp, 1134 aa] {ON...    67   2e-10
CAGL0H10208g Chr8 complement(996853..999936) [3084 bp, 1027 aa] ...    67   2e-10
NDAI0A05700 Chr1 (1288604..1292077) [3474 bp, 1157 aa] {ON} Anc_...    67   2e-10
Kwal_47.18098 s47 (685497..686621) [1125 bp, 374 aa] {ON} YIL035...    65   2e-10
NCAS0A11020 Chr1 (2193556..2194869) [1314 bp, 437 aa] {ON} Anc_3...    66   2e-10
Kwal_47.17345 s47 complement(364905..367004) [2100 bp, 699 aa] {...    67   2e-10
KLTH0A03542g Chr1 (306667..307803) [1137 bp, 378 aa] {ON} highly...    65   2e-10
YKL171W Chr11 (127475..130261) [2787 bp, 928 aa] {ON}  NNK1Prote...    67   3e-10
KLLA0D13266g Chr4 complement(1137750..1141208) [3459 bp, 1152 aa...    67   3e-10
TBLA0A03220 Chr1 complement(765108..768590) [3483 bp, 1160 aa] {...    67   3e-10
ADL315C Chr4 complement(146096..147400) [1305 bp, 434 aa] {ON} S...    66   3e-10
NCAS0B08320 Chr2 complement(1585766..1588471) [2706 bp, 901 aa] ...    67   3e-10
TBLA0B09215 Chr2 complement(2180179..2181375) [1197 bp, 398 aa] ...    65   3e-10
ZYRO0D01584g Chr4 (124739..126688) [1950 bp, 649 aa] {ON} some s...    66   3e-10
Smik_15.25 Chr15 complement(46541..47668) [1128 bp, 375 aa] {ON}...    65   3e-10
TPHA0A04030 Chr1 (901665..904829) [3165 bp, 1054 aa] {ON} Anc_3....    66   3e-10
NCAS0A10590 Chr1 complement(2108142..2111429) [3288 bp, 1095 aa]...    66   3e-10
Smik_8.156 Chr8 complement(234928..238269) [3342 bp, 1113 aa] {O...    66   3e-10
CAGL0M08316g Chr13 (829069..831963) [2895 bp, 964 aa] {ON} weakl...    66   4e-10
Suva_9.165 Chr9 complement(276469..277587) [1119 bp, 372 aa] {ON...    65   4e-10
CAGL0K11990g Chr11 complement(1156224..1159199) [2976 bp, 991 aa...    66   4e-10
Kpol_209.1 s209 (1823..5734) [3912 bp, 1303 aa] {ON} (1823..5734...    66   4e-10
ZYRO0G18590g Chr7 complement(1533974..1536202) [2229 bp, 742 aa]...    66   4e-10
Suva_4.297 Chr4 complement(523650..526973) [3324 bp, 1107 aa] {O...    66   4e-10
Suva_15.271 Chr15 complement(460466..463813) [3348 bp, 1115 aa] ...    66   4e-10
KLTH0E07128g Chr5 complement(657986..660064) [2079 bp, 692 aa] {...    65   5e-10
Suva_16.382 Chr16 (673009..674205) [1197 bp, 398 aa] {ON} YPR054...    65   5e-10
KAFR0F01630 Chr6 complement(323802..326057) [2256 bp, 751 aa] {O...    65   5e-10
NDAI0H02930 Chr8 (715278..716846) [1569 bp, 522 aa] {ON} Anc_2.391     65   5e-10
ZYRO0D16170g Chr4 (1348849..1349982) [1134 bp, 377 aa] {ON} high...    65   5e-10
NCAS0A13320 Chr1 (2622149..2623258) [1110 bp, 369 aa] {ON}             64   5e-10
TBLA0I01930 Chr9 complement(436511..440596) [4086 bp, 1361 aa] {...    66   5e-10
YHR079C Chr8 complement(258244..261591) [3348 bp, 1115 aa] {ON} ...    65   6e-10
Smik_9.156 Chr9 complement(261998..263116) [1119 bp, 372 aa] {ON...    64   6e-10
AEL173W Chr5 (313261..314856) [1596 bp, 531 aa] {ON} Syntenic ho...    65   6e-10
KLTH0D03080g Chr4 (295808..297730) [1923 bp, 640 aa] {ON} simila...    65   7e-10
Suva_11.52 Chr11 (112355..115156) [2802 bp, 933 aa] {ON} YKL171W...    65   7e-10
KLTH0F05522g Chr6 complement(477035..478975) [1941 bp, 646 aa] {...    65   7e-10
AGR027C Chr7 complement(763303..766188) [2886 bp, 961 aa] {ON} S...    65   8e-10
Skud_2.179 Chr2 complement(325193..328465) [3273 bp, 1090 aa] {O...    65   8e-10
TBLA0E02460 Chr5 (620609..621745) [1137 bp, 378 aa] {ON} Anc_7.2...    64   9e-10
Smik_10.183 Chr10 complement(319743..321746) [2004 bp, 667 aa] {...    65   9e-10
Kpol_2001.46 s2001 (127016..129376) [2361 bp, 786 aa] {ON} (1270...    65   9e-10
CAGL0K00693g Chr11 complement(75466..78096) [2631 bp, 876 aa] {O...    65   1e-09
Smik_16.296 Chr16 (542962..544128) [1167 bp, 388 aa] {ON} YPR054...    64   1e-09
CAGL0D06600g Chr4 (626571..628748) [2178 bp, 725 aa] {ON} simila...    64   1e-09
KAFR0F02730 Chr6 (537477..539309) [1833 bp, 610 aa] {ON} Anc_4.4...    64   1e-09
Kpol_1066.19 s1066 (31013..32806) [1794 bp, 597 aa] {OFF} (31013...    64   1e-09
Kpol_YGOB_1066.19 s1066 (30983..32806) [1824 bp, 607 aa] {ON} AN...    64   1e-09
ACR249C Chr3 complement(797020..798951) [1932 bp, 643 aa] {ON} S...    64   1e-09
NCAS0I03020 Chr9 (555481..557853) [2373 bp, 790 aa] {ON} Anc_1.149     64   1e-09
Smik_11.58 Chr11 (112932..115715) [2784 bp, 927 aa] {ON} YKL171W...    64   1e-09
Kpol_2001.31 s2001 complement(90402..93110) [2709 bp, 902 aa] {O...    64   1e-09
Ecym_8380 Chr8 (772519..774573) [2055 bp, 684 aa] {ON} similar t...    64   1e-09
Skud_10.153 Chr10 (288733..290742) [2010 bp, 669 aa] {ON} YJL057...    64   1e-09
KAFR0H01040 Chr8 complement(189604..190860) [1257 bp, 418 aa] {O...    64   1e-09
Kpol_376.5 s376 (6334..7767) [1434 bp, 477 aa] {ON} (6334..7767)...    64   1e-09
NCAS0H01740 Chr8 complement(331436..335284) [3849 bp, 1282 aa] {...    64   1e-09
YJL187C Chr10 complement(76803..79262) [2460 bp, 819 aa] {ON}  S...    64   1e-09
TDEL0H02380 Chr8 complement(399810..400931) [1122 bp, 373 aa] {O...    63   2e-09
Suva_15.32 Chr15 complement(56314..57447) [1134 bp, 377 aa] {ON}...    63   2e-09
Kpol_1027.1 s1027 (1..2088) [2088 bp, 695 aa] {ON} (1..2088) [20...    64   2e-09
NDAI0A05280 Chr1 complement(1191032..1192342) [1311 bp, 436 aa] ...    63   2e-09
TPHA0A04570 Chr1 (1038551..1040674) [2124 bp, 707 aa] {ON} Anc_1...    64   2e-09
Suva_6.268 Chr6 (470348..472519) [2172 bp, 723 aa] {ON} YJL187C ...    64   2e-09
SAKL0B07304g Chr2 (625541..627007) [1467 bp, 488 aa] {ON} simila...    63   2e-09
Skud_10.30 Chr10 complement(51698..54124) [2427 bp, 808 aa] {ON}...    64   2e-09
KLTH0F04686g Chr6 (413669..416209) [2541 bp, 846 aa] {ON} weakly...    64   2e-09
AEL149C Chr5 complement(348350..350533) [2184 bp, 727 aa] {ON} S...    63   2e-09
CAGL0D01694g Chr4 complement(176981..178279) [1299 bp, 432 aa] {...    62   3e-09
Kwal_33.13984 s33 complement(471429..473378) [1950 bp, 649 aa] {...    63   3e-09
KNAG0E03260 Chr5 complement(654134..655246) [1113 bp, 370 aa] {O...    62   3e-09
Kpol_2001.10 s2001 (30724..33018) [2295 bp, 764 aa] {ON} (30724....    63   3e-09
Skud_16.340 Chr16 (631100..632266) [1167 bp, 388 aa] {ON} YPR054...    62   3e-09
Suva_6.133 Chr6 (221952..223955) [2004 bp, 667 aa] {ON} YJL057C ...    63   3e-09
ZYRO0B00638g Chr2 (42738..44930) [2193 bp, 730 aa] {ON} similar ...    63   3e-09
YPR054W Chr16 (666280..667446) [1167 bp, 388 aa] {ON}  SMK1Middl...    62   3e-09
Kwal_27.10945 s27 (565717..568524) [2808 bp, 935 aa] {ON} YBR059...    63   3e-09
TBLA0D05770 Chr4 (1424960..1427671) [2712 bp, 903 aa] {ON} Anc_1...    63   4e-09
YJL057C Chr10 complement(328118..330121) [2004 bp, 667 aa] {ON} ...    62   4e-09
KLLA0F02838g Chr6 (264329..266596) [2268 bp, 755 aa] {ON} simila...    63   4e-09
CAGL0I05896g Chr9 (560169..562505) [2337 bp, 778 aa] {ON} some s...    63   4e-09
SAKL0D05104g Chr4 (402641..404692) [2052 bp, 683 aa] {ON} simila...    62   4e-09
CAGL0K12496g Chr11 (1219220..1220302) [1083 bp, 360 aa] {ON} sim...    61   5e-09
KLLA0F18612g Chr6 (1711131..1713575) [2445 bp, 814 aa] {ON} some...    62   5e-09
Skud_8.139 Chr8 complement(232178..235534) [3357 bp, 1118 aa] {O...    62   5e-09
KNAG0C02600 Chr3 complement(504486..507134) [2649 bp, 882 aa] {O...    62   5e-09
NDAI0G03150 Chr7 complement(741321..742463) [1143 bp, 380 aa] {O...    61   5e-09
AEL120W Chr5 (396394..398715) [2322 bp, 773 aa] {ON} Syntenic ho...    62   5e-09
KNAG0H01220 Chr8 (209884..212625) [2742 bp, 913 aa] {ON} Anc_3.2...    62   7e-09
Skud_9.78 Chr9 (160531..162960) [2430 bp, 809 aa] {ON} YIL095W (...    62   7e-09
Ecym_3488 Chr3 complement(915087..916400) [1314 bp, 437 aa] {ON}...    61   7e-09
SAKL0G08448g Chr7 (718250..721717) [3468 bp, 1155 aa] {ON} simil...    62   7e-09
KLTH0E03828g Chr5 (345775..349131) [3357 bp, 1118 aa] {ON} simil...    62   7e-09
ZYRO0A01848g Chr1 (152134..154248) [2115 bp, 704 aa] {ON} simila...    62   7e-09
NCAS0I02680 Chr9 (498371..500752) [2382 bp, 793 aa] {ON}               62   7e-09
Kpol_1003.35 s1003 (89266..91407) [2142 bp, 713 aa] {ON} (89266....    62   7e-09
ZYRO0C15862g Chr3 (1239992..1241305) [1314 bp, 437 aa] {ON} simi...    61   7e-09
Skud_15.25 Chr15 complement(43728..44864) [1137 bp, 378 aa] {ON}...    61   8e-09
NDAI0D02970 Chr4 (701299..704058) [2760 bp, 919 aa] {ON} Anc_4.4...    62   9e-09
KLLA0A05819g Chr1 (541545..543659) [2115 bp, 704 aa] {ON} simila...    61   1e-08
NCAS0A09170 Chr1 (1813960..1815846) [1887 bp, 628 aa] {ON} Anc_1...    61   1e-08
Kwal_26.7276 s26 (293129..295069) [1941 bp, 646 aa] {ON} YJL106W...    61   1e-08
SAKL0D03234g Chr4 (262365..264941) [2577 bp, 858 aa] {ON} some s...    61   1e-08
NDAI0G06240 Chr7 (1546580..1549282) [2703 bp, 900 aa] {ON} Anc_1...    61   1e-08
KLTH0C07260g Chr3 (626334..629039) [2706 bp, 901 aa] {ON} simila...    61   1e-08
KAFR0F01940 Chr6 complement(379908..382283) [2376 bp, 791 aa] {O...    61   1e-08
Ecym_6294 Chr6 complement(551351..552982) [1632 bp, 543 aa] {ON}...    60   1e-08
Ecym_8100 Chr8 complement(214001..216547) [2547 bp, 848 aa] {ON}...    61   1e-08
TBLA0B06510 Chr2 (1536156..1538489) [2334 bp, 777 aa] {ON} Anc_1...    61   1e-08
Ecym_8129 Chr8 (269437..271626) [2190 bp, 729 aa] {ON} similar t...    61   1e-08
Kpol_251.4 s251 (5802..8318) [2517 bp, 838 aa] {ON} (5802..8318)...    61   2e-08
ZYRO0F03190g Chr6 complement(270262..271371) [1110 bp, 369 aa] {...    60   2e-08
ZYRO0E06864g Chr5 complement(516731..520078) [3348 bp, 1115 aa] ...    61   2e-08
SAKL0C06248g Chr3 complement(577990..580185) [2196 bp, 731 aa] {...    60   2e-08
Smik_10.45 Chr10 complement(74813..77278) [2466 bp, 821 aa] {ON}...    61   2e-08
TBLA0A06670 Chr1 complement(1630701..1632023) [1323 bp, 440 aa] ...    60   2e-08
KLTH0E15004g Chr5 (1328930..1330165) [1236 bp, 411 aa] {ON} simi...    60   2e-08
KLTH0H10582g Chr8 (914695..916440) [1746 bp, 581 aa] {ON} weakly...    60   2e-08
Smik_12.44 Chr12 complement(92046..94262) [2217 bp, 738 aa] {ON}...    60   2e-08
TBLA0D05210 Chr4 (1279846..1282323) [2478 bp, 825 aa] {ON} Anc_1...    60   2e-08
KLLA0F22297g Chr6 complement(2083448..2085547) [2100 bp, 699 aa]...    60   2e-08
TDEL0H00890 Chr8 complement(146908..149088) [2181 bp, 726 aa] {O...    60   2e-08
Kwal_14.2554 s14 (811455..813233) [1779 bp, 592 aa] {ON} YJL057C...    60   2e-08
TDEL0C04800 Chr3 (866157..867467) [1311 bp, 436 aa] {ON} Anc_3.3...    59   2e-08
TDEL0F01550 Chr6 (282677..284839) [2163 bp, 720 aa] {ON} Anc_4.4...    60   2e-08
Skud_12.48 Chr12 complement(97218..99422) [2205 bp, 734 aa] {ON}...    60   2e-08
KNAG0I03000 Chr9 (596789..598840) [2052 bp, 683 aa] {ON} Anc_4.4...    60   3e-08
SAKL0C04576g Chr3 complement(444365..446611) [2247 bp, 748 aa] {...    60   3e-08
YLL019C Chr12 complement(105686..107899) [2214 bp, 737 aa] {ON} ...    60   3e-08
Ecym_6359 Chr6 complement(699564..702176) [2613 bp, 870 aa] {ON}...    60   3e-08
Suva_10.55 Chr10 complement(110943..113177) [2235 bp, 744 aa] {O...    60   4e-08
TPHA0I00820 Chr9 (177222..179651) [2430 bp, 809 aa] {ON} Anc_1.2...    59   4e-08
TDEL0D03520 Chr4 (647828..650977) [3150 bp, 1049 aa] {ON} Anc_3....    60   4e-08
TBLA0D02510 Chr4 complement(626101..627234) [1134 bp, 377 aa] {O...    59   4e-08
YJL141C Chr10 complement(147967..150390) [2424 bp, 807 aa] {ON} ...    59   4e-08
ZYRO0D10472g Chr4 (876899..880357) [3459 bp, 1152 aa] {ON} simil...    59   4e-08
TBLA0B08810 Chr2 (2094401..2095375) [975 bp, 324 aa] {ON} Anc_2....    58   5e-08
TPHA0M01500 Chr13 (317999..319291) [1293 bp, 430 aa] {ON} Anc_3....    59   5e-08
AFR076W Chr6 (564252..566714) [2463 bp, 820 aa] {ON} Syntenic ho...    59   5e-08
AFR150C Chr6 complement(707303..708352) [1050 bp, 349 aa] {ON} S...    58   6e-08
TPHA0A02760 Chr1 (594482..597502) [3021 bp, 1006 aa] {ON} Anc_1....    59   7e-08
ZYRO0D02970g Chr4 complement(231363..233669) [2307 bp, 768 aa] {...    59   8e-08
TDEL0D01930 Chr4 complement(373906..375753) [1848 bp, 615 aa] {O...    58   8e-08
Skud_10.73 Chr10 complement(123049..125436) [2388 bp, 795 aa] {O...    58   9e-08
Suva_6.221 Chr6 (399862..400920,400924..402096) [2232 bp, 743 aa...    58   9e-08
NCAS0C03810 Chr3 complement(772530..773660) [1131 bp, 376 aa] {O...    57   1e-07
Smik_10.91 Chr10 complement(145745..148153) [2409 bp, 802 aa] {O...    58   1e-07
SAKL0D06820g Chr4 (566145..567938) [1794 bp, 597 aa] {ON} simila...    58   1e-07
NDAI0C00570 Chr3 (108274..110547) [2274 bp, 757 aa] {ON}               58   1e-07
Skud_13.385 Chr13 complement(672612..674966) [2355 bp, 784 aa] {...    58   1e-07
TBLA0A02240 Chr1 (539297..540538) [1242 bp, 413 aa] {ON} Anc_6.2...    57   1e-07
TDEL0C03760 Chr3 complement(661391..663895) [2505 bp, 834 aa] {O...    57   1e-07
TBLA0J01000 Chr10 complement(227869..231072) [3204 bp, 1067 aa] ...    57   2e-07
YJL106W Chr10 (221390..223327) [1938 bp, 645 aa] {ON}  IME2Serin...    57   2e-07
KNAG0B01670 Chr2 (307587..309860) [2274 bp, 757 aa] {ON} Anc_1.2...    57   2e-07
Smik_10.132 Chr10 (212933..214873) [1941 bp, 646 aa] {ON} YJL106...    57   2e-07
KAFR0F01150 Chr6 complement(218711..219811) [1101 bp, 366 aa] {O...    56   2e-07
CAGL0G04455g Chr7 (426386..428641) [2256 bp, 751 aa] {ON} simila...    57   2e-07
KLLA0A06776g Chr1 (612115..614517) [2403 bp, 800 aa] {ON} simila...    57   3e-07
NCAS0A09570 Chr1 complement(1907017..1909200) [2184 bp, 727 aa] ...    57   3e-07
TDEL0D01220 Chr4 complement(228529..230451) [1923 bp, 640 aa] {O...    56   3e-07
KNAG0H00790 Chr8 complement(124926..126131) [1206 bp, 401 aa] {O...    56   3e-07
TDEL0E02600 Chr5 (501545..504934) [3390 bp, 1129 aa] {ON} Anc_5....    57   3e-07
KAFR0C03480 Chr3 (708186..709277) [1092 bp, 363 aa] {ON} Anc_8.4...    55   3e-07
KAFR0A01340 Chr1 (259300..261171) [1872 bp, 623 aa] {ON} Anc_1.2...    56   3e-07
SAKL0C05236g Chr3 (498347..501385) [3039 bp, 1012 aa] {ON} simil...    57   4e-07
CAGL0J05082g Chr10 (483782..485743) [1962 bp, 653 aa] {ON} simil...    56   4e-07
NDAI0C01890 Chr3 (419452..423777) [4326 bp, 1441 aa] {ON} Anc_5....    57   4e-07
YFL029C Chr6 complement(78055..79161) [1107 bp, 368 aa] {ON}  CA...    55   5e-07
Suva_13.399 Chr13 complement(679223..681388) [2166 bp, 721 aa] {...    55   6e-07
Suva_6.182 Chr6 complement(328699..330642) [1944 bp, 647 aa] {ON...    55   6e-07
NDAI0A00920 Chr1 (189693..192521) [2829 bp, 942 aa] {ON} Anc_1.1...    55   6e-07
Skud_16.42 Chr16 complement(75193..76287) [1095 bp, 364 aa] {ON}...    55   7e-07
KNAG0B05340 Chr2 complement(1031600..1033588) [1989 bp, 662 aa] ...    55   7e-07
CAGL0H08437g Chr8 complement(825191..829423) [4233 bp, 1410 aa] ...    55   8e-07
KNAG0A05430 Chr1 complement(800787..803153) [2367 bp, 788 aa] {O...    55   8e-07
YMR216C Chr13 complement(698811..701039) [2229 bp, 742 aa] {ON} ...    55   9e-07
TPHA0D00430 Chr4 complement(73651..74730) [1080 bp, 359 aa] {ON}...    54   9e-07
Kwal_56.24274 s56 (932404..933444) [1041 bp, 346 aa] {ON} YPL236...    54   1e-06
Kpol_1051.42 s1051 (98030..99379,99382..100212) [2181 bp, 726 aa...    55   1e-06
Skud_10.107 Chr10 (189314..191254) [1941 bp, 646 aa] {ON} YJL106...    54   1e-06
KAFR0A01740 Chr1 complement(356086..358035) [1950 bp, 649 aa] {O...    54   1e-06
TDEL0C00660 Chr3 complement(107849..108952) [1104 bp, 367 aa] {O...    54   2e-06
NDAI0G05370 Chr7 (1313015..1315555) [2541 bp, 846 aa] {ON} Anc_1...    54   2e-06
TPHA0I02660 Chr9 (582108..584219) [2112 bp, 703 aa] {ON} Anc_1.3...    54   2e-06
Suva_6.222 Chr6 (400975..402096) [1122 bp, 373 aa] {ON} YJL141C ...    53   2e-06
Smik_6.441 Chr6 (721619..722713) [1095 bp, 364 aa] {ON} YPL236C ...    53   2e-06
Smik_13.424 Chr13 complement(682907..685177) [2271 bp, 756 aa] {...    54   2e-06
Kpol_463.19 s463 complement(53246..55561) [2316 bp, 771 aa] {ON}...    54   2e-06
Skud_6.41 Chr6 complement(81310..82416) [1107 bp, 368 aa] {ON} Y...    52   4e-06
ZYRO0G17094g Chr7 complement(1404552..1406804) [2253 bp, 750 aa]...    53   4e-06
ZYRO0A06182g Chr1 (493846..496062) [2217 bp, 738 aa] {ON} simila...    53   5e-06
YPL236C Chr16 complement(101608..102702) [1095 bp, 364 aa] {ON} ...    52   5e-06
Suva_16.70 Chr16 complement(110631..111725) [1095 bp, 364 aa] {O...    52   5e-06
Kpol_413.7 s413 complement(18363..20267) [1905 bp, 634 aa] {ON} ...    52   5e-06
TDEL0A06750 Chr1 (1179818..1180936) [1119 bp, 372 aa] {ON} Anc_6...    52   7e-06
Kwal_14.1249 s14 (252877..253911) [1035 bp, 344 aa] {ON} YFL029C...    51   7e-06
NCAS0I01210 Chr9 complement(218242..222582) [4341 bp, 1446 aa] {...    52   8e-06
Ecym_2153 Chr2 complement(287697..288788) [1092 bp, 363 aa] {ON}...    51   1e-05
Ecym_1502 Chr1 (1030765..1031838) [1074 bp, 357 aa] {ON} similar...    51   1e-05
Kpol_1002.21 s1002 complement(62702..63895) [1194 bp, 397 aa] {O...    51   1e-05
NDAI0F01340 Chr6 complement(327928..329148) [1221 bp, 406 aa] {O...    50   1e-05
AFL143C Chr6 complement(164241..165326) [1086 bp, 361 aa] {ON} S...    50   2e-05
CAGL0F03905g Chr6 complement(377962..380088) [2127 bp, 708 aa] {...    50   2e-05
TPHA0H01880 Chr8 (441140..442402) [1263 bp, 420 aa] {ON} Anc_6.2...    50   3e-05
TBLA0D01110 Chr4 (283160..285640) [2481 bp, 826 aa] {ON} Anc_8.7...    50   3e-05
Kpol_1064.42 s1064 complement(78573..80207) [1635 bp, 544 aa] {O...    50   3e-05
TDEL0B03770 Chr2 (676581..678575) [1995 bp, 664 aa] {ON} Anc_8.7...    50   3e-05
KAFR0F02310 Chr6 (452380..453912) [1533 bp, 510 aa] {ON} Anc_3.1...    50   3e-05
Suva_6.29 Chr6 complement(51588..52691) [1104 bp, 367 aa] {ON} Y...    49   3e-05
NDAI0K01030 Chr11 (239418..241712) [2295 bp, 764 aa] {ON} Anc_8....    50   4e-05
Kwal_33.15381 s33 complement(1080902..1083868) [2967 bp, 988 aa]...    50   4e-05
CAGL0H03245g Chr8 (303335..305686) [2352 bp, 783 aa] {ON} simila...    50   4e-05
Smik_6.49 Chr6 complement(93305..94408) [1104 bp, 367 aa] {ON} Y...    49   5e-05
KLTH0D12518g Chr4 complement(1023214..1024992) [1779 bp, 592 aa]...    49   5e-05
SAKL0B01474g Chr2 complement(145734..146777) [1044 bp, 347 aa] {...    49   6e-05
KNAG0A07560 Chr1 (1186540..1187550) [1011 bp, 336 aa] {ON} Anc_3...    48   7e-05
TPHA0G01380 Chr7 (279600..281579) [1980 bp, 659 aa] {ON} Anc_8.7...    49   7e-05
KLTH0G18282g Chr7 complement(1576512..1577558) [1047 bp, 348 aa]...    48   8e-05
NCAS0G01210 Chr7 complement(215860..216963) [1104 bp, 367 aa] {O...    47   1e-04
Kwal_26.6921 s26 (123345..123875) [531 bp, 176 aa] {OFF} YOR351C...    45   1e-04
SAKL0H05214g Chr8 (468419..470185) [1767 bp, 588 aa] {ON} simila...    47   2e-04
CAGL0H00979g Chr8 complement(94328..95527) [1200 bp, 399 aa] {ON...    47   2e-04
KLTH0B02178g Chr2 (171582..174551) [2970 bp, 989 aa] {ON} simila...    47   2e-04
Ecym_3487 Chr3 complement(910575..914810) [4236 bp, 1411 aa] {ON...    47   2e-04
ZYRO0A05060g Chr1 complement(405402..406886) [1485 bp, 494 aa] {...    47   3e-04
KLTH0H03080g Chr8 complement(274038..275078) [1041 bp, 346 aa] {...    46   3e-04
ZYRO0E07876g Chr5 (616134..617243) [1110 bp, 369 aa] {ON} simila...    46   4e-04
CAGL0K01815g Chr11 (162973..164487) [1515 bp, 504 aa] {ON} simil...    46   4e-04
AER348C Chr5 complement(1275897..1277774) [1878 bp, 625 aa] {ON}...    46   5e-04
SAKL0A03344g Chr1 complement(305149..306243) [1095 bp, 364 aa] {...    45   5e-04
KNAG0J02030 Chr10 complement(368141..370327) [2187 bp, 728 aa] {...    46   6e-04
AER216C Chr5 complement(1032840..1034348) [1509 bp, 502 aa] {ON}...    45   7e-04
NCAS0C01030 Chr3 (192001..194043) [2043 bp, 680 aa] {ON} Anc_8.732     45   7e-04
TDEL0D04390 Chr4 complement(799835..801340) [1506 bp, 501 aa] {O...    45   8e-04
SAKL0H10340g Chr8 complement(883790..886009) [2220 bp, 739 aa] {...    45   0.001
NDAI0A07790 Chr1 (1790683..1795206) [4524 bp, 1507 aa] {ON} Anc_...    45   0.001
KAFR0C02290 Chr3 complement(449963..451204) [1242 bp, 413 aa] {O...    45   0.001
TBLA0F01730 Chr6 complement(431961..433004) [1044 bp, 347 aa] {O...    44   0.001
KLTH0D02970g Chr4 complement(284533..285945) [1413 bp, 470 aa] {...    44   0.001
Ecym_5258 Chr5 (536868..538376) [1509 bp, 502 aa] {ON} similar t...    44   0.001
CAGL0G01716g Chr7 complement(155248..156390) [1143 bp, 380 aa] {...    44   0.001
ZYRO0F09174g Chr6 complement(744109..745638) [1530 bp, 509 aa] {...    44   0.002
SAKL0C07876g Chr3 (732534..733970) [1437 bp, 478 aa] {ON} simila...    44   0.002
Kpol_1033.51 s1033 complement(127843..129165) [1323 bp, 440 aa] ...    44   0.002
TPHA0E02830 Chr5 (591805..593364) [1560 bp, 519 aa] {ON} Anc_6.2...    44   0.002
Kpol_1065.32 s1065 complement(65735..70255) [4521 bp, 1506 aa] {...    44   0.002
Kwal_26.9032 s26 complement(1047382..1049157) [1776 bp, 591 aa] ...    44   0.002
NCAS0A01090 Chr1 (216576..218042) [1467 bp, 488 aa] {ON} Anc_6.215     44   0.002
KNAG0J02520 Chr10 (472464..476795) [4332 bp, 1443 aa] {ON} Anc_3...    44   0.002
TBLA0B06620 Chr2 complement(1556378..1559671) [3294 bp, 1097 aa]...    44   0.002
NDAI0F01640 Chr6 (401323..403086) [1764 bp, 587 aa] {ON} Anc_6.215     44   0.003
CAGL0I08899g Chr9 complement(863906..866701) [2796 bp, 931 aa] {...    44   0.003
Ecym_6239 Chr6 complement(445704..447791) [2088 bp, 695 aa] {ON}...    44   0.003
ZYRO0G08866g Chr7 complement(713156..714661) [1506 bp, 501 aa] {...    43   0.003
NCAS0D03820 Chr4 complement(708820..710241) [1422 bp, 473 aa] {O...    43   0.003
Suva_4.232 Chr4 (417104..418627) [1524 bp, 507 aa] {ON} YDL017W ...    43   0.003
TDEL0E04680 Chr5 complement(875878..878862) [2985 bp, 994 aa] {O...    44   0.003
Kpol_538.20 s538 (39404..42382) [2979 bp, 992 aa] {ON} (39404..4...    44   0.003
TPHA0A03700 Chr1 complement(808996..813273) [4278 bp, 1425 aa] {...    44   0.004
KAFR0K00320 Chr11 (72569..73942) [1374 bp, 457 aa] {ON} Anc_6.21...    43   0.004
NCAS0I01870 Chr9 (345214..346866) [1653 bp, 550 aa] {ON} Anc_3.1...    43   0.004
Suva_7.258 Chr7 (445704..447911) [2208 bp, 735 aa] {ON} YGL021W ...    43   0.004
TPHA0J02290 Chr10 (508389..510779) [2391 bp, 796 aa] {ON} Anc_6....    43   0.005
Kpol_1010.68 s1010 complement(168093..169595) [1503 bp, 500 aa] ...    42   0.005
KLLA0C07216g Chr3 (626227..628278) [2052 bp, 683 aa] {ON} simila...    43   0.005
KNAG0K01660 Chr11 complement(345808..347331) [1524 bp, 507 aa] {...    42   0.006
SAKL0B07326g Chr2 (627224..631477) [4254 bp, 1417 aa] {ON} simil...    42   0.007
KNAG0D01130 Chr4 (190658..191947) [1290 bp, 429 aa] {ON} Anc_6.2...    42   0.007
KNAG0D00830 Chr4 complement(130823..131986) [1164 bp, 387 aa] {O...    42   0.007
KAFR0K00880 Chr11 (188439..191069) [2631 bp, 876 aa] {ON} Anc_5....    42   0.008
TDEL0E05230 Chr5 complement(958851..960323) [1473 bp, 490 aa] {O...    42   0.008
TBLA0B01650 Chr2 (370837..372306) [1470 bp, 489 aa] {ON} Anc_3.1...    42   0.009
Suva_16.102 Chr16 (173734..175209) [1476 bp, 491 aa] {ON} YPL204...    42   0.009
Kwal_27.12562 s27 (1274883..1279139) [4257 bp, 1418 aa] {ON} YBR...    42   0.009
CAGL0H03553g Chr8 complement(328668..330155) [1488 bp, 495 aa] {...    42   0.010
NDAI0I01070 Chr9 (259836..261278) [1443 bp, 480 aa] {ON} Anc_6.215     42   0.011
Skud_7.266 Chr7 (458004..460217) [2214 bp, 737 aa] {ON} YGL021W ...    42   0.011
TDEL0G01540 Chr7 complement(303940..306300) [2361 bp, 786 aa] {O...    42   0.011
Ecym_8210 Chr8 (431406..434297) [2892 bp, 963 aa] {ON} similar t...    42   0.011
KLTH0E15026g Chr5 (1331171..1335730) [4560 bp, 1519 aa] {ON} sim...    42   0.012
Smik_6.409 Chr6 complement(658629..660119) [1491 bp, 496 aa] {ON...    41   0.012
Ecym_2202 Chr2 (399184..400629) [1446 bp, 481 aa] {ON} similar t...    41   0.013
YPL204W Chr16 (164276..165760) [1485 bp, 494 aa] {ON}  HRR25Prot...    41   0.014
Kwal_26.7237 s26 complement(276089..277318) [1230 bp, 409 aa] {O...    41   0.015
YGL021W Chr7 (454785..457067) [2283 bp, 760 aa] {ON}  ALK1Protei...    41   0.015
NDAI0D02140 Chr4 complement(496708..499785) [3078 bp, 1025 aa] {...    41   0.016
TPHA0A04330 Chr1 (974713..976218) [1506 bp, 501 aa] {ON} Anc_3.1...    41   0.016
NCAS0A07080 Chr1 complement(1400590..1403607) [3018 bp, 1005 aa]...    41   0.016
Smik_4.218 Chr4 (406174..407697) [1524 bp, 507 aa] {ON} YDL017W ...    41   0.016
Skud_16.75 Chr16 (137624..139108) [1485 bp, 494 aa] {ON} YPL204W...    41   0.017
TPHA0G00610 Chr7 (114519..116138) [1620 bp, 539 aa] {ON} Anc_8.7...    41   0.018
AGR315C Chr7 complement(1319993..1322872) [2880 bp, 959 aa] {ON}...    41   0.018
Kwal_56.24064 s56 complement(831165..832592) [1428 bp, 475 aa] {...    41   0.018
KAFR0G01670 Chr7 (363200..367459) [4260 bp, 1419 aa] {ON} Anc_3....    41   0.019
YDL017W Chr4 (424209..425732) [1524 bp, 507 aa] {ON}  CDC7DDK (D...    41   0.019
YGR188C Chr7 complement(872044..875109) [3066 bp, 1021 aa] {ON} ...    41   0.021
SAKL0A04444g Chr1 (412103..413527) [1425 bp, 474 aa] {ON} highly...    40   0.021
KLTH0H04158g Chr8 (378344..379798) [1455 bp, 484 aa] {ON} simila...    40   0.022
Kwal_56.23723 s56 complement(676986..677432) [447 bp, 149 aa] {O...    39   0.023
AEL330C Chr5 complement(27521..28105) [585 bp, 194 aa] {ON} Synt...    39   0.024
KLTH0E15972g Chr5 complement(1414595..1416016) [1422 bp, 473 aa]...    40   0.025
TPHA0J02370 Chr10 complement(523628..525016) [1389 bp, 462 aa] {...    40   0.027
KAFR0B03270 Chr2 complement(677477..679231) [1755 bp, 584 aa] {O...    40   0.030
KLLA0D03168g Chr4 (265761..267278) [1518 bp, 505 aa] {ON} simila...    40   0.031
YBR097W Chr2 (436951..441315) [4365 bp, 1454 aa] {ON}  VPS15Myri...    40   0.031
KLLA0F22605g Chr6 complement(2109034..2111913) [2880 bp, 959 aa]...    40   0.032
NDAI0A06470 Chr1 (1470263..1472083) [1821 bp, 606 aa] {ON} Anc_3...    40   0.037
Kpol_1002.53 s1002 (150289..151668) [1380 bp, 459 aa] {ON} (1502...    40   0.039
KLLA0B11924g Chr2 complement(1043344..1047582) [4239 bp, 1412 aa...    40   0.042
KLLA0C04345g Chr3 (397899..399326) [1428 bp, 475 aa] {ON} simila...    39   0.048
Suva_7.481 Chr7 complement(829537..832644) [3108 bp, 1035 aa] {O...    40   0.049
TPHA0I01240 Chr9 (283537..285210) [1674 bp, 557 aa] {ON} Anc_2.1...    39   0.051
Suva_4.344 Chr4 (606007..610371) [4365 bp, 1454 aa] {ON} YBR097W...    40   0.052
Skud_4.237 Chr4 (418979..420502) [1524 bp, 507 aa] {ON} YDL017W ...    39   0.055
SAKL0G13882g Chr7 complement(1191656..1194604) [2949 bp, 982 aa]...    39   0.055
Smik_7.269 Chr7 (446854..449094) [2241 bp, 746 aa] {ON} YGL021W ...    39   0.056
TBLA0A06660 Chr1 complement(1626147..1630400) [4254 bp, 1417 aa]...    39   0.069
Smik_2.239 Chr2 (421843..426207) [4365 bp, 1454 aa] {ON} YBR097W...    39   0.071
Skud_2.225 Chr2 (405095..409459) [4365 bp, 1454 aa] {ON} YBR097W...    39   0.074
TBLA0B05310 Chr2 complement(1251914..1253494) [1581 bp, 526 aa] ...    39   0.075
KNAG0F01490 Chr6 (270931..272604) [1674 bp, 557 aa] {ON} Anc_2.1...    39   0.076
KNAG0E03740 Chr5 complement(738877..741528) [2652 bp, 883 aa] {O...    39   0.086
AFL091W Chr6 (272431..273867) [1437 bp, 478 aa] {ON} Syntenic ho...    38   0.10 
ZYRO0G12232g Chr7 (964508..967591) [3084 bp, 1027 aa] {ON} simil...    39   0.10 
Suva_15.332 Chr15 complement(575263..575547,575959..576084,57614...    38   0.11 
TBLA0A02040 Chr1 complement(493305..495056) [1752 bp, 583 aa] {O...    38   0.12 
YPR106W Chr16 (740061..741392) [1332 bp, 443 aa] {ON}  ISR1Predi...    38   0.14 
YHR135C Chr8 complement(372694..374310) [1617 bp, 538 aa] {ON}  ...    38   0.15 
Ecym_2618 Chr2 (1196140..1197453) [1314 bp, 437 aa] {ON} similar...    37   0.18 
KNAG0F01980 Chr6 (379013..380368) [1356 bp, 451 aa] {ON} Anc_6.2...    37   0.18 
Kpol_1002.61 s1002 complement(167383..169851) [2469 bp, 822 aa] ...    38   0.18 
Skud_8.196 Chr8 complement(346056..346463,346494..347684) [1599 ...    37   0.19 
CAGL0J05940g Chr10 (562687..564147) [1461 bp, 486 aa] {ON} simil...    37   0.27 
AFR040W Chr6 (505602..507245) [1644 bp, 547 aa] {ON} Syntenic ho...    37   0.28 
KAFR0A07320 Chr1 complement(1478564..1480033) [1470 bp, 489 aa] ...    37   0.31 
NCAS0B07200 Chr2 complement(1363351..1364940) [1590 bp, 529 aa] ...    37   0.38 
NCAS0G02120 Chr7 (381894..383465) [1572 bp, 523 aa] {ON} Anc_2.105     37   0.38 
CAGL0G06138g Chr7 complement(585585..587204) [1620 bp, 539 aa] {...    37   0.39 
Smik_14.174 Chr14 complement(323054..324709) [1656 bp, 551 aa] {...    36   0.44 
Kwal_27.9804 s27 (69307..70728) [1422 bp, 473 aa] {ON} YDL017W (...    36   0.46 
Smik_6.306 Chr6 complement(480942..484031) [3090 bp, 1029 aa] {O...    36   0.48 
NDAI0B04530 Chr2 complement(1128472..1130094) [1623 bp, 540 aa] ...    36   0.51 
YNL154C Chr14 complement(343636..345276) [1641 bp, 546 aa] {ON} ...    36   0.51 
Smik_8.216 Chr8 complement(349478..351145) [1668 bp, 555 aa] {ON...    36   0.52 
Skud_7.518 Chr7 complement(847291..850359) [3069 bp, 1022 aa] {O...    36   0.54 
Skud_14.179 Chr14 complement(334239..335924) [1686 bp, 561 aa] {...    36   0.55 
SAKL0A05038g Chr1 complement(458190..460628) [2439 bp, 812 aa] {...    36   0.58 
NDAI0F03150 Chr6 complement(757283..758923) [1641 bp, 546 aa] {O...    36   0.60 
Suva_14.185 Chr14 complement(340104..341789) [1686 bp, 561 aa] {...    36   0.71 
KAFR0C02170 Chr3 (431896..434289) [2394 bp, 797 aa] {ON} Anc_6.1...    35   0.93 
Kpol_1027.20 s1027 complement(43412..44974) [1563 bp, 520 aa] {O...    35   1.1  
ADL053C Chr4 complement(589599..591014) [1416 bp, 471 aa] {ON} S...    35   1.2  
ZYRO0C15884g Chr3 (1241605..1245873) [4269 bp, 1422 aa] {ON} sim...    35   1.4  
KLLA0D11044g Chr4 complement(942458..944068) [1611 bp, 536 aa] {...    34   1.6  
TPHA0J03180 Chr10 complement(691886..694882) [2997 bp, 998 aa] {...    35   1.6  
SAKL0E12100g Chr5 complement(1004036..1005622) [1587 bp, 528 aa]...    34   1.8  
Suva_16.433 Chr16 (747883..749205) [1323 bp, 440 aa] {ON} YPR106...    34   2.1  
NDAI0D01740 Chr4 (406540..407469) [930 bp, 309 aa] {ON} Anc_5.32...    34   2.2  
ZYRO0G05412g Chr7 (435657..437408) [1752 bp, 583 aa] {ON} simila...    34   2.5  
KNAG0H03710 Chr8 complement(687550..689184) [1635 bp, 544 aa] {O...    33   3.4  
YGL083W Chr7 (353058..355472) [2415 bp, 804 aa] {ON}  SCY1Putati...    33   4.1  
TDEL0C04810 Chr3 (867670..871932) [4263 bp, 1420 aa] {ON} Anc_3....    33   4.9  
Skud_4.158 Chr4 complement(280870..282171) [1302 bp, 433 aa] {ON...    33   5.5  
Smik_15.269 Chr15 complement(451402..452034) [633 bp, 210 aa] {O...    32   7.0  
NDAI0G05630 Chr7 complement(1393671..1397360) [3690 bp, 1229 aa]...    32   7.7  
TBLA0E04650 Chr5 complement(1185387..1186514) [1128 bp, 375 aa] ...    32   8.6  

>YCL024W Chr3 (79162..82275) [3114 bp, 1037 aa] {ON}  KCC4Protein
            kinase of the bud neck involved in the septin checkpoint,
            associates with septin proteins, negatively regulates
            Swe1p by phosphorylation, shows structural homology to
            bud neck kinases Gin4p and Hsl1p
          Length = 1037

 Score = 1840 bits (4765), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 920/1037 (88%), Positives = 920/1037 (88%)

Query: 1    MTVANTETHSAAKPSSTIGPWKLGETLGFGSTGKVQLAQHERTGHRTAVKVISKSIFNNN 60
            MTVANTETHSAAKPSSTIGPWKLGETLGFGSTGKVQLAQHERTGHRTAVKVISKSIFNNN
Sbjct: 1    MTVANTETHSAAKPSSTIGPWKLGETLGFGSTGKVQLAQHERTGHRTAVKVISKSIFNNN 60

Query: 61   GNHSNDDSVLPYNIEREIVIMKLLSHPNVLSLYDVWETNNNLYLILEYAEKGELFNLLVD 120
            GNHSNDDSVLPYNIEREIVIMKLLSHPNVLSLYDVWETNNNLYLILEYAEKGELFNLLVD
Sbjct: 61   GNHSNDDSVLPYNIEREIVIMKLLSHPNVLSLYDVWETNNNLYLILEYAEKGELFNLLVD 120

Query: 121  HGPLPEREAINCFRQIIIGISYCHALGIVHRDLKPENLLLDSFYNIKIADFGMAALQTDA 180
            HGPLPEREAINCFRQIIIGISYCHALGIVHRDLKPENLLLDSFYNIKIADFGMAALQTDA
Sbjct: 121  HGPLPEREAINCFRQIIIGISYCHALGIVHRDLKPENLLLDSFYNIKIADFGMAALQTDA 180

Query: 181  DLLETSCGSPHYAAPEIVSGLPYEGFASDVWSCGVILFALLTGRLPFDEENGNVRDLLLK 240
            DLLETSCGSPHYAAPEIVSGLPYEGFASDVWSCGVILFALLTGRLPFDEENGNVRDLLLK
Sbjct: 181  DLLETSCGSPHYAAPEIVSGLPYEGFASDVWSCGVILFALLTGRLPFDEENGNVRDLLLK 240

Query: 241  VQKGQFEMPNDTEISRDAQDLIGKILVVDPRQRIKIRDILSHPLLKKYQTIKDSKSIKDL 300
            VQKGQFEMPNDTEISRDAQDLIGKILVVDPRQRIKIRDILSHPLLKKYQTIKDSKSIKDL
Sbjct: 241  VQKGQFEMPNDTEISRDAQDLIGKILVVDPRQRIKIRDILSHPLLKKYQTIKDSKSIKDL 300

Query: 301  PRENTYLYPLADSNNHTSASIDDSILQNLVVLWHGRHADDIVSKLKENGTNKEKILYALL 360
            PRENTYLYPLADSNNHTSASIDDSILQNLVVLWHGRHADDIVSKLKENGTNKEKILYALL
Sbjct: 301  PRENTYLYPLADSNNHTSASIDDSILQNLVVLWHGRHADDIVSKLKENGTNKEKILYALL 360

Query: 361  YRFKLDSVRGXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQSTPRRRTXXXXXXXX 420
            YRFKLDSVRG                                  QSTPRRRT        
Sbjct: 361  YRFKLDSVRGSNKKNRNKIKKTKKNKRSSTLSSSSSLLLNNRSIQSTPRRRTSKRHSREF 420

Query: 421  XXXXXXXXXXXXXNPTDSSPIPLRSSKRITHINVASANTQATPSGVPNPHXXXXXXXXXX 480
                         NPTDSSPIPLRSSKRITHINVASANTQATPSGVPNPH          
Sbjct: 421  SSSRKRSSFLLSSNPTDSSPIPLRSSKRITHINVASANTQATPSGVPNPHKRNSKKRSSK 480

Query: 481  XXXYMPXXXXXXXXXXXXXXXXXXIDDDDWEYIEKDAKRTSSNFATLIDEIFEPEKFELA 540
               YMP                  IDDDDWEYIEKDAKRTSSNFATLIDEIFEPEKFELA
Sbjct: 481  RLSYMPNTKRSSLTSKSLSNFTNLIDDDDWEYIEKDAKRTSSNFATLIDEIFEPEKFELA 540

Query: 541  KREKAELQRKVQEAKRQSVNAQKINEDEFGSEVSDGMKELKKINDKVSSPLINYEFSQQE 600
            KREKAELQRKVQEAKRQSVNAQKINEDEFGSEVSDGMKELKKINDKVSSPLINYEFSQQE
Sbjct: 541  KREKAELQRKVQEAKRQSVNAQKINEDEFGSEVSDGMKELKKINDKVSSPLINYEFSQQE 600

Query: 601  LLQDIDTLLTNRYQLSSYTRPISRLDPGLTPVTETLPNNLKEKTALLQDTEKKIIETIRR 660
            LLQDIDTLLTNRYQLSSYTRPISRLDPGLTPVTETLPNNLKEKTALLQDTEKKIIETIRR
Sbjct: 601  LLQDIDTLLTNRYQLSSYTRPISRLDPGLTPVTETLPNNLKEKTALLQDTEKKIIETIRR 660

Query: 661  SKFLGSLLNVRGGLSPGKSELAPIEESPIVSTTPLIYNDRMEPRRISDVEVPHFTRKSKH 720
            SKFLGSLLNVRGGLSPGKSELAPIEESPIVSTTPLIYNDRMEPRRISDVEVPHFTRKSKH
Sbjct: 661  SKFLGSLLNVRGGLSPGKSELAPIEESPIVSTTPLIYNDRMEPRRISDVEVPHFTRKSKH 720

Query: 721  FTTANNRRSVLSLYAKDSIKDLNEFLIKEDPDLPPQGSTDNESRSEDPEIAESITDSRNI 780
            FTTANNRRSVLSLYAKDSIKDLNEFLIKEDPDLPPQGSTDNESRSEDPEIAESITDSRNI
Sbjct: 721  FTTANNRRSVLSLYAKDSIKDLNEFLIKEDPDLPPQGSTDNESRSEDPEIAESITDSRNI 780

Query: 781  QYDEDDSKDGDNVNNDNILSDFPQGVGISQEYDMKDKNPNQSPISKSAEPTLVVKLPSLS 840
            QYDEDDSKDGDNVNNDNILSDFPQGVGISQEYDMKDKNPNQSPISKSAEPTLVVKLPSLS
Sbjct: 781  QYDEDDSKDGDNVNNDNILSDFPQGVGISQEYDMKDKNPNQSPISKSAEPTLVVKLPSLS 840

Query: 841  SFQGKNASGLGLYQREPSKVTLPSLTSNNSSVGENIEDGAEKGTESEKIAAXXXXXXXXX 900
            SFQGKNASGLGLYQREPSKVTLPSLTSNNSSVGENIEDGAEKGTESEKIAA         
Sbjct: 841  SFQGKNASGLGLYQREPSKVTLPSLTSNNSSVGENIEDGAEKGTESEKIAASLSDDDLKE 900

Query: 901  XXXXXXXXTVNAPTTVKKPPNSVLLKKFSKGKILELEIHAKIPEKRLYEGLHKLLEGWKQ 960
                    TVNAPTTVKKPPNSVLLKKFSKGKILELEIHAKIPEKRLYEGLHKLLEGWKQ
Sbjct: 901  DNDKKDNDTVNAPTTVKKPPNSVLLKKFSKGKILELEIHAKIPEKRLYEGLHKLLEGWKQ 960

Query: 961  YGLKNLVFNITNMIITGKLVNDSILFLRSTLFEIMVLPNGDGRSLIKFNXXXXXXXXXXX 1020
            YGLKNLVFNITNMIITGKLVNDSILFLRSTLFEIMVLPNGDGRSLIKFN           
Sbjct: 961  YGLKNLVFNITNMIITGKLVNDSILFLRSTLFEIMVLPNGDGRSLIKFNKKTGSTKTLTK 1020

Query: 1021 XXXEIQIILQKEGVLDK 1037
               EIQIILQKEGVLDK
Sbjct: 1021 LATEIQIILQKEGVLDK 1037

>Smik_3.54 Chr3 (80309..83407) [3099 bp, 1032 aa] {ON} YCL024W (REAL)
          Length = 1032

 Score = 1325 bits (3429), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 693/1039 (66%), Positives = 785/1039 (75%), Gaps = 9/1039 (0%)

Query: 1    MTVANTETHSAAKPSSTIGPWKLGETLGFGSTGKVQLAQHERTGHRTAVKVISKSIFNNN 60
            M VAN ET+   KP + IGPWKLGETLGFGSTGKVQLA+HERTG +TAVKVI KSIF + 
Sbjct: 1    MAVANMETYRITKPLNIIGPWKLGETLGFGSTGKVQLARHERTGQKTAVKVIPKSIFKSE 60

Query: 61   GNHSNDDSVLPYNIEREIVIMKLLSHPNVLSLYDVWETNNNLYLILEYAEKGELFNLLVD 120
            G+H N+DSVLP+NIEREIVIMKLLSHPNVLSLYDVWET+NNLYLILEYAEKGELFNLLVD
Sbjct: 61   GSHGNNDSVLPFNIEREIVIMKLLSHPNVLSLYDVWETDNNLYLILEYAEKGELFNLLVD 120

Query: 121  HGPLPEREAINCFRQIIIGISYCHALGIVHRDLKPENLLLDSFYNIKIADFGMAALQTDA 180
             GPLPEREAI CF+QIII ISYCHALGIVHRDLKPENLLLD+ YNIKIADFGMAALQTDA
Sbjct: 121  RGPLPEREAIKCFKQIIIAISYCHALGIVHRDLKPENLLLDNSYNIKIADFGMAALQTDA 180

Query: 181  DLLETSCGSPHYAAPEIVSGLPYEGFASDVWSCGVILFALLTGRLPFDEENGNVRDLLLK 240
             +LETSCGSPHYAAPEIVSGLPYEGFASDVWSCGVILFALLTGRLPFDEENGNVRDLLLK
Sbjct: 181  GMLETSCGSPHYAAPEIVSGLPYEGFASDVWSCGVILFALLTGRLPFDEENGNVRDLLLK 240

Query: 241  VQKGQFEMPNDTEISRDAQDLIGKILVVDPRQRIKIRDILSHPLLKKYQTIKDSKSIKDL 300
            VQKGQFEMPN+ EIS DAQDLI +ILVVDP QRIKIRDILSHPLLKKYQTIKDSKSIKDL
Sbjct: 241  VQKGQFEMPNNAEISGDAQDLIRRILVVDPTQRIKIRDILSHPLLKKYQTIKDSKSIKDL 300

Query: 301  PRENTYLYPLADSNNHTSASIDDSILQNLVVLWHGRHADDIVSKLKENGTNKEKILYALL 360
            PRENTYLYPLAD++NHTS +IDDSILQNLV+LWHGR A++I+ KL++NGTN EK LYALL
Sbjct: 301  PRENTYLYPLADADNHTSVTIDDSILQNLVILWHGRPAEEIMKKLQDNGTNTEKTLYALL 360

Query: 361  YRFKLDSVRGXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQSTPRRRTXXXXXXXX 420
            YRFKL+S++                                    S PR+          
Sbjct: 361  YRFKLESMKETNKRSRSKINKTKKSKRVSTLSSSSSSAFNHQSLDSAPRKHASRGHSKNF 420

Query: 421  XXXXXXXXXXXXXNPTDSSPIPLRSSKRITHINVASANTQATPSGVPNPHXXXXXXXXXX 480
                         N TD SPIPLRSSKRI+  +    NT   P    +            
Sbjct: 421  PSSRKRSSFILSSNSTDCSPIPLRSSKRISISSAVPGNTLQVPDS--SLKLKRNSKRSSK 478

Query: 481  XXXYMPXXXXXXXXXXXXXXXXXXIDDDDWEYIEKDAKRTSSNFATLIDEIFEPEKFELA 540
               YMP                  IDDDDWEYI+KD KRTSSNFATLIDEIFEPEKFELA
Sbjct: 479  RLSYMPNLGRGSLTTNLLSNYTNLIDDDDWEYIDKDTKRTSSNFATLIDEIFEPEKFELA 538

Query: 541  KREKAELQRKVQEAKRQ-SVNAQKINEDEFGSEVSDGMKELKKINDKVSSPLINYEFSQQ 599
            KREKAELQ+KVQEAKRQ S NA   +E + G EVSDGM+ELKKIN+KVSSPL+NYEFSQ+
Sbjct: 539  KREKAELQKKVQEAKRQVSKNAPISDEKDVGFEVSDGMRELKKINNKVSSPLMNYEFSQK 598

Query: 600  ELLQDIDTLLTNRYQLSSYTRPISRLDPGLTPVTETLPNNLKEKTALLQDTEKKIIETIR 659
            ELLQDIDTLLTNRYQLSSYTRPISRLDPGLTPVT  +P+++KEKTALLQDTE KIIETIR
Sbjct: 599  ELLQDIDTLLTNRYQLSSYTRPISRLDPGLTPVTGAIPHSIKEKTALLQDTEMKIIETIR 658

Query: 660  RSKFLGSLLNVRGGLSPGKSELAPIEESPIVSTTPLIYNDRMEPRRISDVEVPHFTRKSK 719
            +S+FLGSLLNVR G+S   ++LA IE SP +STTPL+YND++E R+ISDVEVPHFTRKSK
Sbjct: 659  KSEFLGSLLNVREGISQDNNQLASIEVSPKISTTPLMYNDQVEIRKISDVEVPHFTRKSK 718

Query: 720  HFTTANNRRSVLSLYA-KDSIKDLNEFLIKEDPDLPPQGSTDNESRSEDPEIAESITDSR 778
            HFTTANNRRSVLSLY+ K+S++DLN+    E+PD PPQGSTDN S+SE  ++ E +T+ +
Sbjct: 719  HFTTANNRRSVLSLYSLKESLEDLNQISKNEEPDSPPQGSTDNASKSELVDVIEEVTEQK 778

Query: 779  NIQYDEDDSKDGDNVNNDNILSDFPQGVGISQEYDMKDKNPNQSPISKSAEPTLVVKLPS 838
            N Q+D+DDS D + +NN+NIL D P+ V   Q YD+ D +  QSP SKS EP  VVKLPS
Sbjct: 779  NSQHDQDDSNDSNGMNNNNILYDVPECVDSPQGYDINDAHSTQSPASKSTEPKPVVKLPS 838

Query: 839  LSSFQGKNASGLGLYQREPSKVTLPSLTSNNSSVGENIEDGAEKGTESEKIAAXXXXXXX 898
            LSSFQ KNASGLG+YQRE S+ +LPS+T N S   +  E+ A+K  + +K          
Sbjct: 839  LSSFQRKNASGLGIYQRESSRESLPSVTINISESDKTTENEAQKEIKHDKSDTILSNHDG 898

Query: 899  XXXXXXXXXXTVNAPTTVKKPPNSVLLKKFSKGKILELEIHAKIPEKRLYEGLHKLLEGW 958
                       +     V++  +   LKK SKGKILEL++ AKI EKRLYEGLHKLLEGW
Sbjct: 899  KADSYKGDISNI-----VRESSHGSFLKKLSKGKILELDVRAKISEKRLYEGLHKLLEGW 953

Query: 959  KQYGLKNLVFNITNMIITGKLVNDSILFLRSTLFEIMVLPNGDGRSLIKFNXXXXXXXXX 1018
            KQYGLKNL  N  +MII+GKLVND IL LRSTLFEI++LPNG GRSLIKFN         
Sbjct: 954  KQYGLKNLGINTADMIISGKLVNDGILSLRSTLFEIVILPNGSGRSLIKFNKKTGSTKTL 1013

Query: 1019 XXXXXEIQIILQKEGVLDK 1037
                 EIQIILQKEGVLD+
Sbjct: 1014 TKFATEIQIILQKEGVLDE 1032

>Skud_3.39 Chr3 (66201..69254) [3054 bp, 1017 aa] {ON} YCL024W (REAL)
          Length = 1017

 Score = 1284 bits (3322), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 679/1042 (65%), Positives = 761/1042 (73%), Gaps = 30/1042 (2%)

Query: 1    MTVANTETHSAAKPSSTIGPWKLGETLGFGSTGKVQLAQHERTGHRTAVKVISKSIFNNN 60
            MTVANTET +AAK SSTIGPWKLGETLG GS GKV+LAQHE T H+TAVK+ISKSIFN  
Sbjct: 1    MTVANTETQTAAKSSSTIGPWKLGETLGVGSAGKVRLAQHEGTAHKTAVKIISKSIFNTE 60

Query: 61   GNHSNDDSVLPYNIEREIVIMKLLSHPNVLSLYDVWETNNNLYLILEYAEKGELFNLLVD 120
            GN+ N  SVLPYNIEREIVIMKLLSHPNVL LYDVWETNNNLYLILEYAEKGELFNLLVD
Sbjct: 61   GNYGNHGSVLPYNIEREIVIMKLLSHPNVLGLYDVWETNNNLYLILEYAEKGELFNLLVD 120

Query: 121  HGPLPEREAINCFRQIIIGISYCHALGIVHRDLKPENLLLDSFYNIKIADFGMAALQTDA 180
             G LPEREA+ CFRQIII +SYCHALGIVHRDLKPENLLLDS YNIK+ADFGMAALQTDA
Sbjct: 121  RGALPEREAMKCFRQIIIAVSYCHALGIVHRDLKPENLLLDSDYNIKVADFGMAALQTDA 180

Query: 181  DLLETSCGSPHYAAPEIVSGLPYEGFASDVWSCGVILFALLTGRLPFDEENGNVRDLLLK 240
             LLETSCGSPHYAAPEIVSGLPYEGF+SDVWSCGVILFALLTGRLPFDEENGN+R LLLK
Sbjct: 181  ALLETSCGSPHYAAPEIVSGLPYEGFSSDVWSCGVILFALLTGRLPFDEENGNIRTLLLK 240

Query: 241  VQKGQFEMPNDTEISRDAQDLIGKILVVDPRQRIKIRDILSHPLLKKYQTIKDSKSIKDL 300
            VQ+GQFEMP+DTEIS+DAQDLI KILVVDP QRIKIRDILSHPLLK+YQTIKDSKSIKDL
Sbjct: 241  VQRGQFEMPDDTEISKDAQDLISKILVVDPAQRIKIRDILSHPLLKRYQTIKDSKSIKDL 300

Query: 301  PRENTYLYPLADSNNHTSASIDDSILQNLVVLWHGRHADDIVSKLKENGTNKEKILYALL 360
            PRE+TYLYPLAD+     A+IDDSILQNLVVLWHGRHAD+I +KLK +GTN EK LYALL
Sbjct: 301  PREDTYLYPLADAG----AAIDDSILQNLVVLWHGRHADEIKAKLKASGTNTEKTLYALL 356

Query: 361  YRFKLDSVRGXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQSTPRRRTXXXXXXXX 420
            YRFKL+S+R                                   +STPR+RT        
Sbjct: 357  YRFKLESMR-----ESNKRRRHKTKKTKNRKFSTSSSLVKGRNLESTPRKRTSKTHSNNF 411

Query: 421  XXXXXXXXXXXXXNPTDSSPIPLRSSKRITHINVASANTQATPSGVPNPHXXXXXXXXXX 480
                         N  +SSPIPLR+SK I+  N  S  +   P  + N            
Sbjct: 412  SSGKKRSSFILSPNSINSSPIPLRNSKGISLRNATSGGSPVVPVILLNSF-KRNSKLSSK 470

Query: 481  XXXYMPXXXXXXXXXXXXXXXXXXIDDDDWEYIEKDAKRTSSNFATLIDEIFEPEKFELA 540
               YMP                  ID+DDWE IEKD KRTSSNFATLIDEIFEPE+FELA
Sbjct: 471  RSSYMPNLKSGSVTSRLLSNYNKLIDEDDWECIEKDTKRTSSNFATLIDEIFEPEEFELA 530

Query: 541  KREKAELQRKVQEAKRQSVNAQKINEDEFG--SEVSDGMKELKKINDKVSSPLINYEFSQ 598
            KREK ELQRKV+ +K           D  G  SE +DGMKELK+IN KVSSPLINYEFSQ
Sbjct: 531  KREKVELQRKVRGSKMS---------DNIGDRSEFTDGMKELKRINAKVSSPLINYEFSQ 581

Query: 599  QELLQDIDTLLTNRYQLSSYTRPISRLDPGLTPVTETLPNNLKEKTALLQDTEKKIIETI 658
            QELLQDIDTLLTNRYQLS+YTRPIS+LDPGL P   T P+++KE+TAL++DTE KIIETI
Sbjct: 582  QELLQDIDTLLTNRYQLSAYTRPISKLDPGLMPAAGTTPHDIKEQTALIRDTEVKIIETI 641

Query: 659  RRSKFLGSLLNVRGGLSPGKSELAPIEESPIVSTTPLIYNDRMEPRRISDVEVPHFTRKS 718
             RSKFLGSLLNVR G+S    ELAPIEES I+STTPLIY+DR E R+ISDVEVPHFTRKS
Sbjct: 642  HRSKFLGSLLNVREGMSKDDDELAPIEESSIISTTPLIYDDRTEVRKISDVEVPHFTRKS 701

Query: 719  KHFTTANNRRSVLSLY-AKDSIKDLNEFLIKEDPDLPPQGSTDNESRSEDPEIAESITDS 777
            +HFT A+NRRSVLSLY ++DS KDL++    E  D P Q S D+ S S+     ES+   
Sbjct: 702  RHFTAASNRRSVLSLYSSRDSFKDLSQISKNEYSDSPSQRSVDDTSSSKKVGHTESLASV 761

Query: 778  RNIQYDEDDSKDGDN--VNNDNILSDFPQGVGISQEYDMKDKNPNQSPISKSAEPTLVVK 835
               ++ +DDS +  N  +N+DN+L D P+GV + QE    D+  + S +S S EPT VV+
Sbjct: 762  --AEHIDDDSYNDHNSGMNSDNVLYDVPEGVDLPQEVKNSDEQSSCSLVSSSLEPTPVVE 819

Query: 836  LPSLSSFQGKNASGLGLYQREPSKVTLPSLTSNNSSVGENIEDGAEKGTESEKIAAXXXX 895
            LPSLSSFQGKNASGLG+YQREPSKV+LP+ T + S   EN E   +K  + + IA     
Sbjct: 820  LPSLSSFQGKNASGLGIYQREPSKVSLPTATIDTSDAVENRETEVKKELKHDSIAT---- 875

Query: 896  XXXXXXXXXXXXXTVNAPTTVKKPPNSVLLKKFSKGKILELEIHAKIPEKRLYEGLHKLL 955
                         T  AP+ +KK  N  +LK  SKGKILELEIHAKIP KRL+EGLHKLL
Sbjct: 876  NLPDDNVKENNNATAEAPSRIKKSSNVSILKNISKGKILELEIHAKIPNKRLFEGLHKLL 935

Query: 956  EGWKQYGLKNLVFNITNMIITGKLVNDSILFLRSTLFEIMVLPNGDGRSLIKFNXXXXXX 1015
            EGWKQYGLK L F+   MII GKLVNDSIL LRSTLFEI+VLPNGD RSLIKFN      
Sbjct: 936  EGWKQYGLKKLGFDAAKMIIKGKLVNDSILSLRSTLFEIIVLPNGDDRSLIKFNKKTGSS 995

Query: 1016 XXXXXXXXEIQIILQKEGVLDK 1037
                    EIQIILQKEGVLDK
Sbjct: 996  KVLTKLATEIQIILQKEGVLDK 1017

>Suva_3.190 Chr3 (288639..288813,288870..291766) [3072 bp, 1024 aa]
           {ON} YDR507C (REAL)
          Length = 1024

 Score =  640 bits (1651), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 298/355 (83%), Positives = 326/355 (91%)

Query: 10  SAAKPSSTIGPWKLGETLGFGSTGKVQLAQHERTGHRTAVKVISKSIFNNNGNHSNDDSV 69
           + AKPS+TIGPW+LGETLG GSTG+VQLAQHERTGH+TAVKVISK+IF+           
Sbjct: 2   AMAKPSNTIGPWRLGETLGSGSTGRVQLAQHERTGHKTAVKVISKTIFDTEDGGGXXXLA 61

Query: 70  LPYNIEREIVIMKLLSHPNVLSLYDVWETNNNLYLILEYAEKGELFNLLVDHGPLPEREA 129
           LPYNIEREIV+MKLLSHPNVLSLYDVWETNNNLYLILEYAEKGELFNLLVD GPLPE+EA
Sbjct: 62  LPYNIEREIVVMKLLSHPNVLSLYDVWETNNNLYLILEYAEKGELFNLLVDRGPLPEKEA 121

Query: 130 INCFRQIIIGISYCHALGIVHRDLKPENLLLDSFYNIKIADFGMAALQTDADLLETSCGS 189
           + CFRQIII ISYCHALGIVHRDLKPENLLLD+ YNIKIADFGMAALQTDA LLETSCGS
Sbjct: 122 VKCFRQIIIAISYCHALGIVHRDLKPENLLLDNDYNIKIADFGMAALQTDARLLETSCGS 181

Query: 190 PHYAAPEIVSGLPYEGFASDVWSCGVILFALLTGRLPFDEENGNVRDLLLKVQKGQFEMP 249
           PHYAAPEIVSGLPY GFASDVWSCGVILFALLTGRLPFDE+NGNVRDLLLKVQ+GQFEMP
Sbjct: 182 PHYAAPEIVSGLPYRGFASDVWSCGVILFALLTGRLPFDEDNGNVRDLLLKVQRGQFEMP 241

Query: 250 NDTEISRDAQDLIGKILVVDPRQRIKIRDILSHPLLKKYQTIKDSKSIKDLPRENTYLYP 309
           + TEIS+DAQ+LI +ILVVDP QR+K RDIL+HPLLKKYQTI+DSKSI++LPRENTYLYP
Sbjct: 242 DATEISKDAQNLISRILVVDPTQRMKTRDILTHPLLKKYQTIRDSKSIRNLPRENTYLYP 301

Query: 310 LADSNNHTSASIDDSILQNLVVLWHGRHADDIVSKLKENGTNKEKILYALLYRFK 364
           LAD+ NHT+A+ID SILQNLVVLWHGR AD+IV+ LK+NGTN EK LYALLYRFK
Sbjct: 302 LADAGNHTNATIDGSILQNLVVLWHGRPADEIVANLKDNGTNTEKTLYALLYRFK 356

 Score =  549 bits (1414), Expect = e-178,   Method: Compositional matrix adjust.
 Identities = 330/617 (53%), Positives = 403/617 (65%), Gaps = 30/617 (4%)

Query: 434  NPTDSSPIPLRSSKRITHINVASANTQATPSGVPNPHXXXXXXXXXXXXXYMPXXXXXXX 493
            N ++ SP+P R+SKR +  N ASAN    P  + N +             Y+P       
Sbjct: 423  NSSNGSPMPSRNSKRSSFFNTASANVPPVPVKLLNSYKRNSKRSSKRLS-YVPNVKRGSL 481

Query: 494  XXXXXXXXXXXIDDDDWEYIEKDAKRTSSNFATLIDEIFEPEKFELAKREKAELQRKVQE 553
                       ID+DDWEYIEKD KRTSSNFATLIDEIFEPEKFELA+REKAELQRKVQE
Sbjct: 482  TSKSLSKYTNLIDEDDWEYIEKDTKRTSSNFATLIDEIFEPEKFELARREKAELQRKVQE 541

Query: 554  AKRQSVNAQKINEDEFGSEV--SDGMKELKKINDKVSSPLINYEFSQQELLQDIDTLLTN 611
            AKR   +  K+N+ E G+E   SD M+ELKKIN+KVSSPLINYE+SQQELLQDI+TLLTN
Sbjct: 542  AKRGKSDVAKLNQ-ENGNETGKSDAMEELKKINNKVSSPLINYEYSQQELLQDINTLLTN 600

Query: 612  RYQLSSYTRPISRLDPGLTPVTETLPNNLKEKTALLQDTEKKIIETIRRSKFLGSLLNVR 671
            R QLS+YTRPIS+LDPGL P  ET+P ++KEKT LL DTE KI+ETIR+SK L S LN+R
Sbjct: 601  RCQLSAYTRPISKLDPGLMPTPETIPYDIKEKTDLLLDTEMKILETIRKSKILDSSLNLR 660

Query: 672  GGLSPGKSELAPIEESPIVSTTPLIY-NDRMEPRRISDVEVPHFTRKSKHFTTANNRRSV 730
              +S     L  +EESPI STTPL+Y ND  E  +ISD++VPHFTRKSK FT  NNRRSV
Sbjct: 661  KEVSRDADRLPSVEESPIASTTPLVYNNDSKEVCKISDIQVPHFTRKSKCFTPTNNRRSV 720

Query: 731  LSLY-AKDSIKDLNEFLIKEDPDLPPQGSTDNESRSEDPEIAESITDSRNIQYDEDDSKD 789
            LSLY ++ S K L+  L  +DP   P  S  N   SE+ ++ E I + +NI+ + +++  
Sbjct: 721  LSLYSSRHSFKGLSRILNSKDPSANPY-SHINGPLSEEIDLTEDIANMKNIENNNNNNNR 779

Query: 790  GDNVNNDNILSDFPQGVGISQEYDMKDKNPN----QSPISKSAEPTLVVKLPSLSSFQGK 845
              +V+   IL    QG     + D  + +      QS +S + EPT  VKLPSLSSFQ K
Sbjct: 780  LYDVSESAILL---QGNDDDDDDDDNENDDGSQSIQSSVSNNTEPTTFVKLPSLSSFQEK 836

Query: 846  NASGLGLYQREPSKVTLPSLTSN-----NSSVG-ENIEDGAEKGTESEKIAAXXXXXXXX 899
            NASGLG+YQREPS    PS+ S+     N ++  E++++  E   + E I          
Sbjct: 837  NASGLGIYQREPS--IEPSIESSIEPLPNVTIAIEDVDEDGENEIQHENITTSLSNDNIK 894

Query: 900  XXXXXXXXXTVNAPTTVKKPPNSVLLKKFSKGKILELEIHAKIPEKRLYEGLHKLLEGWK 959
                       +   T+++  N   LKKFSKGKILELEIHAKIP +RL+EGLHKLLEGWK
Sbjct: 895  KND--------DTKDTIREYSNVSFLKKFSKGKILELEIHAKIPAERLFEGLHKLLEGWK 946

Query: 960  QYGLKNLVFNITNMIITGKLVNDSILFLRSTLFEIMVLPNGDGRSLIKFNXXXXXXXXXX 1019
            QYGLKNL F+  NMIITGKLVND+IL LRSTLFEI+VLPN D RSLIKFN          
Sbjct: 947  QYGLKNLGFDTANMIITGKLVNDNILSLRSTLFEIIVLPNRDDRSLIKFNKKTGSTKTLK 1006

Query: 1020 XXXXEIQIILQKEGVLD 1036
                EIQI+LQKEGVLD
Sbjct: 1007 KLGYEIQIVLQKEGVLD 1023

>Suva_2.687 Chr2 complement(1215095..1218481) [3387 bp, 1128 aa]
           {ON} YCL024W (REAL)
          Length = 1128

 Score =  570 bits (1470), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 270/358 (75%), Positives = 306/358 (85%), Gaps = 12/358 (3%)

Query: 17  TIGPWKLGETLGFGSTGKVQLAQHERTGHRTAVKVISKSIFNNNGN-------HSNDDSV 69
           TIGPWKLGETLG GSTGKVQLA+++ TG   AVKVISK++FN+ GN        SN    
Sbjct: 15  TIGPWKLGETLGLGSTGKVQLARNKSTGQEAAVKVISKAVFNS-GNVSGTSIVGSNTPDA 73

Query: 70  LPYNIEREIVIMKLLSHPNVLSLYDVWETNNNLYLILEYAEKGELFNLLVDHGPLPEREA 129
           LPY IEREI+IMKLL+HPNVL LYDVWETN +LYL+LEYAEKGELFNLLV+ GPLPE EA
Sbjct: 74  LPYGIEREIIIMKLLNHPNVLRLYDVWETNTDLYLVLEYAEKGELFNLLVERGPLPENEA 133

Query: 130 INCFRQIIIGISYCHALGIVHRDLKPENLLLDSFYNIKIADFGMAALQTDADLLETSCGS 189
           I  FRQIIIG+SYCHALGIVHRDLKPENLLLD  YNIKIADFGMAAL+T+  LLETSCGS
Sbjct: 134 IRFFRQIIIGVSYCHALGIVHRDLKPENLLLDHKYNIKIADFGMAALETEGKLLETSCGS 193

Query: 190 PHYAAPEIVSGLPYEGFASDVWSCGVILFALLTGRLPFDEENGNVRDLLLKVQKGQFEMP 249
           PHYAAPEIVSG+PY+GFASDVWSCGVILFALLTGRLPFDEE+GN+R LLLKVQKG+FE+P
Sbjct: 194 PHYAAPEIVSGIPYQGFASDVWSCGVILFALLTGRLPFDEEDGNIRALLLKVQKGEFELP 253

Query: 250 NDTEISRDAQDLIGKILVVDPRQRIKIRDILSHPLLKKYQTIKDSKSIKDLPRENTYLYP 309
           +D EISR+AQDLI KIL VDP +RIK RDIL HPLL+KY +I+DSKSI+DLPRE+TYL P
Sbjct: 254 SDDEISREAQDLISKILTVDPERRIKARDILKHPLLQKYPSIRDSKSIRDLPREDTYLTP 313

Query: 310 LADSNNHTSASIDDSILQNLVVLWHGRHADDIVSKLKENGTNKEKILYALLYRFKLDS 367
           L++SN    +SID +ILQNLV+LWHGR  D I +KL+E G N EK LYALLYRFK D+
Sbjct: 314 LSESN----SSIDATILQNLVILWHGRDPDGIRAKLQEPGANAEKTLYALLYRFKCDT 367

 Score =  218 bits (554), Expect = 2e-57,   Method: Compositional matrix adjust.
 Identities = 219/693 (31%), Positives = 313/693 (45%), Gaps = 116/693 (16%)

Query: 438  SSPIPLRSSKRITHINVASANTQATPSGVPNPHXXXXXXXXXXXXXYMPXXXXXXXXXXX 497
            SSP P   +KR +  NV     +A  S                    +P           
Sbjct: 459  SSPTPSSRNKRTSIANVDKNQKRA--SIFSTTKKNKRASKSTRRMSLIPSMKRESVTTKL 516

Query: 498  XXXXXXXIDDDDWEYIEKDAKRTSSNFATLIDEIFEPEKFELAKREKAELQRKVQEAK-- 555
                    +DDDWEYIEK+ KRTSSNFATLIDEIFE EK++  ++EK EL+RKV+EAK  
Sbjct: 517  MSTYAKLAEDDDWEYIEKETKRTSSNFATLIDEIFEYEKYDQIRKEKEELERKVKEAKAL 576

Query: 556  ----------RQSVNAQKINEDEFGSEVSDGMKELKK-------------INDK------ 586
                       +   A+K+ E E   E+    +ELKK             IN +      
Sbjct: 577  EELERRKRKQEEKERARKLLEKE---ELKRKQEELKKQIDIDISDLEHELINHREEKFEG 633

Query: 587  ----VSSPLINYEFSQQELLQDIDTLLTNRYQLSSYTRPISRLDPGL---TPVTETLPNN 639
                +S+P+ N E +   L  DID +L  R   S  TRP+SRLDPG+   +P+    P  
Sbjct: 634  NIRSISAPMENEENNINHLEADIDNILRRR-NFSLQTRPVSRLDPGIIFSSPIETEDPVE 692

Query: 640  LKEKTALLQDTEKKIIETIRRSKFLGSLLNVRGGLS------PGKSELAPIEESPIVS-- 691
             K+       TEKKI+ETIRRSKFLGS  N+   L       PG +    + E  IVS  
Sbjct: 693  PKKAENERLTTEKKILETIRRSKFLGSSFNIDKELKLSQMEYPGMAAPQRLSEERIVSDS 752

Query: 692  --------------------------TTPLIYNDRMEPRRISDVEVPHFTRKSKHFTTAN 725
                                      TT L+ N  +  R+ISD+ VP FTRKS+HF+ +N
Sbjct: 753  NGKYESLVLPKDAKGVAHLKDNTAPTTTELLSNGEL--RKISDIRVPQFTRKSRHFSESN 810

Query: 726  NRRSVLSLYA-KDSIKDLNEFLIKEDPDLPPQGSTDNES-RSEDPEIAESITDSRNIQYD 783
             R SVLS+Y+ K+S  +L + L   + D+ PQ +    + RS D   +E + ++ N    
Sbjct: 811  KRLSVLSMYSTKESFTNLVDILKNGNLDINPQQNQRVPTPRSADD--SEFLFETVN---- 864

Query: 784  EDDSKDGDNVNNDNILSDFPQGVGISQEYDMKDKN------PNQSPISKSAEPTLVVKLP 837
             ++++   N +ND  L D    VG S    +KDKN       ++   S + + T  + LP
Sbjct: 865  -EEAEYTGNSSNDERLYD----VGDSC---IKDKNTLKLNFADRFNGSTNEKETKNLHLP 916

Query: 838  SLSSFQGKNASGL--------GLYQREPSKVTLPSLTSNNSSVGENI--EDGAEKGTESE 887
            +L    GK+ +G          L+++   K  +P   S + +  E    ED    G + E
Sbjct: 917  TLPPLNGKDEAGKQGEEQEKEDLHEQPKVKSMIPESDSLSHAEKEQKEREDQQRGGKDLE 976

Query: 888  KIAAXXXXXXXXXXXXXXXXXTVNAPTTVKK-PPNSVLLKKF--SKGKILELEIHAKIPE 944
                                     P   K    N    +KF  S       E++AK+  
Sbjct: 977  PPLNKSVQKTREKNNDTQAKNQSTDPKPNKNVSGNGSFFRKFSKSSTSEKSTELYAKVSA 1036

Query: 945  KRLYEGLHKLLEGWKQYGLKNLVFNITNMIITGKLVNDSILFLRSTLFEIMVLPNGDGRS 1004
            K+L+ GL KLL GW QYGLKN+  N  N+ +TGKL ++++  LRSTLFE+ +   G   S
Sbjct: 1037 KQLFNGLEKLLRGWNQYGLKNVKSNPNNLTLTGKLSSENMFSLRSTLFEVSIYQKGKV-S 1095

Query: 1005 LIKFNXXXXXXXXXXXXXXEIQIILQKEGVLDK 1037
            +++F               E++ +L KEGVL K
Sbjct: 1096 VVEFKKISGSFKTVKKLVKEVENVLNKEGVLQK 1128

>Skud_4.783 Chr4 complement(1382552..1385959) [3408 bp, 1135 aa]
           {ON} YDR507C (REAL)
          Length = 1135

 Score =  568 bits (1465), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 270/358 (75%), Positives = 304/358 (84%), Gaps = 12/358 (3%)

Query: 17  TIGPWKLGETLGFGSTGKVQLAQHERTGHRTAVKVISKSIFNNNGNHSNDDSV------- 69
           TIGPWKLGETLG GSTGKVQLA+++ TG   AVKVISK++FN  GN S    V       
Sbjct: 15  TIGPWKLGETLGLGSTGKVQLARNKSTGQEAAVKVISKAVFNA-GNMSGTSIVGSITPDA 73

Query: 70  LPYNIEREIVIMKLLSHPNVLSLYDVWETNNNLYLILEYAEKGELFNLLVDHGPLPEREA 129
           LPY IEREI+IMKLL+HPNVL LYDVWETN +LYL+LEYAEKGELFNLLV+ GPLPE EA
Sbjct: 74  LPYGIEREIIIMKLLNHPNVLRLYDVWETNTDLYLVLEYAEKGELFNLLVERGPLPENEA 133

Query: 130 INCFRQIIIGISYCHALGIVHRDLKPENLLLDSFYNIKIADFGMAALQTDADLLETSCGS 189
           I  FRQIIIG+SYCHALGIVHRDLKPENLLLD  YNIKIADFGMAAL+T+  LLETSCGS
Sbjct: 134 IRFFRQIIIGVSYCHALGIVHRDLKPENLLLDHKYNIKIADFGMAALETEGKLLETSCGS 193

Query: 190 PHYAAPEIVSGLPYEGFASDVWSCGVILFALLTGRLPFDEENGNVRDLLLKVQKGQFEMP 249
           PHYAAPEIVSG+PY+GFASDVWSCGVILFALLTGRLPFDEE+GN+R LLLKVQKGQFE+P
Sbjct: 194 PHYAAPEIVSGIPYQGFASDVWSCGVILFALLTGRLPFDEEDGNIRTLLLKVQKGQFELP 253

Query: 250 NDTEISRDAQDLIGKILVVDPRQRIKIRDILSHPLLKKYQTIKDSKSIKDLPRENTYLYP 309
           +D E+SR+AQDLI KIL VDP++RIK RDIL HPLL+KY +I+DSKSI+ LPRE+TYL P
Sbjct: 254 SDDEVSREAQDLICKILTVDPKRRIKARDILKHPLLQKYPSIRDSKSIRGLPREDTYLTP 313

Query: 310 LADSNNHTSASIDDSILQNLVVLWHGRHADDIVSKLKENGTNKEKILYALLYRFKLDS 367
           L++SN    +SID +ILQNLV+LWHGR  D I  KLKE G N EK LYALLYRFK D+
Sbjct: 314 LSESN----SSIDATILQNLVILWHGRDPDGIKEKLKEPGANAEKTLYALLYRFKCDT 367

 Score =  216 bits (549), Expect = 9e-57,   Method: Compositional matrix adjust.
 Identities = 217/689 (31%), Positives = 312/689 (45%), Gaps = 101/689 (14%)

Query: 438  SSPIPLRSSKRITHINVASANTQATPSGVPNPHXXXXXXXXXXXXXYMPXXXXXXXXXXX 497
            +SP P   +KR + INV     +A  S                    +P           
Sbjct: 459  ASPTPASRNKRTSIINVDKNQRRA--SVFSTAKRNKKTSRSTKKLSLIPSMKRESVTTKL 516

Query: 498  XXXXXXXIDDDDWEYIEKDAKRTSSNFATLIDEIFEPEKFELAKREKAELQRKVQEAK-R 556
                     DDDWEYIEK+ KRTSSNFATLIDEIFE EK+E  ++EK EL+ KV+EAK R
Sbjct: 517  MSTYAKLAADDDWEYIEKETKRTSSNFATLIDEIFEYEKYEKIRKEKKELELKVREAKAR 576

Query: 557  QSVNAQKINEDEF--------GSEVSDGMKELKK-----IND------------------ 585
            + +  +K  ++E           E+    +ELKK     I+D                  
Sbjct: 577  EELERRKRKQEEKEHSRKVLEKEELKRKQQELKKQIEIDISDLEHELSKHKEEKPDGNIR 636

Query: 586  KVSSPLINYEFSQQELLQDIDTLLTNRYQLSSYTRPISRLDPGL---TPVTETLPNNLKE 642
             +S+P+ + E +   L  DID +L  R   S  TRP+SRLDPG+   +PV +      K 
Sbjct: 637  SISAPMESEEKNINHLEVDIDNILRRR-NFSLQTRPVSRLDPGIMFSSPVEKESAVEPKR 695

Query: 643  KTALLQDTEKKIIETIRRSKFLGSLLNVRGGLSPGKSE---LAP---IEESPIVSTTPLI 696
                   TEKKI+ETIRRSKFLGS  N+   L   K E   + P   + E  IVS     
Sbjct: 696  TENERLTTEKKILETIRRSKFLGSSFNIEKELKLSKMEYPSMVPPQRLSEERIVSDPSDD 755

Query: 697  YN---------------DRMEP-----------RRISDVEVPHFTRKSKHFTTANNRRSV 730
            Y                D + P           R+IS+V VP FTRKS+HF+ +N R SV
Sbjct: 756  YGSLVLPKDARGYSQLEDHIAPTTGDLLSNGELRKISEVRVPQFTRKSRHFSESNKRLSV 815

Query: 731  LSLY-AKDSIKDLNEFLIKEDPDLPPQGSTDNESRSEDPEIAESITDSRNI-QYDEDDSK 788
            LS+Y +K+S  +L + L   + D+  Q S     R   P+ A+   DS  + +   ++++
Sbjct: 816  LSMYSSKESFTNLVDILKNGNIDVHKQQS----QRIPTPKSAD---DSEFLFETVNEEAE 868

Query: 789  DGDNVNNDNILSDFPQGVGISQEYDMKDKNPNQSPISKSAEPTLVVKLPSLSSFQG---- 844
               N +ND  L D      I  +  +K    ++   S + + T  + LP+L    G    
Sbjct: 869  YTGNSSNDERLYDVGDST-IKDKSALKLNFADRFNASTNEKETENLHLPTLPPLNGGDEV 927

Query: 845  ---KNASGLGLYQREPSKVTLPSLTSNNSSVGENIEDGAEKGTESEKIAAXXXXXXXXXX 901
               K+   LG+  +  S +     +S+     E  E G E   + EK A           
Sbjct: 928  NKQKDEDVLGIQPKVKSMIPQSDSSSHTGKEEEKEEKGEEGREDQEKDAKGAKDIEPPLN 987

Query: 902  XXXXXXXTVNAPTTVKKPP-----------NSVLLKKFSKGKILE--LEIHAKIPEKRLY 948
                     ++   VK  P           N    +KFSK    +  +E++AK+  K+L+
Sbjct: 988  KSVQKTRANDSGPQVKSHPREPKKDRNISGNGSFFRKFSKSSTSDKSVELYAKVSAKQLF 1047

Query: 949  EGLHKLLEGWKQYGLKNLVFNITNMIITGKLVNDSILFLRSTLFEIMVLPNGDGRSLIKF 1008
             GL KLL GW QYGLKN+  +  N+ +TGKL +++I  LRSTLFEI + P G   S+++F
Sbjct: 1048 NGLEKLLRGWTQYGLKNIKSHPNNLTLTGKLSSENIFSLRSTLFEISIYPRGK-MSVVQF 1106

Query: 1009 NXXXXXXXXXXXXXXEIQIILQKEGVLDK 1037
                           E++ +L KEGVL+K
Sbjct: 1107 KKVSGAFKAVKKLVNEVENVLSKEGVLEK 1135

>KAFR0D04100 Chr4 complement(809681..813034) [3354 bp, 1117 aa] {ON}
           Anc_1.52 YDR507C
          Length = 1117

 Score =  568 bits (1463), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 265/353 (75%), Positives = 306/353 (86%), Gaps = 7/353 (1%)

Query: 18  IGPWKLGETLGFGSTGKVQLAQHERTGHRTAVKVISKSIFNNNGNHSNDDS---VLPYNI 74
           +GPWKLGETLG GSTGKVQLA ++ TG + A+KVISKS+FNNN   S+  +    LPY I
Sbjct: 15  LGPWKLGETLGLGSTGKVQLAHNKTTGKQAAIKVISKSVFNNNSAQSSSLTTPDALPYGI 74

Query: 75  EREIVIMKLLSHPNVLSLYDVWETNNNLYLILEYAEKGELFNLLVDHGPLPEREAINCFR 134
           EREI+IMKLL+HPNVL LYDVWETN+NLY++LEYAEKGELFNLLV+ GPL E+EAI  FR
Sbjct: 75  EREIIIMKLLNHPNVLRLYDVWETNSNLYMVLEYAEKGELFNLLVEKGPLQEQEAIRFFR 134

Query: 135 QIIIGISYCHALGIVHRDLKPENLLLDSFYNIKIADFGMAALQTDADLLETSCGSPHYAA 194
           QIIIGISYCHALGIVHRDLKPENLLLD  YNIKIADFGMAAL+T+  LLETSCGSPHYAA
Sbjct: 135 QIIIGISYCHALGIVHRDLKPENLLLDHKYNIKIADFGMAALETEDKLLETSCGSPHYAA 194

Query: 195 PEIVSGLPYEGFASDVWSCGVILFALLTGRLPFDEENGNVRDLLLKVQKGQFEMPNDTEI 254
           PEIVSG+PY GFASDVWSCGVILFALLTGRLPFDEE+GN+R+LLLKVQ G+FEMP+D EI
Sbjct: 195 PEIVSGIPYHGFASDVWSCGVILFALLTGRLPFDEEDGNIRNLLLKVQSGEFEMPSDDEI 254

Query: 255 SRDAQDLIGKILVVDPRQRIKIRDILSHPLLKKYQTIKDSKSIKDLPRENTYLYPLADSN 314
           S +AQDL+ KIL VDP +RI+ RDIL HPLL+KY +IKDSKSI++LPRE+TYL PL+D+N
Sbjct: 255 SHEAQDLLAKILTVDPEKRIRARDILKHPLLQKYPSIKDSKSIRNLPREDTYLNPLSDNN 314

Query: 315 NHTSASIDDSILQNLVVLWHGRHADDIVSKLKENGTNKEKILYALLYRFKLDS 367
               ++ID +ILQNLVVLWHGR  ++I+SKLKE G N EK LYALL RFK+DS
Sbjct: 315 ----STIDKTILQNLVVLWHGRDVNEIISKLKEPGANAEKTLYALLDRFKIDS 363

 Score =  143 bits (360), Expect = 7e-34,   Method: Compositional matrix adjust.
 Identities = 151/493 (30%), Positives = 222/493 (45%), Gaps = 116/493 (23%)

Query: 434 NPTDSSPIPLRSSKRITHIN-----VASANTQATPSGVPNPHXXXXXXXXXXXXXYMPXX 488
           N  +SSP P   +KR + IN     + S N +A+ S                    M   
Sbjct: 456 NSNNSSPTPAHRNKRTSMINTDRQSILSKNKRASRSS--------------KRLSVMANM 501

Query: 489 XXXXXXXXXXXXXXXXIDDDDWEYIEKDAKRTSSNFATLIDEIFEPEKFELAKREKAELQ 548
                            +DDDWEYIEK+ KRTSS+FATLIDEIFE EK+E  ++EK EL 
Sbjct: 502 KRGSITTKLIATYAKLSEDDDWEYIEKETKRTSSDFATLIDEIFEHEKYEQIRKEKEELA 561

Query: 549 RKVQEAKRQSVNA---------QKINEDE-FGSEVSDGMKELKKINDKVSSPLI------ 592
           RKV+ AK +              K+NE++ F ++     +++ +  + + + L       
Sbjct: 562 RKVRLAKEREEEERRRREEEELHKLNEEKKFEAQQLQLQRQMDEEIENLRADLKGDVEPN 621

Query: 593 ------NYEFSQQELLQDI--DTLLTNRYQLSSYTRPISRLDPGL----------TPVT- 633
                 NY      L ++   D LL  R   S  TRPISRLDPGL           P++ 
Sbjct: 622 QEKNEDNYRSVSVPLSKETVNDNLLRQR-NFSLQTRPISRLDPGLFFSEQSPTEEKPISP 680

Query: 634 -ETLPNNLKEKTALLQDTEKKIIETIRRSKFLGSLLNVRGGLSPGKSELAPIEESPIVST 692
            E +PN          DTEK I+ETIRRSKFLGS  ++   L   +     + + P V  
Sbjct: 681 DEPVPNKK-------LDTEKMILETIRRSKFLGSSFDINRELKAAEKR---VMQPPTVQK 730

Query: 693 -----------------TPLIYNDRMEPRRISDVEVPHFTRKSKHFTTANNRRSVLSLYA 735
                            T  + +   E  +ISD+ VP FTRKS+HFTT+N R SVLS+Y+
Sbjct: 731 LTTENKSSDELPKHAVGTAALNSSTAEVSKISDIRVPQFTRKSRHFTTSNRRLSVLSMYS 790

Query: 736 -KDSIKDLNEFLIKEDPDLPPQGSTDNESRSEDPEIAESITDSRNI--QYDEDDSKDGDN 792
            + S  +L + L         +  T+   R+  P    S  DS  I    +E+    G++
Sbjct: 791 TRQSFSNLVDILKN------TEAGTELGQRTPTP---HSAGDSEFIFETVNEEAEYTGNS 841

Query: 793 VNNDNIL-------SDFPQGVGI--SQEYDMKDKNPNQSPISKSAEPTLVV--KLPSLSS 841
            N+D +        ++ P G+ +  +  ++ K+++        S EP+  +  KLP L  
Sbjct: 842 SNDDKLYEVADLDAAEKPSGMKLNFADRFNKKEED--------STEPSRDIQNKLPVLPP 893

Query: 842 FQGKNASGLGLYQ 854
             GK  +GLG+YQ
Sbjct: 894 LDGK--AGLGIYQ 904

 Score = 72.4 bits (176), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 39/94 (41%), Positives = 55/94 (58%), Gaps = 1/94 (1%)

Query: 942  IPEKRLYEGLHKLLEGWKQYGLKNLVFNITNMIITGKLVNDSILFLRSTLFEIMVLPNGD 1001
            I  +++++GL +LL GW +YGLKN+    + M I+GKL +D+IL LRST FEI V  NG+
Sbjct: 1023 IAARQVFDGLRRLLNGWSKYGLKNVRSVSSTMTISGKLSSDNILSLRSTNFEIKVTSNGE 1082

Query: 1002 GRSLIKFNXXXXXXXXXXXXXXEIQIILQKEGVL 1035
              S++                 EI+ I  KEGVL
Sbjct: 1083 SSSVL-IRKKSGSSKAVLRLTTEIENIFSKEGVL 1115

>Smik_4.789 Chr4 complement(1385209..1388619) [3411 bp, 1136 aa]
           {ON} YDR507C (REAL)
          Length = 1136

 Score =  568 bits (1463), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 269/358 (75%), Positives = 303/358 (84%), Gaps = 12/358 (3%)

Query: 17  TIGPWKLGETLGFGSTGKVQLAQHERTGHRTAVKVISKSIFNNNGNHSNDDSV------- 69
           TIGPWKLGETLG GSTGKVQLA+++ TG   AVKVISK++FN  GN S    V       
Sbjct: 15  TIGPWKLGETLGLGSTGKVQLARNKSTGQEAAVKVISKTVFNT-GNVSGTSIVGSTTPDA 73

Query: 70  LPYNIEREIVIMKLLSHPNVLSLYDVWETNNNLYLILEYAEKGELFNLLVDHGPLPEREA 129
           LPY IEREI+IMKLL+HPNVL LYDVWETN +LYL+LEYAEKGELFNLLV+ GPLPE EA
Sbjct: 74  LPYGIEREIIIMKLLNHPNVLRLYDVWETNADLYLVLEYAEKGELFNLLVERGPLPENEA 133

Query: 130 INCFRQIIIGISYCHALGIVHRDLKPENLLLDSFYNIKIADFGMAALQTDADLLETSCGS 189
           I  FRQIIIG+SYCHALGIVHRDLKPENLLLD  YNIKIADFGMAAL+T+  LLETSCGS
Sbjct: 134 IRFFRQIIIGVSYCHALGIVHRDLKPENLLLDHKYNIKIADFGMAALETEGKLLETSCGS 193

Query: 190 PHYAAPEIVSGLPYEGFASDVWSCGVILFALLTGRLPFDEENGNVRDLLLKVQKGQFEMP 249
           PHYAAPEIVSG+PY+GFASDVWSCGVILFALLTGRLPFDEE+GN+R LLLKVQKG+FE+P
Sbjct: 194 PHYAAPEIVSGIPYQGFASDVWSCGVILFALLTGRLPFDEEDGNIRTLLLKVQKGEFELP 253

Query: 250 NDTEISRDAQDLIGKILVVDPRQRIKIRDILSHPLLKKYQTIKDSKSIKDLPRENTYLYP 309
           +D EISR+AQDLI +IL VDP +RIK RDIL HPLL+KY +IKDSKSI+ LPRE+TYL P
Sbjct: 254 SDDEISREAQDLISRILTVDPERRIKTRDILKHPLLQKYPSIKDSKSIRGLPREDTYLTP 313

Query: 310 LADSNNHTSASIDDSILQNLVVLWHGRHADDIVSKLKENGTNKEKILYALLYRFKLDS 367
           L++SN    +SID +ILQNLV+LWHGR  D I  KL+E G N EK LYALLYRFK D+
Sbjct: 314 LSESN----SSIDATILQNLVILWHGRDPDGIKEKLRETGANAEKTLYALLYRFKCDT 367

 Score =  157 bits (398), Expect = 2e-38,   Method: Compositional matrix adjust.
 Identities = 131/389 (33%), Positives = 180/389 (46%), Gaps = 71/389 (18%)

Query: 438 SSPIPLRSSKRITHINVASANTQATPSGVPNPHXXXXXXXXXXXXXYMPXXXXXXXXXXX 497
           SSP P   +KR + IN+     +A  S                    +P           
Sbjct: 459 SSPTPASRNKRASVINIEKNQKRA--SVFSTAKKNKRTSKSIKRMSLIPSMKRESVTTKL 516

Query: 498 XXXXXXXIDDDDWEYIEKDAKRTSSNFATLIDEIFEPEKFELAKREKAELQRKVQEAKRQ 557
                   +DDDWEYIEK+ KRTSSNFATLIDEIFE EK+E  ++EK EL+RKV+EAK +
Sbjct: 517 MSTYAKLAEDDDWEYIEKETKRTSSNFATLIDEIFEYEKYEQIRKEKEELERKVREAKAR 576

Query: 558 SVNAQ--------------------KINEDEFGSE----VSDGMKELKKINDK------- 586
               +                    K+ ++E   +    +SD  +EL +  ++       
Sbjct: 577 EELERRRRRQEEKERTRKLLEKEELKMKQEELKKQIEMDISDLEQELSRHKEEKPDGNIR 636

Query: 587 -VSSPLINYEFSQQELLQDIDTLLTNRYQLSSYTRPISRLDPGLT---PVTETLPNNLKE 642
            +S+P+ N E +   L  DID +L  R   S  TRP+SRLDPG+    P+    P   K 
Sbjct: 637 SISAPMENEEKNIDHLGTDIDNILRRR-NFSLQTRPVSRLDPGIVFSNPIETVYPVEPKR 695

Query: 643 KTALLQDTEKKIIETIRRSKFLGSLLNVRGGLSPGKSE----LAP--IEESPIVSTTPLI 696
                  TEKKI+ETIRRSKFLGS  N+   L   K E    LAP  +    +VS     
Sbjct: 696 SENERLTTEKKILETIRRSKFLGSSFNIEKELKLSKMEYPSVLAPEKLSGERVVSDLNGK 755

Query: 697 YNDRMEP--------------------------RRISDVEVPHFTRKSKHFTTANNRRSV 730
           Y   + P                          R+IS+V VP FTRKS+HF+ +N R S+
Sbjct: 756 YESLILPKDAKGVSQLKDDITSTTTEHLSDGKLRKISEVRVPQFTRKSRHFSESNKRLSL 815

Query: 731 LSLYA-KDSIKDLNEFLIKEDPDLPPQGS 758
           LS+Y+ K+S  +L + L   + D+  Q S
Sbjct: 816 LSMYSTKESFTNLVDILKNSNLDVNNQQS 844

 Score = 90.5 bits (223), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 48/119 (40%), Positives = 72/119 (60%), Gaps = 3/119 (2%)

Query: 921  NSVLLKKFSKGKILE--LEIHAKIPEKRLYEGLHKLLEGWKQYGLKNLVFNITNMIITGK 978
            NS   +KFSK    +  +E++AK+  ++L+ GL KLL GW Q+GLKN+  +  N+ +TGK
Sbjct: 1019 NSSFFRKFSKSSASDKLVELYAKVSARQLFNGLEKLLRGWTQFGLKNIKSHPNNLTLTGK 1078

Query: 979  LVNDSILFLRSTLFEIMVLPNGDGRSLIKFNXXXXXXXXXXXXXXEIQIILQKEGVLDK 1037
            L +++I  LRSTLFEI + P G   S+++F               E++ +L KEGVL K
Sbjct: 1079 LSSENIFSLRSTLFEINIYPKGR-MSVVQFKKISGSFKAVKKLVNEVENVLNKEGVLQK 1136

>NCAS0B08600 Chr2 (1649375..1652728) [3354 bp, 1117 aa] {ON}
           Anc_5.591 YDR466W
          Length = 1117

 Score =  567 bits (1461), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 268/358 (74%), Positives = 307/358 (85%), Gaps = 12/358 (3%)

Query: 17  TIGPWKLGETLGFGSTGKVQLAQHERTGHRTAVKVISKSIFNNNGNHSNDDSV------- 69
           TIGPWKLGETLG GSTGKVQLA +E T  + A+K+ISKSIFN   N SN+ S+       
Sbjct: 18  TIGPWKLGETLGLGSTGKVQLAFNETTNQQAAIKIISKSIFNTKPN-SNETSMVANTPDS 76

Query: 70  LPYNIEREIVIMKLLSHPNVLSLYDVWETNNNLYLILEYAEKGELFNLLVDHGPLPEREA 129
           LPY IEREI+IMKLL H NVLSLYDVWETN+NLY+ILEYAEKGELFNLLV+ GPLPE+EA
Sbjct: 77  LPYGIEREIIIMKLLRHANVLSLYDVWETNSNLYMILEYAEKGELFNLLVEKGPLPEKEA 136

Query: 130 INCFRQIIIGISYCHALGIVHRDLKPENLLLDSFYNIKIADFGMAALQTDADLLETSCGS 189
           +  FRQIIIGISYCHALGIVHRDLKPENLLLD  +NIKIADFGMAAL+T+  LLETSCGS
Sbjct: 137 VRFFRQIIIGISYCHALGIVHRDLKPENLLLDHKFNIKIADFGMAALETEDKLLETSCGS 196

Query: 190 PHYAAPEIVSGLPYEGFASDVWSCGVILFALLTGRLPFDEENGNVRDLLLKVQKGQFEMP 249
           PHYAAPEIVSG+PY GF SDVWSCGVILFALLTGRLPFDEE+GN+R+LLLKVQ GQFEMP
Sbjct: 197 PHYAAPEIVSGIPYHGFESDVWSCGVILFALLTGRLPFDEEDGNIRNLLLKVQSGQFEMP 256

Query: 250 NDTEISRDAQDLIGKILVVDPRQRIKIRDILSHPLLKKYQTIKDSKSIKDLPRENTYLYP 309
           +D E+SRDAQDLI +IL VDP +RIK R+IL HPLL+KY +IKDSKSIK+LPRE+TYL+P
Sbjct: 257 DDDEMSRDAQDLISRILTVDPTKRIKTREILKHPLLQKYPSIKDSKSIKNLPREDTYLFP 316

Query: 310 LADSNNHTSASIDDSILQNLVVLWHGRHADDIVSKLKENGTNKEKILYALLYRFKLDS 367
           L+D+N    + ID SILQNLVVLWHGR  + I +KLKE+G N EK +YALLYRFK+++
Sbjct: 317 LSDNN----SVIDPSILQNLVVLWHGRDKEQIAAKLKESGANAEKTIYALLYRFKIEA 370

 Score =  204 bits (518), Expect = 5e-53,   Method: Compositional matrix adjust.
 Identities = 195/606 (32%), Positives = 288/606 (47%), Gaps = 114/606 (18%)

Query: 506  DDDDWEYIEKDAKRTSSNFATLIDEIFEPEKFELAKREKAELQRKVQEAK---------- 555
            +DD+WEYIEK+ KRTSS+FATLIDEIFE EK+E  ++EK EL RKV+EAK          
Sbjct: 548  EDDNWEYIEKETKRTSSDFATLIDEIFEHEKYEQIRKEKEELARKVREAKEGEARERREQ 607

Query: 556  ---------------RQSVNAQKINEDEFGSEVSDGMKELKKIN-----DKVSSPLINYE 595
                           RQ +  Q   + E  +  +D   E K          VS+PL   E
Sbjct: 608  ESEKQRKQREREELERQQLELQNHIDQEISNLKADLANETKGAEPYENPRSVSAPL---E 664

Query: 596  FSQQELLQ-DIDTLLTNRYQLSSYTRPISRLDPGL--TPVTETLPNNLKEKTALLQDTEK 652
                E ++ DI+ L   R  +S  TRP SRLDPG+  +   ET+ N L        D EK
Sbjct: 665  RENPEAIERDINDLFARR-NVSLQTRPKSRLDPGILYSAPAETVSNPLLSDIDQEIDREK 723

Query: 653  KIIETIRRSKFLGSLLNVRGGLSPGK----SELAPIEESPIVSTTPLI----------YN 698
            KI+ETIRRS+FLGS  N+   L   K    +E +  E+   V++  ++           N
Sbjct: 724  KILETIRRSRFLGSSYNINKELEFAKKTALAETSKKEKRSKVTSQNIVADKAAIGVIPLN 783

Query: 699  D-RMEPRRISDVEVPHFTRKSKHFTTANNRRSVLSLYA-KDSIKDLNEFLIKEDPDLPPQ 756
            D     R+IS+++VP FTRKS+HF+ +N R SVLS+Y+ K S  +L + L +   +L  +
Sbjct: 784  DTEAGLRKISEIKVPQFTRKSRHFSNSNRRLSVLSMYSTKQSYTNLGDILKEGGVNLASE 843

Query: 757  GSTDNESR-SEDPEIA-ESITD-SRNIQYDEDDSKDGDNVNNDNILSDFPQGVGISQEYD 813
             +    S+ S +PE   ES+ + + N  Y+               L + P+   +++E  
Sbjct: 844  ANNTTTSKASTEPEFQFESVNEGTANKLYE---------------LQEEPEYTDVNKEDG 888

Query: 814  MKDKNPNQSPISKSAEPTLVVKLPSLSSFQGK--NASGLGLYQR---------EP---SK 859
               KN               VKLP+L     K   A+GL +YQ          EP   S+
Sbjct: 889  KPKKN---------------VKLPTLPPLHEKTNQANGLAIYQSSSDDDKKPTEPQPKSQ 933

Query: 860  VTLPSL--TSNNSSVGENIEDGAEKGTESEKIAAXXXXXXXXXXXXXXXXXTVNAPTTVK 917
              +P    + NNS+   +++       ES+                         P  V+
Sbjct: 934  SMIPERQDSINNSA---SVKKTPVVEPESQATKKINKPKQRQPKKEEERKPLNEMPPNVE 990

Query: 918  KPPNSVLLKKFSKGKIL--------ELEIHAKIPEKRLYEGLHKLLEGWKQYGLKNLVFN 969
            K  N    +KFSK   +        + E++  +   +LY+GL +LL+GW +YGLK++   
Sbjct: 991  KKRNVSFFRKFSKSSAVSTLTKNGFDYEVYVNVSAPQLYKGLLRLLQGWSKYGLKDVKSQ 1050

Query: 970  ITNMIITGKLVNDSILFLRSTLFEIMVLPNGDGRSLIKFNXXXXXXXXXXXXXXEIQIIL 1029
               M +TGKL ND+IL LRST+FE++V   G  +S++ FN              EI+ +L
Sbjct: 1051 SNYMKLTGKLSNDNILSLRSTVFEMIVESKGK-QSVVGFNKISGSSKTVRRLFVEIEKVL 1109

Query: 1030 QKEGVL 1035
            ++EGVL
Sbjct: 1110 RQEGVL 1115

>YDR507C Chr4 complement(1462358..1465786) [3429 bp, 1142 aa] {ON}
           GIN4Protein kinase involved in bud growth and assembly
           of the septin ring, proposed to have kinase-dependent
           and kinase-independent activities; undergoes
           autophosphorylation; similar to Kcc4p and Hsl1p
          Length = 1142

 Score =  565 bits (1455), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 269/358 (75%), Positives = 302/358 (84%), Gaps = 12/358 (3%)

Query: 17  TIGPWKLGETLGFGSTGKVQLAQHERTGHRTAVKVISKSIFNNNGNHSNDDSV------- 69
           TIGPWKLGETLG GSTGKVQLA++  TG   AVKVISK++FN  GN S    V       
Sbjct: 15  TIGPWKLGETLGLGSTGKVQLARNGSTGQEAAVKVISKAVFNT-GNVSGTSIVGSTTPDA 73

Query: 70  LPYNIEREIVIMKLLSHPNVLSLYDVWETNNNLYLILEYAEKGELFNLLVDHGPLPEREA 129
           LPY IEREI+IMKLL+HPNVL LYDVWETN +LYL+LEYAEKGELFNLLV+ GPLPE EA
Sbjct: 74  LPYGIEREIIIMKLLNHPNVLRLYDVWETNTDLYLVLEYAEKGELFNLLVERGPLPEHEA 133

Query: 130 INCFRQIIIGISYCHALGIVHRDLKPENLLLDSFYNIKIADFGMAALQTDADLLETSCGS 189
           I  FRQIIIG+SYCHALGIVHRDLKPENLLLD  YNIKIADFGMAAL+T+  LLETSCGS
Sbjct: 134 IRFFRQIIIGVSYCHALGIVHRDLKPENLLLDHKYNIKIADFGMAALETEGKLLETSCGS 193

Query: 190 PHYAAPEIVSGLPYEGFASDVWSCGVILFALLTGRLPFDEENGNVRDLLLKVQKGQFEMP 249
           PHYAAPEIVSG+PY+GFASDVWSCGVILFALLTGRLPFDEE+GN+R LLLKVQKG+FEMP
Sbjct: 194 PHYAAPEIVSGIPYQGFASDVWSCGVILFALLTGRLPFDEEDGNIRTLLLKVQKGEFEMP 253

Query: 250 NDTEISRDAQDLIGKILVVDPRQRIKIRDILSHPLLKKYQTIKDSKSIKDLPRENTYLYP 309
           +D EISR+AQDLI KIL VDP +RIK RDIL HPLL+KY +I+DSKSI+ LPRE+TYL P
Sbjct: 254 SDDEISREAQDLIRKILTVDPERRIKTRDILKHPLLQKYPSIRDSKSIRGLPREDTYLTP 313

Query: 310 LADSNNHTSASIDDSILQNLVVLWHGRHADDIVSKLKENGTNKEKILYALLYRFKLDS 367
           L++SN    +SID +ILQNLV+LWHGR  + I  KL+E G N EK LYALLYRFK D+
Sbjct: 314 LSESN----SSIDATILQNLVILWHGRDPEGIKEKLREPGANAEKTLYALLYRFKCDT 367

 Score =  162 bits (411), Expect = 6e-40,   Method: Compositional matrix adjust.
 Identities = 137/389 (35%), Positives = 185/389 (47%), Gaps = 73/389 (18%)

Query: 438 SSPIPLRSSKRITHINVASANTQATPSGVPNPHXXXXXXXXXXXXXYMPXXXXXXXXXXX 497
           SSP P   +KR + INV     +A  S                    +P           
Sbjct: 459 SSPTPASRNKRASVINVEKNQKRA--SIFSTTKKNKRSSRSIKRMSLIPSMKRESVTTKL 516

Query: 498 XXXXXXXIDDDDWEYIEKDAKRTSSNFATLIDEIFEPEKFELAKREKAELQRKVQEAK-- 555
                   +DDDWEYIEK+ KRTSSNFATLIDEIFE EK+E  ++EK EL+RKV+EAK  
Sbjct: 517 MSTYAKLAEDDDWEYIEKETKRTSSNFATLIDEIFEYEKYEQIRKEKEELERKVREAKAR 576

Query: 556 ----------RQSVNAQKINEDE------------FGSEVSDGMKELKKINDK------- 586
                      +   A+K+ E E               ++SD  +EL K  ++       
Sbjct: 577 EELERRRRKQEEKERARKLLEKEDLKRKQEELKKQIEIDISDLEQELSKHKEEKLDGNIR 636

Query: 587 -VSSPLINYEFSQQELLQDIDTLLTNRYQLSSYTRPISRLDPGL---TPVTETLPNNLKE 642
            +S+P+ N E +   L  DID +L  R   S  TRP+SRLDPG+   +P  E  P   K 
Sbjct: 637 SISAPMENEEKNINHLEVDIDNILRRR-NFSLQTRPVSRLDPGIMFSSPTEEVSPVEPKR 695

Query: 643 KTALLQDTEKKIIETIRRSKFLGSLLNVRGGLSPGKSE----LAP--IEESPIVS----- 691
                  TEKKI+ETIRRSKFLGS  N+   L   K E    +AP  + E  +VS     
Sbjct: 696 TENERLTTEKKILETIRRSKFLGSSFNIDKELKLSKMEYPSIIAPQRLSEERVVSDSNDG 755

Query: 692 ---------------------TTPLIYNDRMEPRRISDVEVPHFTRKSKHFTTANNRRSV 730
                                TT  + + R+  R+IS++ VP FTRKS+HF+ +N R SV
Sbjct: 756 YESLILPKDGNGVSQLKDSTATTAPVSDGRL--RKISEIRVPQFTRKSRHFSESNKRLSV 813

Query: 731 LSLYA-KDSIKDLNEFLIKEDPDLPPQGS 758
           LS+Y+ K+S  +L + L   + D+  Q S
Sbjct: 814 LSMYSTKESFTNLVDILKNGNLDVNNQQS 842

 Score = 97.4 bits (241), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 50/117 (42%), Positives = 70/117 (59%), Gaps = 1/117 (0%)

Query: 921  NSVLLKKFSKGKILELEIHAKIPEKRLYEGLHKLLEGWKQYGLKNLVFNITNMIITGKLV 980
            N    +KFSK     +E++AKI  K+L+ GL KLL GW QYGLKN+  +  N+ +TGKL 
Sbjct: 1027 NGSFFRKFSKSSDKTMELYAKISAKQLFNGLEKLLRGWTQYGLKNIKSHPNNLTLTGKLS 1086

Query: 981  NDSILFLRSTLFEIMVLPNGDGRSLIKFNXXXXXXXXXXXXXXEIQIILQKEGVLDK 1037
            +D+I  LRSTLFE+ + P G   S+++F               E++ +L KEGVL K
Sbjct: 1087 SDNIFSLRSTLFEVNIYPRGK-MSVVQFKKVSGSFKAVKKLVNEVENVLNKEGVLQK 1142

>CAGL0K05709g Chr11 complement(556732..560043) [3312 bp, 1103 aa]
           {ON} similar to uniprot|Q12263 Saccharomyces cerevisiae
           YDR507c GIN4
          Length = 1103

 Score =  560 bits (1442), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 258/372 (69%), Positives = 318/372 (85%), Gaps = 8/372 (2%)

Query: 1   MTVANTETHSAAKPSSTIGPWKLGETLGFGSTGKVQLAQHERTGHRTAVKVISKSIF--- 57
           M+  ++ T S  K ++ IGPWKLGETLG GSTGKV LA +E T  + AVKVISK++F   
Sbjct: 1   MSAISSNTVSVIK-NNQIGPWKLGETLGSGSTGKVLLASNETTKQQAAVKVISKAVFEAM 59

Query: 58  NNNGNHSNDDSVLPYNIEREIVIMKLLSHPNVLSLYDVWETNNNLYLILEYAEKGELFNL 117
           NN+ ++ +  + LPYNIE+EI+IMKLL+HPNVL L+DVWETN++LYL+LEYAEKGELFN+
Sbjct: 60  NNSESNGDATNALPYNIEQEIIIMKLLNHPNVLRLFDVWETNSDLYLVLEYAEKGELFNM 119

Query: 118 LVDHGPLPEREAINCFRQIIIGISYCHALGIVHRDLKPENLLLDSFYNIKIADFGMAALQ 177
           LV+ GPLPE EA+  FRQIIIGISYCH+LG+VHRDLKPENLLLD+  NIKIADFGMAAL+
Sbjct: 120 LVERGPLPENEAVRAFRQIIIGISYCHSLGVVHRDLKPENLLLDNKLNIKIADFGMAALE 179

Query: 178 TDADLLETSCGSPHYAAPEIVSGLPYEGFASDVWSCGVILFALLTGRLPFDEENGNVRDL 237
           ++  LLETSCGSPHYAAPEI+SGLPYEGF+SDVWSCGVILFALLTGRLPFDEE+GN+R+L
Sbjct: 180 SEDKLLETSCGSPHYAAPEIISGLPYEGFSSDVWSCGVILFALLTGRLPFDEEDGNIRNL 239

Query: 238 LLKVQKGQFEMPNDTEISRDAQDLIGKILVVDPRQRIKIRDILSHPLLKKYQTIKDSKSI 297
           LLKVQKG+FEMP+D EI+++AQDL+ ++L VDP +RI IR+IL HPLL+KY +IKDS+SI
Sbjct: 240 LLKVQKGEFEMPDDDEITKEAQDLLARLLTVDPSKRITIREILKHPLLQKYPSIKDSRSI 299

Query: 298 KDLPRENTYLYPLADSNNHTSASIDDSILQNLVVLWHGRHADDIVSKLKENGTNKEKILY 357
           ++LPRE+TYL PLAD+N    + IDD+ILQNLV+LWHG+ A +I +KL+E G N EK LY
Sbjct: 300 RNLPREDTYLSPLADTN----SKIDDAILQNLVILWHGKDAREIAAKLREPGANTEKTLY 355

Query: 358 ALLYRFKLDSVR 369
           ALLYRFK D+ R
Sbjct: 356 ALLYRFKCDTQR 367

 Score =  161 bits (408), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 119/293 (40%), Positives = 168/293 (57%), Gaps = 60/293 (20%)

Query: 506 DDDDWEYIEKDAKRTSSNFATLIDEIFEPEKFELAKREKAELQRKV-------------- 551
           +DDDWEYIE++ KRTSS+FATLIDEIFE EK+E  ++EKAEL+RKV              
Sbjct: 529 EDDDWEYIERETKRTSSDFATLIDEIFEYEKYEQIRKEKAELERKVRETKEREERERKER 588

Query: 552 ------QEAKRQSVNAQKINED---EFGSEVSDGMKELKKIND------KVSSPLINYEF 596
                 +  +R+ +  QK  ED   +   E+S+  KEL    D       VS PL +   
Sbjct: 589 QEKELQERLERERIEKQK--EDIARQMDEEISNLKKELVGDQDNEDKFRSVSEPLESKSK 646

Query: 597 SQQELLQDIDTLLTNRYQLSSYTRPISRLDPGL----------TPVTETLPNNLKEKTAL 646
             +++ +DID +L NR + S  TRP+SRLDPG+            V ET+  NL+ +   
Sbjct: 647 KIEDIEEDIDGILRNR-KYSLQTRPVSRLDPGIGFIDKPRQSEQHVPETV--NLEPE--- 700

Query: 647 LQDTEKKIIETIRRSKFLGSLLNVRGGL----------SPGKSELAPIEESPIVSTTPLI 696
           L++TE+KI+ETIRRSKFLGS  +++  L           P + E+AP      +      
Sbjct: 701 LEETEQKILETIRRSKFLGSSFDIKKELENVKRHRQTSQPIEKEMAPPALPETLPKAVEK 760

Query: 697 YNDRMEP--RRISDVEVPHFTRKSKHFTTANNRRSVLSLYA-KDSIKDLNEFL 746
            N  M+P  R+ISD++VP FTRKS+HF+T+N R SVLS+Y+ K+S  +L + L
Sbjct: 761 KNVSMDPSLRKISDIKVPQFTRKSRHFSTSNRRLSVLSMYSTKESYSNLADIL 813

>Kpol_2002.46 s2002 (95107..98478) [3372 bp, 1123 aa] {ON}
           (95107..98478) [3372 nt, 1124 aa]
          Length = 1123

 Score =  560 bits (1442), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 265/355 (74%), Positives = 304/355 (85%), Gaps = 5/355 (1%)

Query: 17  TIGPWKLGETLGFGSTGKVQLAQHERTGHRTAVKVISKSIFNNNGNHSNDDSVLP----Y 72
           TIGPWKLGETLG GSTGKVQLA +E T  + A+KVISKS+F++ GN+S+  S  P    Y
Sbjct: 15  TIGPWKLGETLGLGSTGKVQLAYNESTNQQAAIKVISKSVFSSMGNNSSMVSSTPDSLSY 74

Query: 73  NIEREIVIMKLLSHPNVLSLYDVWETNNNLYLILEYAEKGELFNLLVDHGPLPEREAINC 132
            IEREI+IMKLL+HPNVL LYDVWETNNNLY++LEYAEKGELFNLLV+ GPLPE EAI  
Sbjct: 75  GIEREIIIMKLLNHPNVLRLYDVWETNNNLYMVLEYAEKGELFNLLVEKGPLPENEAIRF 134

Query: 133 FRQIIIGISYCHALGIVHRDLKPENLLLDSFYNIKIADFGMAALQTDADLLETSCGSPHY 192
           FRQIIIG+SYCHALGIVHRDLKPEN+LLD   NIKIADFGMAAL+T+  LLETSCGSPHY
Sbjct: 135 FRQIIIGMSYCHALGIVHRDLKPENILLDHKLNIKIADFGMAALETEDKLLETSCGSPHY 194

Query: 193 AAPEIVSGLPYEGFASDVWSCGVILFALLTGRLPFDEENGNVRDLLLKVQKGQFEMPNDT 252
           AAPEIVSGLPY G  +DVWSCGVILFALLTGRLPFDEE+GN+R+LLLKVQKG+FEMP D 
Sbjct: 195 AAPEIVSGLPYHGLETDVWSCGVILFALLTGRLPFDEEDGNIRNLLLKVQKGEFEMPGDD 254

Query: 253 EISRDAQDLIGKILVVDPRQRIKIRDILSHPLLKKYQTIKDSKSIKDLPRENTYLYPLAD 312
           EIS++AQDL+ KILVVDP +RIK R+IL HPLL+KY +IKDSK+I++LPRE+TYL PL  
Sbjct: 255 EISKEAQDLLYKILVVDPEKRIKSREILKHPLLQKYPSIKDSKTIRNLPREDTYLNPLI- 313

Query: 313 SNNHTSASIDDSILQNLVVLWHGRHADDIVSKLKENGTNKEKILYALLYRFKLDS 367
            N+   A+ID +ILQNLVVLWHGR+ DDI  KL+E G N EK LYALLYRFK+DS
Sbjct: 314 GNDGGDATIDKTILQNLVVLWHGRNEDDIAKKLREPGANAEKTLYALLYRFKVDS 368

 Score =  181 bits (458), Expect = 1e-45,   Method: Compositional matrix adjust.
 Identities = 187/609 (30%), Positives = 278/609 (45%), Gaps = 109/609 (17%)

Query: 506  DDDDWEYIEKDAKRTSSNFATLIDEIFEPEKFELAKREKAELQRKVQEAKRQSVNAQKIN 565
            +DDDWE+IEK+ KR SS+FATLIDEIFE EK+E  ++EK EL+RKV+E K +    ++  
Sbjct: 547  EDDDWEFIEKETKRVSSDFATLIDEIFEHEKYEQIRKEKEELERKVRENKEREERQKRQK 606

Query: 566  EDEFGS--------------EVSDGMKELKKIND-------------KVSSPLINYEFSQ 598
            E E  +              E +   KEL++                 +SSP+ N   ++
Sbjct: 607  EVELAAIAREREELQRRLEEEETQITKELQQDTKNFQEDEVVHKNVRSISSPVENGNEAK 666

Query: 599  QELLQDIDTLLTNRYQLSSYTRPISRLDPGL-----TPV-TETLPNNLKEKTALLQDTEK 652
             E  +D     + +   S  TRP+S+LDPG+      PV  E +  +  +KT    D++K
Sbjct: 667  SE--EDA----SGQRSFSLQTRPVSKLDPGIKCGSNKPVQMEEIVEDELDKTI---DSQK 717

Query: 653  KIIETIRRSKFLGSLLNVRGGLSPGK--SELAPIEESP---------IVSTTPLIY---- 697
             I+ETIRRSKFLGS  N+   L   K  +E+  + +S          IVS T   Y    
Sbjct: 718  VILETIRRSKFLGSSFNIDKELKQVKKDAEVKRMRKSQKEDRDVSGRIVSETNEQYETQV 777

Query: 698  --------------NDRMEPRRISDVEVPHFTRKSKHFTTANNRRSVLSLYAK-DSIKDL 742
                          ++ +EPR+ISD++VP FTRKSK FT +N R SVLS+Y+   S  +L
Sbjct: 778  LPKNATAFGALKDDSEEVEPRKISDIQVPQFTRKSKLFTDSNKRLSVLSIYSSTQSYTNL 837

Query: 743  NEFLIKEDPDLPPQGSTDNESRSEDPEIAESITDSRNIQYDEDDSKDGDNVNNDNILSDF 802
               L +   D+     ++N   SE+PE       +      E ++   +        ++ 
Sbjct: 838  ANVLKEGGVDIGVNEGSNNVEVSEEPEFQFETVGT------EIENNKYEEEKEIENENNL 891

Query: 803  PQGVGISQEY-DMKDKNPNQSPISKSAEPTLVVKLPSLSSF-QGKNASGLGLYQREPSKV 860
             QG  I   Y D  D   N +           VKLP+L      K + GLG+Y  +    
Sbjct: 892  SQGANIKLNYADRFDTAGNVNE----------VKLPTLPPLGDDKVSDGLGIYSSKSGSE 941

Query: 861  T-----LPSLTSNNSSVGENIEDGAEKGTESEKIAAXXXXXXXXXXXXXXXXXTVNAPTT 915
                  +PS+  N S      E   EK  E  K                      NA  +
Sbjct: 942  GNESKPVPSIKENKSE-----ETLKEKNVEP-KPPLNDVVPKTRDTKKTNVVQNNNAKHS 995

Query: 916  VKKPPNSVLLKKFSKGKILE-------LEIHAKIPEKRLYEGLHKLLEGWKQYGLKNLVF 968
              KP ++   +K SKG  ++       +++ + +   +LY GL  LL+GWK YGLK +  
Sbjct: 996  SDKPRSTSFFRKISKGLTVQNDTTGYDVKLFSNVSVTQLYNGLFNLLKGWKDYGLKEIKS 1055

Query: 969  NITNMIITGKLVNDSILFLRSTLFEIMVLPNGDGRSLIKFNXXXXXXXXXXXXXXEIQII 1028
            N     I+ +L +D+IL LRST  +++V   G   S+I F               E++ +
Sbjct: 1056 NKEAFSISVRLSSDNILSLRSTFVDMVVFSEGK-HSVIGFRKKSGSSKTLKRLTSEVEKV 1114

Query: 1029 LQKEGVLDK 1037
            L+KEGVL K
Sbjct: 1115 LRKEGVLAK 1123

>NDAI0A00660 Chr1 (121773..124841) [3069 bp, 1022 aa] {ON} Anc_1.52
          Length = 1022

 Score =  556 bits (1432), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 263/359 (73%), Positives = 303/359 (84%), Gaps = 14/359 (3%)

Query: 17  TIGPWKLGETLGFGSTGKVQLAQHERTGHRTAVKVISKSIFNNN--------GNHSNDDS 68
           TIGPWKLG+TLG GSTGKV+LA +E T  + A+K+ISKSIF+           N S D  
Sbjct: 14  TIGPWKLGKTLGLGSTGKVELAYNETTSQQAAIKIISKSIFSQGTVGESSMVSNSSPD-- 71

Query: 69  VLPYNIEREIVIMKLLSHPNVLSLYDVWETNNNLYLILEYAEKGELFNLLVDHGPLPERE 128
            LPY IEREI+IMKLL HPNVLSLYDVWETN+ LY+ILEYAEKGELFNLLV+ GPLPE+E
Sbjct: 72  ALPYGIEREIIIMKLLRHPNVLSLYDVWETNSKLYMILEYAEKGELFNLLVERGPLPEKE 131

Query: 129 AINCFRQIIIGISYCHALGIVHRDLKPENLLLDSFYNIKIADFGMAALQTDADLLETSCG 188
           AI  FRQIIIGISYCHALGIVHRDLKPENLLLD   NIKIADFGMAAL+T   +LETSCG
Sbjct: 132 AIRFFRQIIIGISYCHALGIVHRDLKPENLLLDHKLNIKIADFGMAALETKDKMLETSCG 191

Query: 189 SPHYAAPEIVSGLPYEGFASDVWSCGVILFALLTGRLPFDEENGNVRDLLLKVQKGQFEM 248
           SPHYAAPEIVSG+PY GF SDVWSCGVILFALLTGRLPFDEE+GN+R+LLLKVQ G++EM
Sbjct: 192 SPHYAAPEIVSGVPYHGFQSDVWSCGVILFALLTGRLPFDEEDGNIRNLLLKVQSGEYEM 251

Query: 249 PNDTEISRDAQDLIGKILVVDPRQRIKIRDILSHPLLKKYQTIKDSKSIKDLPRENTYLY 308
           P+D EIS++AQDLIG+IL VDP QRIK RDIL HPLL+KY +IKDS+SIK+LPRE+TYLY
Sbjct: 252 PDDDEISKEAQDLIGRILTVDPEQRIKTRDILKHPLLQKYPSIKDSRSIKNLPREDTYLY 311

Query: 309 PLADSNNHTSASIDDSILQNLVVLWHGRHADDIVSKLKENGTNKEKILYALLYRFKLDS 367
           PL+++N    + IDDSILQNLV LWHGR  DDI  KL+E+G + EK +YALLYRFK+++
Sbjct: 312 PLSENN----SIIDDSILQNLVALWHGRDKDDIAGKLRESGADAEKTVYALLYRFKVEA 366

 Score =  137 bits (344), Expect = 5e-32,   Method: Compositional matrix adjust.
 Identities = 115/309 (37%), Positives = 166/309 (53%), Gaps = 66/309 (21%)

Query: 506 DDDDWEYIEKDAKRTSSNFATLIDEIFEPEKFELAKREKAELQRKVQEAKRQSVNA---- 561
           +DD+WEYIE++ KRTSS+FATLIDE+FE EK+E  ++EK EL+RKV+E + +        
Sbjct: 514 EDDNWEYIERETKRTSSDFATLIDELFEHEKYERIRKEKEELERKVRETRVREQRREEEE 573

Query: 562 ------------QKINEDEFGSEVSDGMKE--LKKINDK-VSSPLINYEFSQQELLQDID 606
                       QKI+E     E+S  +KE  L+K N + VS+P+      + E   + +
Sbjct: 574 RAELQREQLKLQQKIDE-----EISK-LKEDALEKDNFRSVSAPI-----KENEDEDENE 622

Query: 607 TLLTNRYQLSSYTRPISRLDPGL-------TPVTETLPNNLKEKTALLQDTEKKIIETIR 659
             L NR Q S  TRP+SRLDPG+        P  E +  N     +  Q  ++KI+ETIR
Sbjct: 623 NELRNRRQFSLQTRPVSRLDPGILYSAPAEIPSYERVVVNESGNKSSAQQ-QRKILETIR 681

Query: 660 RSKFLGSLLNV--------RGGLSPGKSELAPIEESPIVSTTPLIYNDRMEPRRISDVEV 711
           RSKFLGS  N+        R  L P K ++  ++E  +              R+IS+V++
Sbjct: 682 RSKFLGSSFNIQQELEFSQRNVLVPTKEQVVDVDEVKLEGGL----------RKISEVKI 731

Query: 712 PHFTRKSKHFTTANNRRSVLSLYA-KDSIKDLNEFLIKEDPDLPPQGSTDNESRSEDPEI 770
           P FTRKS+HF+ +N R SVLS+Y+ K S  +L   L          G+ ++E   + PE+
Sbjct: 732 PQFTRKSRHFSDSNKRLSVLSMYSTKQSYTNLGHIL--------KDGTEESEPAKKTPEL 783

Query: 771 A-ESITDSR 778
             ES  D R
Sbjct: 784 LFESGRDDR 792

 Score = 99.8 bits (247), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 59/129 (45%), Positives = 73/129 (56%), Gaps = 4/129 (3%)

Query: 911  NAPTTVKKPPNSVLLKKFSKG----KILELEIHAKIPEKRLYEGLHKLLEGWKQYGLKNL 966
            N   T +K  N    +KFS      K  + EI+  I  ++LY GL KLLEGW QYGLK++
Sbjct: 894  NKVGTTEKKRNVSFFRKFSNNSATIKGYDHEIYVNIGSRQLYTGLRKLLEGWTQYGLKDV 953

Query: 967  VFNITNMIITGKLVNDSILFLRSTLFEIMVLPNGDGRSLIKFNXXXXXXXXXXXXXXEIQ 1026
              + T M ITGKL ND+IL LRSTLFE++V P G   SLI F               EI+
Sbjct: 954  RSDNTAMKITGKLANDNILSLRSTLFELLVEPKGSKYSLIGFTKVQGSSKVVRRLFTEIE 1013

Query: 1027 IILQKEGVL 1035
             +L KEGVL
Sbjct: 1014 KVLNKEGVL 1022

>KNAG0F00290 Chr6 (31750..35127) [3378 bp, 1125 aa] {ON} Anc_1.52
           YDR507C
          Length = 1125

 Score =  555 bits (1429), Expect = e-179,   Method: Compositional matrix adjust.
 Identities = 261/353 (73%), Positives = 304/353 (86%), Gaps = 8/353 (2%)

Query: 18  IGPWKLGETLGFGSTGKVQLAQHERTGHRTAVKVISKSIFNNNGNHSNDDS----VLPYN 73
           IG WK+GETLG GSTGKVQLA ++ TG++ A+KVISK+IF ++   S  D+     LPY 
Sbjct: 15  IGSWKMGETLGLGSTGKVQLAYNKTTGNQAAIKVISKTIFQDSNVTSMVDNTTPDALPYG 74

Query: 74  IEREIVIMKLLSHPNVLSLYDVWETNNNLYLILEYAEKGELFNLLVDHGPLPEREAINCF 133
           IEREIVIMKLL+H NVL LYDVWETN+NLY++LEYAEKGELFNLLV+ GPLPE EAI  F
Sbjct: 75  IEREIVIMKLLNHANVLRLYDVWETNSNLYMVLEYAEKGELFNLLVERGPLPENEAIRFF 134

Query: 134 RQIIIGISYCHALGIVHRDLKPENLLLDSFYNIKIADFGMAALQTDADLLETSCGSPHYA 193
           RQIIIGISYCHALGIVHRDLKPENLLLD+ YNIKIADFGMAAL+T+  LLETSCGSPHYA
Sbjct: 135 RQIIIGISYCHALGIVHRDLKPENLLLDTKYNIKIADFGMAALETEDKLLETSCGSPHYA 194

Query: 194 APEIVSGLPYEGFASDVWSCGVILFALLTGRLPFDEENGNVRDLLLKVQKGQFEMPNDTE 253
           APEIVSG+PY GFASDVWSCGVIL+ALLTGRLPFDEE+GN+R+LLLKVQ GQFEMP D E
Sbjct: 195 APEIVSGIPYHGFASDVWSCGVILYALLTGRLPFDEEDGNIRNLLLKVQAGQFEMPEDDE 254

Query: 254 ISRDAQDLIGKILVVDPRQRIKIRDILSHPLLKKYQTIKDSKSIKDLPRENTYLYPLADS 313
           IS++AQ+LI KILVV+P +RI  RDIL HPLL+KY +IKDSKSI++LPRE+TYL+PLA++
Sbjct: 255 ISKEAQNLISKILVVNPAERITARDILKHPLLQKYPSIKDSKSIRNLPREDTYLHPLAET 314

Query: 314 NNHTSASIDDSILQNLVVLWHGRHADDIVSKLKENGTNKEKILYALLYRFKLD 366
           N    ++ID++ILQNLVVLWHGR   +I  KLKE+G N EK LYA+L RFKLD
Sbjct: 315 N----SAIDENILQNLVVLWHGRDPAEIRVKLKEHGANAEKTLYAMLNRFKLD 363

 Score =  190 bits (483), Expect = 1e-48,   Method: Compositional matrix adjust.
 Identities = 192/615 (31%), Positives = 288/615 (46%), Gaps = 109/615 (17%)

Query: 506  DDDDWEYIEKDAKRTSSNFATLIDEIFEPEKFELAKREKAELQRKVQEAK---------- 555
            +DD+WEY+E++ KRTSSNFATLIDEIFE EK+E  ++EK EL RKV+EAK          
Sbjct: 531  EDDEWEYLEQETKRTSSNFATLIDEIFEHEKYEQIRKEKEELARKVREAKEREEAERKQK 590

Query: 556  ---------------RQSVNAQKINEDE---FGSEVSDGMKELKKINDKVSSPL----IN 593
                            ++ + Q+I E+E      E+     E K  +  VS PL      
Sbjct: 591  ELQEREKQRERERKENETNDRQRIMEEEIENLKKELDMMSHEGKTESRSVSEPLNKKQGG 650

Query: 594  YEFSQQELLQDIDTLLTNRYQLSSYTRPISRLDPGL----------TPVTETLPNNLKEK 643
             E   +ELL+  +  L         TRP SRLDPGL           P  +     +  K
Sbjct: 651  VEIEVKELLRQRNAALQ--------TRPKSRLDPGLFFDSAESDTRNPSLQVFEGEVDNK 702

Query: 644  TALLQDTEKKIIETIRRSKFLGSLLNVRGGL-----------SPGKSELAP--IEESPI- 689
                  TEK I+ETIRRSKFLGS  ++   L           +PG+   AP  +E S + 
Sbjct: 703  L----KTEKAILETIRRSKFLGSSFDISKELKSASARSDYSRAPGRVITAPSNLERSDVL 758

Query: 690  ----VSTTPL-IYNDRMEPRRISDVEVPHFTRKSKHFTTANNRRSVLSLYA-KDSIKDLN 743
                ++T PL I++D+ E R+ISD++VP FTRKS++F+ ++ R SVLS+Y+ + S K+L+
Sbjct: 759  PKNAIATAPLRIHSDQPEVRKISDIKVPQFTRKSRNFSESSKRLSVLSMYSTRQSFKNLS 818

Query: 744  EFLIKEDPDLPPQGSTDNESRSEDPEIAESITDSRNIQYDEDDSKDGDNVNNDNILSDFP 803
            + +     +   + +   E+R +   IA   +  ++    E  +++ +N NN +      
Sbjct: 819  DMM-----NFESENTDAAENRGQ---IATPNSAGQSEFLFESVNEEAENTNNTSTDGKLY 870

Query: 804  QGVGISQEYDMKDKNPNQSPISKSA--EPTLVVKLPSLSSFQGKNASGLGLYQREPSKVT 861
            +     +    K    N S     A  E  +  KLP L     + A GLG+YQ +P +V 
Sbjct: 871  EVSESPESSSKKGLRVNLSDRYNKANSEADMENKLPILPPLDPEIA-GLGIYQDQPEEVN 929

Query: 862  LP---------SLTSNNSSVGE---------NIEDGAEKG-TESEKIAAXXXXXXXXXXX 902
                       S  + + S GE         NI    +   TE +K+ A           
Sbjct: 930  AKPQEKKSKSKSAETGDISEGEPEVSDLKAENIRKAPQPPITEKKKLDAKKQRNDERTKA 989

Query: 903  XXXXXXTVNAPTTVKKPPNSVL--LKKFSKGKILELEIHAKIPEKRLYEGLHKLLEGWKQ 960
                  + N    +    N+    +KK   G   E  IH  +   ++Y+GL+ LL GW  
Sbjct: 990  SKENTFSNNFLRKLSGQSNTTTQSVKKTKLG--AEDGIHTTVSATQMYQGLYNLLRGWGS 1047

Query: 961  YGLKNLVFNITNMIITGKLVNDSILFLRSTLFEIMVLPNGDGRSLIKFNXXXXXXXXXXX 1020
            YGLK++  N  NM ITGKL +++IL LRST+FEI+++  G G S +              
Sbjct: 1048 YGLKSIKGNSENMTITGKLASENILSLRSTIFEIIIIREGKG-SKVDIKKKSGSTKAVNR 1106

Query: 1021 XXXEIQIILQKEGVL 1035
               E++ +L KEGV+
Sbjct: 1107 LAGEVKNVLVKEGVM 1121

>TDEL0C06490 Chr3 complement(1191461..1194922) [3462 bp, 1153 aa]
           {ON} Anc_1.52 YDR507C
          Length = 1153

 Score =  550 bits (1418), Expect = e-177,   Method: Compositional matrix adjust.
 Identities = 261/357 (73%), Positives = 301/357 (84%), Gaps = 11/357 (3%)

Query: 18  IGPWKLGETLGFGSTGKVQLAQHERTGHRTAVKVISKSIFNNNGNHSNDDSV-------L 70
           IGPWKLGETLG GSTGKVQLA  E T  + A+KVISK+IFN  G+   D SV       L
Sbjct: 17  IGPWKLGETLGLGSTGKVQLAYDESTNQQAAIKVISKAIFNVKGS-VKDSSVAASTPDSL 75

Query: 71  PYNIEREIVIMKLLSHPNVLSLYDVWETNNNLYLILEYAEKGELFNLLVDHGPLPEREAI 130
           PY IEREI+IMKLL+HPNVL LYDVWETN+NLY++LEYA+KGELFNLLV+ GPLPE+EAI
Sbjct: 76  PYGIEREIIIMKLLNHPNVLRLYDVWETNSNLYMVLEYAQKGELFNLLVERGPLPEKEAI 135

Query: 131 NCFRQIIIGISYCHALGIVHRDLKPENLLLDSFYNIKIADFGMAALQTDADLLETSCGSP 190
             FRQI+IGISYCHALGIVHRDLKPENLLLD  +NIKIADFGMAAL+T+  LLETSCGSP
Sbjct: 136 RFFRQIVIGISYCHALGIVHRDLKPENLLLDHKFNIKIADFGMAALETEDKLLETSCGSP 195

Query: 191 HYAAPEIVSGLPYEGFASDVWSCGVILFALLTGRLPFDEENGNVRDLLLKVQKGQFEMPN 250
           HYAAPEIVSG+PY GFASDVWSCGVILFALLTGRLPFD+E+GN+R+LLL+VQ G++EMP 
Sbjct: 196 HYAAPEIVSGIPYHGFASDVWSCGVILFALLTGRLPFDDEDGNIRNLLLQVQSGRYEMPG 255

Query: 251 DTEISRDAQDLIGKILVVDPRQRIKIRDILSHPLLKKYQTIKDSKSIKDLPRENTYLYPL 310
           D EIS DAQDLI +IL VDP QRIK RDIL HPLL+KY +I DSKSI++LPRE+TYL+PL
Sbjct: 256 DDEISPDAQDLIARILTVDPEQRIKARDILKHPLLQKYPSINDSKSIRNLPREDTYLHPL 315

Query: 311 ADSNNHTSASIDDSILQNLVVLWHGRHADDIVSKLKENGTNKEKILYALLYRFKLDS 367
           ++     SA ID++ILQNLVVLWHGR   +I++KL+E G N EK LYALL RFK D+
Sbjct: 316 SEGE---SAEIDENILQNLVVLWHGREQLEIINKLREPGANAEKTLYALLDRFKSDT 369

 Score =  225 bits (574), Expect = 7e-60,   Method: Compositional matrix adjust.
 Identities = 203/620 (32%), Positives = 298/620 (48%), Gaps = 102/620 (16%)

Query: 506  DDDDWEYIEKDAKRTSSNFATLIDEIFEPEKFELAKREKAELQRKV-------------- 551
            +DDDWEYIEK+ KRTSS+FATL D+IFE EKFE  +REK EL+RKV              
Sbjct: 545  EDDDWEYIEKETKRTSSDFATLCDQIFEHEKFEQIRREKEELERKVRETKEREERERREK 604

Query: 552  -----------QEAKRQSVNAQKINEDE---FGSEVSDGMK---------ELKKINDK-V 587
                       Q+ +R+ +  Q+  ++E    G E+  GM          E   +N + V
Sbjct: 605  EIEEKRKIQEKQDLERRQLEIQRQMDEEVANLGKELQGGMNADQDADEGDEHGAVNGRSV 664

Query: 588  SSPLINYEFSQQELLQ-DIDTLLTNRYQLSSYTRPISRLDPGL--TPVTETLPNNLKEKT 644
            S PL          LQ +ID LL  R   S  TRP+SRLDPG+  +  +E       E  
Sbjct: 665  SEPLQKKSADPMADLQANIDDLLRQRT-FSLQTRPVSRLDPGVFSSDSSEKDQYTGSEDR 723

Query: 645  ALLQDTEKKIIETIRRSKFLGSLLNVRGGLSPG------KSELAPIEESPIVSTT----- 693
            A L + +K I+ETIRRSKFLGS  ++   L         K   +      I+STT     
Sbjct: 724  AKL-NNDKIILETIRRSKFLGSSFDINKELKRAADNEAKKQRQSKATSDRIISTTNDEYE 782

Query: 694  ------------PLI-YNDRMEPRRISDVEVPHFTRKSKHFTTANNRRSVLSLYA-KDSI 739
                        PL  +N + EPR+ISD++VP FTRKS+ F  +N R SVLS+Y+ K S 
Sbjct: 783  TQILPKNATASAPLKDHNHQAEPRKISDIKVPQFTRKSRQFGDSNKRLSVLSMYSSKQSY 842

Query: 740  KDLNEFLIKEDPDLPPQGSTDNESRSEDPEIAESITDSRNIQYDEDDSKDGDNVNNDNIL 799
             +L + L +E  +      + N+    +PE         N+Q  ED    GD+ ++D  L
Sbjct: 843  TNLADLLNEEASNAKGNRDSPNDQSGHEPEFL-----FENVQ--EDGEVTGDS-SHDGRL 894

Query: 800  SDFPQGVGISQE---YDMKDKNPNQSPISKSAEPTLVVKLPSLSSFQGKNASGLGLYQR- 855
             + P+   +++E    +  D+    +   ++AE    V+LP+L    GK A GLG+YQ  
Sbjct: 895  YEVPEDSNMTKEKLKLNFADRFKTSNGEDRTAEDK-NVRLPTLPPLDGKEAKGLGIYQSS 953

Query: 856  -----EPSKVTLPSLTSNN----SSVGENI---EDGAEKGTESEKIAAXXXXXXXXXXXX 903
                 EP++  + S+  N+    S   E +   ED A+   E ++ A             
Sbjct: 954  SESLPEPAQHNVKSMIQNDENQPSETAEVLSIKEDNAQ--VERQQEAPLNASIPKHRTDG 1011

Query: 904  XXXXXTVNAPTTVKKPPNSVLLKKFSKGK------ILELEIHAKIPEKRLYEGLHKLLEG 957
                  + +    +K  N+   +KFSK          + E++A +  K+L+ GL  LL+G
Sbjct: 1012 AQKSERMPSKEGSEKKRNTSFFRKFSKSSNEKTNGEFDAELYASVAAKQLFNGLQNLLQG 1071

Query: 958  WKQYGLKNLVFNITNMIITGKLVNDSILFLRSTLFEIMVLPNGDGRSLIKFNXXXXXXXX 1017
            WK+YGLK +      + +TGKL +++IL LRSTLFE++V   G G S++ F         
Sbjct: 1072 WKKYGLKGVKSMPDKLTLTGKLSSENILSLRSTLFEMVVWSRGKG-SIVGFRKKSGSTKT 1130

Query: 1018 XXXXXXEIQIILQKEGVLDK 1037
                  EI+ +L KE VL K
Sbjct: 1131 LKRLVSEIEKVLLKERVLTK 1150

>TPHA0E03640 Chr5 complement(769962..773375) [3414 bp, 1137 aa] {ON}
           Anc_1.52 YDR507C
          Length = 1137

 Score =  550 bits (1416), Expect = e-177,   Method: Compositional matrix adjust.
 Identities = 258/370 (69%), Positives = 300/370 (81%), Gaps = 19/370 (5%)

Query: 18  IGPWKLGETLGFGSTGKVQLAQHERTGHRTAVKVISKSIFN------------------N 59
           IGPWKLGETLGFGSTGKVQLA +E+T  + A+K+ISKS+F+                  N
Sbjct: 16  IGPWKLGETLGFGSTGKVQLATNEQTNQQAAIKIISKSVFDHLVNSNNNNNSALAASDVN 75

Query: 60  NGNHSNDDSVLPYNIEREIVIMKLLSHPNVLSLYDVWETNNNLYLILEYAEKGELFNLLV 119
           NG+  ++   LPY IEREI+IMKLL+H NVL LYDVWETNNNLY++LEYAEKGELFNLLV
Sbjct: 76  NGSVQHNQEALPYGIEREIIIMKLLNHTNVLRLYDVWETNNNLYMVLEYAEKGELFNLLV 135

Query: 120 DHGPLPEREAINCFRQIIIGISYCHALGIVHRDLKPENLLLDSFYNIKIADFGMAALQTD 179
           + GPL E EA+  FRQIIIG+SYCHALGIVHRDLKPEN+LLD   NIKIADFGMAAL+T+
Sbjct: 136 EKGPLAENEAVRFFRQIIIGMSYCHALGIVHRDLKPENILLDHKSNIKIADFGMAALETE 195

Query: 180 ADLLETSCGSPHYAAPEIVSGLPYEGFASDVWSCGVILFALLTGRLPFDEENGNVRDLLL 239
             LLETSCGSPHYAAPEIVSGLPY G  +D+WSCGVILFALLTGRLPFDEE+GN+R+LLL
Sbjct: 196 DKLLETSCGSPHYAAPEIVSGLPYNGLETDIWSCGVILFALLTGRLPFDEEDGNIRNLLL 255

Query: 240 KVQKGQFEMPNDTEISRDAQDLIGKILVVDPRQRIKIRDILSHPLLKKYQTIKDSKSIKD 299
           KVQKG+FEMP   E+S +AQDLIGKIL V+P+QRIK R+IL HPLL+KY  IKDSK+I+D
Sbjct: 256 KVQKGEFEMPGSDELSLEAQDLIGKILTVNPKQRIKTREILKHPLLQKYPNIKDSKTIRD 315

Query: 300 LPRENTYLYPLADSNNHTSASIDDSILQNLVVLWHGRHADDIVSKLKENGTNKEKILYAL 359
           LPRE+TYL PLAD NN     ID+SILQNL VLWHG+  ++I+ KLKE G N EK LY L
Sbjct: 316 LPREDTYLNPLAD-NNGVDTEIDESILQNLTVLWHGKDKNEIIKKLKEPGANAEKTLYVL 374

Query: 360 LYRFKLDSVR 369
           L+RFK D+ R
Sbjct: 375 LHRFKEDTER 384

 Score =  194 bits (494), Expect = 5e-50,   Method: Compositional matrix adjust.
 Identities = 195/617 (31%), Positives = 288/617 (46%), Gaps = 125/617 (20%)

Query: 506  DDDDWEYIEKDAKRTSSNFATLIDEIFEPEKFELAKREKAELQRKVQEAK---------- 555
            +DDDWE+IEK+ KR SS+FATLIDEIFE EKFE  ++EK EL+RKV EAK          
Sbjct: 561  EDDDWEFIEKETKRVSSDFATLIDEIFEHEKFEKIRKEKEELERKVIEAKQKEERERKEA 620

Query: 556  ----------RQSVNAQKIN--EDEFGSEVSDGMKELKK----INDKVSSPLINYEFSQQ 599
                      R+     ++N  E++  +++ +  + LK     +ND+     IN   S  
Sbjct: 621  EAAAKEEARVRREKELARMNKEEEQLQNDIDEEARLLKDEFNFVNDETQENPINSR-SVS 679

Query: 600  ELLQDIDTLLTNRYQLSSYTRPISRLDPGLT-PVTETLPNNLKEKTALLQDTEKKIIETI 658
            E +++  T    +   S  TRPISRLDPGL       + NN      L  + +K I+ETI
Sbjct: 680  EPVKNGGTDEKGQRNFSLQTRPISRLDPGLMFSKLGDVDNNSSVDENLTMNNQKTILETI 739

Query: 659  RRSKFLGSLLNVRGGLSPGKSELA-----------PIEESPIVSTTPLIYNDR------- 700
            RRSKFLGS  ++   L+    E              +EE   +++T  + N+        
Sbjct: 740  RRSKFLGSSFDINKELNNANEERKRLRQLQLQKQKELEEKERIASTSYVSNENQVLSKNA 799

Query: 701  ------------MEPRRISDVEVPHFTRKSKHFTTANNRRSVLSLYA-KDSIKDLNEFLI 747
                        +EPR+IS+V+VP FTRKSK+F+ +N R SVLS Y+ K S  +L + +I
Sbjct: 800  IGVVDLKDFSSDVEPRKISEVQVPQFTRKSKYFSESNKRLSVLSFYSSKQSYTNLVD-MI 858

Query: 748  KEDPDLPPQGSTDNESRSEDPEIAESITDSRNIQYDEDDSKDGDNVNNDNILSDFPQGV- 806
            KE+P        ++E  +EDP    +  DS   QYD  + K+   +    +  + P+ V 
Sbjct: 859  KENP-------VEDEDVTEDPGF--NFEDS---QYDYLEEKNEAPLE---VSDEVPKEVD 903

Query: 807  ---------GISQEYDMKDKNPNQSPISKSAEPTLVVKLPSLSSFQGKNASGLGLYQR-- 855
                      +S + +  D+  N +  +K  E +   K P++ S  G    GLGLY +  
Sbjct: 904  DKVQEEEKNSVSMKLNFADRFSNVNSNTKQ-ESSFEDKFPNILSKSG--TEGLGLYSKNE 960

Query: 856  ----EPSKVTLPSLTSNNSS-VGENIEDGAEKGTESEKIAAXXXXXXXXXXXXXXXXXTV 910
                +P K  +P     NSS V E   +     T +E                     T 
Sbjct: 961  KTEPKPVKSMIPEEDKVNSSPVVEAPLNKVVNKTRAEN------------------KSTS 1002

Query: 911  NAPTTVKKPPN-SVLLKKFSKGK---------ILELEIHAKIPEKRLYEGLHKLLEGWKQ 960
              P+  +K  N S  L+K S GK           E+ +++ + E +L+ GL  LL+GW  
Sbjct: 1003 KGPSGSQKVSNTSSFLRKIS-GKSSNSTVAKGAFEVNLYSSVTETQLFNGLQNLLKGWTN 1061

Query: 961  YGLKNLVFNITNMIITGKLVNDSILFLRSTLFEIMVLPNGDGRSLIKFNXXXXXXXXXXX 1020
            YGLK++  +    +I GKL ND+IL LRST+ E+ V       S+I              
Sbjct: 1062 YGLKDVKVDKQKKMIVGKLSNDNILSLRSTIVELCVFTESKF-SVIGIRKKSGSSKTMRR 1120

Query: 1021 XXXEIQIILQKEGVLDK 1037
               EI+ +L KEGVL K
Sbjct: 1121 LASEIEKVLSKEGVLQK 1137

>TBLA0A07150 Chr1 (1776160..1780335) [4176 bp, 1391 aa] {ON}
           Anc_1.52 YDR507C
          Length = 1391

 Score =  556 bits (1434), Expect = e-177,   Method: Compositional matrix adjust.
 Identities = 258/356 (72%), Positives = 301/356 (84%), Gaps = 6/356 (1%)

Query: 17  TIGPWKLGETLGFGSTGKVQLAQHERTGHRTAVKVISKSIFNNNGNHSNDDSVL-----P 71
           T+GPWKLGETLG GSTGKVQLA +  TG + A+KVISK++FNN+  +++D ++L     P
Sbjct: 16  TVGPWKLGETLGLGSTGKVQLAYNSSTGQQAAIKVISKAVFNNDNANASDSALLTPDSLP 75

Query: 72  YNIEREIVIMKLLSHPNVLSLYDVWETNNNLYLILEYAEKGELFNLLVDHGPLPEREAIN 131
           Y IEREI+IMKLL+HPNVL LYDVWET++NLY++LEYAEKGELFNLLV+ GPLPE EAI 
Sbjct: 76  YGIEREIIIMKLLNHPNVLRLYDVWETDSNLYMVLEYAEKGELFNLLVERGPLPENEAIR 135

Query: 132 CFRQIIIGISYCHALGIVHRDLKPENLLLDSFYNIKIADFGMAALQTDADLLETSCGSPH 191
            FRQIIIGISYCHALGIVHRDLKPENLLLD  YNIKIADFGMAAL+T+  LLETSCGSPH
Sbjct: 136 FFRQIIIGISYCHALGIVHRDLKPENLLLDHKYNIKIADFGMAALETEDKLLETSCGSPH 195

Query: 192 YAAPEIVSGLPYEGFASDVWSCGVILFALLTGRLPFDEENGNVRDLLLKVQKGQFEMPND 251
           YAAPEI+SGLPY G  +DVWSCG+ILFALLTGRLPFDEE+GN+R+LLLKVQ GQFEMP +
Sbjct: 196 YAAPEIISGLPYHGLETDVWSCGIILFALLTGRLPFDEEDGNIRNLLLKVQSGQFEMPGN 255

Query: 252 TEISRDAQDLIGKILVVDPRQRIKIRDILSHPLLKKYQTIKDSKSIKDLPRENTYLYPLA 311
            EISR+AQDLI KIL VDP++RIK R+IL HPL++KY +IKDSK+I++LPRE+TYL PL+
Sbjct: 256 DEISREAQDLISKILTVDPKKRIKTREILKHPLVQKYPSIKDSKTIRNLPREDTYLNPLS 315

Query: 312 DSNNHTSASIDDSILQNLVVLWHGRHADDIVSKLKENGTNKEKILYALLYRFKLDS 367
           D N      ID  ILQNLVVLWHGR + +I  KLKE G N EK LYALL RFK D+
Sbjct: 316 DDNGDV-CEIDPKILQNLVVLWHGRDSKEITKKLKEPGANAEKTLYALLDRFKNDT 370

 Score =  122 bits (305), Expect = 3e-27,   Method: Compositional matrix adjust.
 Identities = 140/493 (28%), Positives = 218/493 (44%), Gaps = 152/493 (30%)

Query: 506  DDDDWEYIEKDAKRTSSNFATLIDEIFEPEKFELAKREKAELQRKVQ------------- 552
            +DDDWE+IEK+ KR SSNFATLID IFE EK+E  ++EK EL+RKV+             
Sbjct: 638  EDDDWEFIEKETKRVSSNFATLIDNIFEHEKYEQIRKEKDELERKVRENKKREEEERLVR 697

Query: 553  ---------EAKRQSVNAQKINEDEFGS-----EVSDGMKELKKINDKVSSPLINYE--- 595
                     E +++ +  QK  E +  +     + ++G +E    NDK+ +   + E   
Sbjct: 698  EAIEKEKQIELEKERLQLQKEMEGDIDNAKETVQTTEGKREAH--NDKIKTETDDEERDI 755

Query: 596  ------------FSQQELLQDIDTLLTNRYQLSSYTRPISRLDPGL-----TPVTETLPN 638
                          + E  +D     + +   S  TRP+SRLDPGL     T  +   P+
Sbjct: 756  IVDIQPRSVSAPLEKTEKSRDSPFDYSKQRNFSLRTRPVSRLDPGLMYSSGTGSSAYNPS 815

Query: 639  NLKE---KTALLQ--DTEKKIIETIRRSKFLGSLLNVRGGLSPGKSELAPIEE------- 686
            +  E    T+ L   DT+K I+ETIRRSKFLGS  ++       K EL  +EE       
Sbjct: 816  HSTEDLHSTSSLNRIDTQKVILETIRRSKFLGSSFDL-------KKELEMVEELESNRIK 868

Query: 687  ----------------------------SPIVSTTPLIYNDRME---------------- 702
                                          IVSTT    NDR E                
Sbjct: 869  QQAFQDSHLEEMNDVTEDLSQHNVDTSNDRIVSTT----NDRYETEILPKSHAGKTQTIG 924

Query: 703  -------PRRISDVEVPHFTRKSKHFTTANNRRSVLSLY-AKDSIKDLNEFLIKEDPDLP 754
                   PR +S+++VP FTRKSK F+ +N R SVLSLY +++S  +L + L ++  ++ 
Sbjct: 925  LNDSSVQPRTLSEIKVPQFTRKSKFFSESNKRLSVLSLYSSRESFTNLVDMLKEDGINVE 984

Query: 755  PQGSTDNESRSEDPEI---AESI-TDSRNIQYDE---DDSKDGDNVNNDNILSDF----- 802
            P   +   ++S++PE    + S+ T SR+   ++   ++ ++ + + ++N+   F     
Sbjct: 985  PTERSPT-TKSQEPEFLFESPSVDTYSRDSSTEDKPINEKENSEPIQSNNLRLSFHDRFN 1043

Query: 803  --------------PQGVGISQEYDMKDKNPNQSPISKSAEPTLVVKLPSLSSFQGKNAS 848
                          P G  I  E    D N       K+ + + +VKLP+L     K   
Sbjct: 1044 RQLSTEDTEKTKNSPSG-HIKDEPKKDDDNGVDLSTPKAKDESNLVKLPALPPLTTKKTD 1102

Query: 849  GLGLYQREPSKVT 861
            GLG+YQ+   + +
Sbjct: 1103 GLGIYQKSKQRTS 1115

 Score = 68.6 bits (166), Expect = 7e-11,   Method: Compositional matrix adjust.
 Identities = 30/101 (29%), Positives = 58/101 (57%)

Query: 935  ELEIHAKIPEKRLYEGLHKLLEGWKQYGLKNLVFNITNMIITGKLVNDSILFLRSTLFEI 994
            + ++ A +   ++++GL  L  GW +YGLKN+  +  ++  TGK+ +++IL  +ST+FE+
Sbjct: 1289 DFQLKANVAAPQMFKGLDTLFRGWSKYGLKNIKSSPESLRFTGKVSSENILSFKSTVFEL 1348

Query: 995  MVLPNGDGRSLIKFNXXXXXXXXXXXXXXEIQIILQKEGVL 1035
             ++ N     L++F               E++ +L+KEGVL
Sbjct: 1349 EIISNSVKTCLLRFKKTSGSSKSVRRLVNEVENVLRKEGVL 1389

>KLTH0F01672g Chr6 (127277..130771) [3495 bp, 1164 aa] {ON} similar
           to uniprot|Q12263 Saccharomyces cerevisiae YDR507C
          Length = 1164

 Score =  548 bits (1411), Expect = e-176,   Method: Compositional matrix adjust.
 Identities = 259/355 (72%), Positives = 293/355 (82%), Gaps = 9/355 (2%)

Query: 18  IGPWKLGETLGFGSTGKVQLAQHERTGHRTAVKVISKSIFNNNGNHS-----NDDSVLPY 72
           IGPWKLG TLG GSTGKV +AQHE TG + AVK++SKSIF N  N S     ND  VLPY
Sbjct: 23  IGPWKLGSTLGAGSTGKVVMAQHESTGQQAAVKIVSKSIFGNQSNSSTIVGSNDPDVLPY 82

Query: 73  NIEREIVIMKLLSHPNVLSLYDVWETNNNLYLILEYAEKGELFNLLVDHGPLPEREAINC 132
            IEREI+IMKLL+HPNVL LYDVWETN++LY++LEY EKGELFNLLVD GPLPE EA+  
Sbjct: 83  GIEREIIIMKLLNHPNVLRLYDVWETNSSLYMVLEYVEKGELFNLLVDRGPLPENEAVRF 142

Query: 133 FRQIIIGISYCHALGIVHRDLKPENLLLDSFYNIKIADFGMAALQTDADLLETSCGSPHY 192
           FRQIIIGISYCHALGIVHRDLKPENLLLD  +NIKIADFGMAAL++   LLETSCGSPHY
Sbjct: 143 FRQIIIGISYCHALGIVHRDLKPENLLLDHKFNIKIADFGMAALESKDKLLETSCGSPHY 202

Query: 193 AAPEIVSGLPYEGFASDVWSCGVILFALLTGRLPFDEENGNVRDLLLKVQKGQFEMPNDT 252
           AAPEIVSGLPY GF SDVWSCG+ILFALLTGRLPFDEE+GN+R+LLLKVQ G+FEMP+  
Sbjct: 203 AAPEIVSGLPYHGFESDVWSCGIILFALLTGRLPFDEEDGNIRNLLLKVQSGKFEMPDTN 262

Query: 253 EISRDAQDLIGKILVVDPRQRIKIRDILSHPLLKKYQTIKDSKSIKDLPRENTYLYPLAD 312
           EIS +AQDLI KIL VDP  RIK R IL HPLL+KY +IKDSKSI++LPRE+TYL PL  
Sbjct: 263 EISGEAQDLIAKILTVDPAARIKSRGILKHPLLQKYPSIKDSKSIRNLPREDTYLNPL-- 320

Query: 313 SNNHTSASIDDSILQNLVVLWHGRHADDIVSKLKENGTNKEKILYALLYRFKLDS 367
             +    +IDD+I+ NLVVLWHGR  ++I +KLKE G N EK  YALL+RFK DS
Sbjct: 321 --DSVDGTIDDTIIGNLVVLWHGRDRNEITNKLKEPGANLEKTFYALLFRFKHDS 373

 Score =  174 bits (440), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 187/634 (29%), Positives = 283/634 (44%), Gaps = 120/634 (18%)

Query: 506  DDDDWEYIEKDAKRTSSNFATLIDEIFEPEKFE--------------------------- 538
            +D+DWEYIEK+ KRTS++FATL DEIFE EK+E                           
Sbjct: 543  EDNDWEYIEKETKRTSADFATLCDEIFEHEKYEQIRREKEELERRVREAKEQEERERRQR 602

Query: 539  -----------LAKREKAELQRKVQEAKRQSVNAQKINEDEFGSEVSDGMKELKKINDKV 587
                       LA++ + E +R  ++ + Q    +++   + G E S G+   K  N  V
Sbjct: 603  EEEERRQREEELARQREFEEERYHRQREVQENIDREMALLKEGYETSSGVDPNK--NRSV 660

Query: 588  SSPL-----INYEFSQQELLQDIDTLLTNRYQLSSYTRPISRLDPGLTPVTETLPNNLKE 642
            S+P+     ++   S   L  DI  LL NR   S  TRP SRLDPG+  + E   +++K+
Sbjct: 661  SAPVESVLKVDKRSSMDALDGDIMDLL-NRRTFSLETRPKSRLDPGIYTLEEVPNSDIKD 719

Query: 643  KTALLQDTEKKIIETIRRSKFLGSLLNVRGGLSPG---KSELAPI-----EESPIVSTTP 694
                L+ TEK I+ETIRRSKFLGS  ++   L+     K E A       +E  +VS   
Sbjct: 720  GGRDLK-TEKTILETIRRSKFLGSSFDINKELARERRLKEERAAALKQRKKEDRVVSNAT 778

Query: 695  LIYNDR---------------------MEPRRISDVEVPHFTRKSKHFTTANNRRSVLSL 733
              Y++                       +PR+IS+V+VP FTR+S+HFT +N R SVLS+
Sbjct: 779  GNYSENGYEPQTLPKNAAATKISNDAGSDPRKISEVQVPQFTRRSRHFTASNKRLSVLSM 838

Query: 734  YA-KDSIKDLNEFLIKEDPDLPPQGSTDNESRSEDPEIAESITDSRNIQYDEDDS--KDG 790
            Y+ K S  +L + L         +G TD +S +  P     +       ++  D   K+ 
Sbjct: 839  YSTKASFTNLADHL---------RGKTDLQSINGSPPSTSRMEPETEFMFESVDGEGKET 889

Query: 791  DNVNNDNILSDF-----PQGVGISQ-EYDMKDK-NPNQSPISKSAEPTLVVKLPSLSSF- 842
             + + D+ L +      P+G   S    +  D+ N   SP  +S E    +KLPSL    
Sbjct: 890  ADTSADSRLYEVAEGNDPKGAARSAVRLNFADRFNKPTSPPPQSVEDPNGIKLPSLPPLD 949

Query: 843  --QGKNASGLGLYQ--REPSKVTLPSLTSNNSSVGENIEDGAEKGTESEK---------I 889
              +    +GLGLYQ   + S+  +     +   V    ++ AE   E +K          
Sbjct: 950  KAKSDGVNGLGLYQPASDSSETEIHHQPKSMIPVDAEQKEAAEAKPEEQKQVPPKDVESA 1009

Query: 890  AAXXXXXXXXXXXXXXXXXTVNAPTTVKKPPNSVLLKKFSKGKI--------LELEIHAK 941
             A                    AP  VKK  N    ++FS GK          + +    
Sbjct: 1010 PAPLNKVMKKNTEAEKNQPNQPAPNAVKKN-NKSFFRRFS-GKSDDEKRPGEYDFKFDTV 1067

Query: 942  IPEKRLYEGLHKLLEGWKQYGLKNLVFNITNMIITGKLVNDSILFLRSTLFEIMVLPNGD 1001
            I   +++  L KLL  WK YGLK++V + +   I GK+ +D++L LRSTLFEI ++  G+
Sbjct: 1068 IEGTQMFNALSKLLAAWKDYGLKDVVASPSQKKIKGKMSSDNMLSLRSTLFEISIVSKGE 1127

Query: 1002 GRSLIKFNXXXXXXXXXXXXXXEIQIILQKEGVL 1035
            G S++ F               EI+ IL+ +  L
Sbjct: 1128 G-SIVGFTKKSGSTKTFKKLVKEIEKILESKKAL 1160

>KLLA0C01650g Chr3 (128119..131457) [3339 bp, 1112 aa] {ON} similar
           to uniprot|Q12263 Saccharomyces cerevisiae YDR507C
          Length = 1112

 Score =  541 bits (1394), Expect = e-174,   Method: Compositional matrix adjust.
 Identities = 253/353 (71%), Positives = 294/353 (83%), Gaps = 5/353 (1%)

Query: 17  TIGPWKLGETLGFGSTGKVQLAQHERTGHRTAVKVISKSIFNNNGNH---SNDDSVLPYN 73
           TIGPWKLG TLG GSTGKV +A +E  G + AVK+ISKSIFN  G+     ND  VLPY 
Sbjct: 13  TIGPWKLGSTLGVGSTGKVVMAYNETKGQQAAVKIISKSIFNAQGSTMIGGNDPDVLPYG 72

Query: 74  IEREIVIMKLLSHPNVLSLYDVWETNNNLYLILEYAEKGELFNLLVDHGPLPEREAINCF 133
           IEREI+IMKLL+HPNVL LYDVWET+ +LY++LEY EKGELFNLLV+ GPLPE EA+  F
Sbjct: 73  IEREIIIMKLLNHPNVLRLYDVWETSKDLYMVLEYVEKGELFNLLVERGPLPENEAVRFF 132

Query: 134 RQIIIGISYCHALGIVHRDLKPENLLLDSFYNIKIADFGMAALQTDADLLETSCGSPHYA 193
           RQIIIGISYCHALGIVHRDLKPENLLLD  +N+K+ADFGMAAL++   LLETSCGSPHYA
Sbjct: 133 RQIIIGISYCHALGIVHRDLKPENLLLDHKFNVKLADFGMAALESKDKLLETSCGSPHYA 192

Query: 194 APEIVSGLPYEGFASDVWSCGVILFALLTGRLPFDEENGNVRDLLLKVQKGQFEMPNDTE 253
           APEIVSGLPY GF SDVWSCGVIL+ALLTGRLPFDEE+GN+R+LLLKVQ G+FEMP D E
Sbjct: 193 APEIVSGLPYHGFESDVWSCGVILYALLTGRLPFDEEDGNIRNLLLKVQSGKFEMPGDDE 252

Query: 254 ISRDAQDLIGKILVVDPRQRIKIRDILSHPLLKKYQTIKDSKSIKDLPRENTYLYPLADS 313
           IS +AQDLI +IL VDP QRIK R+IL HPLL+KY +IKDSKSI++LPRE+TYL PL+  
Sbjct: 253 ISSEAQDLIARILTVDPEQRIKTREILKHPLLRKYPSIKDSKSIRNLPREDTYLNPLSLE 312

Query: 314 NNHTSASIDDSILQNLVVLWHGRHADDIVSKLKENGTNKEKILYALLYRFKLD 366
             +    +D++ILQNLVVLWHGR+ +DI++KL E G N EK  YALL+RFK D
Sbjct: 313 GGN--QCVDETILQNLVVLWHGRNKEDIITKLMEPGANLEKTFYALLHRFKHD 363

 Score =  185 bits (469), Expect = 5e-47,   Method: Compositional matrix adjust.
 Identities = 177/608 (29%), Positives = 279/608 (45%), Gaps = 103/608 (16%)

Query: 506  DDDDWEYIEKDAKRTSSNFATLIDEIFEPEKFELAKREKAELQRKVQ------------- 552
            +D +WEYIEK+ KRTS +FATL+D+IFE EK+E  ++EK EL+RKV              
Sbjct: 526  EDSEWEYIEKETKRTSQDFATLMDQIFEHEKYEQIRKEKEELERKVNEAREKEEAERKER 585

Query: 553  ------------EAKRQSVNAQKINEDEFGSEVSDGMKELKKIND-----------KVSS 589
                          +R+    QK  +D+   E++    E + +              VS+
Sbjct: 586  ERIEREEQERLEREERKRAERQKELQDQMEDEIAKLKAEYEAVQGSSDERNTANGRSVSA 645

Query: 590  PL-----INYEFSQQELLQDIDTLLTNRYQLSSYTRPISRLDPGLTPVTETLPNNLKEKT 644
            P+      N   S   +  DI+ L+  R   S  TRP+SRLDPG+      L  NL++  
Sbjct: 646  PIETDRTANKRDSTFGIKNDINELINTR-NFSLQTRPVSRLDPGIIAAESRLSANLEDDQ 704

Query: 645  ALLQDTEKKIIETIRRSKFLGSLLNVRGGLSPGKSELAPIEESPIV-------------- 690
            A     EK I+ETIRRSKFLGS  N+   L   + +L   E    +              
Sbjct: 705  A---SKEKTILETIRRSKFLGSQFNLNVELEKAQKDLVSKERQEQLRKYSEQTAKYEVQK 761

Query: 691  -----STTPLIYNDRMEPRRISDVEVPHFTRKSKHFTTANNRRSVLSLYA-KDSIKDLNE 744
                      + +D +EPR++S+V+VP FTR+SKHF+++N R SVLSLY+ K S  +L +
Sbjct: 762  LPKNAKAVATLRDDEVEPRKLSEVKVPQFTRRSKHFSSSNKRFSVLSLYSTKTSFTNLVD 821

Query: 745  FLIKED--PDLPPQGSTDNESRSEDPE-IAESIT--DSRNIQYDEDDSKDGDNVNNDNIL 799
             L  ++    LP Q    +   +++PE + E++   D  +  ++  ++++G   +     
Sbjct: 822  HLKNDNYLEPLPGQPEYSSSKVAQEPEFMFETVEELDENSKLFEVPETEEGKLAS----- 876

Query: 800  SDFPQGVGISQEYDMKDKNPNQSPISKSAEPTLVVKLPSLSSFQGKNASGLGLYQ----- 854
                      +  D + ++ N   I+  + P L V   S        A GLG+YQ     
Sbjct: 877  ------AARKESTDARKQSTNDKDINLPSLPPLQV---SHDVADENGALGLGIYQPNDQT 927

Query: 855  REPSKVTLPSLTSNNSSVGENIEDGAEKGTESEKIAAXXXXXXXXXXXXXXXXXTVNAPT 914
            ++P K  L      + S+ ENI   ++  + +E +                       P 
Sbjct: 928  QKPHKTMLI-----DESIDENISSTSDV-SRTEVVKKPPLNDVVRKNNNERKPLEEITPK 981

Query: 915  TVKKPPNSVLLKKFSKGKILEL-------EIHAKIPEKRLYEGLHKLLEGWKQYGLKNLV 967
               K   S   +KFS+G   +L       ++ A +   ++Y+ L +LL  W  YGLK++ 
Sbjct: 982  VENKRKIS-FFRKFSQGSEKKLGPESFDSQLKAGVSAPKMYKALDRLLNEWTNYGLKHVE 1040

Query: 968  FNITNMIITGKLVNDSILFLRSTLFEIMVLPNGDGRSLIKFNXXXXXXXXXXXXXXEIQI 1027
             +  + +I+GKL +D+IL LRST F+I VLP     S+I+F               EI+ 
Sbjct: 1041 SSPNDFVISGKLTSDNILSLRSTGFKITVLPGEGNGSIIQFTKKSGSTKTFNRLVKEIEK 1100

Query: 1028 ILQKEGVL 1035
            IL+KE VL
Sbjct: 1101 ILEKEKVL 1108

>SAKL0C01716g Chr3 (143880..147527) [3648 bp, 1215 aa] {ON} similar
           to uniprot|Q12263 Saccharomyces cerevisiae YDR507C
          Length = 1215

 Score =  537 bits (1384), Expect = e-172,   Method: Compositional matrix adjust.
 Identities = 255/356 (71%), Positives = 290/356 (81%), Gaps = 11/356 (3%)

Query: 18  IGPWKLGETLGFGSTGKVQLAQHERTGHRTAVKVISKSIF----NNNGN---HSNDDSVL 70
           IGPWKLG  LG GS GKV +AQHE TG + AVK++SKSIF     NN +    SND  +L
Sbjct: 23  IGPWKLGSILGAGSAGKVLMAQHETTGQQAAVKIVSKSIFGAVAQNNSSTIVGSNDPDLL 82

Query: 71  PYNIEREIVIMKLLSHPNVLSLYDVWETNNNLYLILEYAEKGELFNLLVDHGPLPEREAI 130
           PY IEREI+IMKLL+H NVL LYDVWET +NLY++LEY EKGELFNLLV+ GPLPE EA+
Sbjct: 83  PYGIEREIIIMKLLNHTNVLRLYDVWETKSNLYMVLEYVEKGELFNLLVERGPLPENEAV 142

Query: 131 NCFRQIIIGISYCHALGIVHRDLKPENLLLDSFYNIKIADFGMAALQTDADLLETSCGSP 190
             FRQIIIGISYCHALGIVHRDLKPENLLLD  +NIKIADFGMAAL++   LLETSCGSP
Sbjct: 143 RFFRQIIIGISYCHALGIVHRDLKPENLLLDHKFNIKIADFGMAALESKDKLLETSCGSP 202

Query: 191 HYAAPEIVSGLPYEGFASDVWSCGVILFALLTGRLPFDEENGNVRDLLLKVQKGQFEMPN 250
           HYAAPEIVSGLPY GF SDVWSCGVIL+ALLTGRLPFDE+NGN+R LLLKVQ G++EMP 
Sbjct: 203 HYAAPEIVSGLPYHGFESDVWSCGVILYALLTGRLPFDEDNGNIRSLLLKVQSGEYEMPG 262

Query: 251 DTEISRDAQDLIGKILVVDPRQRIKIRDILSHPLLKKYQTIKDSKSIKDLPRENTYLYPL 310
           + EIS +AQDLI KIL VDP +RIK R+IL HPLL+KY +IKDSKSI++LPRE+TYL PL
Sbjct: 263 NDEISSEAQDLIAKILTVDPDRRIKTREILKHPLLQKYPSIKDSKSIRNLPREDTYLNPL 322

Query: 311 ADSNNHTSASIDDSILQNLVVLWHGRHADDIVSKLKENGTNKEKILYALLYRFKLD 366
               +H   SIDD ILQNLVVLWHGR  ++IV+KL E G N EK  Y LL+RFK D
Sbjct: 323 ----DHGDGSIDDGILQNLVVLWHGRDRNEIVAKLNEPGANLEKTFYVLLFRFKHD 374

 Score =  181 bits (458), Expect = 1e-45,   Method: Compositional matrix adjust.
 Identities = 189/656 (28%), Positives = 294/656 (44%), Gaps = 141/656 (21%)

Query: 506  DDDDWEYIEKDAKRTSSNFATLIDEIFEPEKFELAKREKAELQRKVQ------------- 552
            ++DDWEYIEK+ KRTS++FATL D+IFE EK+E  ++EK EL+RKV+             
Sbjct: 571  EEDDWEYIEKETKRTSADFATLCDQIFEHEKYEQIRKEKQELERKVREAKEREERERRKR 630

Query: 553  -----------------------EAKRQSVNAQKINE-----DEFGSEVSDGMKELKKIN 584
                                   +AK+Q +      E      ++G   ++  ++    N
Sbjct: 631  QEEQEEQERKRRAEEERVLRELEDAKQQELQELMAKEVAMLRADYGEPQTEPEEQGASKN 690

Query: 585  DKVSSPLINYEF-------SQQELLQDIDTLLTNRYQLSSYTRPISRLDPGLTPVTETLP 637
              VS+P+ +          S   L  DID LL  R  +S  TRP+SRLDPG+    E L 
Sbjct: 691  RCVSAPIASSSAKDDGKRDSIARLSGDIDDLLKRR-TVSLQTRPVSRLDPGIV-AAENLG 748

Query: 638  NNLKEKTALLQDT----EKKIIETIRRSKFLGSLLNVRGGLSPGKSE----LAPIEESPI 689
            + + E+   + +T    EK I+ETIRRS+FLGS  +++  L   + +    LA   +  I
Sbjct: 749  SVIYEEADGVDETTLRTEKTILETIRRSRFLGSSFDIKKELERAQRKKEEALARQHQQRI 808

Query: 690  VST------TPLIYNDRM-----------------EPRRISDVEVPHFTRKSKHFTTANN 726
            +S+      T   Y  R                  EPR+IS+++VP FTR+S+HFT +N 
Sbjct: 809  LSSATAASATNDAYESRALPKNAAAVDTLNDERNPEPRKISEIKVPQFTRRSRHFTASNK 868

Query: 727  RRSVLSLYA-KDSIKDLNEFLIKEDPDLPP-QGSTDNESR-SEDPE-IAESITDSRNIQY 782
            R SVLS+Y+ K S  +L + L K   DL    GS  + ++ +++PE + ES+        
Sbjct: 869  RLSVLSMYSTKSSFTNLADHL-KGGADLQEVSGSAPSTTKITQEPEFLFESV-------- 919

Query: 783  DEDDSKDGDNVNNDNILSDFPQGVGISQEYDMKDKNPNQSPI--SKSAEPTLVVKLPSLS 840
             E+DS++  +   D+ L + P G   S+         N +    +++ +    VKLP L 
Sbjct: 920  HEEDSEETPDTTADSRLYEVPDGSESSKTSTKAAMRLNFADRFNTRAGDNPADVKLPPLP 979

Query: 841  SFQ---GKNASGLGLYQ--REPSKVTLPSLTSNNSSVGENIED---GAEKGT---ESEKI 889
              +    K  +GLG+YQ    P     P+   +   V   I D   G  K T   ESE +
Sbjct: 980  PLEKNGSKKPNGLGIYQSPERPRADPNPTSMVHEPKVFSMIPDDIAGPAKSTKPAESENV 1039

Query: 890  AAXXXXXXXXXXXXXXXXXTVNAPTTVKKPPNSVL------------------------L 925
                               + +AP   + P N ++                         
Sbjct: 1040 PT----SATKKSEPKNALHSADAPEASQPPLNGMMRKNNDRKPLEDITPAAEKKRNRSFF 1095

Query: 926  KKFS------KGKILELEIHAKIPEKRLYEGLHKLLEGWKQYGLKNLVFNITNMIITGKL 979
            +KFS      K    + +++  +   +++  L KLL GWK YGLK +        ITGKL
Sbjct: 1096 RKFSRSSEEKKSDNFDAKLNTSVEAVQMFNALGKLLGGWKDYGLKEVRVQGPTKTITGKL 1155

Query: 980  VNDSILFLRSTLFEIMVLPNGDGRSLIKFNXXXXXXXXXXXXXXEIQIILQKEGVL 1035
             +D+IL LRST+FEI+V  +    S++ F               E++ +L++E VL
Sbjct: 1156 SSDNILSLRSTMFEILVRDDSSKGSVVWFVKKSGSTKTFKRLVKEVEKVLERENVL 1211

>AFR696C Chr6 complement(1722130..1725558) [3429 bp, 1142 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDR507C
           (GIN4) and YCL024W (KCC4)
          Length = 1142

 Score =  533 bits (1374), Expect = e-171,   Method: Compositional matrix adjust.
 Identities = 253/352 (71%), Positives = 291/352 (82%), Gaps = 7/352 (1%)

Query: 18  IGPWKLGETLGFGSTGKVQLAQHERTGHRTAVKVISKSIFNNNGNH---SNDDSVLPYNI 74
           IGPWKLGETLG GSTGKV LAQ+  TG   AVKVISKS+FN  G+    SND  VLPY I
Sbjct: 16  IGPWKLGETLGAGSTGKVLLAQNTETGQIAAVKVISKSVFNAQGSTFVGSNDPDVLPYGI 75

Query: 75  EREIVIMKLLSHPNVLSLYDVWETNNNLYLILEYAEKGELFNLLVDHGPLPEREAINCFR 134
           EREI+IMKLL+HPNVL LYDVWET  +LY++LEY EKGELFNLLV  GPLPE EA+  FR
Sbjct: 76  EREIIIMKLLNHPNVLRLYDVWETAQDLYMVLEYVEKGELFNLLVQRGPLPENEAVRFFR 135

Query: 135 QIIIGISYCHALGIVHRDLKPENLLLDSFYNIKIADFGMAALQTDADLLETSCGSPHYAA 194
           QIIIGISYCHALGIVHRDLKPENLLLD  +NIK+ADFGMAAL++   LLETSCGSPHYAA
Sbjct: 136 QIIIGISYCHALGIVHRDLKPENLLLDHKFNIKLADFGMAALESKDKLLETSCGSPHYAA 195

Query: 195 PEIVSGLPYEGFASDVWSCGVILFALLTGRLPFDEENGNVRDLLLKVQKGQFEMPNDTEI 254
           PEIVSGLPY GF SDVWSCGVIL+ALLTGRLPFDEE+GN+R+LLLKVQ G++E+P + EI
Sbjct: 196 PEIVSGLPYHGFESDVWSCGVILYALLTGRLPFDEEDGNIRNLLLKVQSGKYEIPGEDEI 255

Query: 255 SRDAQDLIGKILVVDPRQRIKIRDILSHPLLKKYQTIKDSKSIKDLPRENTYLYPLADSN 314
           S +A+DLI +IL V+P QRIK R+IL HPLL+KY +IKDSKSI++LPRE+TYL PL    
Sbjct: 256 SPEARDLIVQILTVEPEQRIKTREILKHPLLQKYPSIKDSKSIRNLPREDTYLNPL---- 311

Query: 315 NHTSASIDDSILQNLVVLWHGRHADDIVSKLKENGTNKEKILYALLYRFKLD 366
           +H   +ID +ILQNLVVLWHGR  ++I  KLKE G N EK  YALL+RFK +
Sbjct: 312 DHNDGTIDQAILQNLVVLWHGRDKNEITMKLKEPGANLEKTFYALLHRFKFE 363

 Score = 77.8 bits (190), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 65/197 (32%), Positives = 99/197 (50%), Gaps = 61/197 (30%)

Query: 601 LLQDIDTLLTNRYQLSSYTRPISRLDPGLTPVTETLPNNLKEKTALLQD----------T 650
           L  +I++LL  R  LS  TRPISRLDPG+          L E+  +L+D           
Sbjct: 660 LQNNINSLLKRR-TLSLETRPISRLDPGI---------RLSEENTILEDDLECNEDRLRV 709

Query: 651 EKKIIETIRRSKFLGSL-----------------LNVRGG----LSPG---KSELAPIEE 686
           EK I+ETIRRSKFLGS                  +N+R      L PG   + E   + +
Sbjct: 710 EKNILETIRRSKFLGSQYDIDKELQRVRREKLEKVNMRKSQDRKLEPGLHSRQEQRFVSD 769

Query: 687 SPIVSTT----------------PLIYNDRMEPRRISDVEVPHFTRKSKHFTTANNRRSV 730
              V+++                 ++ ++  EPR++S+V++P FTR+SKHF+ ++ R SV
Sbjct: 770 GTTVTSSHEDSESIILPKNVTAIGVLKDEESEPRKLSEVKIPQFTRRSKHFSASSKRLSV 829

Query: 731 LSLYA-KDSIKDLNEFL 746
           LS+Y+ K S  +L ++L
Sbjct: 830 LSMYSTKVSYTNLADYL 846

 Score = 72.0 bits (175), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 38/102 (37%), Positives = 57/102 (55%)

Query: 934  LELEIHAKIPEKRLYEGLHKLLEGWKQYGLKNLVFNITNMIITGKLVNDSILFLRSTLFE 993
             ++++   + + +++  L+KLL GW  YGLK +     +  ITGKL +D+IL LRST FE
Sbjct: 1037 CDVQLDTTVGDSKMFRALNKLLNGWTSYGLKEVRSMPASYTITGKLSSDNILSLRSTAFE 1096

Query: 994  IMVLPNGDGRSLIKFNXXXXXXXXXXXXXXEIQIILQKEGVL 1035
            I++L   D  S +KF               EI+ IL+KE VL
Sbjct: 1097 IVILSVADTGSSVKFTKKSGSKKTFTRLVNEIEKILEKESVL 1138

 Score = 70.5 bits (171), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 31/45 (68%), Positives = 40/45 (88%)

Query: 506 DDDDWEYIEKDAKRTSSNFATLIDEIFEPEKFELAKREKAELQRK 550
           +D+DWEYI+++AKRTSS+FATLID IFE EK+E  +REK EL+RK
Sbjct: 518 EDNDWEYIDREAKRTSSDFATLIDNIFEHEKYEQIRREKEELERK 562

>ZYRO0F17402g Chr6 complement(1445685..1449254) [3570 bp, 1189 aa]
           {ON} similar to uniprot|Q12263 Saccharomyces cerevisiae
           YDR507C
          Length = 1189

 Score =  535 bits (1377), Expect = e-171,   Method: Compositional matrix adjust.
 Identities = 257/358 (71%), Positives = 297/358 (82%), Gaps = 9/358 (2%)

Query: 18  IGPWKLGETLGFGSTGKVQLAQHERTGHRTAVKVISKSIFNNN---GNHSNDDSV---LP 71
           +GPWKLGETLGFGSTGKVQLA +E T    AVK ISK+IF+     GN S   S    LP
Sbjct: 17  VGPWKLGETLGFGSTGKVQLACNEITQQSAAVKEISKAIFSAKTAPGNSSIAASTPDPLP 76

Query: 72  YNIEREIVIMKLLSHPNVLSLYDVWETNNNLYLILEYAEKGELFNLLVDHGPLPEREAIN 131
           Y IEREI+IMKLL+HPNVL LYDVWETN +LY++LEYAEKGELFNLLV++GPLPE EA+ 
Sbjct: 77  YGIEREIIIMKLLNHPNVLRLYDVWETNPSLYMVLEYAEKGELFNLLVENGPLPENEAVC 136

Query: 132 CFRQIIIGISYCHALGIVHRDLKPENLLLDSFYNIKIADFGMAALQTDADLLETSCGSPH 191
            FRQIIIG+SYCHALGIVHRDLKPENLLLD   NIKIADFGMAAL+T+  LLETSCGSPH
Sbjct: 137 FFRQIIIGVSYCHALGIVHRDLKPENLLLDHDLNIKIADFGMAALETEDKLLETSCGSPH 196

Query: 192 YAAPEIVSGLPYEGFASDVWSCGVILFALLTGRLPFDEENGNVRDLLLKVQKGQFEMPND 251
           YAAPEIVSG+PY GFASD+WSCGVI FALLTGRLPFDEE+GN+R+LLLKVQ G+FEMP+D
Sbjct: 197 YAAPEIVSGIPYHGFASDIWSCGVIFFALLTGRLPFDEEDGNIRNLLLKVQSGKFEMPDD 256

Query: 252 TEISRDAQDLIGKILVVDPRQRIKIRDILSHPLLKKYQTIKDSKSIKDLPRENTYLYPLA 311
            EIS +AQDL+ KIL VDP  RIK R+IL HPLL+KY  + D+KSI++LPRE+TYL+PL+
Sbjct: 257 DEISPEAQDLLAKILTVDPECRIKPREILKHPLLQKYPNVSDNKSIRNLPREDTYLHPLS 316

Query: 312 DSNNHTSASIDDSILQNLVVLWHGRHADDIVSKLKENGTNKEKILYALLYRFKLDSVR 369
           DS    S+ +D +ILQNLVVLWHGR A +I +KLK+ G N EK LYALL RFK D+ R
Sbjct: 317 DSG---SSEVDQNILQNLVVLWHGRPAGEIAAKLKDPGANAEKTLYALLARFKNDTER 371

 Score =  139 bits (351), Expect = 8e-33,   Method: Compositional matrix adjust.
 Identities = 140/418 (33%), Positives = 208/418 (49%), Gaps = 78/418 (18%)

Query: 506 DDDDWEYIEKDAKRTSSNFATLIDEIFEPEKFELAKREKAELQRKVQEA----------- 554
           ++DDWEYIEK+ KRTSS+FATLIDEIFE EKFE  ++EKAEL+R+V+E            
Sbjct: 539 EEDDWEYIEKETKRTSSDFATLIDEIFEHEKFEQIRKEKAELERRVKETKEREERERKER 598

Query: 555 --------------KRQSVNAQKINEDEFGSEVSDGMKELKKIND--KVSSPLINYEF-S 597
                         +++ + AQ+   D+     SD     +  N    VS+PL   +  S
Sbjct: 599 EEKELNEKLENDARQKREMEAQEAQGDDGTDTESDVHSNNQAPNGVRSVSAPLERKKRDS 658

Query: 598 QQELLQDIDTLLTNRYQLSSYTRPISRLDPGLTPVTET---LPNNLKEKTALLQDTEKKI 654
              +  DI+ +   R  +S  TRP+SRLDPGL    E+      + +E+  L   T+K I
Sbjct: 659 MVNVQSDIEEIFGQR-TMSLQTRPVSRLDPGLFYAEESNEPEAGDTEEEKKLR--TQKNI 715

Query: 655 IETIRRSKFLGSLLNVRGGLSPGKSELAPIEESP----IVSTTPLIYNDRM--------- 701
           +ETIRRSKFLGS  ++  G      EL      P     VS T   Y+ R+         
Sbjct: 716 LETIRRSKFLGSSFDI--GKELQNEELKKKASQPHRDRTVSQTNEPYDTRVLPTQAVATA 773

Query: 702 -----EPRRISDVEVPHFTRKSKHFTTANNRRSVLSLYA-KDSIKDLNEFLIKEDPD--- 752
                EPR+IS++ VP FTRKS+ F+ +N R SVLS+Y+ K S  +L+  L   D     
Sbjct: 774 PLRDQEPRKISEISVPQFTRKSRFFSDSNKRLSVLSMYSTKHSYNNLSNLLNDSDASDGR 833

Query: 753 LPPQGSTDNESRSEDPEIA-ESITDSRNIQYDEDDSKDGDNVNNDNI--LSDFPQGVGI- 808
           L       +    ++PE   E++ ++     DED+     + N++ +  +S    G G+ 
Sbjct: 834 LNSAAEYSDVKGKKEPEFQFEAVREA----SDEDNGISRLSNNDERLRNVSGTSGGSGVP 889

Query: 809 ----SQEYDMK----DKNPNQSPISKSAEPTLV---VKLPSLSSFQGKN-ASGLGLYQ 854
               S +++MK    D+     P + S+  +     VKLP+L    G + A+GLG+YQ
Sbjct: 890 HDNLSSKHNMKLNFADRFSADEPTAGSSNSSSASKNVKLPTLPPLDGTSEANGLGIYQ 947

 Score = 78.6 bits (192), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 47/129 (36%), Positives = 68/129 (52%), Gaps = 6/129 (4%)

Query: 914  TTVKKPPNSVLLKKFSKGK-----ILELEIHAKIPEKRLYEGLHKLLEGWKQYGLKNLVF 968
            T   K  N    +KFSK         + EI+  +  K+L+ GL  LL GW QYGLK++  
Sbjct: 1062 TNSDKKRNVSFFRKFSKSNEKDTTGFDGEINTTVSAKQLFLGLQNLLHGWTQYGLKDVRS 1121

Query: 969  NITNMIITGKLVNDSILFLRSTLFEIMVLPNGDGRSLIKFNXXXXXXXXXXXXXXEIQII 1028
            +   M +TGKL +++IL LRSTLFE++V   G   S++ F               E++ +
Sbjct: 1122 HPEKMTLTGKLTSENILSLRSTLFEMVVWSRGK-VSVVGFRKKSGSSKAMRRLVSEVEKV 1180

Query: 1029 LQKEGVLDK 1037
            L KEGV+ K
Sbjct: 1181 LLKEGVISK 1189

>Ecym_1058 Chr1 (105835..109329) [3495 bp, 1164 aa] {ON} similar to
           Ashbya gossypii AFR696C
          Length = 1164

 Score =  531 bits (1369), Expect = e-170,   Method: Compositional matrix adjust.
 Identities = 252/352 (71%), Positives = 290/352 (82%), Gaps = 7/352 (1%)

Query: 18  IGPWKLGETLGFGSTGKVQLAQHERTGHRTAVKVISKSIFNNNGNH---SNDDSVLPYNI 74
           IGPW LGETLG GSTGKV +AQ+ +TG   AVK+ISKSIFN  G+    SND  VLPY I
Sbjct: 17  IGPWMLGETLGVGSTGKVLMAQNVQTGQIAAVKIISKSIFNAQGSTFVGSNDPDVLPYGI 76

Query: 75  EREIVIMKLLSHPNVLSLYDVWETNNNLYLILEYAEKGELFNLLVDHGPLPEREAINCFR 134
           EREI IMKLL+HPNVL LYDVWET+ +LY++LEY EKGELFNLL++ GPLPE EA+  FR
Sbjct: 77  EREITIMKLLNHPNVLRLYDVWETSTDLYMVLEYVEKGELFNLLIERGPLPENEAVRFFR 136

Query: 135 QIIIGISYCHALGIVHRDLKPENLLLDSFYNIKIADFGMAALQTDADLLETSCGSPHYAA 194
           QIIIGISYCHALGIVHRDLKPENLLLD  +NIK+ADFGMAAL++   LLETSCGSPHYAA
Sbjct: 137 QIIIGISYCHALGIVHRDLKPENLLLDHKFNIKLADFGMAALESKDKLLETSCGSPHYAA 196

Query: 195 PEIVSGLPYEGFASDVWSCGVILFALLTGRLPFDEENGNVRDLLLKVQKGQFEMPNDTEI 254
           PEIVSGLPY GF SDVWSCGVIL+ALLTGRLPFDE++GN+R LLLKVQ G+FEMP+  EI
Sbjct: 197 PEIVSGLPYHGFESDVWSCGVILYALLTGRLPFDEDDGNIRKLLLKVQSGEFEMPDKDEI 256

Query: 255 SRDAQDLIGKILVVDPRQRIKIRDILSHPLLKKYQTIKDSKSIKDLPRENTYLYPLADSN 314
           S +AQDLI KIL VDP  RIK R+IL HPLLKKY +IKDSKSI++LPRE+TYL PL    
Sbjct: 257 SIEAQDLIAKILTVDPSGRIKTREILKHPLLKKYPSIKDSKSIRNLPREDTYLNPL---- 312

Query: 315 NHTSASIDDSILQNLVVLWHGRHADDIVSKLKENGTNKEKILYALLYRFKLD 366
           +H   ++D +IL+NLVVLWHGR  ++IV KL E G N EK  YALL+RFK +
Sbjct: 313 DHNDGTVDRTILKNLVVLWHGRDENEIVMKLNEQGPNLEKTFYALLHRFKYE 364

 Score =  132 bits (331), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 143/493 (29%), Positives = 218/493 (44%), Gaps = 77/493 (15%)

Query: 601  LLQDIDTLLTNRYQLSSYTRPISRLDPGLTPVTETLPNNLKEKTALLQDT---EKKIIET 657
            L   I+T+L N+  +S  TRPISRLDPG+         +  ++  L + T   EK I+ET
Sbjct: 687  LQYSINTVL-NKRAVSVQTRPISRLDPGIMAQEVAHELDYDDEEILSERTLRREKTILET 745

Query: 658  IRRSKFLGSLLNVRGGL---------------------------------SPGKSELAPI 684
            IRRS FLGS  ++   L                                 S G +  +  
Sbjct: 746  IRRSNFLGSQFDIHKELKNAKKEKIEKAKKRKQLNRKLPDRISYHDQRFVSDGTTITSAH 805

Query: 685  EESPIVS-----TTPLIYNDRMEPRRISDVEVPHFTRKSKHFTTANNRRSVLSLYAK-DS 738
            +     S     T  ++ +D  EP+++S+V +P  TR+S+H + ++ R SVLS+Y+   S
Sbjct: 806  DGYDTTSLTRHTTVGVLRDDESEPKKLSEVRIPEVTRRSRHLSASSKRFSVLSMYSTMTS 865

Query: 739  IKDLNEFLIKEDPDLPPQGSTDNESRSEDPEIA-ESITDSRNIQYDEDDS------KDGD 791
              +L +F+ K D  L P   T +   ++ PE   ES  D+       D+S         +
Sbjct: 866  YTNLADFM-KSDVQLKPLNDTASSKVTQQPEFMFESTIDNVERISSNDNSHISSMEAPNN 924

Query: 792  NVNNDNILSDFPQGVGISQEYDMKDKNPNQSPISKSAEPTLVVKLPSLSSFQGKNAS--G 849
             V   N    F + V + +  D  +  P+      + E    VKLP+L   +  N S  G
Sbjct: 925  TVIKLNYADRFYKPVEVIELDDTDNTQPD------TEEDITKVKLPALPPLEKLNKSPNG 978

Query: 850  LGLYQ----REPSKVTLPSLTSNNSSVGENIEDGAEKGTESEKIAAXXXXXXXXXXXXXX 905
            LG+YQ    RE  K  + S+T N     EN E+    GT  +K                 
Sbjct: 979  LGIYQHSSPREDFKHAVRSVTPN-----ENKENEDPAGTTQQKAPLTSVGKELGIREPLT 1033

Query: 906  XXXTVNAPTTVKKPPNSVLLKKFSKGKI---LELEIHAKIPEKRLYEGLHKLLEGWKQYG 962
                   P   KK P+    +KFSK KI    + ++   +   +++  L KLL GW  YG
Sbjct: 1034 DLAQQGVP---KKRPS--FFRKFSKEKIKPEYDYQLDTTVNNTKMFRALDKLLNGWTSYG 1088

Query: 963  LKNLVFNITNMIITGKLVNDSILFLRSTLFEIMVLPNGDGRSLIKFNXXXXXXXXXXXXX 1022
            LK +  + +  +ITGKL +D+IL LRST F+++V  +  G S ++F              
Sbjct: 1089 LKQVRSSPSVSMITGKLSSDNILSLRSTAFQVVVAGSNHGSS-VRFTKKSGSKKTFARLV 1147

Query: 1023 XEIQIILQKEGVL 1035
             EI+ IL+KE VL
Sbjct: 1148 NEIEKILEKEKVL 1160

 Score = 70.5 bits (171), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 32/46 (69%), Positives = 40/46 (86%)

Query: 506 DDDDWEYIEKDAKRTSSNFATLIDEIFEPEKFELAKREKAELQRKV 551
           +D+DWEYI+K+AKRTSS+FATLID IFE EK+E  +REK  L+RKV
Sbjct: 521 EDNDWEYIDKEAKRTSSDFATLIDNIFEHEKYEQIRREKEGLERKV 566

>SAKL0E02860g Chr5 complement(228726..232859) [4134 bp, 1377 aa]
           {ON} similar to uniprot|Q75DQ1 Ashbya gossypii ABL034W
           ABL034Wp and weakly similar to YKL101W uniprot|P34244
           Saccharomyces cerevisiae YKL101W HSL1 Nim1p-related
           protein kinase that regulates the morphogenesis and
           septin checkpoints associates with the assembled septin
           filament required along with Hsl7p for bud neck
           recruitment phosphorylation and degradation of Swe1p
          Length = 1377

 Score =  389 bits (998), Expect = e-115,   Method: Compositional matrix adjust.
 Identities = 194/370 (52%), Positives = 261/370 (70%), Gaps = 17/370 (4%)

Query: 2   TVANTETHSAAKPS-STIGPWKLGETLGFGSTGKVQLAQHERTGHRTAVKVISKSIFNNN 60
           + + T T S+ + S  T+GPWKLG+TLG GS+G+V+LA++  TG   A+K++ K +  + 
Sbjct: 41  SASTTNTKSSKRKSRDTVGPWKLGKTLGKGSSGRVRLAKNMETGKLAAIKIVPKKVVRST 100

Query: 61  GNHSNDDSV---LPYNIEREIVIMKLLSHPNVLSLYDVWETNNNLYLILEYAEKGELFNL 117
                 ++    LPY IEREI+IMKL+SHPN+++LY+VWE  + L+L+LEY E GELF+ 
Sbjct: 101 NASKKSNAANGNLPYGIEREIIIMKLISHPNIMALYEVWENKSELFLVLEYVEGGELFDY 160

Query: 118 LVDHGPLPEREAINCFRQIIIGISYCHALGIVHRDLKPENLLLDSF-YNIKIADFGMAAL 176
           LV  G LPE+EA++ FRQII G++YCH   I HRDLKPENLL+D   + IKIADFGMAAL
Sbjct: 161 LVSKGKLPEQEAVHYFRQIIQGVAYCHNYNICHRDLKPENLLVDKKNHQIKIADFGMAAL 220

Query: 177 QTDADLLETSCGSPHYAAPEIVSGLPYEGFASDVWSCGVILFALLTGRLPFDEENGNVRD 236
           +T   LLETSCGSPHYA+PEIV G  Y G  SDVWSCG+ILFALLTG LPF+++  N++ 
Sbjct: 221 ETTNKLLETSCGSPHYASPEIVMGKNYHGSPSDVWSCGIILFALLTGHLPFNDD--NIKK 278

Query: 237 LLLKVQKGQFEMPNDTEISRDAQDLIGKILVVDPRQRIKIRDILSHPLLKKYQTIKDSKS 296
           LLLKVQ G++ MP +  IS +AQDLI KIL+VDPR RI I ++L HPL+ KY   + SKS
Sbjct: 279 LLLKVQSGKYHMPQN--ISSEAQDLISKILIVDPRGRITINEVLQHPLITKYDKAR-SKS 335

Query: 297 IKDLP--RENTYLYPLADSNNHTSASIDDSILQNLVVLWHGRHADDIVSKLKENGTNKEK 354
             DL        L  L      +   ID SIL NL +LWHG  ++ IV++L ++G  +EK
Sbjct: 336 NSDLHLLSRTPQLVTL-----QSKEDIDGSILGNLQILWHGAPSEYIVARLLQHGFTEEK 390

Query: 355 ILYALLYRFK 364
           + Y+LL++++
Sbjct: 391 LFYSLLWQYQ 400

>KLTH0D05566g Chr4 (498055..501441) [3387 bp, 1128 aa] {ON} weakly
           similar to uniprot|P34244 Saccharomyces cerevisiae
           YKL101W HSL1 Nim1p-related protein kinase that regulates
           the morphogenesis and septin checkpoints associates with
           the assembled septin filament required along with Hsl7p
           for bud neck recruitment phosphorylation and degradation
           of Swe1p
          Length = 1128

 Score =  384 bits (985), Expect = e-115,   Method: Compositional matrix adjust.
 Identities = 205/374 (54%), Positives = 256/374 (68%), Gaps = 34/374 (9%)

Query: 2   TVANTETHSAAKPS-STIGPWKLGETLGFGSTGKVQLAQHERTGHRTAVKVISKSIFNNN 60
           +  NT T S+ + S  TIGPWKLG+TLG GS+G+V+LA++  TG   AVK++ K+     
Sbjct: 38  STTNTATQSSKRRSRDTIGPWKLGKTLGKGSSGRVRLAKNMETGKLAAVKIVPKT----- 92

Query: 61  GNHSNDDSVLPYNIEREIVIMKLLSHPNVLSLYDVWETNNNLYLILEYAEKGELFNLLVD 120
              S+  + LPY IEREI+IMKL+SHPNV+ LY+VWE    L+L+LEY + GELF+ LV 
Sbjct: 93  --KSSRPNALPYGIEREIIIMKLISHPNVMGLYEVWENKLELFLVLEYVDGGELFDYLVS 150

Query: 121 HGPLPEREAINCFRQIIIGISYCHALGIVHRDLKPENLLLDSF-YNIKIADFGMAALQTD 179
            G L E+EAI+ FRQII G +YCH+  I HRDLKPENLLLD     IKIADFGMAALQT 
Sbjct: 151 RGRLSEKEAIHYFRQIIEGTAYCHSFNICHRDLKPENLLLDKKNKRIKIADFGMAALQTS 210

Query: 180 ADLLETSCGSPHYAAPEIVSGLPYEGFASDVWSCGVILFALLTGRLPFDEENGNVRDLLL 239
             LLETSCGSPHYA+PEIV G  Y G  SDVWSCG+ILFALLTG LPF+++  N++ LLL
Sbjct: 211 NKLLETSCGSPHYASPEIVMGKTYNGGPSDVWSCGIILFALLTGHLPFNDD--NIKRLLL 268

Query: 240 KVQKGQFEMPNDTEISRDAQDLIGKILVVDPRQRIKIRDILSHPLLKKYQTIKDSKSIKD 299
           KVQ G+++MP    IS +AQDLI +ILVVDP +RI I DILSHPL+ KY   K SKS   
Sbjct: 269 KVQAGKYQMPQ--AISLEAQDLISRILVVDPNKRITINDILSHPLITKYD-YKRSKS--- 322

Query: 300 LPRENTYLYPLADSNNHTSASI---------DDSILQNLVVLWHGRHADDIVSKLKENGT 350
               N+ L+ L+    HTS  I         D +ILQNL +LWHG   D I+ +L E   
Sbjct: 323 ----NSDLHILS----HTSPQICTIRSERDVDPTILQNLQILWHGAPKDYIMKRLLEPEL 374

Query: 351 NKEKILYALLYRFK 364
            +EK  Y+LL  ++
Sbjct: 375 TEEKTFYSLLLAYQ 388

>Ecym_7392 Chr7 complement(803240..807544) [4305 bp, 1434 aa] {ON}
           similar to Ashbya gossypii ABL034W
          Length = 1434

 Score =  386 bits (992), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 191/354 (53%), Positives = 250/354 (70%), Gaps = 22/354 (6%)

Query: 17  TIGPWKLGETLGFGSTGKVQLAQHERTGHRTAVKVISKSIFNNNGNHSNDD-SVLPYNIE 75
           T+GPWKLG+TLG GS+G+V+LA++  TG   A+K++ K     N  H+N   + LPY IE
Sbjct: 60  TVGPWKLGKTLGKGSSGRVRLAKNMETGKLAAIKIVPK----RNVRHNNTQLTSLPYGIE 115

Query: 76  REIVIMKLLSHPNVLSLYDVWETNNNLYLILEYAEKGELFNLLVDHGPLPEREAINCFRQ 135
           REI+IMKL+SHPNV++LY+VWE    LYL+LEY E GELF+ L+  G LPE+EA++ F+Q
Sbjct: 116 REIIIMKLISHPNVMALYEVWENKPELYLVLEYVEGGELFDYLISRGKLPEQEAVHYFKQ 175

Query: 136 IIIGISYCHALGIVHRDLKPENLLLDSF-YNIKIADFGMAALQTDADLLETSCGSPHYAA 194
           I+ G+SYCH   I HRDLKPENLLLD    ++KIADFGMAAL+T   LLETSCGSPHYA+
Sbjct: 176 IVQGVSYCHHFNICHRDLKPENLLLDKKNLSVKIADFGMAALETTDKLLETSCGSPHYAS 235

Query: 195 PEIVSGLPYEGFASDVWSCGVILFALLTGRLPFDEENGNVRDLLLKVQKGQFEMPNDTEI 254
           PEIV G  Y G  SDVWSCG+ILFALLTG LPF+++  NV+ LLLKVQ G+++MP +  I
Sbjct: 236 PEIVMGQKYHGSPSDVWSCGIILFALLTGHLPFNDD--NVKKLLLKVQSGKYQMPQN--I 291

Query: 255 SRDAQDLIGKILVVDPRQRIKIRDILSHPLLKKYQTIKDSKSIKDLPRENTYLYPLADSN 314
           S +A+DLI KIL+VDP  RI I ++L HPLL KYQ  +   S        + L+ L  + 
Sbjct: 292 SNEAKDLIAKILIVDPAMRITIDEVLEHPLLLKYQKTRSKSS--------SNLHALDSTP 343

Query: 315 N----HTSASIDDSILQNLVVLWHGRHADDIVSKLKENGTNKEKILYALLYRFK 364
           N     +   ID+SIL NL +LWHG   + +  KL + G  +EK+ Y+LL R++
Sbjct: 344 NIVVLESEDKIDESILSNLQILWHGAPKEYLTGKLLQQGFTEEKLFYSLLLRYQ 397

>ABL034W Chr2 (333432..337709) [4278 bp, 1425 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YKL101W (HSL1)
          Length = 1425

 Score =  386 bits (991), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 189/356 (53%), Positives = 250/356 (70%), Gaps = 25/356 (7%)

Query: 17  TIGPWKLGETLGFGSTGKVQLAQHERTGHRTAVKVISKSIFNNNGNHSNDDSVLPYNIER 76
           T+GPWKLG+TLG GS+G+V+LA++ ++G   A+K++ K    +N       + LPY IER
Sbjct: 57  TVGPWKLGKTLGKGSSGRVRLAKNMQSGKLAAIKIVPKRNVRHNQKQV---TALPYGIER 113

Query: 77  EIVIMKLLSHPNVLSLYDVWETNNNLYLILEYAEKGELFNLLVDHGPLPEREAINCFRQI 136
           EI+IMKL++HPN+++LY+VWE  + LYL+LEY E GELF+ L+  G LPE+EAI+ F+QI
Sbjct: 114 EIIIMKLITHPNIMALYEVWENKSELYLVLEYVEGGELFDYLIARGKLPEQEAIHYFKQI 173

Query: 137 IIGISYCHALGIVHRDLKPENLLLDSF-YNIKIADFGMAALQTDADLLETSCGSPHYAAP 195
           + G+SYCH   I HRDLKPENLLLD     +KIADFGMAAL+T   LLETSCGSPHYA+P
Sbjct: 174 VQGVSYCHNFNICHRDLKPENLLLDKKNKTVKIADFGMAALETTNRLLETSCGSPHYASP 233

Query: 196 EIVSGLPYEGFASDVWSCGVILFALLTGRLPFDEENGNVRDLLLKVQKGQFEMPNDTEIS 255
           EIV G  Y G  SDVWSCG+ILFALLTG LPF+++  NVR LLLKVQ G+++MP++  +S
Sbjct: 234 EIVMGQKYHGSPSDVWSCGIILFALLTGHLPFNDD--NVRKLLLKVQHGRYQMPSN--VS 289

Query: 256 RDAQDLIGKILVVDPRQRIKIRDILSHPLLKKYQTIKDSKSIKDLPRENTYLYPLADSNN 315
           ++A+DLI KILVVDP +RI +  IL HPLL KY          D P +     PL     
Sbjct: 290 KEAKDLISKILVVDPEKRITVDKILEHPLLVKY----------DNPGKGGLACPLEKPEE 339

Query: 316 -------HTSASIDDSILQNLVVLWHGRHADDIVSKLKENGTNKEKILYALLYRFK 364
                  H+   ID++IL NL +LWHG   + +V KL ++G  +EK+ YALL R++
Sbjct: 340 RPKVLDIHSIDDIDETILSNLQILWHGAPKEYLVDKLLQSGFTEEKLFYALLLRYQ 395

>KLLA0F13552g Chr6 complement(1252906..1256709) [3804 bp, 1267 aa]
           {ON} weakly similar to uniprot|P34244 Saccharomyces
           cerevisiae YKL101W HSL1 Nim1p-related protein kinase
           that regulates the morphogenesis and septin checkpoints
           associates with the assembled septin filament required
           along with Hsl7p for bud neck recruitment
           phosphorylation and degradation of Swe1p
          Length = 1267

 Score =  381 bits (979), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 195/363 (53%), Positives = 252/363 (69%), Gaps = 14/363 (3%)

Query: 3   VANTETHSAAKPSSTIGPWKLGETLGFGSTGKVQLAQHERTGHRTAVKVISKSIFNNNGN 62
           V NT+T S  +   T+GPWKLG+TLG GS+G+V+LA++  TG  +A+K++ K        
Sbjct: 56  VNNTKT-SKRRNRDTVGPWKLGKTLGKGSSGRVRLAKNMETGKLSAIKIVPKKFV----- 109

Query: 63  HSNDDSVLPYNIEREIVIMKLLSHPNVLSLYDVWETNNNLYLILEYAEKGELFNLLVDHG 122
            SN    LPY IEREI+IMKL+SHPNV+ LY+VWE  + LYL+LEY E GELF+ LV  G
Sbjct: 110 KSNQIKQLPYGIEREIIIMKLISHPNVMGLYEVWENKSELYLVLEYVEGGELFDYLVSKG 169

Query: 123 PLPEREAINCFRQIIIGISYCHALGIVHRDLKPENLLLD-SFYNIKIADFGMAALQTDAD 181
            LPE EAI+ F+QI+  ++YCH   I HRDLKPENLLLD    +IKIADFGMAAL+T   
Sbjct: 170 KLPESEAIHYFKQIVQAVAYCHGFNICHRDLKPENLLLDKKKRSIKIADFGMAALETSDK 229

Query: 182 LLETSCGSPHYAAPEIVSGLPYEGFASDVWSCGVILFALLTGRLPFDEENGNVRDLLLKV 241
           LLETSCGSPHYA+PEIV G  Y G  SDVWSCG+ILFALLTG LPF+++  NV+ LLLKV
Sbjct: 230 LLETSCGSPHYASPEIVLGRKYHGSPSDVWSCGIILFALLTGHLPFNDD--NVKKLLLKV 287

Query: 242 QKGQFEMPNDTEISRDAQDLIGKILVVDPRQRIKIRDILSHPLLKKYQTIKDSKSIKDLP 301
           Q G+++MP    +S +A+DLI +ILVVDP +RI I  IL H LL KY     SKS  DL 
Sbjct: 288 QSGKYQMPQ--WLSVEAKDLISRILVVDPNRRITIDQILQHELLTKYDQKSRSKSNSDLN 345

Query: 302 RENTYLYPLADSNNHTSASIDDSILQNLVVLWHGRHADDIVSKLKENGTNKEKILYALLY 361
             N     ++ S+      ID++IL NL +LWHG     +V++L + G  +EK+ Y+LL+
Sbjct: 346 LLNRTPNIVSFSSER---DIDETILSNLQILWHGAARKHLVTRLMKPGFTEEKMFYSLLW 402

Query: 362 RFK 364
            ++
Sbjct: 403 NYQ 405

>Kwal_26.7788 s26 (511530..515333) [3804 bp, 1267 aa] {ON} YKL101W
           (HSL1) - Putative protein kinase homologous to S. pombe
           cdr1/nim1 [contig 55] FULL
          Length = 1267

 Score =  377 bits (967), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 194/354 (54%), Positives = 246/354 (69%), Gaps = 25/354 (7%)

Query: 17  TIGPWKLGETLGFGSTGKVQLAQHERTGHRTAVKVISKSIFNNNGNHSNDDSVLPYNIER 76
           TIGPWKLG+TLG GS+G+V+LA++  TG   A+K++ K+  +  G+       LPY IER
Sbjct: 54  TIGPWKLGKTLGKGSSGRVRLAKNMETGKLAAIKIVPKTKSSRTGS-------LPYGIER 106

Query: 77  EIVIMKLLSHPNVLSLYDVWETNNNLYLILEYAEKGELFNLLVDHGPLPEREAINCFRQI 136
           EI+IMKL+SHPNV+ LY+VWE    L+L+LEY + GELF+ LV  G LPE+EAI+ FRQI
Sbjct: 107 EIIIMKLISHPNVMGLYEVWENKLELFLVLEYVDGGELFDYLVSRGRLPEKEAIHYFRQI 166

Query: 137 IIGISYCHALGIVHRDLKPENLLLDSF-YNIKIADFGMAALQTDADLLETSCGSPHYAAP 195
           I G +YCH   I HRDLKPENLLLD     IKIADFGMAALQT   LLETSCGSPHYA+P
Sbjct: 167 IEGTAYCHGFNICHRDLKPENLLLDKKNKRIKIADFGMAALQTSNKLLETSCGSPHYASP 226

Query: 196 EIVSGLPYEGFASDVWSCGVILFALLTGRLPFDEENGNVRDLLLKVQKGQFEMPNDTEIS 255
           EIV G  Y G  SDVWSCG+ILFALLTG LPF+++  N++ LLLKVQ G+++MP    +S
Sbjct: 227 EIVMGKNYNGGPSDVWSCGIILFALLTGHLPFNDD--NIKRLLLKVQAGKYQMPQS--VS 282

Query: 256 RDAQDLIGKILVVDPRQRIKIRDILSHPLLKKYQTIKDSKSIKDLPRENTYLYPLADSNN 315
             AQDLI +ILVVDP +RI I +IL+HPLL KY   K SKS       N+ L+ L+ S  
Sbjct: 283 SGAQDLISRILVVDPDKRISINEILAHPLLAKYGN-KRSKS-------NSDLHILSHSKP 334

Query: 316 HTS-----ASIDDSILQNLVVLWHGRHADDIVSKLKENGTNKEKILYALLYRFK 364
             S     + +D +ILQNL +LWHG   + I+  L +    +EK  Y+LL  ++
Sbjct: 335 QISTIKSESDVDPTILQNLQILWHGAPKESILKGLLKPELTEEKTFYSLLLAYQ 388

>YKL101W Chr11 (248920..253476) [4557 bp, 1518 aa] {ON}
           HSL1Nim1p-related protein kinase that regulates the
           morphogenesis and septin checkpoints; associates with
           the assembled septin filament; required along with Hsl7p
           for bud neck recruitment, phosphorylation, and
           degradation of Swe1p
          Length = 1518

 Score =  380 bits (976), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 197/406 (48%), Positives = 268/406 (66%), Gaps = 50/406 (12%)

Query: 2   TVANTETHSAAKPSSTIGPWKLGETLGFGSTGKVQLAQHERTGHRTAVKVI-SKSIF--- 57
           TV+     S  K   T+GPWKLG+TLG GS+G+V+LA++  TG   A+K++  K  F   
Sbjct: 62  TVSVATKSSKRKSRDTVGPWKLGKTLGKGSSGRVRLAKNMETGQLAAIKIVPKKKAFVHC 121

Query: 58  NNNGN-----------------------HSNDDSVLPYNIEREIVIMKLLSHPNVLSLYD 94
           +NNG                        HSN     PY IEREIVIMKL+SH NV++L++
Sbjct: 122 SNNGTVPNSYSSSMVTSNVSSPSIASREHSNHSQTNPYGIEREIVIMKLISHTNVMALFE 181

Query: 95  VWETNNNLYLILEYAEKGELFNLLVDHGPLPEREAINCFRQIIIGISYCHALGIVHRDLK 154
           VWE  + LYL+LEY + GELF+ LV  G LPEREAI+ F+QI+ G+SYCH+  I HRDLK
Sbjct: 182 VWENKSELYLVLEYVDGGELFDYLVSKGKLPEREAIHYFKQIVEGVSYCHSFNICHRDLK 241

Query: 155 PENLLLDSF-YNIKIADFGMAALQTDADLLETSCGSPHYAAPEIVSGLPYEGFASDVWSC 213
           PENLLLD     IKIADFGMAAL+    LL+TSCGSPHYA+PEIV G PY G  SDVWSC
Sbjct: 242 PENLLLDKKNRRIKIADFGMAALELPNKLLKTSCGSPHYASPEIVMGRPYHGGPSDVWSC 301

Query: 214 GVILFALLTGRLPFDEENGNVRDLLLKVQKGQFEMPNDTEISRDAQDLIGKILVVDPRQR 273
           G++LFALLTG LPF+++  N++ LLLKVQ G+++MP++  +S +A+DLI KILV+DP +R
Sbjct: 302 GIVLFALLTGHLPFNDD--NIKKLLLKVQSGKYQMPSN--LSSEARDLISKILVIDPEKR 357

Query: 274 IKIRDILSHPLLKKYQTIKDSKSIKDLPRENTY-------LYPLADSNN--------HTS 318
           I  ++IL HPL+KKY  +  +K ++ + ++N         L+ L   NN        H+ 
Sbjct: 358 ITTQEILKHPLIKKYDDLPVNKVLRKMRKDNMARGKSNSDLHLL---NNVSPSIVTLHSK 414

Query: 319 ASIDDSILQNLVVLWHGRHADDIVSKLKENGTNKEKILYALLYRFK 364
             ID+SIL++L +LWHG   + I +KL +   ++EK+ Y+LL ++K
Sbjct: 415 GEIDESILRSLQILWHGVSRELITAKLLQKPMSEEKLFYSLLLQYK 460

>KNAG0A06540 Chr1 (1002435..1006733) [4299 bp, 1432 aa] {ON}
           Anc_2.479 YKL101W
          Length = 1432

 Score =  379 bits (973), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 196/375 (52%), Positives = 254/375 (67%), Gaps = 31/375 (8%)

Query: 17  TIGPWKLGETLGFGSTGKVQLAQHERTGHRTAVKVISKSIFNNNGN---HSNDDSVL--- 70
           T+GPWKLG+TLG GS+G+V+LA++   G   A+K++ K+     G     SND+S     
Sbjct: 84  TVGPWKLGKTLGKGSSGRVRLAKNMENGQLAAIKIVPKNKCLKGGTDNCSSNDNSTTLTT 143

Query: 71  ---------------PYNIEREIVIMKLLSHPNVLSLYDVWETNNNLYLILEYAEKGELF 115
                          PY IEREIVIMKL+SH NV+ L++VWE  N+L+L+LEY + GELF
Sbjct: 144 NYSMENTSDKDIPLNPYGIEREIVIMKLISHRNVMGLFEVWENKNDLFLVLEYVDGGELF 203

Query: 116 NLLVDHGPLPEREAINCFRQIIIGISYCHALGIVHRDLKPENLLLDSFYN-IKIADFGMA 174
           + LV  G LPE EA++ F+QII G+++CH+  I HRDLKPENLLLD     IKIADFGMA
Sbjct: 204 DYLVSKGKLPEWEAVHYFKQIIEGVAFCHSYNICHRDLKPENLLLDKKNKIIKIADFGMA 263

Query: 175 ALQTDADLLETSCGSPHYAAPEIVSGLPYEGFASDVWSCGVILFALLTGRLPFDEENGNV 234
           AL+    LLETSCGSPHYA+PEIV G PY G  SDVWSCG+ILFALLTG LPF+++  N+
Sbjct: 264 ALELPNKLLETSCGSPHYASPEIVMGKPYHGGPSDVWSCGIILFALLTGHLPFNDD--NI 321

Query: 235 RDLLLKVQKGQFEMPNDTEISRDAQDLIGKILVVDPRQRIKIRDILSHPLLKKYQTIKDS 294
           R LLLKVQ G+F +P +  IS +AQDLI KILVV+PRQRIKI DIL HPL+ KY+     
Sbjct: 322 RKLLLKVQSGRFRLPRN--ISLEAQDLIAKILVVNPRQRIKISDILKHPLITKYRQFFKV 379

Query: 295 K--SIKDLPRENTYLYPLADSNN---HTSASIDDSILQNLVVLWHGRHADDIVSKLKENG 349
           K   + +    N     +   NN    + A ID+SIL+NL +LWHG   + I++KL +  
Sbjct: 380 KFNQVPNPSATNLNSEHMLTPNNLKLASRADIDESILRNLQILWHGTSREIIIAKLLQYP 439

Query: 350 TNKEKILYALLYRFK 364
            + EKI Y+LL+++K
Sbjct: 440 MSAEKIFYSLLWQYK 454

>Skud_11.126 Chr11 (235011..239567) [4557 bp, 1518 aa] {ON} YKL101W
           (REAL)
          Length = 1518

 Score =  378 bits (970), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 196/406 (48%), Positives = 267/406 (65%), Gaps = 50/406 (12%)

Query: 2   TVANTETHSAAKPSSTIGPWKLGETLGFGSTGKVQLAQHERTGHRTAVKVI-SKSIF--- 57
           T++     S  K   T+GPWKLG+TLG GS+G+V+LA++  TG   A+K++  K  F   
Sbjct: 62  TISVATKSSKRKSRDTVGPWKLGKTLGKGSSGRVRLAKNIETGQLAAIKIVPKKKAFVHR 121

Query: 58  NNNGN-----------------------HSNDDSVLPYNIEREIVIMKLLSHPNVLSLYD 94
           +NNG                        HSN     PY IEREIVIMKL+SH NV++L++
Sbjct: 122 SNNGTVPNSYSSSMITSNVSSPSIASKEHSNHTQTNPYGIEREIVIMKLISHANVMALFE 181

Query: 95  VWETNNNLYLILEYAEKGELFNLLVDHGPLPEREAINCFRQIIIGISYCHALGIVHRDLK 154
           VWE  + LYL+LEY + GELF+ LV  G LPEREAI+ F+QI+ G+S+CH+  I HRDLK
Sbjct: 182 VWENKSELYLVLEYVDGGELFDYLVSKGKLPEREAIHYFKQIVEGVSFCHSFNICHRDLK 241

Query: 155 PENLLLDSF-YNIKIADFGMAALQTDADLLETSCGSPHYAAPEIVSGLPYEGFASDVWSC 213
           PENLLLD     IKIADFGMAAL+    LL+TSCGSPHYA+PEIV G PY G  SDVWSC
Sbjct: 242 PENLLLDKKNRKIKIADFGMAALELPNKLLKTSCGSPHYASPEIVMGRPYHGGPSDVWSC 301

Query: 214 GVILFALLTGRLPFDEENGNVRDLLLKVQKGQFEMPNDTEISRDAQDLIGKILVVDPRQR 273
           G++LFALLTG LPF+++  N++ LLLKVQ G+++MP    +S +A+DLI KILV++P +R
Sbjct: 302 GIVLFALLTGHLPFNDD--NIKKLLLKVQSGKYQMP--MNLSAEARDLISKILVINPEKR 357

Query: 274 IKIRDILSHPLLKKYQTIKDSKSIKDLPRENTY-------LYPLADSNN--------HTS 318
           I  ++IL+HPL+KKY  +  +K I+ + R+N         L+ L   NN        H+ 
Sbjct: 358 ITTQEILNHPLIKKYDNLPINKMIRKMKRDNMARGKSNSDLHLL---NNVSPSVVTLHSR 414

Query: 319 ASIDDSILQNLVVLWHGRHADDIVSKLKENGTNKEKILYALLYRFK 364
             ID+SIL++L +LWHG   + I +KL +   ++EK+ Y+LL ++K
Sbjct: 415 GEIDESILRSLQILWHGVSRELITAKLLQKPMSEEKLFYSLLLQYK 460

>Suva_11.123 Chr11 (235064..239644) [4581 bp, 1526 aa] {ON} YKL101W
           (REAL)
          Length = 1526

 Score =  378 bits (970), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 196/403 (48%), Positives = 267/403 (66%), Gaps = 44/403 (10%)

Query: 2   TVANTETHSAAKPSSTIGPWKLGETLGFGSTGKVQLAQHERTGHRTAVKVI-SKSIF--- 57
           TV+ T   S  K   T+GPWKLG+TLG GS+G+V+LA++  TG   A+K++  K  F   
Sbjct: 62  TVSVTTKSSKRKSRDTVGPWKLGKTLGKGSSGRVRLAKNMETGQLAAIKIVPKKKAFVHR 121

Query: 58  NNNGN-----------------------HSNDDSVLPYNIEREIVIMKLLSHPNVLSLYD 94
           +NNG                        HSN     PY IEREIVIMKL+SH NV++L++
Sbjct: 122 SNNGTVPNSYSSSMVTSNVSSPSIVSKEHSNHSQTNPYGIEREIVIMKLISHANVMALFE 181

Query: 95  VWETNNNLYLILEYAEKGELFNLLVDHGPLPEREAINCFRQIIIGISYCHALGIVHRDLK 154
           VWE  + LYL+LEY + GELF+ LV  G LPEREAI+ F+QI+ G+SYCH+  I HRDLK
Sbjct: 182 VWENKSELYLVLEYVDGGELFDYLVSRGKLPEREAIHYFKQIVEGVSYCHSFNICHRDLK 241

Query: 155 PENLLLD-SFYNIKIADFGMAALQTDADLLETSCGSPHYAAPEIVSGLPYEGFASDVWSC 213
           PENLLLD     IKIADFGMAAL+    LL+TSCGSPHYA+PEIV G PY G  SDVWSC
Sbjct: 242 PENLLLDKKNKKIKIADFGMAALELPNKLLKTSCGSPHYASPEIVMGRPYHGGPSDVWSC 301

Query: 214 GVILFALLTGRLPFDEENGNVRDLLLKVQKGQFEMPNDTEISRDAQDLIGKILVVDPRQR 273
           G++LFALLTG LPF+++  N++ LLLKVQ G+++MP    +S +A++LI KILV+DP +R
Sbjct: 302 GIVLFALLTGHLPFNDD--NIKKLLLKVQSGKYQMP--MNLSLEARNLISKILVIDPEKR 357

Query: 274 IKIRDILSHPLLKKYQTIKDSKSIKDLP-------RENTYLYPLADSNN-----HTSASI 321
           I  ++IL HPL+KKY  +  +K ++ +        + N+ L+ L + +      +T   I
Sbjct: 358 ITTQEILEHPLIKKYDNLPVNKMLRKMKGDSMTRGKSNSDLHLLDNVSPSIVTLNTKNEI 417

Query: 322 DDSILQNLVVLWHGRHADDIVSKLKENGTNKEKILYALLYRFK 364
           D+SIL++L +LWHG   + I +KL +   ++EK+ Y+LL R+K
Sbjct: 418 DESILRSLQILWHGVSRELITAKLLQKPMSEEKLFYSLLLRYK 460

>Kpol_431.9 s431 complement(22310..26968) [4659 bp, 1552 aa] {ON}
           complement(22310..26968) [4659 nt, 1553 aa]
          Length = 1552

 Score =  377 bits (969), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 199/411 (48%), Positives = 268/411 (65%), Gaps = 55/411 (13%)

Query: 5   NTETHSAAKPSSTIGPWKLGETLGFGSTGKVQLAQHERTGHRTAVKVISKSI-FNN---- 59
           N++  +  +   T+GPWKLG+TLG GS+G+V+LA++  TG   A+K++ K+  FNN    
Sbjct: 78  NSKNKNKRRTRDTVGPWKLGKTLGKGSSGRVRLAKNIETGKLAAIKIVPKNKKFNNQHRS 137

Query: 60  -NGNHSNDDSVL-----------------------------PYNIEREIVIMKLLSHPNV 89
            N N +N D  L                             PY IEREIVIMKLLSHPNV
Sbjct: 138 KNTNSNNGDLFLSYSSIHNTTNTHNARNTDNTAIENSGGGNPYGIEREIVIMKLLSHPNV 197

Query: 90  LSLYDVWETNNNLYLILEYAEKGELFNLLVDHGPLPEREAINCFRQIIIGISYCHALGIV 149
           ++LY+VWE NN LYL+LEY + GELF+ LV  G L E EA++ F+QII GISYCH+  I 
Sbjct: 198 MALYEVWENNNELYLVLEYVDGGELFDYLVSKGKLTESEAVHYFKQIINGISYCHSFNIC 257

Query: 150 HRDLKPENLLLDSFYN-IKIADFGMAALQTDADLLETSCGSPHYAAPEIVSGLPYEGFAS 208
           HRDLKPENLLLD     IKIADFGMAALQ    LL+TSCGSPHYA+PEIV G  Y G  S
Sbjct: 258 HRDLKPENLLLDKKRRIIKIADFGMAALQVSNRLLQTSCGSPHYASPEIVMGKCYNGAPS 317

Query: 209 DVWSCGVILFALLTGRLPFDEENGNVRDLLLKVQKGQFEMPNDTEISRDAQDLIGKILVV 268
           D+WSCG+ILFALLTG LPF+++  N++ LL+KVQ G+++MP  + IS++A++LI +ILVV
Sbjct: 318 DIWSCGIILFALLTGHLPFNDD--NIKKLLIKVQNGRYQMP--SYISQEAKNLISRILVV 373

Query: 269 DPRQRIKIRDILSHPLLKKY--------QTIKDSKSIKDLPRENTYLYPLADSNNHTS-- 318
           DP +RI    ILSHPLL KY        + +  +  I    + N+ L  L++   +T   
Sbjct: 374 DPSKRISTEQILSHPLLTKYDKRLGKKDRKVTKNNKIMHRGKSNSDLNMLSNIPQNTEIV 433

Query: 319 -----ASIDDSILQNLVVLWHGRHADDIVSKLKENGTNKEKILYALLYRFK 364
                + ID+SIL+NL +LWHG   D I++KL +   ++EK++Y+LL+++K
Sbjct: 434 KLRARSDIDESILKNLQILWHGISRDIIIAKLLQTPMSEEKLIYSLLWKYK 484

>KAFR0D03200 Chr4 (628993..633339) [4347 bp, 1448 aa] {ON} Anc_2.479
           YKL101W
          Length = 1448

 Score =  375 bits (962), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 198/394 (50%), Positives = 264/394 (67%), Gaps = 35/394 (8%)

Query: 2   TVANTETHSAAKPSSTIGPWKLGETLGFGSTGKVQLAQHERTGHRTAVKVISKS-IFNNN 60
           T +     S  K   T+GPWKLG+TLG GS+G+V+LA++  TG   A+K++ K+ IF   
Sbjct: 73  TFSTVTKSSKRKSRDTVGPWKLGKTLGKGSSGRVRLAKNMETGQLAAIKIVPKTKIFRKQ 132

Query: 61  GNHS--------NDDS------------VLPYNIEREIVIMKLLSHPNVLSLYDVWETNN 100
            ++S        ND+S            + PY IEREIVIMKL+SHPNV+ LY+VWE  +
Sbjct: 133 NDNSFQMSSYSSNDESPKHTNNNDTYSKINPYGIEREIVIMKLISHPNVMGLYEVWENKS 192

Query: 101 NLYLILEYAEKGELFNLLVDHGPLPEREAINCFRQIIIGISYCHALGIVHRDLKPENLLL 160
            L+L+LEY + GELF+ LV  G L EREA++ F+QII G+SYCH+  I HRDLKPENLLL
Sbjct: 193 ELFLVLEYVDGGELFDYLVSRGKLSEREAVHYFKQIIEGVSYCHSFNICHRDLKPENLLL 252

Query: 161 DSFYN-IKIADFGMAALQTDADLLETSCGSPHYAAPEIVSGLPYEGFASDVWSCGVILFA 219
           D   N IKIADFGMAAL+    LL TSCGSPHYA+PEIV G  Y G  SDVWSCG+ILFA
Sbjct: 253 DKKINTIKIADFGMAALELPNKLLVTSCGSPHYASPEIVMGKSYHGSPSDVWSCGIILFA 312

Query: 220 LLTGRLPFDEENGNVRDLLLKVQKGQFEMPNDTEISRDAQDLIGKILVVDPRQRIKIRDI 279
           LLTG LPF+++  +++ LLLKVQ G+F+MP +  IS +A+DLI +ILVVDP +RI+I DI
Sbjct: 313 LLTGHLPFNDD--SIKKLLLKVQSGKFQMPQN--ISLEAEDLISRILVVDPEKRIQINDI 368

Query: 280 LSHPLLKKYQTIK-DSKSIKDLPRENTYLYPLADSNN--------HTSASIDDSILQNLV 330
           L HPL++KY+  K DS ++    + +     L   N+             ID+SIL+NL 
Sbjct: 369 LIHPLIRKYEDNKTDSNNVSSYKKSSKSNSNLHILNDMGPSIVTLKARNEIDESILKNLQ 428

Query: 331 VLWHGRHADDIVSKLKENGTNKEKILYALLYRFK 364
           +LWHG   + I+SKL +   ++EK+ Y+LL ++K
Sbjct: 429 ILWHGTSRELIISKLLQTPMSEEKLFYSLLLQYK 462

>Smik_11.139 Chr11 (235511..240115) [4605 bp, 1534 aa] {ON} YKL101W
           (REAL)
          Length = 1534

 Score =  373 bits (958), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 193/406 (47%), Positives = 266/406 (65%), Gaps = 50/406 (12%)

Query: 2   TVANTETHSAAKPSSTIGPWKLGETLGFGSTGKVQLAQHERTGHRTAVKVI--------- 52
           T++     S  K   T+GPWKLG+TLG GS+G+V+LA++  TG   A+K++         
Sbjct: 62  TISAATKSSKRKSRDTVGPWKLGKTLGKGSSGRVRLAKNMETGQLAAIKIVPKKKAFVHR 121

Query: 53  ----------SKSIFNNN--------GNHSNDDSVLPYNIEREIVIMKLLSHPNVLSLYD 94
                     S S+  +N          +SN     PY IEREIVIMKL+SH NV++L++
Sbjct: 122 STNGTMPNSYSSSMVTSNVSSPSIVSKEYSNHSQTNPYGIEREIVIMKLISHTNVMALFE 181

Query: 95  VWETNNNLYLILEYAEKGELFNLLVDHGPLPEREAINCFRQIIIGISYCHALGIVHRDLK 154
           VWE  + LYL+LEY + GELF+ LV  G LPEREAI+ F+QI+ G+SYCH+  I HRDLK
Sbjct: 182 VWENKSELYLVLEYVDGGELFDYLVSKGKLPEREAIHYFKQIVEGVSYCHSFNICHRDLK 241

Query: 155 PENLLLD-SFYNIKIADFGMAALQTDADLLETSCGSPHYAAPEIVSGLPYEGFASDVWSC 213
           PENLLLD     IKIADFGMAAL+    LL+TSCGSPHYA+PEIV G PY G  SDVWSC
Sbjct: 242 PENLLLDKKNRRIKIADFGMAALELPNKLLKTSCGSPHYASPEIVMGRPYHGGPSDVWSC 301

Query: 214 GVILFALLTGRLPFDEENGNVRDLLLKVQKGQFEMPNDTEISRDAQDLIGKILVVDPRQR 273
           G++LFALLTG LPF+++  N++ LLLKVQ G+++MP    +S +A+DLI KILV+DP +R
Sbjct: 302 GIVLFALLTGHLPFNDD--NIKKLLLKVQSGKYQMP--MNLSAEARDLISKILVIDPAKR 357

Query: 274 IKIRDILSHPLLKKYQTIKDSKSIKDLPRENTY-------LYPLADSNN--------HTS 318
           I  ++IL HPL+KKY  +  +K ++ + R+N         L+ L   NN        ++ 
Sbjct: 358 ITTQEILKHPLIKKYDDLPVNKILRKMKRDNMARGKSNSDLHLL---NNVSPSIVTLYSR 414

Query: 319 ASIDDSILQNLVVLWHGRHADDIVSKLKENGTNKEKILYALLYRFK 364
           + ID+SIL++L +LWHG   + I +KL +   ++EK+ Y+LL ++K
Sbjct: 415 SDIDESILRSLQILWHGVSRELITAKLLQKPMSEEKLFYSLLLQYK 460

>TDEL0A02550 Chr1 (457841..461950) [4110 bp, 1369 aa] {ON} Anc_2.479
           YKL101W
          Length = 1369

 Score =  367 bits (943), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 193/395 (48%), Positives = 258/395 (65%), Gaps = 55/395 (13%)

Query: 17  TIGPWKLGETLGFGSTGKVQLAQHERTGHRTAVKVISK---------------------- 54
           T+GPWKLG+TLG GS+G+V+LA++  TG   A+K++ K                      
Sbjct: 75  TVGPWKLGKTLGKGSSGRVRLAKNMETGQLAAIKIVPKKNNVLGKNDACSTSSASYTSNS 134

Query: 55  ----SIFNNNGN------HSNDDSVLPYNIEREIVIMKLLSHPNVLSLYDVWETNNNLYL 104
               ++ N   N      HSN  +  PY IEREIVIMKL+SH NVL LY+VWE  + LYL
Sbjct: 135 SQTSTMMNTTANNYTTAGHSNV-ATNPYGIEREIVIMKLISHANVLGLYEVWENKSELYL 193

Query: 105 ILEYAEKGELFNLLVDHGPLPEREAINCFRQIIIGISYCHALGIVHRDLKPENLLLDSFY 164
           +LEY + GELF+ LV  G L EREA++ F+QII G+SYCHA  I HRDLKPENLLLD   
Sbjct: 194 VLEYVDGGELFDYLVSRGRLCEREAVHYFKQIIQGVSYCHAFNICHRDLKPENLLLDKKN 253

Query: 165 N-IKIADFGMAALQTDADLLETSCGSPHYAAPEIVSGLPYEGFASDVWSCGVILFALLTG 223
           + IKIADFGMAAL+    LL+TSCGSPHYA+PEIV G  Y G  SDVWSCG+ILFALLTG
Sbjct: 254 STIKIADFGMAALEVSNKLLQTSCGSPHYASPEIVMGKQYHGGPSDVWSCGIILFALLTG 313

Query: 224 RLPFDEENGNVRDLLLKVQKGQFEMPNDTEISRDAQDLIGKILVVDPRQRIKIRDILSHP 283
            LPF+++  +++ LLLKVQ G+++MP +  +S++AQDLI KIL V+P +R+   +IL HP
Sbjct: 314 HLPFNDD--SIKKLLLKVQSGKYQMPQN--LSKEAQDLIAKILTVNPAKRLTTEEILRHP 369

Query: 284 LLKKYQTIKDSKSIKDL------PRENTYLYPLADSNNHTSAS--------IDDSILQNL 329
           L+ KY ++  +K  K L       + N  L+ L   NN+ + +        IDD+IL NL
Sbjct: 370 LIVKYDSMMKTKKYKALYKNMGQGKSNADLHLL---NNYEATTINLNSRKDIDDTILNNL 426

Query: 330 VVLWHGRHADDIVSKLKENGTNKEKILYALLYRFK 364
            +LWHG   + IV+KL +   ++EK+ Y+LL ++K
Sbjct: 427 QILWHGASRELIVAKLLQPRMSEEKVFYSLLLKYK 461

>NCAS0A05770 Chr1 (1132854..1137239) [4386 bp, 1461 aa] {ON}
           Anc_2.479
          Length = 1461

 Score =  368 bits (944), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 195/395 (49%), Positives = 266/395 (67%), Gaps = 43/395 (10%)

Query: 6   TETHSAAKPS-STIGPWKLGETLGFGSTGKVQLAQHERTGHRTAVKVISK---------- 54
           T+T S+ + S  T+GPWKLG+TLG GS+G+V+LA++  TG   A+K++ K          
Sbjct: 85  TDTKSSKRKSRDTVGPWKLGKTLGKGSSGRVRLAKNIETGQLAAIKIVPKKHKLFMKSSH 144

Query: 55  ---SIFNNNGNHSNDDSVL----------------PYNIEREIVIMKLLSHPNVLSLYDV 95
              S F+   N +++ S L                PY IEREIVIMKL+SHPNV++LY+V
Sbjct: 145 SNVSFFSAASNSNSNISTLATSPPMNNGSEKNQPNPYGIEREIVIMKLISHPNVMALYEV 204

Query: 96  WETNNNLYLILEYAEKGELFNLLVDHGPLPEREAINCFRQIIIGISYCHALGIVHRDLKP 155
           WE  + LYL+LEY + GELF+ LV  G L E+EA++ F+QII G+SYCH+  I HRDLKP
Sbjct: 205 WENKSELYLVLEYVDGGELFDYLVSKGKLSEKEAVHYFKQIIQGVSYCHSFNICHRDLKP 264

Query: 156 ENLLLDSF-YNIKIADFGMAALQTDADLLETSCGSPHYAAPEIVSGLPYEGFASDVWSCG 214
           ENLLLD    +IKIADFGMAAL+    LL+TSCGSPHYA+PEIV G  Y G  SDVWSCG
Sbjct: 265 ENLLLDKKNKSIKIADFGMAALELPNKLLQTSCGSPHYASPEIVMGKSYHGGPSDVWSCG 324

Query: 215 VILFALLTGRLPFDEENGNVRDLLLKVQKGQFEMPNDTEISRDAQDLIGKILVVDPRQRI 274
           +ILFALLTG LPF+++  N++ LLLKVQ G+F MP  + +S +AQDLI +ILV+DP +RI
Sbjct: 325 IILFALLTGHLPFNDD--NIKKLLLKVQAGKFRMP--STLSPEAQDLISRILVIDPSKRI 380

Query: 275 KIRDILSHPLLKKYQ----TIKDSKSIKDLP-RENTYLYPLADSNNHTSASIDDSILQNL 329
               IL+HPL+ KY+     +   KS  DL   E+    P++ ++ +    ID SIL+NL
Sbjct: 381 TTDRILNHPLILKYEPAGKNMVSGKSNSDLHVLEHISPQPISLTSRN---DIDASILKNL 437

Query: 330 VVLWHGRHADDIVSKLKENGTNKEKILYALLYRFK 364
            +LWHG   + I++KL +   ++EK+ Y+LL+++K
Sbjct: 438 QILWHGTSRELIIAKLLQTPMSEEKLFYSLLWQYK 472

>TBLA0I01150 Chr9 complement(235187..240424) [5238 bp, 1745 aa] {ON}
           Anc_2.479 YKL101W
          Length = 1745

 Score =  369 bits (946), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 196/395 (49%), Positives = 258/395 (65%), Gaps = 37/395 (9%)

Query: 2   TVANTETHSAAKPSSTIGPWKLGETLGFGSTGKVQLAQHERTGHRTAVKVISKSIFNNN- 60
           T ANT++ S  K   T+GPWKLG+TLG GS+G+V+LA++ +TG   A+K++ K+  +   
Sbjct: 55  TNANTQS-SKRKTRDTVGPWKLGKTLGKGSSGRVRLAKNMKTGQLAAIKIVPKNFHSKKK 113

Query: 61  -----------------GNHSNDD--SVLPYNIEREIVIMKLLSHPNVLSLYDVWETNNN 101
                              HSN+   S   Y IEREIVIMKL+SHPNV+ LY+VWE  + 
Sbjct: 114 RQDSPAKSLSSSPDKPYTTHSNETNPSNNSYGIEREIVIMKLISHPNVMGLYEVWENKSE 173

Query: 102 LYLILEYAEKGELFNLLVDHGPLPEREAINCFRQIIIGISYCHALGIVHRDLKPENLLLD 161
           LYL+LEY + GELF+ LV  G LPEREA++ F+QII G++YCHA  I HRDLKPENLLLD
Sbjct: 174 LYLVLEYVDGGELFDYLVSRGKLPEREAVHYFKQIIQGVAYCHAFNICHRDLKPENLLLD 233

Query: 162 SFYN-IKIADFGMAALQTDADLLETSCGSPHYAAPEIVSGLPYEGFASDVWSCGVILFAL 220
                IKIADFGMAAL+    LL TSCGSPHYA+PEIV G  Y G  +DVWSCG+ILFAL
Sbjct: 234 KKNKIIKIADFGMAALEVSDKLLSTSCGSPHYASPEIVMGKSYHGSPTDVWSCGIILFAL 293

Query: 221 LTGRLPFDEENGNVRDLLLKVQKGQFEMPNDTEISRDAQDLIGKILVVDPRQRIKIRDIL 280
           LTG LPF+ +  N++ LLLKVQ G + MP+D  +S DA+DLI KILVVDP +R+   +IL
Sbjct: 294 LTGHLPFNHD--NIKKLLLKVQSGVYHMPSD--LSPDAKDLISKILVVDPDKRLTTTEIL 349

Query: 281 SHPLLKKYQ----TIKDSKSIKDLPRE--NTYLYPLADSNN-----HTSASIDDSILQNL 329
           +H L+ KY     T ++  +   + R+  N+ L  + + +N          ID SIL NL
Sbjct: 350 NHSLITKYDRMGLTNRNYNNNLSMARDKSNSNLNFINNLSNVDILLQNPCDIDTSILSNL 409

Query: 330 VVLWHGRHADDIVSKLKENGTNKEKILYALLYRFK 364
            +LWHG     I+ KL +   N+EK+ Y+LL ++K
Sbjct: 410 QILWHGESKHAIIDKLLQPNMNEEKLFYSLLLKYK 444

>ZYRO0G03366g Chr7 (261014..265864) [4851 bp, 1616 aa] {ON} similar
           to uniprot|P34244 Saccharomyces cerevisiae YKL101W HSL1
           Nim1p-related protein kinase that regulates the
           morphogenesis and septin checkpoints associates with the
           assembled septin filament required along with Hsl7p for
           bud neck recruitment phosphorylation and degradation of
           Swe1p
          Length = 1616

 Score =  366 bits (939), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 193/413 (46%), Positives = 264/413 (63%), Gaps = 53/413 (12%)

Query: 1   MTVANTETHSAAKPSSTIGPWKLGETLGFGSTGKVQLAQHERTGHRTAVKVISKSIFNNN 60
            +++ T   S  +   T+GPWKLG+TLG GS+G+V+LA++  TG   A+K++ K    N+
Sbjct: 81  FSISTTTKSSKRRSRDTVGPWKLGKTLGKGSSGRVRLAKNMETGQLAAIKIVPKKKCKND 140

Query: 61  -------------------------------GNHSN----DDSVLPYNIEREIVIMKLLS 85
                                          G ++N    +    PY IEREIVIMKL+S
Sbjct: 141 PGSHSSSKSTESDFSATMNTTTNTNRATTNGGTNANAGPSEVPANPYGIEREIVIMKLIS 200

Query: 86  HPNVLSLYDVWETNNNLYLILEYAEKGELFNLLVDHGPLPEREAINCFRQIIIGISYCHA 145
           H N+L LY+VWE  + LYL+LEY + GELF+ LV  G L EREA++ F+QI+ G+SYCH+
Sbjct: 201 HSNILGLYEVWENKSELYLVLEYVDGGELFDYLVSRGKLGEREAVHYFKQIVQGVSYCHS 260

Query: 146 LGIVHRDLKPENLLLDSF-YNIKIADFGMAALQTDADLLETSCGSPHYAAPEIVSGLPYE 204
             I HRDLKPENLLLD    +IKIADFGMAAL+    LL+TSCGSPHYA+PEIV G PY 
Sbjct: 261 FNICHRDLKPENLLLDKKNKSIKIADFGMAALEVSNKLLQTSCGSPHYASPEIVMGRPYH 320

Query: 205 GFASDVWSCGVILFALLTGRLPFDEENGNVRDLLLKVQKGQFEMPNDTEISRDAQDLIGK 264
           G  SDVWSCG+ILFALLTG LPF+++  N++ LLLKVQ G+F MP +  +S +A+DL+ K
Sbjct: 321 GGPSDVWSCGIILFALLTGHLPFNDD--NIKKLLLKVQSGKFHMPQN--LSAEAKDLMSK 376

Query: 265 ILVVDPRQRIKIRDILSHPLLKKY----QTIKDSKSIKDLP----RENTYLYPLADSNNH 316
           ILVV+P +RI   +IL+HPLL KY    + +K   S+  +     + N+ L+ L  SN++
Sbjct: 377 ILVVNPFKRIATEEILNHPLLTKYDKLVKPVKYRSSVNPVALSQGKSNSDLHVLDASNSN 436

Query: 317 -----TSASIDDSILQNLVVLWHGRHADDIVSKLKENGTNKEKILYALLYRFK 364
                +   IDDSI+ NL +LWHG   + IV+KL +   ++EK+ Y+LL  +K
Sbjct: 437 IVDLRSREDIDDSIVSNLQILWHGASRELIVAKLLQPRMSEEKLFYSLLLSYK 489

>CAGL0K08514g Chr11 complement(854143..858612) [4470 bp, 1489 aa]
           {ON} similar to uniprot|P34244 Saccharomyces cerevisiae
           YKL101w serine/threonine-protein kinase
          Length = 1489

 Score =  361 bits (927), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 194/400 (48%), Positives = 258/400 (64%), Gaps = 44/400 (11%)

Query: 4   ANTETHSAAKPSSTIGPWKLGETLGFGSTGKVQLAQHERTGHRTAVKVISKSIFN----- 58
           +N    S  K   T+GPWKLG+TLG GS+G+V+LA++   G   A+K++ K  +N     
Sbjct: 76  SNNTKSSKRKSRDTVGPWKLGKTLGKGSSGRVRLAKNIENGTLAAIKIVPKRTYNRRMRD 135

Query: 59  ---------NNGNHSND------------DSVL-PYNIEREIVIMKLLSHPNVLSLYDVW 96
                    ++G  S D            DS L PY IEREIVIMKL+SHPNV+ L +VW
Sbjct: 136 QKMKTAGGVSSGTDSKDSSNREDPIKNGTDSALNPYGIEREIVIMKLISHPNVMGLLEVW 195

Query: 97  ETNNNLYLILEYAEKGELFNLLVDHGPLPEREAINCFRQIIIGISYCHALGIVHRDLKPE 156
           E  + LYL+LEY + GELF+ LV  G L E EA++ F QII G+SYCH+  I HRDLKPE
Sbjct: 196 ENKSELYLVLEYVDGGELFDYLVSKGKLSEPEAVHYFTQIIQGVSYCHSFNICHRDLKPE 255

Query: 157 NLLLDSFYN-IKIADFGMAALQTDADLLETSCGSPHYAAPEIVSGLPYEGFASDVWSCGV 215
           NLLLD     IKIADFGMAAL+    LLETSCGSPHYA+PEIV G PY G  SDVWSCG+
Sbjct: 256 NLLLDKKNKVIKIADFGMAALELPNKLLETSCGSPHYASPEIVMGKPYHGGPSDVWSCGI 315

Query: 216 ILFALLTGRLPFDEENGNVRDLLLKVQKGQFEMPNDTEISRDAQDLIGKILVVDPRQRIK 275
           ILFALLTG LPF+++  N++ LLLKVQ G+F++P    ++ DA+DLI +ILV +P +R+ 
Sbjct: 316 ILFALLTGHLPFNDD--NIKKLLLKVQAGRFQLP--PYLTNDAKDLITRILVTNPEKRLT 371

Query: 276 IRDILSHPLLKKYQTIKDSKSIKDL-----PRENTYLYPL-----ADSNNHTSASIDDSI 325
           I +IL+HPL+KKY+       I+ L      + N+ L+ L     A    ++   ID SI
Sbjct: 372 INEILNHPLIKKYRN--PPAHIRKLNLLGRGKSNSDLHVLEYNTPATVCLNSEEDIDQSI 429

Query: 326 LQNLVVLWHGRHADDIVSKLKENGTNKEKILYALLYRFKL 365
           L++L +LWHG     +V +L   G  +EK+ Y+LL+++KL
Sbjct: 430 LKSLQILWHGTPRQRLVERLLVEGATEEKLFYSLLFQYKL 469

>TPHA0G03200 Chr7 (683296..687900) [4605 bp, 1534 aa] {ON} Anc_2.479
           YKL101W
          Length = 1534

 Score =  353 bits (906), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 195/427 (45%), Positives = 261/427 (61%), Gaps = 85/427 (19%)

Query: 18  IGPWKLGETLGFGSTGKVQLAQHERTGHRTAVKVISKSI---FNN-----NG-------- 61
           IGPWKLG+TLG GS+G+V+LA+++ TG   A+K++ KS    FNN     NG        
Sbjct: 93  IGPWKLGKTLGKGSSGRVRLAKNKETGQLAAIKIVPKSKSTKFNNAKKNGNGKDNTYDNK 152

Query: 62  ------------NHS------------------------------NDDSVLPYNIEREIV 79
                       NHS                              N D+   Y IEREIV
Sbjct: 153 PHLSYSSLHNRSNHSVLHNPSFLMDNSIIKNELGSDLDDDGNDSRNKDNSNRYGIEREIV 212

Query: 80  IMKLLSHPNVLSLYDVWETNNNLYLILEYAEKGELFNLLVDHGPLPEREAINCFRQIIIG 139
           IMKL+SHPNV++LY+VWE  N LYL+LEY + GELF+ LV  G L E EA+  F+QII G
Sbjct: 213 IMKLVSHPNVMALYEVWENKNELYLVLEYVDGGELFDYLVSKGKLTELEAVRYFKQIIRG 272

Query: 140 ISYCHALGIVHRDLKPENLLLDSFYN-IKIADFGMAALQTDADLLETSCGSPHYAAPEIV 198
           + YCH+  I HRDLKPENLLLD     IKIADFGMAALQ    LL+TSCGSPHYA+PEIV
Sbjct: 273 VQYCHSFNICHRDLKPENLLLDKKRKLIKIADFGMAALQVSNTLLKTSCGSPHYASPEIV 332

Query: 199 SGLPYEGFASDVWSCGVILFALLTGRLPFDEENGNVRDLLLKVQKGQFEMPNDTEISRDA 258
            G  Y G  SDVWSCG+ILFALLTG LPF+++  +++ LL+KVQ G+++MPN   +S+DA
Sbjct: 333 MGKTYNGGPSDVWSCGIILFALLTGHLPFNDD--SIKKLLIKVQNGRYQMPN--YLSKDA 388

Query: 259 QDLIGKILVVDPRQRIKIRDILSHPLLKKY--------------QTIKDSKSIKDLPREN 304
           +DLI +IL+V+P+ R+    IL HPL+ KY              Q IK+  ++    + N
Sbjct: 389 KDLISRILLVNPKARLTTEQILEHPLITKYDNQYSLKKENKLTKQAIKNYNNLM-RGKSN 447

Query: 305 TYLYPLADSNNHTSA-------SIDDSILQNLVVLWHGRHADDIVSKLKENGTNKEKILY 357
           T L  L +  + T          IDDSIL+NL +LW+G   + ++SKL ++  ++EK++Y
Sbjct: 448 TDLAILQNIPDKTDIIQLRSRNDIDDSILRNLQILWNGVPRETLISKLIQDPVSEEKLIY 507

Query: 358 ALLYRFK 364
           +LL+++K
Sbjct: 508 SLLWQYK 514

>NDAI0D02750 Chr4 (639802..644349) [4548 bp, 1515 aa] {ON} Anc_2.479
           YKL101W
          Length = 1515

 Score =  318 bits (816), Expect = 3e-90,   Method: Compositional matrix adjust.
 Identities = 163/298 (54%), Positives = 213/298 (71%), Gaps = 9/298 (3%)

Query: 72  YNIEREIVIMKLLSHPNVLSLYDVWETNNNLYLILEYAEKGELFNLLVDHGPLPEREAIN 131
           Y IEREIVIMKL+SHPNV+ LY+VWE  + LYLILEY + GELF+ LV  G LPE EAI+
Sbjct: 197 YGIEREIVIMKLISHPNVMGLYEVWENKSELYLILEYVDGGELFDYLVSRGKLPEAEAIH 256

Query: 132 CFRQIIIGISYCHALGIVHRDLKPENLL-LDSFYNIKIADFGMAALQTDADLLETSCGSP 190
            F+QII G+SYCH+  I HRDLKPENLL      +IKIADFGMAAL+    LL+TSCGSP
Sbjct: 257 YFKQIIQGVSYCHSFNICHRDLKPENLLIDKKKKSIKIADFGMAALELPKKLLQTSCGSP 316

Query: 191 HYAAPEIVSGLPYEGFASDVWSCGVILFALLTGRLPFDEENGNVRDLLLKVQKGQFEMPN 250
           HYA+PEIV G  Y G  SDVWSCG+ILFALLTG LPF+++  N++ LLLKVQ G+++MP 
Sbjct: 317 HYASPEIVMGKSYHGGPSDVWSCGIILFALLTGHLPFNDD--NIKKLLLKVQAGKYQMPK 374

Query: 251 DTEISRDAQDLIGKILVVDPRQRIKIRDILSHPLLKKYQ-TIKDSKSIKDLPRENTYLYP 309
           +  +S +A+DLI +ILVV P +R+   +IL+HPL+ KY+ + K    +K     + +L  
Sbjct: 375 N--LSDEAKDLISRILVVSPSKRLTTVEILNHPLILKYEKSSKKKHMVKGKSNSDLHLLD 432

Query: 310 LADSNNHTSAS---IDDSILQNLVVLWHGRHADDIVSKLKENGTNKEKILYALLYRFK 364
                N T  S   ID+SIL+NL +LWHG   D I++KL +   ++EK+ Y+LL ++K
Sbjct: 433 SISPENITLNSRMDIDESILKNLQILWHGTSRDIIIAKLLQKPISEEKLFYSLLLQYK 490

 Score = 57.0 bits (136), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 26/53 (49%), Positives = 38/53 (71%), Gaps = 1/53 (1%)

Query: 3   VANTETHSAAKPS-STIGPWKLGETLGFGSTGKVQLAQHERTGHRTAVKVISK 54
             NT T S+ + S  T+GPWKLG+TLG GS+G+V+LA++  TG   A+K++ K
Sbjct: 74  TTNTNTKSSKRKSRDTVGPWKLGKTLGKGSSGRVRLAKNVETGQLAAIKIVPK 126

>TPHA0C00470 Chr3 (81482..83377) [1896 bp, 631 aa] {ON} Anc_5.611
           YDR477W
          Length = 631

 Score =  241 bits (614), Expect = 1e-67,   Method: Compositional matrix adjust.
 Identities = 124/271 (45%), Positives = 175/271 (64%), Gaps = 13/271 (4%)

Query: 16  STIGPWKLGETLGFGSTGKVQLAQHERTGHRTAVKVISKSIFNNNGNHSNDDSVLPYNIE 75
           S IG +++ +TLG GS GKV+LA H  T  + A+K+I+K + +         S +   IE
Sbjct: 25  SKIGNYQIVKTLGEGSFGKVKLAFHSTTRQKVALKIINKKVLSK--------SDMQGRIE 76

Query: 76  REIVIMKLLSHPNVLSLYDVWETNNNLYLILEYAEKGELFNLLVDHGPLPEREAINCFRQ 135
           REI  ++LL HP+++ LYDV ++ + + +++EYA+  ELF+ +V    + E E    F+Q
Sbjct: 77  REISYLRLLRHPHIIKLYDVIKSKDEIIMVIEYADH-ELFDYIVQREKMSENEGRRFFQQ 135

Query: 136 IIIGISYCHALGIVHRDLKPENLLLDSFYNIKIADFGMAALQTDADLLETSCGSPHYAAP 195
           II  + YCH   IVHRDLKPENLLLD  YN+KI DFG++ + TD + L+TSCGSP+YAAP
Sbjct: 136 IISAVEYCHRHKIVHRDLKPENLLLDEHYNVKITDFGLSNIITDGNFLKTSCGSPNYAAP 195

Query: 196 EIVSGLPYEGFASDVWSCGVILFALLTGRLPFDEENGNVRDLLLKVQKGQFEMPNDTEIS 255
           E++SG  Y G   DVWSCGVIL+ LL  RLPFD+E  ++  L   +  G + +PN   +S
Sbjct: 196 EVISGKLYAGPEVDVWSCGVILYVLLCRRLPFDDE--SIPTLFKNINNGVYTIPN--FLS 251

Query: 256 RDAQDLIGKILVVDPRQRIKIRDILSHPLLK 286
             A  LI K+L+V+P  RI I DI+  P  K
Sbjct: 252 EGAASLIKKMLIVNPMNRITIGDIIQDPWFK 282

>CAGL0M08910g Chr13 complement(887703..889541) [1839 bp, 612 aa]
           {ON}
          Length = 612

 Score =  239 bits (611), Expect = 2e-67,   Method: Compositional matrix adjust.
 Identities = 123/277 (44%), Positives = 177/277 (63%), Gaps = 13/277 (4%)

Query: 10  SAAKPSSTIGPWKLGETLGFGSTGKVQLAQHERTGHRTAVKVISKSIFNNNGNHSNDDSV 69
           S+    S +G +++ +TLG GS GKV+LA H  TG + A+K+I+K +           S 
Sbjct: 28  SSLADGSRVGNYQIVKTLGEGSFGKVKLAYHVTTGQKVALKIINKKVLAK--------SD 79

Query: 70  LPYNIEREIVIMKLLSHPNVLSLYDVWETNNNLYLILEYAEKGELFNLLVDHGPLPEREA 129
           +   IEREI  ++LL HP+++ LYDV ++ + + +++EYA   ELF+ +V    + E+EA
Sbjct: 80  MQGRIEREISYLRLLRHPHIIKLYDVIKSKDEIIMVIEYA-GNELFDYIVQRNKMSEQEA 138

Query: 130 INCFRQIIIGISYCHALGIVHRDLKPENLLLDSFYNIKIADFGMAALQTDADLLETSCGS 189
              F+QII  + YCH   IVHRDLKPENLLLD   N+KIADFG++ + TD + L+TSCGS
Sbjct: 139 RRFFQQIISAVEYCHRHKIVHRDLKPENLLLDEHLNVKIADFGLSNIMTDGNFLKTSCGS 198

Query: 190 PHYAAPEIVSGLPYEGFASDVWSCGVILFALLTGRLPFDEENGNVRDLLLKVQKGQFEMP 249
           P+YAAPE++SG  Y G   DVWSCGVIL+ +L  RLPFD+E+  V  L   +  G + +P
Sbjct: 199 PNYAAPEVISGKLYAGPEVDVWSCGVILYVMLCRRLPFDDESIPV--LFKNISNGVYTLP 256

Query: 250 NDTEISRDAQDLIGKILVVDPRQRIKIRDILSHPLLK 286
               +S  A DLI ++L+V+P  RI I +I+     K
Sbjct: 257 K--FLSPGASDLIKRMLIVNPLNRISIHEIMQDEWFK 291

>KLLA0A03806g Chr1 complement(338807..340615) [1809 bp, 602 aa] {ON}
           highly similar to uniprot|P06782 Saccharomyces
           cerevisiae YDR477W SNF1 Protein serine/threonine kinase
           required for release from glucose repression invertase
           expression sporulation and for expression of catabolite-
           repressed genes when glucose is limiting regulates
           Adr1p- dependent transcription primarily at the level of
           chromatin binding
          Length = 602

 Score =  238 bits (608), Expect = 4e-67,   Method: Compositional matrix adjust.
 Identities = 136/325 (41%), Positives = 193/325 (59%), Gaps = 40/325 (12%)

Query: 18  IGPWKLGETLGFGSTGKVQLAQHERTGHRTAVKVISKSIFNNNGNHSNDDSVLPYNIERE 77
           IG +++ +TLG GS GKV+LA H  TG + A+K+I+K +           S +   IERE
Sbjct: 32  IGKYQIIKTLGEGSFGKVKLAYHISTGQKVALKIINKKVLAK--------SDMQGRIERE 83

Query: 78  IVIMKLLSHPNVLSLYDVWETNNNLYLILEYAEKGELFNLLVDHGPLPEREAINCFRQII 137
           I  ++LL HP+++ LYDV ++ + + +++EYA   ELF+ +V    +PE+EA   F+QII
Sbjct: 84  ISYLRLLRHPHIIKLYDVIKSKDEIIMVIEYA-GNELFDYIVQRDKMPEQEARRFFQQII 142

Query: 138 IGISYCHALGIVHRDLKPENLLLDSFYNIKIADFGMAALQTDADLLETSCGSPHYAAPEI 197
             + YCH   IVHRDLKPENLLLD   N+KIADFG++ + TD + L+TSCGSP+YAAPE+
Sbjct: 143 SAVDYCHRHKIVHRDLKPENLLLDEHLNVKIADFGLSNIMTDGNFLKTSCGSPNYAAPEV 202

Query: 198 VSGLPYEGFASDVWSCGVILFALLTGRLPFDEENGNVRDLLLKVQKGQFEMPNDTEISRD 257
           +SG  Y G   DVWS GVIL+ +L  RLPFD+E+  V  L   +  G + +PN   +S+ 
Sbjct: 203 ISGKLYAGPEVDVWSSGVILYVMLCRRLPFDDESIPV--LFKNISNGVYTIPN--FLSQG 258

Query: 258 AQDLIGKILVVDPRQRIKIRDILSHPLLKKYQTIKDSKSIKDLPRENTYLYPLADSNNHT 317
           A  LI K+L+V+P  RI + +I+     K            DLP    YL P   ++   
Sbjct: 259 AASLIKKMLIVNPVNRITVHEIMQDEWFK-----------VDLP---DYLVPAESTHQEN 304

Query: 318 SAS-------------IDDSILQNL 329
           S S             IDDS++Q L
Sbjct: 305 SESKTEDGGPSVPLELIDDSLVQTL 329

>Kpol_495.14 s495 (33810..35684) [1875 bp, 624 aa] {ON}
           (33810..35684) [1875 nt, 625 aa]
          Length = 624

 Score =  239 bits (610), Expect = 4e-67,   Method: Compositional matrix adjust.
 Identities = 124/276 (44%), Positives = 176/276 (63%), Gaps = 13/276 (4%)

Query: 11  AAKPSSTIGPWKLGETLGFGSTGKVQLAQHERTGHRTAVKVISKSIFNNNGNHSNDDSVL 70
           A    S IG +++ +TLG GS GKV+LA H  TG + A+K+I++ + +         S +
Sbjct: 32  ALSDGSRIGNYQIVKTLGEGSFGKVKLAFHVTTGQKVALKIINRKVLSK--------SDM 83

Query: 71  PYNIEREIVIMKLLSHPNVLSLYDVWETNNNLYLILEYAEKGELFNLLVDHGPLPEREAI 130
              IEREI  ++LL HP+++ LYDV ++ + + +I+EYA   ELF+ +V    + E EA 
Sbjct: 84  QGRIEREIAYLRLLRHPHIIRLYDVIKSKDEIIMIIEYAHH-ELFDYIVQRDKMSENEAR 142

Query: 131 NCFRQIIIGISYCHALGIVHRDLKPENLLLDSFYNIKIADFGMAALQTDADLLETSCGSP 190
             F+QII  + YCH   IVHRDLKPENLLLD  YN+KI DFG++ + TD + L+TSCGSP
Sbjct: 143 KFFQQIISAVDYCHRHMIVHRDLKPENLLLDEHYNVKITDFGLSNIMTDGNFLKTSCGSP 202

Query: 191 HYAAPEIVSGLPYEGFASDVWSCGVILFALLTGRLPFDEENGNVRDLLLKVQKGQFEMPN 250
           +YAAPE++SG  Y G   DVWSCGVIL+ +L  RLPFD+E+  +  L   +  G + +PN
Sbjct: 203 NYAAPEVISGKLYAGPEVDVWSCGVILYVMLCRRLPFDDESIPI--LFKNISNGIYTLPN 260

Query: 251 DTEISRDAQDLIGKILVVDPRQRIKIRDILSHPLLK 286
              +S  A  LI K+L+V+P  RI I +I+     K
Sbjct: 261 --FLSDGAASLIKKMLIVNPINRISISEIMQDEWFK 294

>Kwal_33.13225 s33 (127676..130570) [2895 bp, 964 aa] {ON} YFR016C -
           Hypothetical ORF [contig 120] FULL
          Length = 964

 Score =  245 bits (626), Expect = 4e-67,   Method: Compositional matrix adjust.
 Identities = 118/167 (70%), Positives = 137/167 (82%), Gaps = 4/167 (2%)

Query: 201 LPYEGFASDVWSCGVILFALLTGRLPFDEENGNVRDLLLKVQKGQFEMPNDTEISRDAQD 260
           LPY GF SDVWSCG+ILFALLTGRLPFDEE+GN+R+LLLKVQ GQFEMP+  EIS +AQD
Sbjct: 10  LPYHGFESDVWSCGIILFALLTGRLPFDEEDGNIRNLLLKVQSGQFEMPDSDEISPEAQD 69

Query: 261 LIGKILVVDPRQRIKIRDILSHPLLKKYQTIKDSKSIKDLPRENTYLYPLADSNNHTSAS 320
           LI KIL VDP  RIK R+IL HPLL+KY +IKDSKSI++LPRE+TYL PL DS N    S
Sbjct: 70  LIAKILTVDPAARIKSREILKHPLLQKYPSIKDSKSIRNLPREDTYLNPL-DSVN---GS 125

Query: 321 IDDSILQNLVVLWHGRHADDIVSKLKENGTNKEKILYALLYRFKLDS 367
           ID+SI+ NLVVLWHGR  ++I ++LKE G N EK  YALL+RFK DS
Sbjct: 126 IDESIINNLVVLWHGRDRNEITAQLKEPGANLEKTFYALLFRFKHDS 172

 Score =  184 bits (467), Expect = 5e-47,   Method: Compositional matrix adjust.
 Identities = 197/648 (30%), Positives = 277/648 (42%), Gaps = 149/648 (22%)

Query: 507  DDDWEYIEKDAKRTSSNFATLIDEIFEPEKFELAKREKAELQRKVQEAK----------- 555
            D+DWEYIEK+ +RTS++FATL DEIFE EK+E  ++EK EL+R+V+EAK           
Sbjct: 343  DNDWEYIEKETRRTSADFATLCDEIFEHEKYEQIRKEKEELERRVREAKEQEELERRQRE 402

Query: 556  ---------------------------------------RQSVNAQKINEDEFGSEVSDG 576
                                                   +QSVN Q  ++      VS  
Sbjct: 403  EEERLQREMELQHQMRLEEESRRRQRETQELIEQEIALLKQSVNPQGPSDSNHVRSVSAP 462

Query: 577  MKELKKINDKVSSPLINYEFSQQELLQDIDTLLTNRYQLSSYTRPISRLDPGLTPVTETL 636
             + + K++ + S+           L  DI  LL NR   S  TRP SRLDPG+   +E  
Sbjct: 463  AESVLKVDKRGST---------GNLDNDIMALL-NRRTFSLETRPKSRLDPGIY-TSEEE 511

Query: 637  PNNLKEKTALLQDTEKKIIETIRRSKFLGSLLNV-------------RGGLSPGKSELAP 683
                K   A L  TEK I+ETIRRSKFLGS  ++             R  L+  K E   
Sbjct: 512  DFGSKNHGADLS-TEKTILETIRRSKFLGSSFDINKELARERRLKEERAALAKRKDEERV 570

Query: 684  IEESPIVSTTPLIYNDRM--------------EPRRISDVEVPHFTRKSKHFTTANNRRS 729
               +   +     Y  +               EPR+IS+VEVP FTR+S+HFT +N R S
Sbjct: 571  ASNATTANVVGNGYESQTLPKRKMGSAMEASSEPRKISEVEVPQFTRRSRHFTASNKRLS 630

Query: 730  VLSLYA-KDSIKDLNEFLI-KEDPDL----PPQGS-TDNESR-------SEDPEIAESIT 775
            VLS+Y+ K S  +L + L  K D  L    PP  S  D E+         E  E A++  
Sbjct: 631  VLSMYSTKTSFTNLADHLKGKADVQLIQTSPPSASKMDQEAEFMFESVDKEGKETADTSA 690

Query: 776  DSRNIQYDEDDSKDGDNVNNDNILSDFPQGVGISQEYDMKDK-NPNQSPISKSAEPTLVV 834
            DSR   Y+  ++KD  N                + + +  D+ N   SP S+  + +  +
Sbjct: 691  DSR--LYEVAETKDAKNAKP-------------AVKLNFADRFNRPTSPPSQDTDSSAAI 735

Query: 835  KLPSLSSFQGKN---ASGLGLYQ--REPSKVTLPSLTSNNSSVGENIE-----DGAEKGT 884
            KLP+L           SGLGLYQ   EPS      +    S V +++E     +     T
Sbjct: 736  KLPALPPLDKNKPNMVSGLGLYQATAEPSHEDAQPVA--KSMVIDDVESEITTEPRNTVT 793

Query: 885  ESEKIAAXXXXXXXXXXXXXXXXXTVNAPT----------TVKKPPNSVLLKKFS----- 929
            E+E+ A                    N              V+K  N    +KFS     
Sbjct: 794  ETEEAAKNSTVVPTAPVAPLNNVMKKNTDADRKPLSDITPAVEKKANKSFFRKFSSKGSD 853

Query: 930  --KGKILELEIHAKIPEKRLYEGLHKLLEGWKQYGLKNLVFNITNMIITGKLVNDSILFL 987
              K    +      I E +++  L KLL  WK YGLK+++ + +   I GKL +D+IL L
Sbjct: 854  EKKSGDYDFRFKTVIEETQMFNALSKLLAAWKDYGLKDVIASPSLKQIRGKLSSDNILSL 913

Query: 988  RSTLFEIMVLPNGDGRSLIKFNXXXXXXXXXXXXXXEIQIILQKEGVL 1035
            RSTLF I V+  G+G S ++F               EI+ IL+ +  L
Sbjct: 914  RSTLFIITVVGRGEG-SYVEFTKKSGSNKTFKKLVKEIEKILESKKAL 960

>NCAS0A08080 Chr1 complement(1594221..1596092) [1872 bp, 623 aa]
           {ON} Anc_5.611
          Length = 623

 Score =  238 bits (606), Expect = 1e-66,   Method: Compositional matrix adjust.
 Identities = 124/277 (44%), Positives = 177/277 (63%), Gaps = 13/277 (4%)

Query: 10  SAAKPSSTIGPWKLGETLGFGSTGKVQLAQHERTGHRTAVKVISKSIFNNNGNHSNDDSV 69
           S+    S IG +++ +TLG GS GKV+LA H  TG + A+K+I+K +           S 
Sbjct: 35  SSLSDGSHIGNYQIVKTLGEGSFGKVKLAYHMTTGQKVALKIINKKVLAK--------SD 86

Query: 70  LPYNIEREIVIMKLLSHPNVLSLYDVWETNNNLYLILEYAEKGELFNLLVDHGPLPEREA 129
           +   IEREI  ++LL HP+++ LYDV ++ + + +++EYA   ELF+ +V    + E EA
Sbjct: 87  MQGRIEREISYLRLLRHPHIIKLYDVIKSKDEIIMVMEYA-GNELFDYIVQRDKMSEDEA 145

Query: 130 INCFRQIIIGISYCHALGIVHRDLKPENLLLDSFYNIKIADFGMAALQTDADLLETSCGS 189
              F+QII  + YCH   IVHRDLKPENLLLD   N+KIADFG++ + TD + L+TSCGS
Sbjct: 146 RRFFQQIISAVEYCHRHKIVHRDLKPENLLLDEHLNVKIADFGLSNIMTDGNFLKTSCGS 205

Query: 190 PHYAAPEIVSGLPYEGFASDVWSCGVILFALLTGRLPFDEENGNVRDLLLKVQKGQFEMP 249
           P+YAAPE++SG  Y G   DVWSCGVIL+ +L  RLPFD+E+  V  L   +  G + +P
Sbjct: 206 PNYAAPEVISGKLYAGPEVDVWSCGVILYVMLCRRLPFDDESIPV--LFKNINNGVYTIP 263

Query: 250 NDTEISRDAQDLIGKILVVDPRQRIKIRDILSHPLLK 286
               +S+ A  LI K+L+V+P  RI I++I+     K
Sbjct: 264 K--FLSQGASTLIKKMLIVNPLNRISIQEIMQDEWFK 298

>TBLA0E03360 Chr5 complement(838512..840476) [1965 bp, 654 aa] {ON}
           Anc_5.611 YDR477W
          Length = 654

 Score =  237 bits (605), Expect = 3e-66,   Method: Compositional matrix adjust.
 Identities = 123/280 (43%), Positives = 178/280 (63%), Gaps = 13/280 (4%)

Query: 7   ETHSAAKPSSTIGPWKLGETLGFGSTGKVQLAQHERTGHRTAVKVISKSIFNNNGNHSND 66
           + +   K  S IG +++ +TLG GS GKV+LA H  TG + A+K+I++ +          
Sbjct: 30  QRNGGLKDGSKIGNYQIIKTLGEGSFGKVKLAYHATTGQKVALKIINRKVLAK------- 82

Query: 67  DSVLPYNIEREIVIMKLLSHPNVLSLYDVWETNNNLYLILEYAEKGELFNLLVDHGPLPE 126
            S +   IEREI  ++LL HP+++ LYDV ++ + + +++EYA+  ELF+ +V    + E
Sbjct: 83  -SDMQGRIEREISYLRLLRHPHIIKLYDVIKSKDEIIMVIEYAD-NELFDYIVQRDKMSE 140

Query: 127 REAINCFRQIIIGISYCHALGIVHRDLKPENLLLDSFYNIKIADFGMAALQTDADLLETS 186
           +EA   F+QII  + YCH   IVHRDLKPENLLLD   N+KIADFG++ + TD + L+TS
Sbjct: 141 QEARRFFQQIISAVDYCHRHKIVHRDLKPENLLLDEHLNVKIADFGLSNIMTDGNFLKTS 200

Query: 187 CGSPHYAAPEIVSGLPYEGFASDVWSCGVILFALLTGRLPFDEENGNVRDLLLKVQKGQF 246
           CGSP+YAAPE++SG  Y G   DVWSCGVIL+ +L  RLPFD+E+  V  L   +  G +
Sbjct: 201 CGSPNYAAPEVISGKLYAGPEVDVWSCGVILYVMLCRRLPFDDESIPV--LFKNINNGIY 258

Query: 247 EMPNDTEISRDAQDLIGKILVVDPRQRIKIRDILSHPLLK 286
            +P    +S  A  LI K+L+V+P  RI I +I+     K
Sbjct: 259 TLPR--FLSEGASSLIKKMLIVNPLNRISIHEIMQDEWFK 296

>YDR477W Chr4 (1412373..1414274) [1902 bp, 633 aa] {ON}
           SNF1AMP-activated serine/threonine protein kinase found
           in a complex containing Snf4p and members of the
           Sip1p/Sip2p/Gal83p family; required for transcription of
           glucose-repressed genes, thermotolerance, sporulation,
           and peroxisome biogenesis
          Length = 633

 Score =  236 bits (602), Expect = 5e-66,   Method: Compositional matrix adjust.
 Identities = 122/277 (44%), Positives = 176/277 (63%), Gaps = 13/277 (4%)

Query: 10  SAAKPSSTIGPWKLGETLGFGSTGKVQLAQHERTGHRTAVKVISKSIFNNNGNHSNDDSV 69
           S+    + IG +++ +TLG GS GKV+LA H  TG + A+K+I+K +           S 
Sbjct: 44  SSLADGAHIGNYQIVKTLGEGSFGKVKLAYHTTTGQKVALKIINKKVLAK--------SD 95

Query: 70  LPYNIEREIVIMKLLSHPNVLSLYDVWETNNNLYLILEYAEKGELFNLLVDHGPLPEREA 129
           +   IEREI  ++LL HP+++ LYDV ++ + + +++EYA   ELF+ +V    + E+EA
Sbjct: 96  MQGRIEREISYLRLLRHPHIIKLYDVIKSKDEIIMVIEYA-GNELFDYIVQRDKMSEQEA 154

Query: 130 INCFRQIIIGISYCHALGIVHRDLKPENLLLDSFYNIKIADFGMAALQTDADLLETSCGS 189
              F+QII  + YCH   IVHRDLKPENLLLD   N+KIADFG++ + TD + L+TSCGS
Sbjct: 155 RRFFQQIISAVEYCHRHKIVHRDLKPENLLLDEHLNVKIADFGLSNIMTDGNFLKTSCGS 214

Query: 190 PHYAAPEIVSGLPYEGFASDVWSCGVILFALLTGRLPFDEENGNVRDLLLKVQKGQFEMP 249
           P+YAAPE++SG  Y G   DVWSCGVIL+ +L  RLPFD+E+  V  L   +  G + +P
Sbjct: 215 PNYAAPEVISGKLYAGPEVDVWSCGVILYVMLCRRLPFDDESIPV--LFKNISNGVYTLP 272

Query: 250 NDTEISRDAQDLIGKILVVDPRQRIKIRDILSHPLLK 286
               +S  A  LI ++L+V+P  RI I +I+     K
Sbjct: 273 K--FLSPGAAGLIKRMLIVNPLNRISIHEIMQDDWFK 307

>Smik_4.754 Chr4 (1333667..1335565) [1899 bp, 632 aa] {ON} YDR477W
           (REAL)
          Length = 632

 Score =  236 bits (601), Expect = 8e-66,   Method: Compositional matrix adjust.
 Identities = 121/269 (44%), Positives = 173/269 (64%), Gaps = 13/269 (4%)

Query: 18  IGPWKLGETLGFGSTGKVQLAQHERTGHRTAVKVISKSIFNNNGNHSNDDSVLPYNIERE 77
           IG +++ +TLG GS GKV+LA H  TG + A+K+I+K +           S +   IERE
Sbjct: 52  IGNYQIVKTLGEGSFGKVKLAYHTTTGQKVALKIINKKVLAK--------SDMQGRIERE 103

Query: 78  IVIMKLLSHPNVLSLYDVWETNNNLYLILEYAEKGELFNLLVDHGPLPEREAINCFRQII 137
           I  ++LL HP+++ LYDV ++ + + +++EYA   ELF+ +V    + E+EA   F+QII
Sbjct: 104 ISYLRLLRHPHIIKLYDVIKSKDEIIMVIEYA-GNELFDYIVQRDKMSEQEARRFFQQII 162

Query: 138 IGISYCHALGIVHRDLKPENLLLDSFYNIKIADFGMAALQTDADLLETSCGSPHYAAPEI 197
             + YCH   IVHRDLKPENLLLD   N+KIADFG++ + TD + L+TSCGSP+YAAPE+
Sbjct: 163 SAVEYCHRHKIVHRDLKPENLLLDEHLNVKIADFGLSNIMTDGNFLKTSCGSPNYAAPEV 222

Query: 198 VSGLPYEGFASDVWSCGVILFALLTGRLPFDEENGNVRDLLLKVQKGQFEMPNDTEISRD 257
           +SG  Y G   DVWSCGVIL+ +L  RLPFD+E+  V  L   +  G + +P    +S  
Sbjct: 223 ISGKLYAGPEVDVWSCGVILYVMLCRRLPFDDESIPV--LFKNISNGVYTLPK--FLSPG 278

Query: 258 AQDLIGKILVVDPRQRIKIRDILSHPLLK 286
           A  LI ++L+V+P  RI I +I+     K
Sbjct: 279 AAGLIKRMLIVNPLNRISIHEIMQDDWFK 307

>Suva_2.651 Chr2 (1164264..1166165) [1902 bp, 633 aa] {ON} YDR477W
           (REAL)
          Length = 633

 Score =  235 bits (599), Expect = 1e-65,   Method: Compositional matrix adjust.
 Identities = 122/277 (44%), Positives = 175/277 (63%), Gaps = 13/277 (4%)

Query: 10  SAAKPSSTIGPWKLGETLGFGSTGKVQLAQHERTGHRTAVKVISKSIFNNNGNHSNDDSV 69
           S+    + IG +++ +TLG GS GKV+LA H  TG + A+K+I+K +           S 
Sbjct: 43  SSLADGAHIGNYQIVKTLGEGSFGKVKLAYHTTTGQKVALKIINKKVLAK--------SD 94

Query: 70  LPYNIEREIVIMKLLSHPNVLSLYDVWETNNNLYLILEYAEKGELFNLLVDHGPLPEREA 129
           +   IEREI  ++LL HP+++ LYDV ++ + + +++EYA   ELF+ +V    + E EA
Sbjct: 95  MQGRIEREISYLRLLRHPHIIKLYDVIKSKDEIIMVIEYA-GNELFDYIVQRDKMSEDEA 153

Query: 130 INCFRQIIIGISYCHALGIVHRDLKPENLLLDSFYNIKIADFGMAALQTDADLLETSCGS 189
              F+QII  + YCH   IVHRDLKPENLLLD   N+KIADFG++ + TD + L+TSCGS
Sbjct: 154 RRFFQQIISAVEYCHRHKIVHRDLKPENLLLDEHLNVKIADFGLSNIMTDGNFLKTSCGS 213

Query: 190 PHYAAPEIVSGLPYEGFASDVWSCGVILFALLTGRLPFDEENGNVRDLLLKVQKGQFEMP 249
           P+YAAPE++SG  Y G   DVWSCGVIL+ +L  RLPFD+E+  V  L   +  G + +P
Sbjct: 214 PNYAAPEVISGKLYAGPEVDVWSCGVILYVMLCRRLPFDDESIPV--LFKNISNGVYSLP 271

Query: 250 NDTEISRDAQDLIGKILVVDPRQRIKIRDILSHPLLK 286
               +S  A  LI ++L+V+P  RI I +I+     K
Sbjct: 272 K--FLSPGAASLIKRMLIVNPLNRISIHEIMQDDWFK 306

>Skud_4.751 Chr4 (1332135..1334039) [1905 bp, 634 aa] {ON} YDR477W
           (REAL)
          Length = 634

 Score =  235 bits (599), Expect = 1e-65,   Method: Compositional matrix adjust.
 Identities = 122/277 (44%), Positives = 176/277 (63%), Gaps = 13/277 (4%)

Query: 10  SAAKPSSTIGPWKLGETLGFGSTGKVQLAQHERTGHRTAVKVISKSIFNNNGNHSNDDSV 69
           S+    + IG +++ +TLG GS GKV+LA H  TG + A+K+I+K +           S 
Sbjct: 45  SSLADGAHIGNYQIVKTLGEGSFGKVKLAYHTTTGQKVALKIINKKVLAK--------SD 96

Query: 70  LPYNIEREIVIMKLLSHPNVLSLYDVWETNNNLYLILEYAEKGELFNLLVDHGPLPEREA 129
           +   IEREI  ++LL HP+++ LYDV ++ + + +++EYA   ELF+ +V    + E+EA
Sbjct: 97  MQGRIEREISYLRLLRHPHIIKLYDVIKSKDEIIMVIEYA-GNELFDYIVQRDKMSEQEA 155

Query: 130 INCFRQIIIGISYCHALGIVHRDLKPENLLLDSFYNIKIADFGMAALQTDADLLETSCGS 189
              F+QII  + YCH   IVHRDLKPENLLLD   N+KIADFG++ + TD + L+TSCGS
Sbjct: 156 RRFFQQIISAVEYCHRHKIVHRDLKPENLLLDEHLNVKIADFGLSNIMTDGNFLKTSCGS 215

Query: 190 PHYAAPEIVSGLPYEGFASDVWSCGVILFALLTGRLPFDEENGNVRDLLLKVQKGQFEMP 249
           P+YAAPE++SG  Y G   DVWSCGVIL+ +L  RLPFD+E+  V  L   +  G + +P
Sbjct: 216 PNYAAPEVISGKLYAGPEVDVWSCGVILYVMLCRRLPFDDESIPV--LFKNISNGVYTLP 273

Query: 250 NDTEISRDAQDLIGKILVVDPRQRIKIRDILSHPLLK 286
               +S  A  LI ++L+V+P  RI I +I+     K
Sbjct: 274 K--FLSPGAAGLIKRMLIVNPLNRISIHEIMQDDWFK 308

>TDEL0A04780 Chr1 (842715..844580) [1866 bp, 621 aa] {ON} Anc_5.611
           YDR477W
          Length = 621

 Score =  233 bits (593), Expect = 7e-65,   Method: Compositional matrix adjust.
 Identities = 121/271 (44%), Positives = 173/271 (63%), Gaps = 13/271 (4%)

Query: 16  STIGPWKLGETLGFGSTGKVQLAQHERTGHRTAVKVISKSIFNNNGNHSNDDSVLPYNIE 75
           S IG +++ +TLG GS GKV+LA H  TG + A+K+I+K +           S +   IE
Sbjct: 37  SRIGNYQIVKTLGEGSFGKVKLAYHVTTGQKVALKIINKKVLAK--------SDMQGRIE 88

Query: 76  REIVIMKLLSHPNVLSLYDVWETNNNLYLILEYAEKGELFNLLVDHGPLPEREAINCFRQ 135
           REI  ++LL HP+++ LYDV ++ + + +++EYA   ELF+ +V    + E+EA   F+Q
Sbjct: 89  REISYLRLLRHPHIIKLYDVIKSKDEIIMVIEYA-GNELFDYIVQRDKMSEKEARRFFQQ 147

Query: 136 IIIGISYCHALGIVHRDLKPENLLLDSFYNIKIADFGMAALQTDADLLETSCGSPHYAAP 195
           II  + YCH   IVHRDLKPENLLLD   N+KIADFG++ + TD + L+TSCGSP+YAAP
Sbjct: 148 IISAVEYCHRHKIVHRDLKPENLLLDEHLNVKIADFGLSNIMTDGNFLKTSCGSPNYAAP 207

Query: 196 EIVSGLPYEGFASDVWSCGVILFALLTGRLPFDEENGNVRDLLLKVQKGQFEMPNDTEIS 255
           E++SG  Y G   DVWS GVIL+ +L  RLPFD+E+  V  L   +  G + +P    +S
Sbjct: 208 EVISGKLYAGPEVDVWSSGVILYVMLCRRLPFDDESIPV--LFKNISNGVYTLPK--FLS 263

Query: 256 RDAQDLIGKILVVDPRQRIKIRDILSHPLLK 286
             A  LI ++L+V+P  RI I +I+     K
Sbjct: 264 PGAAGLIKRMLIVNPLNRISIHEIMQDEWFK 294

>KLTH0G05698g Chr7 (453530..455323) [1794 bp, 597 aa] {ON} similar
           to uniprot|P06782 Saccharomyces cerevisiae YDR477W SNF1
           Protein serine/threonine kinase required for release
           from glucose repression invertase expression sporulation
           and for expression of catabolite- repressed genes when
           glucose is limiting regulates Adr1p- dependent
           transcription primarily at the level of chromatin
           binding
          Length = 597

 Score =  231 bits (589), Expect = 1e-64,   Method: Compositional matrix adjust.
 Identities = 120/269 (44%), Positives = 173/269 (64%), Gaps = 13/269 (4%)

Query: 18  IGPWKLGETLGFGSTGKVQLAQHERTGHRTAVKVISKSIFNNNGNHSNDDSVLPYNIERE 77
           IG +++ +TLG GS GKV+LA H  TG + A+K+I+K +           S +   IERE
Sbjct: 27  IGKYQIIKTLGEGSFGKVKLAYHVTTGQKVALKIINKKVLAK--------SDMQGRIERE 78

Query: 78  IVIMKLLSHPNVLSLYDVWETNNNLYLILEYAEKGELFNLLVDHGPLPEREAINCFRQII 137
           I  ++LL HP+++ LYDV ++ + + +++EYA   ELF+ +V    + EREA   F+QII
Sbjct: 79  ISYLRLLRHPHIIKLYDVIKSKDEIVMVIEYA-GNELFDYIVQRDKMSEREARRFFQQII 137

Query: 138 IGISYCHALGIVHRDLKPENLLLDSFYNIKIADFGMAALQTDADLLETSCGSPHYAAPEI 197
             + YCH   IVHRDLKPENLLLD   N+KIADFG++ + TD + L+TSCGSP+YAAPE+
Sbjct: 138 SAVEYCHRHKIVHRDLKPENLLLDEHLNVKIADFGLSNIMTDGNFLKTSCGSPNYAAPEV 197

Query: 198 VSGLPYEGFASDVWSCGVILFALLTGRLPFDEENGNVRDLLLKVQKGQFEMPNDTEISRD 257
           +SG  Y G   DVWS GVIL+ +L  RLPFD+E+  +  L   +  G + +P    +S  
Sbjct: 198 ISGKLYAGPEVDVWSSGVILYVMLCRRLPFDDESIPI--LFKNISNGIYTLPK--FLSPG 253

Query: 258 AQDLIGKILVVDPRQRIKIRDILSHPLLK 286
           A +LI ++L+V+P  RI I +I+     K
Sbjct: 254 AANLIKRMLIVNPLNRITIHEIMEDEWFK 282

>AEL230W Chr5 (198401..200227) [1827 bp, 608 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YDR477W (SNF1)
          Length = 608

 Score =  231 bits (590), Expect = 1e-64,   Method: Compositional matrix adjust.
 Identities = 123/283 (43%), Positives = 177/283 (62%), Gaps = 18/283 (6%)

Query: 9   HSAAKPSST-----IGPWKLGETLGFGSTGKVQLAQHERTGHRTAVKVISKSIFNNNGNH 63
           H   +P S      IG +++ +TLG GS GKV+LA H  TG + A+K+I+K +       
Sbjct: 22  HGMHRPGSIPIGQRIGKYQVIKTLGEGSFGKVKLAHHVSTGQKVALKIINKKVLAK---- 77

Query: 64  SNDDSVLPYNIEREIVIMKLLSHPNVLSLYDVWETNNNLYLILEYAEKGELFNLLVDHGP 123
               S +   IEREI  ++LL HP+++ LYDV ++ + + +++EYA   ELF+ +V    
Sbjct: 78  ----SDMQGRIEREISYLRLLRHPHIIKLYDVIKSKDEIIMVIEYA-GNELFDYIVQRDK 132

Query: 124 LPEREAINCFRQIIIGISYCHALGIVHRDLKPENLLLDSFYNIKIADFGMAALQTDADLL 183
           + E EA   F+QII  + YCH   IVHRDLKPENLLLD   N+KIADFG++ + TD + L
Sbjct: 133 MSENEARRFFQQIISAVEYCHRHKIVHRDLKPENLLLDEHLNVKIADFGLSNIMTDGNFL 192

Query: 184 ETSCGSPHYAAPEIVSGLPYEGFASDVWSCGVILFALLTGRLPFDEENGNVRDLLLKVQK 243
           +TSCGSP+YAAPE++SG  Y G   DVWS GVIL+ +L  RLPFD+E+  V  L   +  
Sbjct: 193 KTSCGSPNYAAPEVISGKLYAGPEVDVWSSGVILYVMLCRRLPFDDESIPV--LFKNISN 250

Query: 244 GQFEMPNDTEISRDAQDLIGKILVVDPRQRIKIRDILSHPLLK 286
           G + +P    +S+ A +LI ++L+V+P  RI I +I+     K
Sbjct: 251 GVYSIPK--FLSQGAANLIKRMLIVNPLNRITIHEIMEDEWFK 291

>KAFR0C05860 Chr3 (1160586..1162520) [1935 bp, 644 aa] {ON}
           Anc_5.611 YDR477W
          Length = 644

 Score =  232 bits (591), Expect = 2e-64,   Method: Compositional matrix adjust.
 Identities = 120/265 (45%), Positives = 172/265 (64%), Gaps = 13/265 (4%)

Query: 16  STIGPWKLGETLGFGSTGKVQLAQHERTGHRTAVKVISKSIFNNNGNHSNDDSVLPYNIE 75
           S IG +++ +TLG GS GKV+LA H  TG + A+K+I+K I           S +   IE
Sbjct: 44  SKIGNYQIVKTLGEGSFGKVKLAYHITTGQKVALKIINKKILAK--------SDMQGRIE 95

Query: 76  REIVIMKLLSHPNVLSLYDVWETNNNLYLILEYAEKGELFNLLVDHGPLPEREAINCFRQ 135
           REI  ++LL HP+++ LYDV ++ + + +++E+A   ELF+ ++    + E EA   F+Q
Sbjct: 96  REISYLRLLRHPHIIKLYDVIKSKDEIIIVIEFA-SNELFDYIIQRDKMSENEARRFFQQ 154

Query: 136 IIIGISYCHALGIVHRDLKPENLLLDSFYNIKIADFGMAALQTDADLLETSCGSPHYAAP 195
           II  + YCH   IVHRDLKPENLLLD   N+KIADFG++ + TD + L+TSCGSP+YAAP
Sbjct: 155 IISAVEYCHRHKIVHRDLKPENLLLDEDLNVKIADFGLSNIMTDGNFLKTSCGSPNYAAP 214

Query: 196 EIVSGLPYEGFASDVWSCGVILFALLTGRLPFDEENGNVRDLLLKVQKGQFEMPNDTEIS 255
           E++SG  Y G   DVWSCGVIL+ +L  RLPFD+E+  V  L   +  G + +P    +S
Sbjct: 215 EVISGKLYAGPEVDVWSCGVILYVMLCRRLPFDDESIPV--LFKNISNGVYILPK--FLS 270

Query: 256 RDAQDLIGKILVVDPRQRIKIRDIL 280
             A  LI ++L+V+P  RI I +I+
Sbjct: 271 PGASSLIKRMLIVNPLNRISIHEIM 295

>Kwal_33.13222 s33 (127342..127788) [447 bp, 148 aa] {OFF} YDR507C
           (GIN4) - putative serine/threonine kinase [contig 120]
           PARTIAL
          Length = 148

 Score =  215 bits (548), Expect = 2e-64,   Method: Composition-based stats.
 Identities = 99/120 (82%), Positives = 107/120 (89%)

Query: 81  MKLLSHPNVLSLYDVWETNNNLYLILEYAEKGELFNLLVDHGPLPEREAINCFRQIIIGI 140
           MKLL H NVL LYDVWETN+NLY++LEY EKGELFNLLV+ GPLPE EA+  FRQIIIGI
Sbjct: 1   MKLLHHANVLRLYDVWETNSNLYMVLEYVEKGELFNLLVERGPLPENEAVRFFRQIIIGI 60

Query: 141 SYCHALGIVHRDLKPENLLLDSFYNIKIADFGMAALQTDADLLETSCGSPHYAAPEIVSG 200
           SYCHALGIVHRDLKPENLLLD  +NIKIADFGMAAL++   LLETSCGSPHYAAPEIVSG
Sbjct: 61  SYCHALGIVHRDLKPENLLLDHKFNIKIADFGMAALESKDKLLETSCGSPHYAAPEIVSG 120

>Kpol_1018.65 s1018 (189779..191584) [1806 bp, 601 aa] {ON}
           (189779..191584) [1806 nt, 602 aa]
          Length = 601

 Score =  230 bits (587), Expect = 3e-64,   Method: Compositional matrix adjust.
 Identities = 120/265 (45%), Positives = 173/265 (65%), Gaps = 13/265 (4%)

Query: 16  STIGPWKLGETLGFGSTGKVQLAQHERTGHRTAVKVISKSIFNNNGNHSNDDSVLPYNIE 75
           S IG +++ +TLG GS GKV+LA H  T  R A+K+I+K I           S +   IE
Sbjct: 37  SRIGNYQIIKTLGEGSFGKVKLAYHVTTNQRVALKIINKKILAK--------SDMQGRIE 88

Query: 76  REIVIMKLLSHPNVLSLYDVWETNNNLYLILEYAEKGELFNLLVDHGPLPEREAINCFRQ 135
           REI  ++LL HP+++ LYDV ++  ++ +++EYA+  ELF+ +V    + E EA   F+Q
Sbjct: 89  REISYLRLLRHPHIIKLYDVIKSKEDIIMVIEYADH-ELFDYIVQRDKMSENEARKFFQQ 147

Query: 136 IIIGISYCHALGIVHRDLKPENLLLDSFYNIKIADFGMAALQTDADLLETSCGSPHYAAP 195
           II  + YCH   IVHRDLKPENLLLD   N+KIADFG++ + TD + L+TSCGSP+YAAP
Sbjct: 148 IISAVEYCHRHKIVHRDLKPENLLLDEELNVKIADFGLSNIMTDGNFLKTSCGSPNYAAP 207

Query: 196 EIVSGLPYEGFASDVWSCGVILFALLTGRLPFDEENGNVRDLLLKVQKGQFEMPNDTEIS 255
           E++SG  Y G   DVWSCGVIL+ +L  RLPFD+++  V  L   +  G + +P    +S
Sbjct: 208 EVISGKLYAGPEVDVWSCGVILYVMLCRRLPFDDDSIPV--LFKNISNGIYTLPK--FLS 263

Query: 256 RDAQDLIGKILVVDPRQRIKIRDIL 280
             A +LI ++L+V+P  RI + +I+
Sbjct: 264 PGAANLIKRMLIVNPLNRISMNEIM 288

>NDAI0H00940 Chr8 complement(209645..211702) [2058 bp, 685 aa] {ON}
           Anc_5.611
          Length = 685

 Score =  232 bits (592), Expect = 3e-64,   Method: Compositional matrix adjust.
 Identities = 120/269 (44%), Positives = 172/269 (63%), Gaps = 13/269 (4%)

Query: 18  IGPWKLGETLGFGSTGKVQLAQHERTGHRTAVKVISKSIFNNNGNHSNDDSVLPYNIERE 77
           IG +++ +TLG GS GKV+LA H  TG + A+K+I+K +           S +   IERE
Sbjct: 58  IGNYQIVKTLGEGSFGKVKLAYHMTTGQKVALKIINKKVLAK--------SDMQGRIERE 109

Query: 78  IVIMKLLSHPNVLSLYDVWETNNNLYLILEYAEKGELFNLLVDHGPLPEREAINCFRQII 137
           I  ++LL HP+++ LYDV ++ + + +++EYA   ELF+ +V    + E EA   F+QII
Sbjct: 110 ISYLRLLRHPHIIKLYDVIKSKDEIIMVMEYA-GNELFDYIVQRDKMSENEARRFFQQII 168

Query: 138 IGISYCHALGIVHRDLKPENLLLDSFYNIKIADFGMAALQTDADLLETSCGSPHYAAPEI 197
             + YCH   IVHRDLKPENLLLD   N+KIADFG++ + TD + L+TSCGSP+YAAPE+
Sbjct: 169 SAVEYCHRHKIVHRDLKPENLLLDEHLNVKIADFGLSNIMTDGNFLKTSCGSPNYAAPEV 228

Query: 198 VSGLPYEGFASDVWSCGVILFALLTGRLPFDEENGNVRDLLLKVQKGQFEMPNDTEISRD 257
           +SG  Y G   DVWS GVIL+ +L  RLPFD+E+  V  L   +  G + +P    +S+ 
Sbjct: 229 ISGKLYAGPEVDVWSSGVILYVMLCRRLPFDDESIPV--LFKNINNGVYTIPK--FLSQG 284

Query: 258 AQDLIGKILVVDPRQRIKIRDILSHPLLK 286
           A  LI ++L+V+P  RI I +I+     K
Sbjct: 285 ASSLIKRMLIVNPLNRISISEIMQDEWFK 313

>Kwal_47.18233 s47 complement(743846..745642) [1797 bp, 598 aa] {ON}
           YDR477W (SNF1) - protein serine/threonine kinase [contig
           197] FULL
          Length = 598

 Score =  229 bits (584), Expect = 7e-64,   Method: Compositional matrix adjust.
 Identities = 120/269 (44%), Positives = 171/269 (63%), Gaps = 13/269 (4%)

Query: 18  IGPWKLGETLGFGSTGKVQLAQHERTGHRTAVKVISKSIFNNNGNHSNDDSVLPYNIERE 77
           IG +++ +TLG GS GKV+LA H  TG + A+K+I+K +           S +   IERE
Sbjct: 28  IGKYQIIKTLGEGSFGKVKLAYHVTTGQKVALKIINKKVLAK--------SDMQGRIERE 79

Query: 78  IVIMKLLSHPNVLSLYDVWETNNNLYLILEYAEKGELFNLLVDHGPLPEREAINCFRQII 137
           I  ++LL HP+++ LYDV ++ + + +++EYA   ELF+ +V    + E EA   F+QII
Sbjct: 80  ISYLRLLRHPHIIKLYDVVKSKDEIVMVIEYA-GNELFDYIVQRDKMSENEARRFFQQII 138

Query: 138 IGISYCHALGIVHRDLKPENLLLDSFYNIKIADFGMAALQTDADLLETSCGSPHYAAPEI 197
             + YCH   IVHRDLKPENLLLD   N+KIADFG++ + TD + L TSCGSP+YAAPE+
Sbjct: 139 SAVEYCHRHKIVHRDLKPENLLLDEHLNVKIADFGLSNIMTDGNFLRTSCGSPNYAAPEV 198

Query: 198 VSGLPYEGFASDVWSCGVILFALLTGRLPFDEENGNVRDLLLKVQKGQFEMPNDTEISRD 257
           +SG  Y G   DVWS GVIL+ +L  RLPFD+E+  V  L   +  G + +P    +S  
Sbjct: 199 ISGKLYAGPEVDVWSSGVILYVMLCRRLPFDDESIPV--LFKNISNGIYTLPK--FLSPG 254

Query: 258 AQDLIGKILVVDPRQRIKIRDILSHPLLK 286
           A +LI ++L+V+P  RI I +I+     K
Sbjct: 255 AANLIKRMLIVNPLNRITIHEIMQDEWFK 283

>SAKL0G06952g Chr7 (570584..572383) [1800 bp, 599 aa] {ON} similar
           to uniprot|P06782 Saccharomyces cerevisiae YDR477W SNF1
           Protein serine/threonine kinase required for release
           from glucose repression invertase expression sporulation
           and for expression of catabolite-repressed genes when
           glucose is limiting regulates Adr1p-dependent
           transcription primarily at the level of chromatin
           binding
          Length = 599

 Score =  229 bits (583), Expect = 1e-63,   Method: Compositional matrix adjust.
 Identities = 120/269 (44%), Positives = 172/269 (63%), Gaps = 13/269 (4%)

Query: 18  IGPWKLGETLGFGSTGKVQLAQHERTGHRTAVKVISKSIFNNNGNHSNDDSVLPYNIERE 77
           IG +++ +TLG GS GKV+LA H  TG + A+K+I+K +           S +   IERE
Sbjct: 29  IGKYQIIKTLGEGSFGKVKLAYHITTGQKVALKIINKKVLAK--------SDMQGRIERE 80

Query: 78  IVIMKLLSHPNVLSLYDVWETNNNLYLILEYAEKGELFNLLVDHGPLPEREAINCFRQII 137
           I  ++LL HP+++ LYDV ++ + + +++EYA   ELF+ +V    + E EA   F+QII
Sbjct: 81  ISYLRLLRHPHIIKLYDVIKSKDEIVMVIEYA-GNELFDYIVQRDKMNEDEARRFFQQII 139

Query: 138 IGISYCHALGIVHRDLKPENLLLDSFYNIKIADFGMAALQTDADLLETSCGSPHYAAPEI 197
             + YCH   IVHRDLKPENLLLD   N+KIADFG++ + TD + L+TSCGSP+YAAPE+
Sbjct: 140 SAVEYCHRHKIVHRDLKPENLLLDEHLNVKIADFGLSNIMTDGNFLKTSCGSPNYAAPEV 199

Query: 198 VSGLPYEGFASDVWSCGVILFALLTGRLPFDEENGNVRDLLLKVQKGQFEMPNDTEISRD 257
           +SG  Y G   DVWS GVIL+ +L  RLPFD+E+  V  L   +  G + +P    +S  
Sbjct: 200 ISGKLYAGPEVDVWSSGVILYVMLCRRLPFDDESIPV--LFKNISNGVYTLPK--FLSPG 255

Query: 258 AQDLIGKILVVDPRQRIKIRDILSHPLLK 286
           A +LI ++L+V+P  RI I +I+     K
Sbjct: 256 ASNLIKRMLIVNPLNRITIHEIMQDEWFK 284

>KNAG0B03230 Chr2 complement(625072..626997) [1926 bp, 641 aa] {ON}
           Anc_5.611 YDR477W
          Length = 641

 Score =  229 bits (584), Expect = 2e-63,   Method: Compositional matrix adjust.
 Identities = 119/265 (44%), Positives = 172/265 (64%), Gaps = 13/265 (4%)

Query: 16  STIGPWKLGETLGFGSTGKVQLAQHERTGHRTAVKVISKSIFNNNGNHSNDDSVLPYNIE 75
           S IG +++ +TLG GS GKV+LA H  T  + A+K+I+K +           S +   IE
Sbjct: 40  SRIGNYQIVKTLGEGSFGKVKLAYHITTNQKVALKIINKKVLAK--------SDMQGRIE 91

Query: 76  REIVIMKLLSHPNVLSLYDVWETNNNLYLILEYAEKGELFNLLVDHGPLPEREAINCFRQ 135
           REI  ++LL HP+++ LYDV ++ + + +++E+A   ELF+ ++    + E+EA   F+Q
Sbjct: 92  REISYLRLLRHPHIIKLYDVIKSKDEIIIVIEFA-SNELFDYIIQRDKMSEQEARRFFQQ 150

Query: 136 IIIGISYCHALGIVHRDLKPENLLLDSFYNIKIADFGMAALQTDADLLETSCGSPHYAAP 195
           II  + YCH   IVHRDLKPENLLLD   N+KIADFG++ + TD + L+TSCGSP+YAAP
Sbjct: 151 IISAVEYCHRHKIVHRDLKPENLLLDEDLNVKIADFGLSNIMTDGNFLKTSCGSPNYAAP 210

Query: 196 EIVSGLPYEGFASDVWSCGVILFALLTGRLPFDEENGNVRDLLLKVQKGQFEMPNDTEIS 255
           E++SG  Y G   DVWSCGVIL+ +L  RLPFD+E+  V  L   +  G + +P    +S
Sbjct: 211 EVISGKLYAGPEVDVWSCGVILYVMLCRRLPFDDESIPV--LFKNISNGVYILPK--FLS 266

Query: 256 RDAQDLIGKILVVDPRQRIKIRDIL 280
             A +LI K+L+V+P  RI I +I 
Sbjct: 267 LGAANLIKKMLIVNPLNRISISEIF 291

>TPHA0D02840 Chr4 (591733..593637) [1905 bp, 634 aa] {ON} 
          Length = 634

 Score =  229 bits (583), Expect = 2e-63,   Method: Compositional matrix adjust.
 Identities = 117/271 (43%), Positives = 172/271 (63%), Gaps = 13/271 (4%)

Query: 16  STIGPWKLGETLGFGSTGKVQLAQHERTGHRTAVKVISKSIFNNNGNHSNDDSVLPYNIE 75
           + IG +++ +TLG GS GKV+LA H  T  + A+K+I+K +           S +   +E
Sbjct: 63  ARIGNYQIIKTLGEGSFGKVKLAYHVTTNQKVALKIINKKVL--------AKSDMQGRVE 114

Query: 76  REIVIMKLLSHPNVLSLYDVWETNNNLYLILEYAEKGELFNLLVDHGPLPEREAINCFRQ 135
           REI  ++LL HP+++ LYDV ++ + + +++EYA   ELF  +V    + E EA   F+Q
Sbjct: 115 REISFLRLLRHPHIIKLYDVIKSKDEIIMVIEYA-NNELFEYIVQRDKMTENEARKFFQQ 173

Query: 136 IIIGISYCHALGIVHRDLKPENLLLDSFYNIKIADFGMAALQTDADLLETSCGSPHYAAP 195
           II  + YCH   IVHRDLKPENLLLD   N+KIADFG++ + TD + L+TSCGSP+YAAP
Sbjct: 174 IISAVEYCHRHKIVHRDLKPENLLLDENLNVKIADFGLSNIMTDGNFLKTSCGSPNYAAP 233

Query: 196 EIVSGLPYEGFASDVWSCGVILFALLTGRLPFDEENGNVRDLLLKVQKGQFEMPNDTEIS 255
           E++SG  Y G   DVWSCGVIL+ +L  RLPFD++  ++  L   +  G + +P    +S
Sbjct: 234 EVISGKLYAGPEVDVWSCGVILYVMLCRRLPFDDD--SIPALFKNISNGIYTLP--KFLS 289

Query: 256 RDAQDLIGKILVVDPRQRIKIRDILSHPLLK 286
             A +LI K+L+V+P  RI + +I+     K
Sbjct: 290 EGAANLIKKMLIVNPLNRISMTEIIHDEWFK 320

>ZYRO0A05544g Chr1 (450809..452704) [1896 bp, 631 aa] {ON} highly
           similar to uniprot|P06782 Saccharomyces cerevisiae
           YDR477W SNF1 Protein serine/threonine kinase required
           for release from glucose repression invertase expression
           sporulation and for expression of catabolite- repressed
           genes when glucose is limiting regulates Adr1p-
           dependent transcription primarily at the level of
           chromatin binding
          Length = 631

 Score =  229 bits (583), Expect = 2e-63,   Method: Compositional matrix adjust.
 Identities = 121/271 (44%), Positives = 172/271 (63%), Gaps = 13/271 (4%)

Query: 16  STIGPWKLGETLGFGSTGKVQLAQHERTGHRTAVKVISKSIFNNNGNHSNDDSVLPYNIE 75
           S IG +++ +TLG GS GKV+LA H  TG + A+K+I+K +           S +   IE
Sbjct: 46  SHIGNYQIVKTLGEGSFGKVKLAYHITTGQKVALKIINKKVLAK--------SDMQGRIE 97

Query: 76  REIVIMKLLSHPNVLSLYDVWETNNNLYLILEYAEKGELFNLLVDHGPLPEREAINCFRQ 135
           REI  ++LL HP+++ LYDV ++ + + +++EYA   ELF+ +V    + E EA   F+Q
Sbjct: 98  REISYLRLLRHPHIIKLYDVIKSKDEIIMVIEYA-GNELFDYIVQRDKMSEEEARRFFQQ 156

Query: 136 IIIGISYCHALGIVHRDLKPENLLLDSFYNIKIADFGMAALQTDADLLETSCGSPHYAAP 195
           II  + YCH   IVHRDLKPENLLLD   N+KIADFG++ + TD + L+TSCGSP+YAAP
Sbjct: 157 IISAVEYCHRHKIVHRDLKPENLLLDEHLNVKIADFGLSNIMTDGNFLKTSCGSPNYAAP 216

Query: 196 EIVSGLPYEGFASDVWSCGVILFALLTGRLPFDEENGNVRDLLLKVQKGQFEMPNDTEIS 255
           E++SG  Y G   DVWS GVIL+ +L  RLPFD+E+  V  L   +  G + +P    +S
Sbjct: 217 EVISGKLYAGPEVDVWSSGVILYVMLCRRLPFDDESIPV--LFKNISNGVYTLPK--FLS 272

Query: 256 RDAQDLIGKILVVDPRQRIKIRDILSHPLLK 286
             A  LI ++L+V+P  RI I +I+     K
Sbjct: 273 EGAAGLIKRMLIVNPLNRISILEIMQDDWFK 303

>Ecym_5588 Chr5 complement(1205102..1206943) [1842 bp, 613 aa] {ON}
           similar to Ashbya gossypii AEL230W
          Length = 613

 Score =  227 bits (579), Expect = 4e-63,   Method: Compositional matrix adjust.
 Identities = 120/269 (44%), Positives = 171/269 (63%), Gaps = 13/269 (4%)

Query: 18  IGPWKLGETLGFGSTGKVQLAQHERTGHRTAVKVISKSIFNNNGNHSNDDSVLPYNIERE 77
           IG +++ +TLG GS GKV+LA H  T  + A+K+I+K +           S +   IERE
Sbjct: 40  IGKYQVIKTLGEGSFGKVKLAYHVSTSQKVALKIINKKVLAK--------SDMQGRIERE 91

Query: 78  IVIMKLLSHPNVLSLYDVWETNNNLYLILEYAEKGELFNLLVDHGPLPEREAINCFRQII 137
           I  ++LL HP+++ LYDV ++ + + +++EYA   ELF+ +V    + E EA   F+QII
Sbjct: 92  ISYLRLLRHPHIIKLYDVIKSKDEIIMVIEYA-GNELFDYIVQRDKMSENEARRFFQQII 150

Query: 138 IGISYCHALGIVHRDLKPENLLLDSFYNIKIADFGMAALQTDADLLETSCGSPHYAAPEI 197
             + YCH   IVHRDLKPENLLLD   N+KIADFG++ + TD + L+TSCGSP+YAAPE+
Sbjct: 151 SAVEYCHRHKIVHRDLKPENLLLDEHLNVKIADFGLSNIMTDGNFLKTSCGSPNYAAPEV 210

Query: 198 VSGLPYEGFASDVWSCGVILFALLTGRLPFDEENGNVRDLLLKVQKGQFEMPNDTEISRD 257
           +SG  Y G   DVWS GVIL+ +L  RLPFD+E+  V  L   +  G + +P    +S  
Sbjct: 211 ISGKLYAGPEVDVWSSGVILYVMLCRRLPFDDESIPV--LFKNISNGVYSIPK--FLSPG 266

Query: 258 AQDLIGKILVVDPRQRIKIRDILSHPLLK 286
           A +LI K+L+V+P  RI I +I+     K
Sbjct: 267 AANLIKKMLIVNPLNRITIHEIMEDQWFK 295

>KNAG0J01590 Chr10 (292565..294982) [2418 bp, 805 aa] {ON} Anc_8.654
           YPL141C
          Length = 805

 Score =  200 bits (508), Expect = 2e-52,   Method: Compositional matrix adjust.
 Identities = 121/326 (37%), Positives = 176/326 (53%), Gaps = 37/326 (11%)

Query: 7   ETHSAAKPSSTIGPWKLGETLGFGSTGKVQLAQHERTGHR--------TAVKVISKSIFN 58
           +T +A  PS   GP+ +G TLG G  GKV++      G++         A+K+I +   +
Sbjct: 30  KTGNAKCPS--FGPYLIGSTLGQGGFGKVKMGWTTPMGNKGIYDVPKQVAIKLIKRDSIS 87

Query: 59  NNGNHSNDDSVLPYNIEREIVIMKLLSHPNVLSLYDVWETNNNLYLILEYAEKGELFNLL 118
           N       D      I REI  +K L HPN++ L +V + +  + ++LEYA  GE +  +
Sbjct: 88  N-------DKSKEVKIYREINALKQLHHPNIVKLEEVLQNSKYIGIVLEYASGGEFYKYI 140

Query: 119 VDHGPLPEREAINCFRQIIIGISYCHALGIVHRDLKPENLLLDSFYNIKIADFGMA-ALQ 177
                L E  A   F Q+I G+ Y H+ G+VHRDLK ENLLLD   N+ I DFG      
Sbjct: 141 QKRRVLKEHVACRLFAQLISGVHYIHSKGLVHRDLKLENLLLDKHENLIITDFGFVNEYF 200

Query: 178 TDADLLETSCGSPHYAAPEIV-SGLPYEGFASDVWSCGVILFALLTGRLPFDEENGN--- 233
           +  +L+ TSCGSP YAAPE+V S  PY+G  +D+WSCG+ILFA+L G LP+D++  N   
Sbjct: 201 SQNELMTTSCGSPCYAAPELVISTQPYQGRRADLWSCGIILFAMLAGYLPWDDDKDNPDG 260

Query: 234 --VRDLLLKVQKGQFEMPNDTEISRDAQDLIGKILVVDPRQRIKIRDILSHPLLKK---- 287
             +  L   +     + P    I+   +DL+ +ILV DPR+R+ +R+I  H  LKK    
Sbjct: 261 EDIAKLYYYITHTALKFPE--YITPIPRDLLRRILVADPRRRVTLREIQGHQWLKKHAQF 318

Query: 288 -------YQTIKDSKSIKDLPRENTY 306
                  +  I  SK+I  LP+ N +
Sbjct: 319 LSIQPEEWDRISQSKNITRLPKHNKH 344

>CAGL0M11396g Chr13 (1122109..1125687) [3579 bp, 1192 aa] {ON}
           similar to uniprot|P13186 Saccharomyces cerevisiae
           YLR096w KIN2 ser/thr protein kinase
          Length = 1192

 Score =  200 bits (509), Expect = 8e-52,   Method: Compositional matrix adjust.
 Identities = 101/291 (34%), Positives = 164/291 (56%), Gaps = 26/291 (8%)

Query: 17  TIGPWKLGETLGFGSTGKVQLAQHERTGHRTAVKVISKSIFNNNGNHSNDDSVLPYNIE- 75
           ++G W   ET+G GS GKV+LA+H RTG   A+K+++++       H   +S  P N + 
Sbjct: 104 SLGDWDFLETVGAGSMGKVKLAKHRRTGEVCAIKIVNRA--TKAFLHKEQNSPPPVNNQE 161

Query: 76  -------------------REIVIMKLLSHPNVLSLYDVWETNNNLYLILEYAEKGELFN 116
                              RE  + ++  HP++  L+++   +N+ Y++ EY   G+L +
Sbjct: 162 IMERQKKLEKEISRDKRAIREASLGQIFYHPHICRLFEMCTMSNHFYMLFEYVAGGQLLD 221

Query: 117 LLVDHGPLPEREAINCFRQIIIGISYCHALGIVHRDLKPENLLLDSFYNIKIADFGMAAL 176
            ++ HG L E  A    R +   + Y HA  IVHRDLK EN+++ +   IKI DFG++ +
Sbjct: 222 YIIQHGSLREHHARKFARGVASALQYLHANNIVHRDLKIENIMISNSGEIKIIDFGLSNV 281

Query: 177 QTDADLLETSCGSPHYAAPEIVSGLPYEGFASDVWSCGVILFALLTGRLPFDEENGNVRD 236
                 L T CGS ++AAPE++   PY G   DVWS GV+L+ L+ G++PFD+EN +V  
Sbjct: 282 YDTRKQLHTFCGSLYFAAPELLKAHPYTGPEVDVWSFGVVLYVLVCGKVPFDDENSSV-- 339

Query: 237 LLLKVQKGQFEMPNDTEISRDAQDLIGKILVVDPRQRIKIRDILSHPLLKK 287
           L  K+++G+ E P    +S +   L+ K+LVVDP +R  ++ ++ HP + K
Sbjct: 340 LHEKIKRGKVEYPQ--HLSIEVMSLLSKMLVVDPSRRASLKQVVEHPWMTK 388

>NDAI0J01250 Chr10 complement(291314..294844) [3531 bp, 1176 aa]
           {ON} 
          Length = 1176

 Score =  198 bits (504), Expect = 3e-51,   Method: Compositional matrix adjust.
 Identities = 109/311 (35%), Positives = 182/311 (58%), Gaps = 29/311 (9%)

Query: 16  STIGPWKLGETLGFGSTGKVQLAQHERTGHRTAVKVISKS----------IFNNNGNH-- 63
           +++G W   ET+G GS GKV+LA++ +T    A+K+++++          + ++  NH  
Sbjct: 92  TSLGEWDFIETVGAGSMGKVKLARNRQTREVCAIKIVNRATKIFLTKESKLMSHPTNHII 151

Query: 64  SNDDSVLPYN--IEREIV----------IMKLLSHPNVLSLYDVWETNNNLYLILEYAEK 111
            N+  +L     +E+EI           + ++L HP++  L++++  +N+ Y++ EY   
Sbjct: 152 MNEKDILDRQKRLEKEISRDRRTIREASLGQILYHPHICRLFEMYTLSNHFYMLFEYVSG 211

Query: 112 GELFNLLVDHGPLPEREAINCFRQIIIGISYCHALGIVHRDLKPENLLLDSFYNIKIADF 171
           G+L + ++ HG L E  A N  RQI+  + Y HA  IVHRDLK EN+++ S  NIKI DF
Sbjct: 212 GQLLDYIIQHGSLKESHARNFARQILSALKYLHANNIVHRDLKIENIMISSNGNIKIIDF 271

Query: 172 GMAALQTDADLLETSCGSPHYAAPEIVSGLPYEGFASDVWSCGVILFALLTGRLPFDEEN 231
           G++ L   +  L+T CGS ++AAPE++   PY G   DVWS GV+L+ L+ G++PFD+EN
Sbjct: 272 GLSNLYDKSKKLKTYCGSLYFAAPELLRANPYIGPEIDVWSFGVVLYVLVCGKVPFDDEN 331

Query: 232 GNVRDLLLKVQKGQFEMPNDTEISRDAQDLIGKILVVDPRQRIKIRDILSHP-LLKKYQT 290
            NV  L  K+++G+   P    I  +   L+  +LVVDP +R  +  ++ H  ++K Y +
Sbjct: 332 SNV--LHEKIKQGRVFYPQFLSI--EVISLLSTMLVVDPFKRATLDQVMKHHWMVKDYDS 387

Query: 291 IKDSKSIKDLP 301
           I D+   K +P
Sbjct: 388 IPDAHLPKRVP 398

>Kpol_1072.29 s1072 complement(61987..64668) [2682 bp, 893 aa] {ON}
           complement(61987..64668) [2682 nt, 894 aa]
          Length = 893

 Score =  197 bits (500), Expect = 3e-51,   Method: Compositional matrix adjust.
 Identities = 109/283 (38%), Positives = 159/283 (56%), Gaps = 22/283 (7%)

Query: 17  TIGPWKLGETLGFGSTGKVQLA------QHERTGHRTAVKVISKSIFNNNGNHSNDDSVL 70
           T GP+ +G TLG G  GKV+L        ++    + A+K+I +     N       S  
Sbjct: 40  TFGPYYIGSTLGEGEFGKVKLGWTRNPTSNQEVSKQVAIKLIRRDKIVKN-------SEK 92

Query: 71  PYNIEREIVIMKLLSHPNVLSLYDVWETNNNLYLILEYAEKGELFNLLVDHGPLPEREAI 130
              I REI  +K L+HPN++ L +V + +  + ++LEYA  GE +  +     L E    
Sbjct: 93  EIKIFREINALKHLTHPNIVKLEEVLQNSKYIGIVLEYASGGEFYRYIQRKRRLKETAGC 152

Query: 131 NCFRQIIIGISYCHALGIVHRDLKPENLLLDSFYNIKIADFGMA-ALQTDADLLETSCGS 189
             F Q++ G++Y H+ G+VHRDLK ENLLLD   N+ I DFG       D DL++TSCGS
Sbjct: 153 RLFTQLVSGVNYMHSKGLVHRDLKLENLLLDKHENLVITDFGFVNEFLKDNDLMKTSCGS 212

Query: 190 PHYAAPEIV-SGLPYEGFASDVWSCGVILFALLTGRLPFDE-----ENGNVRDLLLKVQK 243
           P YAAPE+V S  PYE   +D+WSCG+IL+A+L G LP+D+     E  ++  L   + +
Sbjct: 213 PCYAAPELVISTKPYEARKADIWSCGIILYAMLAGYLPWDDDPQNPEGDDIARLYYFITR 272

Query: 244 GQFEMPNDTEISRDAQDLIGKILVVDPRQRIKIRDILSHPLLK 286
              + P    IS   +DL+ ++LV DPR+R+ IR I  H  L+
Sbjct: 273 TSLKFPE--YISPIPRDLLRRLLVSDPRKRLNIRQIQQHEWLR 313

>TDEL0A06000 Chr1 (1053427..1055799) [2373 bp, 790 aa] {ON}
           Anc_8.654 YPL141C
          Length = 790

 Score =  195 bits (496), Expect = 4e-51,   Method: Compositional matrix adjust.
 Identities = 110/291 (37%), Positives = 161/291 (55%), Gaps = 11/291 (3%)

Query: 5   NTETHSAAKPSSTIGPWKLGETLGFGSTGKVQLAQHERTGHRTAVKVISKSIFNNNGNHS 64
           N   H   +   T GP+ LG TLG G  G+V+L   + T      K ++  +   +    
Sbjct: 28  NGGQHRQKRKHVTFGPYILGSTLGEGEFGRVKLGWSKNTSPNEVSKQVAIKLIRRDTIPK 87

Query: 65  NDDSVLPYNIEREIVIMKLLSHPNVLSLYDVWETNNNLYLILEYAEKGELFNLLVDHGPL 124
           N D  +   I REI  +K LSHPN++ L +V + +  + ++LEYA  GE +  +     L
Sbjct: 88  NSDKEI--KIYREINALKHLSHPNIVKLEEVLQNSKYIGIVLEYASGGEFYKYIQKKRRL 145

Query: 125 PEREAINCFRQIIIGISYCHALGIVHRDLKPENLLLDSFYNIKIADFGMA-ALQTDADLL 183
            E  A   F Q+I G+ Y H+ G+VHRDLK ENLLLD   N+ I DFG        ++L+
Sbjct: 146 KEAVACRLFAQLISGVQYMHSKGLVHRDLKLENLLLDKHENLVITDFGFVNEFFAHSELM 205

Query: 184 ETSCGSPHYAAPE-IVSGLPYEGFASDVWSCGVILFALLTGRLPFDEENGN-----VRDL 237
           +TSCGSP YAAPE +VS  PYE   +D+WSCGVIL+A+L G LP+D++  N     +  L
Sbjct: 206 KTSCGSPCYAAPELVVSSKPYEARKADIWSCGVILYAMLAGYLPWDDDTKNPDGNDIGKL 265

Query: 238 LLKVQKGQFEMPNDTEISRDAQDLIGKILVVDPRQRIKIRDILSHPLLKKY 288
              + +   + P    I+   +DL+ +IL  DP++RI +R I  H  +K +
Sbjct: 266 YQYITRTPLKFPE--YITPLPRDLLRRILYPDPKRRISMRSIQKHEWVKPH 314

>TPHA0G01710 Chr7 complement(350452..352869) [2418 bp, 805 aa] {ON}
           Anc_8.654 YPL141C
          Length = 805

 Score =  195 bits (495), Expect = 6e-51,   Method: Compositional matrix adjust.
 Identities = 111/286 (38%), Positives = 162/286 (56%), Gaps = 31/286 (10%)

Query: 17  TIGPWKLGETLGFGSTGKVQLAQHERTGH-----RTAVKVISKSIFNNNGNHSNDDSVLP 71
           T GP+ +G TLG G  GKV+L   + T       + A+K+I +            D++L 
Sbjct: 36  TFGPYYVGSTLGEGEFGKVKLGWTKTTSKLEMPKQVAIKLIRR------------DAILN 83

Query: 72  YN-----IEREIVIMKLLSHPNVLSLYDVWETNNNLYLILEYAEKGELFNLLVDHGPLPE 126
           Y+     I REI  +K L+HPN++ L +V + +  + ++LE+A  GE +  +     L E
Sbjct: 84  YSEKETKIYREINALKHLTHPNIVKLEEVLQNSKYIGIVLEFASGGEFYKYIQKKRRLKE 143

Query: 127 REAINCFRQIIIGISYCHALGIVHRDLKPENLLLDSFYNIKIADFGMA-ALQTDADLLET 185
             A   F Q++ G+ Y H+ G+VHRDLK ENLLLD   N+ I DFG         +L++T
Sbjct: 144 TPACRLFAQLVSGVHYMHSKGLVHRDLKLENLLLDKHENLIITDFGFVNEFSQRNELMKT 203

Query: 186 SCGSPHYAAPE-IVSGLPYEGFASDVWSCGVILFALLTGRLPFDEENGN-----VRDLLL 239
           SCGSP YAAPE +V+  PYE   +DVWSCG+IL+A+L G LP+D++  N     +  L L
Sbjct: 204 SCGSPCYAAPELVVTTEPYEARKADVWSCGIILYAMLAGYLPWDDDPQNPDGDDIAKLYL 263

Query: 240 KVQKGQFEMPNDTEISRDAQDLIGKILVVDPRQRIKIRDILSHPLL 285
            + K   + P    I+   +DL+ KILV DP +R+ IR+I  H  L
Sbjct: 264 YITKTALKFPE--YINPIQRDLLRKILVSDPTKRLNIRNIEKHEWL 307

>Kpol_1012.6 s1012 (11581..13467) [1887 bp, 628 aa] {ON}
           (11581..13467) [1887 nt, 629 aa]
          Length = 628

 Score =  192 bits (487), Expect = 8e-51,   Method: Compositional matrix adjust.
 Identities = 111/291 (38%), Positives = 160/291 (54%), Gaps = 24/291 (8%)

Query: 13  KPSSTIGPWKLGETLGFGSTGKVQLAQHER--------TGHRTAVKVISKSIFNNNGNHS 64
           K   T GP+ LG T+G G  GKV+     +         G + A+K+I +       +  
Sbjct: 47  KKQPTFGPYYLGSTIGEGEFGKVKSGWSRKPQNDNGLTIGKQVAIKLIRRDTLAEKKDQE 106

Query: 65  NDDSVLPYNIEREIVIMKLLSHPNVLSLYDVWETNNNLYLILEYAEKGELFNLLVDHGPL 124
                    + REI  +KLLSHPN++ L DV + +  + ++LEYA  GE +  L     L
Sbjct: 107 -------LKVYREINALKLLSHPNIVKLEDVLQNSKYIGIVLEYASGGEFYKYLQRKKRL 159

Query: 125 PEREAINCFRQIIIGISYCHALGIVHRDLKPENLLLDSFYNIKIADFGMA-ALQTDADLL 183
            E  A + F Q+I G++Y H+ G+VHRDLK ENLLLD   N+ I DFG    + T+  L+
Sbjct: 160 KEPLACSTFAQLISGVAYIHSKGLVHRDLKLENLLLDKHSNLVITDFGFVNEISTNNKLM 219

Query: 184 ETSCGSPHYAAPEIV-SGLPYEGFASDVWSCGVILFALLTGRLPFDE-----ENGNVRDL 237
           +T CGSP YAAPE+V S  PY+   +D+WS GVIL+A+L G LP+D+     +  N+  L
Sbjct: 220 KTPCGSPCYAAPELVLSTKPYDARKADIWSAGVILYAMLAGYLPWDDDPENPDGSNIMRL 279

Query: 238 LLKVQKGQFEMPNDTEISRDAQDLIGKILVVDPRQRIKIRDILSHPLLKKY 288
              + K   + P+   I   A+DLI KILV+ P+ R+ I  +  H  LK +
Sbjct: 280 YEYITKNNLKFPD--YIEPLARDLIRKILVIQPKSRLNIVQVQQHEWLKPH 328

>NDAI0E02320 Chr5 (480203..483001) [2799 bp, 932 aa] {ON} 
          Length = 932

 Score =  196 bits (498), Expect = 8e-51,   Method: Compositional matrix adjust.
 Identities = 111/288 (38%), Positives = 162/288 (56%), Gaps = 26/288 (9%)

Query: 18  IGPWKLGETLGFGSTGKVQLAQHER----------TGHRTAVKVISKSIFNNNGNHSNDD 67
            GP+ +G T+G G  GKV+L   +              + A+K+I +   +        D
Sbjct: 66  FGPYIIGSTIGQGEFGKVKLGWSKNPPSSPPNNLGISKQVAIKLIKRDAIS-------KD 118

Query: 68  SVLPYNIEREIVIMKLLSHPNVLSLYDVWETNNNLYLILEYAEKGELFNLLVDHGPLPER 127
           S     I REI  +K LSHPN++ L +V + +  + ++LEYA  GE +  +     L E 
Sbjct: 119 SSKELKIYREINALKHLSHPNIVKLEEVLQNSRYIGIVLEYASGGEFYRYIQRKKRLKET 178

Query: 128 EAINCFRQIIIGISYCHALGIVHRDLKPENLLLDSFYNIKIADFGMA-ALQTDADLLETS 186
            A   F Q+I G+ Y H+ G+VHRDLK ENLLLD   N+ I DFG      +  +L++TS
Sbjct: 179 AACRLFAQLINGVHYIHSKGLVHRDLKLENLLLDKHENLVITDFGFVNEFYSHNELMKTS 238

Query: 187 CGSPHYAAPEIV-SGLPYEGFASDVWSCGVILFALLTGRLPFDEENGN-----VRDLLLK 240
           CGSP YAAPE+V S  PYE   +D+WSCG+IL+A+L G LP+D+++GN     +  L   
Sbjct: 239 CGSPCYAAPELVISTKPYEARKADIWSCGIILYAMLAGYLPWDDDSGNPDGDDISRLYYY 298

Query: 241 VQKGQFEMPNDTEISRDAQDLIGKILVVDPRQRIKIRDILSHPLLKKY 288
           + K   + P+   I+   +DL+ KILV DPR+RI ++ I  H  LK +
Sbjct: 299 ITKTPLKFPD--YINPIPRDLLRKILVSDPRRRITMKQIEKHEWLKPH 344

>NCAS0C01590 Chr3 (293327..295921) [2595 bp, 864 aa] {ON} Anc_8.654
          Length = 864

 Score =  194 bits (492), Expect = 3e-50,   Method: Compositional matrix adjust.
 Identities = 111/292 (38%), Positives = 164/292 (56%), Gaps = 26/292 (8%)

Query: 17  TIGPWKLGETLGFGSTGKVQLAQHERT----------GHRTAVKVISKSIFNNNGNHSND 66
           T GP+ +G TLG G  GKV+L   + +            + A+K+I +   +        
Sbjct: 44  TFGPYIIGSTLGEGEFGKVKLGWPKNSLPSSSSGIDVPKQVAIKLIRRDTISK------- 96

Query: 67  DSVLPYNIEREIVIMKLLSHPNVLSLYDVWETNNNLYLILEYAEKGELFNLLVDHGPLPE 126
           DS     I REI  +K L+HPN++ L +V + +  + ++LEYA  GE +  +     L E
Sbjct: 97  DSSKEIKIYREINALKHLTHPNIVKLEEVLQNSKYIGIVLEYASGGEFYKYIQRKKRLKE 156

Query: 127 REAINCFRQIIIGISYCHALGIVHRDLKPENLLLDSFYNIKIADFGMAA-LQTDADLLET 185
             A   F Q+I G+ Y H+ G+VHRDLK ENLLLD   N+ I DFG  +   +  +L++T
Sbjct: 157 GPACRLFAQLINGVHYIHSKGLVHRDLKLENLLLDKHENLIITDFGFVSEFYSHGELMKT 216

Query: 186 SCGSPHYAAPE-IVSGLPYEGFASDVWSCGVILFALLTGRLPFDEENGN-----VRDLLL 239
           SCGSP YAAPE +VS  PYE   +D+WSCGVIL+A+L G LP+D++ GN     +  L  
Sbjct: 217 SCGSPCYAAPELVVSTKPYEAKKADIWSCGVILYAMLAGYLPWDDDAGNPDGDDISRLYH 276

Query: 240 KVQKGQFEMPNDTEISRDAQDLIGKILVVDPRQRIKIRDILSHPLLKKYQTI 291
            + +   + P+   I+   +DL+ +IL+ DPR+RI I+ I  H  LK +   
Sbjct: 277 YITQTPLKFPD--YINPIPRDLLRRILISDPRRRITIKYIEKHEWLKPHSAF 326

>ZYRO0F06842g Chr6 (561269..563800) [2532 bp, 843 aa] {ON} similar
           to Saccharomyces cerevisiae YPL141C and to YOR233W
           uniprot|Q01919 Saccharomyces cerevisiae YOR233W KIN4
           Nonessential protein kinase with unknown cellular role
          Length = 843

 Score =  193 bits (490), Expect = 4e-50,   Method: Compositional matrix adjust.
 Identities = 115/294 (39%), Positives = 166/294 (56%), Gaps = 25/294 (8%)

Query: 11  AAKPSS---TIGPWKLGETLGFGSTGKVQLAQHERTG------HRTAVKVISKSIFNNNG 61
           +AKP     T GP+ +G TLG G  GKV+L   +          + A+K+I +     N 
Sbjct: 26  SAKPRKRHVTFGPYIVGSTLGEGEFGKVKLGWSKAASSSLEVPKQVAIKLIRRDSIPKNS 85

Query: 62  NHSNDDSVLPYNIEREIVIMKLLSHPNVLSLYDVWETNNNLYLILEYAEKGELFNLLVDH 121
                       I REI  +K LSHPN++ L +V + +  + ++LEYA  GE +  +   
Sbjct: 86  EKE-------VKIYREINALKHLSHPNIVKLEEVLQNSKYIGIVLEYASGGEFYKYIQRK 138

Query: 122 GPLPEREAINCFRQIIIGISYCHALGIVHRDLKPENLLLDSFYNIKIADFGMA-ALQTDA 180
             L E  A   F Q++ G++Y H+ G+VHRDLK ENLLLD   N+ I DFG      +  
Sbjct: 139 RRLKEAIACRLFAQLVSGVNYMHSKGLVHRDLKLENLLLDKHENLVITDFGFVNEFVSHN 198

Query: 181 DLLETSCGSPHYAAPE-IVSGLPYEGFASDVWSCGVILFALLTGRLPFDEE----NGN-V 234
           +L++TSCGSP YAAPE +VS  PYE   SDVWSCGVIL+A+L G LP+D++    +GN +
Sbjct: 199 ELMKTSCGSPCYAAPELVVSTKPYEARKSDVWSCGVILYAMLAGYLPWDDDPKNPDGNDI 258

Query: 235 RDLLLKVQKGQFEMPNDTEISRDAQDLIGKILVVDPRQRIKIRDILSHPLLKKY 288
             L   + +   + P    I+  ++DL+ +ILV DP++RI +R I  H  LK +
Sbjct: 259 VRLYYYITRTPLKFPE--YITPLSRDLLRRILVSDPKKRITLRSIHKHEWLKPH 310

>SAKL0H07084g Chr8 complement(619288..622047) [2760 bp, 919 aa] {ON}
           weakly similar to uniprot|Q03002 Saccharomyces
           cerevisiae YPL141C Hypothetical ORF
          Length = 919

 Score =  193 bits (490), Expect = 7e-50,   Method: Compositional matrix adjust.
 Identities = 105/279 (37%), Positives = 160/279 (57%), Gaps = 11/279 (3%)

Query: 17  TIGPWKLGETLGFGSTGKVQLAQHERTGHRTAVKVISKSIFNNNGNHSNDDSVLPYNIER 76
           T GP+ +G TLG G  GKV+L   + TG     K ++  +   +    N D  +   I R
Sbjct: 40  TFGPYIVGSTLGEGEFGKVKLGWSKTTGSNEVPKQVAIKLIRRDTVPKNSDKEV--KIYR 97

Query: 77  EIVIMKLLSHPNVLSLYDVWETNNNLYLILEYAEKGELFNLLVDHGPLPEREAINCFRQI 136
           EI  +K L+HPN++ L +V + +  + ++LEYA  GE +  +     L E  A   F Q+
Sbjct: 98  EINALKHLTHPNIVRLEEVLQNSKYIGIVLEYASGGEFYRYIQKKRRLKEHAACRLFAQL 157

Query: 137 IIGISYCHALGIVHRDLKPENLLLDSFYNIKIADFGMA-ALQTDADLLETSCGSPHYAAP 195
           I G+ Y H+ G+VHRDLK ENLLLD   N+ I DFG         +L++TSCGSP YAAP
Sbjct: 158 ISGVHYMHSKGLVHRDLKLENLLLDKNENLLITDFGFVNEFNHKNELMKTSCGSPCYAAP 217

Query: 196 E-IVSGLPYEGFASDVWSCGVILFALLTGRLPFDEENGN-----VRDLLLKVQKGQFEMP 249
           E +V+  PYE   +D+WSCGVI++A+L G LP+D+++ N     +  L   + K   + P
Sbjct: 218 ELVVTTKPYEARKADIWSCGVIMYAMLAGYLPWDDDSENPEGDDIAKLYHYITKTPLKFP 277

Query: 250 NDTEISRDAQDLIGKILVVDPRQRIKIRDILSHPLLKKY 288
               I+   +DL+ +ILV +P++R+ +R +  H  L+ +
Sbjct: 278 E--YINPVPRDLLRRILVSNPKKRLNLRQVEQHQWLQPH 314

>KAFR0A03730 Chr1 (761946..764312) [2367 bp, 788 aa] {ON} Anc_8.654
           YPL141C
          Length = 788

 Score =  191 bits (486), Expect = 8e-50,   Method: Compositional matrix adjust.
 Identities = 117/305 (38%), Positives = 173/305 (56%), Gaps = 33/305 (10%)

Query: 5   NTETHSAAKPSSTIGPWKLGETLGFGSTGKVQLA---QHERT--GHRTAVKVISKSIFNN 59
           N   +S+ +   T GP+ +G TLG G  GKV+L    ++E T    + A+K+I +     
Sbjct: 18  NPSHNSSRRKHVTFGPYIVGSTLGKGEFGKVKLGWSRKNESTDISKQVAIKLIRR----- 72

Query: 60  NGNHSNDDSVLP-----YNIEREIVIMKLLSHPNVLSLYDVWETNNNLYLILEYAEKGEL 114
                  DS+L        I REI  +K L+HPN++ L +V + +  + ++LEYA  GE 
Sbjct: 73  -------DSILQDREKEIKIYREINALKHLTHPNIVRLEEVLQNSKYIGIVLEYASGGEF 125

Query: 115 FNLLVDHGPLPEREAINCFRQIIIGISYCHALGIVHRDLKPENLLLDSFYNIKIADFGMA 174
           +  +     L E  A   F Q++ G+ Y H+ G+VHRDLK ENLLLD   N+ I DFG  
Sbjct: 126 YKYIQKKRRLKEPIACKLFAQLVSGVYYMHSKGLVHRDLKLENLLLDKNENLIITDFGFV 185

Query: 175 A--LQTDADLLETSCGSPHYAAPE-IVSGLPYEGFASDVWSCGVILFALLTGRLPFDEEN 231
              LQ + +L++TSCGSP YAAPE +V+  PY+   +DVWSCG+ILFA+L G LP+D++ 
Sbjct: 186 NEFLQNN-ELMKTSCGSPCYAAPELVVTSNPYKARKADVWSCGIILFAMLAGYLPWDDDP 244

Query: 232 GNVR-----DLLLKVQKGQFEMPNDTEISRDAQDLIGKILVVDPRQRIKIRDILSHPLLK 286
            N R      L   +     + P  + IS   +DL+ KILV +P QR+ +R+I +H  LK
Sbjct: 245 DNPRGDDIAKLYNYITTSPLKFP--SYISAIPRDLLRKILVANPNQRLSLREIETHQWLK 302

Query: 287 KYQTI 291
            + + 
Sbjct: 303 PHSSF 307

>TPHA0J00820 Chr10 (193408..197064) [3657 bp, 1218 aa] {ON}
           Anc_8.279 YLR096W
          Length = 1218

 Score =  194 bits (492), Expect = 9e-50,   Method: Compositional matrix adjust.
 Identities = 100/289 (34%), Positives = 169/289 (58%), Gaps = 22/289 (7%)

Query: 17  TIGPWKLGETLGFGSTGKVQLAQHERTGHRTAVKVI---SKSIFNNNGN----HSNDDSV 69
           ++G W   ET+G GS GKV+LA+H +T    A+K++   +KS      +     S ++++
Sbjct: 150 SLGDWDFLETVGAGSMGKVKLARHHKTNEVCAIKIVNRATKSFLQKEASLPPPKSEEEAL 209

Query: 70  -LPYNIEREIV----------IMKLLSHPNVLSLYDVWETNNNLYLILEYAEKGELFNLL 118
               N+E+EI           + ++L HP++  L+++   +N+ Y++ EY   G+L + +
Sbjct: 210 ERQKNLEKEISRDKRTIREASLGQILYHPHICRLFEICTMSNHFYMLFEYVSGGQLLDYI 269

Query: 119 VDHGPLPEREAINCFRQIIIGISYCHALGIVHRDLKPENLLLDSFYNIKIADFGMAALQT 178
           + HG L E  A    R I   + Y H   IVHRDLK EN+++ +  +IKI DFG++ L  
Sbjct: 270 IQHGSLREHHARKFTRGIASALQYLHGNNIVHRDLKIENIMISTSGDIKIIDFGLSNLYD 329

Query: 179 DADLLETSCGSPHYAAPEIVSGLPYEGFASDVWSCGVILFALLTGRLPFDEENGNVRDLL 238
               L T CGS ++AAPE++   PY G   D+WS GV+L+ L  G++PFD+EN +V  L 
Sbjct: 330 SKKQLNTFCGSLYFAAPELLKANPYVGPEVDIWSFGVVLYVLACGKVPFDDENSSV--LH 387

Query: 239 LKVQKGQFEMPNDTEISRDAQDLIGKILVVDPRQRIKIRDILSHPLLKK 287
            K+++G+ + P    +S +   L+ K+LVVDP++R  ++ I++HP + +
Sbjct: 388 EKIKQGKVDYPQ--HLSIEVISLLSKMLVVDPKKRASLQQIVNHPWMTR 434

>Ecym_4291 Chr4 complement(620549..623986) [3438 bp, 1145 aa] {ON}
           similar to Ashbya gossypii AGR058W
          Length = 1145

 Score =  194 bits (492), Expect = 1e-49,   Method: Compositional matrix adjust.
 Identities = 101/291 (34%), Positives = 166/291 (57%), Gaps = 24/291 (8%)

Query: 17  TIGPWKLGETLGFGSTGKVQLAQHERTGHRTAVKVI---SKSIFNNNGNH-----SNDDS 68
           ++G W   ET+G GS GKV+LA+H  T    A+K++   +KS  +          SN++ 
Sbjct: 111 SLGDWDFLETVGAGSMGKVKLAKHRYTNELCAIKIVNRATKSFIHKQQQQQLPPPSNEEE 170

Query: 69  VLPYNIE------------REIVIMKLLSHPNVLSLYDVWETNNNLYLILEYAEKGELFN 116
           ++    +            RE  + ++L HP++  L+++   +N+ Y++ EY   G+L +
Sbjct: 171 LMERRKKLEKEISRDKRTIREASLGQILYHPHICRLFEMCTMSNHFYMLFEYVSGGQLLD 230

Query: 117 LLVDHGPLPEREAINCFRQIIIGISYCHALGIVHRDLKPENLLLDSFYNIKIADFGMAAL 176
            ++ HG L ER A    R I   + Y H   IVHRDLK EN+++ S   I+I DFG++ L
Sbjct: 231 YIIQHGSLRERHARKFARGIASALQYLHMNNIVHRDLKIENIMISSSGEIRIIDFGLSNL 290

Query: 177 QTDADLLETSCGSPHYAAPEIVSGLPYEGFASDVWSCGVILFALLTGRLPFDEENGNVRD 236
                 L T CGS ++AAPE++   PY G   D+WS GV+L+ L+ G++PFD+EN +V  
Sbjct: 291 YDPKKQLHTFCGSLYFAAPELLKAHPYTGPEVDIWSFGVVLYVLVCGKVPFDDENASV-- 348

Query: 237 LLLKVQKGQFEMPNDTEISRDAQDLIGKILVVDPRQRIKIRDILSHPLLKK 287
           L  K+++G+ E P    +S D   L+ K+LVVDP +R  ++ +++H  ++K
Sbjct: 349 LHEKIKQGKVEYPQ--HLSIDVISLLSKMLVVDPLKRATLKQVVNHQWMQK 397

>Smik_4.367 Chr4 (655941..659141) [3201 bp, 1066 aa] {ON} YDR122W
           (REAL)
          Length = 1066

 Score =  193 bits (490), Expect = 1e-49,   Method: Compositional matrix adjust.
 Identities = 101/284 (35%), Positives = 163/284 (57%), Gaps = 22/284 (7%)

Query: 17  TIGPWKLGETLGFGSTGKVQLAQHERTGHRTAVKVISKSI--FNNNGNH----SNDDSVL 70
           ++G W+  ET+G GS GKV+LA+H  T    AVK+++++   F +         N+  VL
Sbjct: 114 SLGDWEFVETVGAGSMGKVKLAKHRYTNEVCAVKIVNRATKAFLHKEQMLPPPKNEQDVL 173

Query: 71  PYNIE------------REIVIMKLLSHPNVLSLYDVWETNNNLYLILEYAEKGELFNLL 118
               +            RE  + ++L HP++  L+++   +N+ Y++ EY   G+L + +
Sbjct: 174 ERQKKLEKEISRDKRTIREASLGQVLYHPHICRLFEMCTLSNHFYMLFEYVSGGQLLDYI 233

Query: 119 VDHGPLPEREAINCFRQIIIGISYCHALGIVHRDLKPENLLLDSFYNIKIADFGMAALQT 178
           + HG + E +A    R I   + Y HA  IVHRDLK EN+++     IKI DFG++ L  
Sbjct: 234 IQHGSIREHQARKFARGIASALMYLHANNIVHRDLKIENIMISDSSEIKIIDFGLSNLYD 293

Query: 179 DADLLETSCGSPHYAAPEIVSGLPYEGFASDVWSCGVILFALLTGRLPFDEENGNVRDLL 238
               L T CGS ++AAPE++   PY G   DVWS GV+LF L+ G++PFD+EN +V  L 
Sbjct: 294 SRKQLHTFCGSLYFAAPELLKAHPYTGPEVDVWSFGVVLFVLVCGKVPFDDENSSV--LH 351

Query: 239 LKVQKGQFEMPNDTEISRDAQDLIGKILVVDPRQRIKIRDILSH 282
            K+++G+ E P    +S +   L+ K+LVVDP++R  ++ ++ H
Sbjct: 352 EKIKQGKVEYPQ--HLSIEVISLLSKMLVVDPKRRATLKQVVEH 393

>Kpol_1066.46 s1066 (82874..86551) [3678 bp, 1225 aa] {ON}
           (82874..86551) [3678 nt, 1226 aa]
          Length = 1225

 Score =  193 bits (491), Expect = 1e-49,   Method: Compositional matrix adjust.
 Identities = 102/293 (34%), Positives = 172/293 (58%), Gaps = 23/293 (7%)

Query: 17  TIGPWKLGETLGFGSTGKVQLAQHERTGHRTAVKVI---SKSIFNNNGN---HSNDDSVL 70
           ++G W   ET+G GS GKV+LA+H RT    A+K++   +K+  +   +    +ND  ++
Sbjct: 141 SLGDWNFLETVGAGSMGKVKLAKHHRTNEICAIKIVNRATKAFLHKEQSLPAPANDQEIM 200

Query: 71  PY--NIEREIV----------IMKLLSHPNVLSLYDVWETNNNLYLILEYAEKGELFNLL 118
               N+E+EI           + ++L HP++  L+++   +N+ Y++ EY   G+L + +
Sbjct: 201 ERQKNLEKEISRDKRTIREASLGQILYHPHICRLFEMCTMSNHFYMLFEYVSGGQLLDYI 260

Query: 119 VDHGPLPEREAINCFRQIIIGISYCHALGIVHRDLKPENLLLDSFYNIKIADFGMAALQT 178
           + HG L E  A    R I   + Y HA  IVHRDLK EN+++ +   IK+ DFG++ L  
Sbjct: 261 IQHGSLREHHARRFARGIASALQYLHANNIVHRDLKIENIMISTSGEIKLIDFGLSNLYD 320

Query: 179 DADLLETSCGSPHYAAPEIVSGLPYEGFASDVWSCGVILFALLTGRLPFDEENGNVRDLL 238
           +   L T CGS ++AAPE++   PY G   DVWS GV+L+ L+ G++PFD+EN +V  L 
Sbjct: 321 NRKQLHTFCGSLYFAAPELLKANPYTGPEVDVWSFGVVLYVLVCGKVPFDDENSSV--LH 378

Query: 239 LKVQKGQFEMPNDTEISRDAQDLIGKILVVDPRQRIKIRDILSHP-LLKKYQT 290
            K+++G+ E      +S +   L+ K+LVVDP++R  ++ ++ H  +++ Y T
Sbjct: 379 EKIKQGKVEY--SQHLSIEVISLLSKMLVVDPKRRASLKQVVDHHWMVRGYDT 429

>Skud_4.383 Chr4 (666354..669551) [3198 bp, 1065 aa] {ON} YDR122W
           (REAL)
          Length = 1065

 Score =  193 bits (490), Expect = 1e-49,   Method: Compositional matrix adjust.
 Identities = 102/284 (35%), Positives = 164/284 (57%), Gaps = 22/284 (7%)

Query: 17  TIGPWKLGETLGFGSTGKVQLAQHERTGHRTAVKVISKSI--FNNNGNH----SNDDSVL 70
           ++G W+  ET+G GS GKV+LA+H RT    AVK+++++   F +         N+  VL
Sbjct: 114 SLGDWEFIETVGAGSMGKVKLARHRRTNEVCAVKIVNRATKAFLHKEQMLPPPKNEQDVL 173

Query: 71  PYNIE------------REIVIMKLLSHPNVLSLYDVWETNNNLYLILEYAEKGELFNLL 118
               +            RE  + ++L HP++  L+++   +N+ Y++ EY   G+L + +
Sbjct: 174 ERQKKLEKEISRDKRTIREASLGQILYHPHICRLFEMCTLSNHFYMLFEYVSGGQLLDYI 233

Query: 119 VDHGPLPEREAINCFRQIIIGISYCHALGIVHRDLKPENLLLDSFYNIKIADFGMAALQT 178
           + HG + E +A    R I   + Y HA  IVHRDLK EN+++     IKI DFG++ L  
Sbjct: 234 IQHGSIREHQAKKFARGIASALMYLHANNIVHRDLKIENIMISDSSEIKIIDFGLSNLYD 293

Query: 179 DADLLETSCGSPHYAAPEIVSGLPYEGFASDVWSCGVILFALLTGRLPFDEENGNVRDLL 238
               L T CGS ++AAPE++   PY G   DVWS GV+LF L+ G++PFD+EN +V  L 
Sbjct: 294 SRKQLYTFCGSLYFAAPELLKANPYTGPEVDVWSFGVVLFVLVCGKVPFDDENSSV--LH 351

Query: 239 LKVQKGQFEMPNDTEISRDAQDLIGKILVVDPRQRIKIRDILSH 282
            K+++G+ E P    +S +   L+ K+LVVDP++R  ++ ++ H
Sbjct: 352 EKIKQGKVEYPQ--HLSIEVISLLSKMLVVDPKRRATLKQVVEH 393

>NCAS0B05090 Chr2 (946126..949758) [3633 bp, 1210 aa] {ON} 
          Length = 1210

 Score =  193 bits (490), Expect = 2e-49,   Method: Compositional matrix adjust.
 Identities = 98/292 (33%), Positives = 167/292 (57%), Gaps = 28/292 (9%)

Query: 17  TIGPWKLGETLGFGSTGKVQLAQHERTGHRTAVKVISKSIFNNNGNHSNDDSVLPYNIER 76
           ++G W   ET+G GS GKV+LA+H +T    A+K++++++         + S+ P   E+
Sbjct: 158 SLGDWDFLETVGAGSMGKVKLARHHQTKEICAIKIVNRAM---KAFLHKEQSMPPPRTEQ 214

Query: 77  EIV---------------------IMKLLSHPNVLSLYDVWETNNNLYLILEYAEKGELF 115
           E++                     + ++L HP++  L+++   +N+ Y++ EY   G+L 
Sbjct: 215 EVLERQKKLEKEISRDKRTIREASLGQVLYHPHICRLFEMCTMSNHFYMLFEYVSGGQLL 274

Query: 116 NLLVDHGPLPEREAINCFRQIIIGISYCHALGIVHRDLKPENLLLDSFYNIKIADFGMAA 175
           + ++ HG L E  A    R I   + Y HA  IVHRDLK EN+++ +   IKI DFG++ 
Sbjct: 275 DYIIQHGSLREHHARKFARGIASALEYIHANNIVHRDLKIENIMISTSGEIKIIDFGLSN 334

Query: 176 LQTDADLLETSCGSPHYAAPEIVSGLPYEGFASDVWSCGVILFALLTGRLPFDEENGNVR 235
           +      L T CGS ++AAPE++   PY G   DVWS GV+L+ L+ G++PFD+EN +V 
Sbjct: 335 VFDRKKQLHTFCGSLYFAAPELLKAHPYTGPEVDVWSFGVVLYVLVCGKVPFDDENSSV- 393

Query: 236 DLLLKVQKGQFEMPNDTEISRDAQDLIGKILVVDPRQRIKIRDILSHPLLKK 287
            L  K+++G+ + PN   +S +   L+ K+LVVDP +R  ++ ++ HP + +
Sbjct: 394 -LHEKIKQGKVDYPN--HLSIEVISLLSKMLVVDPLRRASLKQVVEHPWMTR 442

>Smik_15.417 Chr15 (725513..727933) [2421 bp, 806 aa] {ON} YOR233W
           (REAL)
          Length = 806

 Score =  191 bits (484), Expect = 2e-49,   Method: Compositional matrix adjust.
 Identities = 110/288 (38%), Positives = 162/288 (56%), Gaps = 21/288 (7%)

Query: 16  STIGPWKLGETLGFGSTGKVQLAQHERTG-----HRTAVKVISKSIFNNNGNHSNDDSVL 70
           +T GP+ +G TLG G  GKV+L   + +       + A+K+I +     +     D  V 
Sbjct: 41  ATFGPYIIGSTLGEGEFGKVKLGWTKASSPTEVPKQVAIKLIRRDTIKKDA----DKEVK 96

Query: 71  PYNIEREIVIMKLLSHPNVLSLYDVWETNNNLYLILEYAEKGELFNLLVDHGPLPEREAI 130
            Y   REI  +K L+HPN++ L +V + +  + ++LE+   GE +  +     L E  A 
Sbjct: 97  IY---REINALKHLTHPNIIYLEEVLQNSKYIGIVLEFVSGGEFYKYIQRKRRLKESSAC 153

Query: 131 NCFRQIIIGISYCHALGIVHRDLKPENLLLDSFYNIKIADFGMA-ALQTDADLLETSCGS 189
             F Q+I G++Y H  G+VHRDLK ENLLLD   N+ I DFG       D +L+ TSCGS
Sbjct: 154 RLFAQLISGVNYMHYKGLVHRDLKLENLLLDKHENLVITDFGFVNEFFKDNELMNTSCGS 213

Query: 190 PHYAAPE-IVSGLPYEGFASDVWSCGVILFALLTGRLPFDEENGN-----VRDLLLKVQK 243
           P YAAPE +VS  PYE   +DVWSCGVIL+A+L G LP+D+++ N     +  L   + +
Sbjct: 214 PCYAAPELVVSTKPYEARKADVWSCGVILYAMLAGYLPWDDDHENPTGDDIARLYQYITQ 273

Query: 244 GQFEMPNDTEISRDAQDLIGKILVVDPRQRIKIRDILSHPLLKKYQTI 291
              + P    I+   +DL+ +ILV +PR+R+ +R I  H  LK + T 
Sbjct: 274 TPLKFPE--YITPVPRDLLRRILVPNPRRRVSLRSIERHEWLKPHYTF 319

>NDAI0B02070 Chr2 (514024..517800) [3777 bp, 1258 aa] {ON} 
          Length = 1258

 Score =  192 bits (489), Expect = 2e-49,   Method: Compositional matrix adjust.
 Identities = 109/337 (32%), Positives = 183/337 (54%), Gaps = 41/337 (12%)

Query: 17  TIGPWKLGETLGFGSTGKVQLAQHERTGHRTAVKVISKSIFNNNGNHSNDDSVLPYNIER 76
           ++G W   ET+G GS GKV+LA+H +T    A+K+++++          + S+ P   E+
Sbjct: 160 SLGDWDFLETVGAGSMGKVKLAKHHQTQEICAIKIVNRAT---KAFLHKEQSMPPPKNEQ 216

Query: 77  EIV---------------------IMKLLSHPNVLSLYDVWETNNNLYLILEYAEKGELF 115
           EI                      + ++L HP++  L+++   +N+ Y++ EY   G+L 
Sbjct: 217 EIAERQKRLEKEISRDKRTVREASLGQILYHPHICRLFEMCTMSNHFYMLFEYVSGGQLL 276

Query: 116 NLLVDHGPLPEREAINCFRQIIIGISYCHALGIVHRDLKPENLLLDSFYNIKIADFGMAA 175
           + ++ HG L E  A    R I   + Y H   IVHRDLK EN+++ +   IKI DFG++ 
Sbjct: 277 DYIIQHGSLREHHARKFARGIASALQYLHLNNIVHRDLKIENIMISNSGEIKIIDFGLSN 336

Query: 176 LQTDADLLETSCGSPHYAAPEIVSGLPYEGFASDVWSCGVILFALLTGRLPFDEENGNVR 235
           +  +   L T CGS ++AAPE++   PY G   DVWS G++L+ L+ G++PFD+EN +V 
Sbjct: 337 VFDNRKQLHTFCGSLYFAAPELLKAHPYTGPEVDVWSFGIVLYVLVCGKVPFDDENSSV- 395

Query: 236 DLLLKVQKGQFEMPNDTEISRDAQDLIGKILVVDPRQRIKIRDILSHPLLKKYQTIKDSK 295
            L  K+++G+ E PN   +S +   L+ K++VVDP +R  +R ++ HP + +     D  
Sbjct: 396 -LHEKIRQGKVEYPN--HLSIEVISLLSKMIVVDPAKRASLRQVVEHPWMTRGY---DFP 449

Query: 296 SIKDLPRENTYLYPLADSNNHTSASIDDSILQNLVVL 332
            +  LPR      PL      T  +ID+++L+ +  L
Sbjct: 450 PLSYLPRR----IPL------TPEAIDNNVLREMFRL 476

>TBLA0C04600 Chr3 (1112043..1115990) [3948 bp, 1315 aa] {ON}
           Anc_8.279 YLR096W
          Length = 1315

 Score =  192 bits (489), Expect = 3e-49,   Method: Compositional matrix adjust.
 Identities = 99/287 (34%), Positives = 163/287 (56%), Gaps = 28/287 (9%)

Query: 17  TIGPWKLGETLGFGSTGKVQLAQHERTGHRTAVKVISKSIFNNNGNHSNDDSVLPYNIER 76
           ++G W   ET+G GS GKV+LA+H  T    A+KV++++     G    + ++ P   E+
Sbjct: 179 SLGDWDFLETVGAGSMGKVKLAKHHYTNEICAIKVVNRAT---KGFLHKEQTLPPPQTEQ 235

Query: 77  EIV---------------------IMKLLSHPNVLSLYDVWETNNNLYLILEYAEKGELF 115
           EI+                     + ++L HP++  L+++   +N+ Y++ EY   G+L 
Sbjct: 236 EILERQKNLEKEISRDKRTIREASLGQILYHPHICRLFEMCTMSNHFYMLFEYVSGGQLL 295

Query: 116 NLLVDHGPLPEREAINCFRQIIIGISYCHALGIVHRDLKPENLLLDSFYNIKIADFGMAA 175
           + ++ HG L E  A    R I   + Y H+  IVHRDLK EN+++ +   IKI DFG++ 
Sbjct: 296 DYIIQHGSLREHHARKFARGIASALQYLHSNNIVHRDLKIENIMISTSGEIKIIDFGLSN 355

Query: 176 LQTDADLLETSCGSPHYAAPEIVSGLPYEGFASDVWSCGVILFALLTGRLPFDEENGNVR 235
           L      L T CGS ++AAPE++   PY G   DVWS GV+L+ L+ G++PFD+EN +V 
Sbjct: 356 LYDTTRQLHTFCGSLYFAAPELLKAHPYTGPEVDVWSFGVVLYVLVCGKVPFDDENSSV- 414

Query: 236 DLLLKVQKGQFEMPNDTEISRDAQDLIGKILVVDPRQRIKIRDILSH 282
            L  K+++G+ + P    +S +   L+ K+LVVDP++R  +R ++ H
Sbjct: 415 -LHEKIKQGKVDYPQ--HLSIEVISLLSKMLVVDPKKRATLRQVVEH 458

>NCAS0B03740 Chr2 complement(668231..671380) [3150 bp, 1049 aa] {ON}
           Anc_8.279
          Length = 1049

 Score =  191 bits (486), Expect = 4e-49,   Method: Compositional matrix adjust.
 Identities = 100/290 (34%), Positives = 165/290 (56%), Gaps = 27/290 (9%)

Query: 16  STIGPWKLGETLGFGSTGKVQLAQHERTGHRTAVKVISKS---IFNNNGNHSNDDSVLPY 72
           +++G W   ET+G GS GKV+LA++ RT    A+K+++++     +      ++   +P 
Sbjct: 66  TSLGDWDFVETVGAGSMGKVKLAKNRRTNEVCAIKIVNRATKIFLSKEYAAKHNGYTIPL 125

Query: 73  ----------NIE----------REIVIMKLLSHPNVLSLYDVWETNNNLYLILEYAEKG 112
                     N+E          RE  + ++L HP++  LY++   +N+ Y++ EY   G
Sbjct: 126 SEKEVIERQKNLEKEASRDKRTVREASLGQILYHPHICRLYEMHTLSNHFYMLFEYVSGG 185

Query: 113 ELFNLLVDHGPLPEREAINCFRQIIIGISYCHALGIVHRDLKPENLLLDSFYNIKIADFG 172
           +L + ++ HG L E  A    RQI   + Y H+  IVHRDLK EN+++    NIK+ DFG
Sbjct: 186 QLLDYIIQHGSLKESRARTFTRQICSALKYLHSHNIVHRDLKIENIMISKDGNIKLIDFG 245

Query: 173 MAALQTDADLLETSCGSPHYAAPEIVSGLPYEGFASDVWSCGVILFALLTGRLPFDEENG 232
           ++ L    + L+T CGS ++AAPE++   PY G   DVWS GV+L+ L+ G++PFD+EN 
Sbjct: 246 LSNLYDKCNKLKTYCGSLYFAAPELLKATPYIGPEIDVWSFGVVLYVLVCGKVPFDDENS 305

Query: 233 NVRDLLLKVQKGQFEMPNDTEISRDAQDLIGKILVVDPRQRIKIRDILSH 282
           NV  L  K+++G+   P    I  +   L+ K+LVVDP +R  +  +++H
Sbjct: 306 NV--LHEKIKQGKVFYPQFLSI--EVISLLSKMLVVDPFKRATLDQVMNH 351

>Suva_2.283 Chr2 (489490..492759) [3270 bp, 1089 aa] {ON} YDR122W
           (REAL)
          Length = 1089

 Score =  191 bits (486), Expect = 4e-49,   Method: Compositional matrix adjust.
 Identities = 108/307 (35%), Positives = 172/307 (56%), Gaps = 33/307 (10%)

Query: 4   ANTETHSAAKPSS----------TIGPWKLGETLGFGSTGKVQLAQHERTGHRTAVKVIS 53
           +NT + S A PSS          ++G W+  ET+G GS GKV+LA+H  T    AVK+++
Sbjct: 105 SNTSSQSRA-PSSQGMPKQFHRKSLGDWEFVETVGAGSMGKVKLAKHHYTNEVCAVKIVN 163

Query: 54  KSI--FNNNGNH----SNDDSVLPYNIE------------REIVIMKLLSHPNVLSLYDV 95
           ++   F +         N+  VL    +            RE  + ++L HP++  L+++
Sbjct: 164 RATKAFLHKEQMLPPPKNEQDVLERQKKLEKEISRDKRTIREASLGQILYHPHICRLFEM 223

Query: 96  WETNNNLYLILEYAEKGELFNLLVDHGPLPEREAINCFRQIIIGISYCHALGIVHRDLKP 155
              +N+ Y++ EY   G+L + ++ HG + E +A    R I   + Y HA  IVHRDLK 
Sbjct: 224 CTLSNHFYMLFEYVSGGQLLDYIIQHGSIREHQARKFARGIASALMYLHANNIVHRDLKI 283

Query: 156 ENLLLDSFYNIKIADFGMAALQTDADLLETSCGSPHYAAPEIVSGLPYEGFASDVWSCGV 215
           EN+++     IKI DFG++ L      L T CGS ++AAPE++   PY G   DVWS GV
Sbjct: 284 ENIMISDSSEIKIIDFGLSNLYDSRKQLHTFCGSLYFAAPELLKANPYTGPEVDVWSFGV 343

Query: 216 ILFALLTGRLPFDEENGNVRDLLLKVQKGQFEMPNDTEISRDAQDLIGKILVVDPRQRIK 275
           +LF L+ G++PFD+EN +V  L  K+++G+ E P    +S +   L+ K+LVVDP++R  
Sbjct: 344 VLFVLVCGKVPFDDENSSV--LHEKIKQGKVEYPQ--HLSIEVISLLSKMLVVDPKRRAT 399

Query: 276 IRDILSH 282
           ++ ++ H
Sbjct: 400 LKQVVEH 406

>Suva_8.284 Chr8 (514891..517317) [2427 bp, 808 aa] {ON} YOR233W
           (REAL)
          Length = 808

 Score =  189 bits (480), Expect = 5e-49,   Method: Compositional matrix adjust.
 Identities = 115/318 (36%), Positives = 175/318 (55%), Gaps = 24/318 (7%)

Query: 16  STIGPWKLGETLGFGSTGKVQLAQHERTG-----HRTAVKVISKSIFNNNGNHSNDDSVL 70
           +T GP+ +G TLG G  GKV+L   + +       + A+K+I +     +     D  V 
Sbjct: 41  ATFGPYIVGSTLGEGEFGKVKLGWSKASSPNEVPKQVAIKLIRRDTIKKDA----DKEVK 96

Query: 71  PYNIEREIVIMKLLSHPNVLSLYDVWETNNNLYLILEYAEKGELFNLLVDHGPLPEREAI 130
            Y   REI  +K L+HPN++ L +V + +  + ++LE+   GE +  +     L E  A 
Sbjct: 97  IY---REINALKHLTHPNIIYLEEVLQNSKYIGIVLEFVSGGEFYKYIQRKRRLKESSAC 153

Query: 131 NCFRQIIIGISYCHALGIVHRDLKPENLLLDSFYNIKIADFGMA-ALQTDADLLETSCGS 189
             F Q+I G++Y H  G+VHRDLK ENLL+D   N+ I DFG       D +L+ TSCGS
Sbjct: 154 RLFAQLISGVNYMHTKGLVHRDLKLENLLMDKHENLVITDFGFVNEFFEDNELMRTSCGS 213

Query: 190 PHYAAPE-IVSGLPYEGFASDVWSCGVILFALLTGRLPFDEENGN-----VRDLLLKVQK 243
           P YAAPE +VS   YE   +DVWSCGVIL+A+L G LP+D+++ N     +  L   + +
Sbjct: 214 PCYAAPELVVSTKAYEARKADVWSCGVILYAMLAGYLPWDDDHENPTGDDIARLYQYITQ 273

Query: 244 GQFEMPNDTEISRDAQDLIGKILVVDPRQRIKIRDILSHPLLKKYQ---TIKDSKSIKDL 300
              + P    I+   +DL+ +ILV +PR+R+ +R I  H  LK +Q   +I+ +   + L
Sbjct: 274 TPLKFPE--YITPIPRDLLRRILVPNPRRRVSLRAIQRHEWLKPHQAFLSIQPNYWDEQL 331

Query: 301 PRENTYLYPLADSNNHTS 318
            +E+  L    D   HT+
Sbjct: 332 QKEHPQLAAGGDVGRHTT 349

>TDEL0F04060 Chr6 (749896..753276) [3381 bp, 1126 aa] {ON} Anc_8.279
           YLR096W
          Length = 1126

 Score =  191 bits (485), Expect = 5e-49,   Method: Compositional matrix adjust.
 Identities = 100/287 (34%), Positives = 162/287 (56%), Gaps = 28/287 (9%)

Query: 17  TIGPWKLGETLGFGSTGKVQLAQHERTGHRTAVKVISKSIFNNNGNHSNDDSVLPYNIER 76
           ++G W   ET+G GS GKV+LA+H  T    A+K+++++    N     + S+ P   E 
Sbjct: 74  SLGEWDFLETVGAGSMGKVKLAKHRYTKEVCAIKIVNRA---TNAFLHKEQSLPPPKKEE 130

Query: 77  EIV---------------------IMKLLSHPNVLSLYDVWETNNNLYLILEYAEKGELF 115
           EI+                     + ++L HP++  L+++   +N+ Y++ EY   G+L 
Sbjct: 131 EILERQKKLEKEISRDKRTIREASLGQILYHPHICRLFEMCTMSNHFYMLFEYVSGGQLL 190

Query: 116 NLLVDHGPLPEREAINCFRQIIIGISYCHALGIVHRDLKPENLLLDSFYNIKIADFGMAA 175
           + ++ HG L E  A    R I   + Y HA  IVHRDLK EN+++ +   IKI DFG++ 
Sbjct: 191 DYIIQHGSLREHHARKFTRGIASALQYLHANNIVHRDLKIENIMISTSGEIKIIDFGLSN 250

Query: 176 LQTDADLLETSCGSPHYAAPEIVSGLPYEGFASDVWSCGVILFALLTGRLPFDEENGNVR 235
           L   +  L T CGS ++AAPE++   PY G   DVWS GV+L+ L+ G++PFD+EN +V 
Sbjct: 251 LFDKSKQLHTFCGSLYFAAPELLKASPYTGPEVDVWSFGVVLYVLVCGKVPFDDENSSV- 309

Query: 236 DLLLKVQKGQFEMPNDTEISRDAQDLIGKILVVDPRQRIKIRDILSH 282
            L  K+++G+ E P    +S +   L+ K+LVVDP +R  ++ ++ H
Sbjct: 310 -LHEKIKQGKVEYPQ--HLSIEVISLLSKMLVVDPHRRASLKQVVEH 353

>SAKL0H16632g Chr8 complement(1461613..1464801) [3189 bp, 1062 aa]
           {ON} similar to uniprot|P13186 Saccharomyces cerevisiae
           YLR096W KIN2 Serine/threonine protein kinase involved in
           regulation of exocytosis localizes to the cytoplasmic
           face of the plasma membrane closely related to Kin1p and
           to YDR122W uniprot|P13185 Saccharomyces cerevisiae
           YDR122W KIN1 Serine/threonine protein kinase involved in
           regulation of exocytosis; localizes to the cytoplasmic
           face of the plasma membrane; closely related to Kin2p
          Length = 1062

 Score =  191 bits (484), Expect = 6e-49,   Method: Compositional matrix adjust.
 Identities = 98/291 (33%), Positives = 163/291 (56%), Gaps = 26/291 (8%)

Query: 17  TIGPWKLGETLGFGSTGKVQLAQHERTGHRTAVKVISKSIFNNNGNHSNDDSVLPYNIE- 75
           ++G W   ET+G GS GKV+LA+H  T    A+K+++++    +  H       P + + 
Sbjct: 75  SLGDWDFLETVGAGSMGKVKLARHRYTSEICAIKIVNRAA--KSFVHKQQQMTPPKSEQE 132

Query: 76  -------------------REIVIMKLLSHPNVLSLYDVWETNNNLYLILEYAEKGELFN 116
                              RE  + ++L HP++  L+++   +N+ Y++ EY   G+L +
Sbjct: 133 ALERKRKLEKEISRDKRTIREASLGQILYHPHICRLFEMCTMSNHFYMLFEYVSGGQLLD 192

Query: 117 LLVDHGPLPEREAINCFRQIIIGISYCHALGIVHRDLKPENLLLDSFYNIKIADFGMAAL 176
            ++ HG L ER A    R I   + Y H   IVHRDLK EN+++ +   IKI DFG++ +
Sbjct: 193 YIIQHGSLRERHARKFARGIASALQYLHMNNIVHRDLKIENIMISTSGEIKIIDFGLSNM 252

Query: 177 QTDADLLETSCGSPHYAAPEIVSGLPYEGFASDVWSCGVILFALLTGRLPFDEENGNVRD 236
                 L T CGS ++AAPE++   PY G   DVWS GV+L+ L+ G++PFD+EN +V  
Sbjct: 253 YDPKKQLHTFCGSLYFAAPELLKAHPYIGPEVDVWSFGVVLYVLVCGKVPFDDENASV-- 310

Query: 237 LLLKVQKGQFEMPNDTEISRDAQDLIGKILVVDPRQRIKIRDILSHPLLKK 287
           L  K+++G+ E P    +S +   L+ K+LVVDP +R  ++ ++SH  +++
Sbjct: 311 LHEKIKQGKVEYPQ--HLSIEVISLLSKMLVVDPSKRATLKQVVSHQWMQR 359

>Suva_16.169 Chr16 complement(292738..295314) [2577 bp, 858 aa] {ON}
           YPL141C (REAL)
          Length = 858

 Score =  189 bits (480), Expect = 9e-49,   Method: Compositional matrix adjust.
 Identities = 112/292 (38%), Positives = 161/292 (55%), Gaps = 26/292 (8%)

Query: 17  TIGPWKLGETLGFGSTGKVQLAQHERTGH----------RTAVKVISKSIFNNNGNHSND 66
           T GP+ LG TLG G  GKV+L   +   +          + AVK+I +   +N       
Sbjct: 37  TFGPYILGSTLGEGEFGKVKLGWPKNFPNSSTSAFDFPKQVAVKLIKRDTISN------- 89

Query: 67  DSVLPYNIEREIVIMKLLSHPNVLSLYDVWETNNNLYLILEYAEKGELFNLLVDHGPLPE 126
           D      I REI  +K LSHPN++ L +V + +  + ++LEYA  GE +  +     L E
Sbjct: 90  DYKKEVKIYREINALKHLSHPNIVKLEEVLQNSRYIGIVLEYACGGEFYKYIQKKRRLKE 149

Query: 127 REAINCFRQIIIGISYCHALGIVHRDLKPENLLLDSFYNIKIADFGMA-ALQTDADLLET 185
             A   F Q+I G+ Y H+ G+VHRDLK ENLLLD   N+ I DFG      +  +L++T
Sbjct: 150 TNACRLFSQLISGVHYIHSKGLVHRDLKLENLLLDKNENLVITDFGFVNEFCSRNELMKT 209

Query: 186 SCGSPHYAAPE-IVSGLPYEGFASDVWSCGVILFALLTGRLPFDE-----ENGNVRDLLL 239
           SCGSP YAAPE +VS  PYE   +D+WSCGVIL+A+L G LP+D+     E  ++  L  
Sbjct: 210 SCGSPCYAAPELVVSTKPYEARKADIWSCGVILYAMLAGYLPWDDDPNNPEGSDIGRLYN 269

Query: 240 KVQKGQFEMPNDTEISRDAQDLIGKILVVDPRQRIKIRDILSHPLLKKYQTI 291
            +     + P+   I    +DL+ +ILV DP++RI ++ I  H  LK + + 
Sbjct: 270 YICSTPLKFPD--YILPIPRDLLRRILVSDPKRRINLKQIEKHGWLKSHSSF 319

>YDR122W Chr4 (694700..697894) [3195 bp, 1064 aa] {ON}
           KIN1Serine/threonine protein kinase involved in
           regulation of exocytosis; localizes to the cytoplasmic
           face of the plasma membrane; closely related to Kin2p
          Length = 1064

 Score =  190 bits (482), Expect = 1e-48,   Method: Compositional matrix adjust.
 Identities = 100/284 (35%), Positives = 163/284 (57%), Gaps = 22/284 (7%)

Query: 17  TIGPWKLGETLGFGSTGKVQLAQHERTGHRTAVKVISKSI--FNNNGNH----SNDDSVL 70
           ++G W+  ET+G GS GKV+LA+H  T    AVK+++++   F +         N+  VL
Sbjct: 116 SLGDWEFVETVGAGSMGKVKLAKHRYTNEVCAVKIVNRATKAFLHKEQMLPPPKNEQDVL 175

Query: 71  PYNIE------------REIVIMKLLSHPNVLSLYDVWETNNNLYLILEYAEKGELFNLL 118
               +            RE  + ++L HP++  L+++   +N+ Y++ EY   G+L + +
Sbjct: 176 ERQKKLEKEISRDKRTIREASLGQILYHPHICRLFEMCTLSNHFYMLFEYVSGGQLLDYI 235

Query: 119 VDHGPLPEREAINCFRQIIIGISYCHALGIVHRDLKPENLLLDSFYNIKIADFGMAALQT 178
           + HG + E +A    R I   + Y HA  IVHRDLK EN+++     IKI DFG++ +  
Sbjct: 236 IQHGSIREHQARKFARGIASALIYLHANNIVHRDLKIENIMISDSSEIKIIDFGLSNIYD 295

Query: 179 DADLLETSCGSPHYAAPEIVSGLPYEGFASDVWSCGVILFALLTGRLPFDEENGNVRDLL 238
               L T CGS ++AAPE++   PY G   DVWS GV+LF L+ G++PFD+EN +V  L 
Sbjct: 296 SRKQLHTFCGSLYFAAPELLKANPYTGPEVDVWSFGVVLFVLVCGKVPFDDENSSV--LH 353

Query: 239 LKVQKGQFEMPNDTEISRDAQDLIGKILVVDPRQRIKIRDILSH 282
            K+++G+ E P    +S +   L+ K+LVVDP++R  ++ ++ H
Sbjct: 354 EKIKQGKVEYPQ--HLSIEVISLLSKMLVVDPKRRATLKQVVEH 395

>AGR058W Chr7 (823626..826841) [3216 bp, 1071 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YLR096W (KIN2) and
           YDR122W (KIN1)
          Length = 1071

 Score =  190 bits (482), Expect = 1e-48,   Method: Compositional matrix adjust.
 Identities = 104/311 (33%), Positives = 169/311 (54%), Gaps = 30/311 (9%)

Query: 1   MTVANTETHSAAKP--SSTIGPWKLGETLGFGSTGKVQLAQHERTGHRTAVKVISKSIFN 58
           M  A  E     KP    ++G W   ET+G GS GKV+LA+H  T    A+K+++++   
Sbjct: 32  MGKAGEEERRMPKPFHRKSLGDWDFLETVGAGSMGKVKLAKHRYTNELCAIKIVNRA--T 89

Query: 59  NNGNHSNDDSVLP------------YNIEREI----------VIMKLLSHPNVLSLYDVW 96
            +  H      LP              +E+E+           + ++L HP++  L+++ 
Sbjct: 90  KSFMHKQQLQGLPPPATEEELLERRKKLEKEVSRDKRTIREASLGQILYHPHICRLFEMC 149

Query: 97  ETNNNLYLILEYAEKGELFNLLVDHGPLPEREAINCFRQIIIGISYCHALGIVHRDLKPE 156
             +N+ Y++ EY   G+L + ++ HG L ER A    R I   + Y H   IVHRDLK E
Sbjct: 150 TMSNHFYMLFEYVSGGQLLDYIIQHGSLRERHARKFARGIASALQYLHLNNIVHRDLKIE 209

Query: 157 NLLLDSFYNIKIADFGMAALQTDADLLETSCGSPHYAAPEIVSGLPYEGFASDVWSCGVI 216
           N+++ S   I+I DFG++ +      L T CGS ++AAPE++   PY G   D+WS GV+
Sbjct: 210 NIMISSSGEIRIIDFGLSNMYDPKKQLHTFCGSLYFAAPELLKAHPYTGPEVDIWSFGVV 269

Query: 217 LFALLTGRLPFDEENGNVRDLLLKVQKGQFEMPNDTEISRDAQDLIGKILVVDPRQRIKI 276
           L+ L+ G++PFD+EN +V  L  K+++G+ E P    +S D   L+ K+LVVDP +R  +
Sbjct: 270 LYVLVCGKVPFDDENASV--LHEKIKQGKVEYPQ--HLSIDVISLLSKMLVVDPYKRATL 325

Query: 277 RDILSHPLLKK 287
           + ++ H  ++K
Sbjct: 326 KQVVHHQWMQK 336

>Suva_10.180 Chr10 (337364..340843) [3480 bp, 1159 aa] {ON} YLR096W
           (REAL)
          Length = 1159

 Score =  190 bits (483), Expect = 1e-48,   Method: Compositional matrix adjust.
 Identities = 113/374 (30%), Positives = 199/374 (53%), Gaps = 39/374 (10%)

Query: 17  TIGPWKLGETLGFGSTGKVQLAQHERTGHRTAVKVI---SKSIFNNNGNHS-----NDDS 68
           ++G W+  ET+G GS GKV+L +H +T     +K++   SK+  +    HS     N++ 
Sbjct: 103 SLGDWEFLETVGAGSMGKVKLVKHCQTKEVCVIKIVNRASKAFLHKQ--HSLPPPKNENE 160

Query: 69  VLPYN--IEREIV----------IMKLLSHPNVLSLYDVWETNNNLYLILEYAEKGELFN 116
           +L     +E+EI           + ++L HP++  L+++   +N+ Y++ EY   G+L +
Sbjct: 161 LLERQKRLEKEIARDKRTVREASLGQILYHPHICRLFEMCTMSNHFYMLFEYVSGGQLLD 220

Query: 117 LLVDHGPLPEREAINCFRQIIIGISYCHALGIVHRDLKPENLLLDSFYNIKIADFGMAAL 176
            ++ HG L E  A    R I   + Y HA  IVHRDLK EN+++ +   IKI DFG++ +
Sbjct: 221 YIIQHGSLKEHHARKFARGIASALQYLHANNIVHRDLKIENIMISNSGEIKIIDFGLSNI 280

Query: 177 QTDADLLETSCGSPHYAAPEIVSGLPYEGFASDVWSCGVILFALLTGRLPFDEENGNVRD 236
                 L T CGS ++AAPE++   PY G   D+WS G++L+ L+ G++PFD+EN ++  
Sbjct: 281 FDSKKKLHTFCGSLYFAAPELLKAQPYTGPEVDIWSFGIVLYVLVCGKVPFDDENSSI-- 338

Query: 237 LLLKVQKGQFEMPNDTEISRDAQDLIGKILVVDPRQRIKIRDILSHPLLKKYQTIKDSKS 296
           L  K++KG+ + P  + +S DA  L+ +++VVDP +R  ++++  HP + +    K    
Sbjct: 339 LHEKIKKGKVDYP--SHLSIDAVSLLTRMIVVDPLKRATLKNVTDHPWMNRGYDFKTPSY 396

Query: 297 IKDLPRENTYLYPLADSNNHTSASIDDSILQNLVVLWHGRHADDIVSKLKENGTNKEKIL 356
           + +         PL      T   ID  +L+ +  L      +D    L +  T +E + 
Sbjct: 397 VPN-------RVPL------TPEMIDSQVLKEMHRLEFIDDIEDTRRSLNQLVTEREYVQ 443

Query: 357 YALLYRFKLDSVRG 370
           ++  Y  +L + +G
Sbjct: 444 FSQEYWNRLSNSKG 457

>CAGL0M02519g Chr13 complement(290723..292993) [2271 bp, 756 aa]
           {ON} highly similar to uniprot|Q03002 Saccharomyces
           cerevisiae YPL141c or uniprot|Q01919 Saccharomyces
           cerevisiae YOR233w KIN4
          Length = 756

 Score =  187 bits (475), Expect = 1e-48,   Method: Compositional matrix adjust.
 Identities = 111/302 (36%), Positives = 159/302 (52%), Gaps = 36/302 (11%)

Query: 17  TIGPWKLGETLGFGSTGKVQLAQHE--------------------RTGHRTAVKVISKSI 56
           T GP+ +G TLG G  GKV+LA  +                    +   + A+K+I +  
Sbjct: 44  TFGPYVIGATLGEGEFGKVKLAWSKSAYQQCDNTEGNAGNKPMTFKVPKQVAIKLIKRDF 103

Query: 57  FNNNGNHSNDDSVLPYNIEREIVIMKLLSHPNVLSLYDVWETNNNLYLILEYAEKGELFN 116
                     D      I REI  +K LSHPN++ L +V + +  + ++LEYA  GE + 
Sbjct: 104 ITK-------DPSKETKIYREINALKHLSHPNIVKLEEVLQNSKYIGIVLEYAAGGEFYK 156

Query: 117 LLVDHGPLPEREAINCFRQIIIGISYCHALGIVHRDLKPENLLLDSFYNIKIADFGMA-A 175
            +     L E  A   F Q+I  + Y H+ G+VHRDLK ENLLLD+  N+ I DFG    
Sbjct: 157 FIQRKRRLKENHACRLFSQLISAVHYIHSKGLVHRDLKLENLLLDNEENLIITDFGFVNE 216

Query: 176 LQTDADLLETSCGSPHYAAPE-IVSGLPYEGFASDVWSCGVILFALLTGRLPFDEENGN- 233
                 +++TSCGSP YAAPE +VS  PY+   +D WSCG+ILFA+L G LP+D++  N 
Sbjct: 217 FLRQNGMMKTSCGSPCYAAPELVVSNRPYDARKADTWSCGIILFAMLAGYLPWDDDPKNP 276

Query: 234 ----VRDLLLKVQKGQFEMPNDTEISRDAQDLIGKILVVDPRQRIKIRDILSHPLLKKYQ 289
               +  L   +     + P    I+   +DL+ KILV+DP++RI IR I  HP L+ + 
Sbjct: 277 DGHDISRLYNYILNTPLKFPE--YINPVPRDLLRKILVIDPKKRINIRSIEKHPWLESHS 334

Query: 290 TI 291
           T 
Sbjct: 335 TF 336

>KAFR0B02800 Chr2 (571295..574582) [3288 bp, 1095 aa] {ON} Anc_8.279
           YLR096W
          Length = 1095

 Score =  189 bits (481), Expect = 2e-48,   Method: Compositional matrix adjust.
 Identities = 102/303 (33%), Positives = 167/303 (55%), Gaps = 34/303 (11%)

Query: 10  SAAKPS------STIGPWKLGETLGFGSTGKVQLAQHERTGHRTAVKVISKSIFNNNGNH 63
           SA+KP        ++G W   ET+G GS GKV+LA+H +T    A+K+++++        
Sbjct: 84  SASKPEIKQFHRKSLGDWDFLETVGAGSMGKVKLARHHQTNEICAIKIVNRA---TKAYL 140

Query: 64  SNDDSVLPYNIE---------------------REIVIMKLLSHPNVLSLYDVWETNNNL 102
             + S+ P   E                     RE  + ++L HP++  L+++   +N+ 
Sbjct: 141 HKEQSLAPPKNENEMLERQKKLEKEISRDKRTIREASLGQVLYHPHICRLFEMCTMSNHF 200

Query: 103 YLILEYAEKGELFNLLVDHGPLPEREAINCFRQIIIGISYCHALGIVHRDLKPENLLLDS 162
           Y++ EY   G+L + ++ HG L E  A    R +   + Y HA  IVHRDLK EN+++ +
Sbjct: 201 YMLFEYVSGGQLLDYIIQHGSLREHHARKFARGVASALQYLHANNIVHRDLKIENIMIST 260

Query: 163 FYNIKIADFGMAALQTDADLLETSCGSPHYAAPEIVSGLPYEGFASDVWSCGVILFALLT 222
              IKI DFG++ +      L T CGS ++AAPE++   PY G   D+WS GV+L+ L+ 
Sbjct: 261 SGEIKIIDFGLSNVFDTRKQLHTFCGSLYFAAPELLKANPYIGPEVDIWSFGVVLYVLVC 320

Query: 223 GRLPFDEENGNVRDLLLKVQKGQFEMPNDTEISRDAQDLIGKILVVDPRQRIKIRDILSH 282
           G++PFD+EN +V  L  K+++G+ E PN   +S +   L+ K+LVVDP +R  +  ++ H
Sbjct: 321 GKVPFDDENSSV--LHEKIKQGKVEYPN--HLSIEVISLLSKMLVVDPLKRANLTKVIEH 376

Query: 283 PLL 285
           P +
Sbjct: 377 PWM 379

>Smik_12.155 Chr12 (312480..315968) [3489 bp, 1162 aa] {ON} YLR096W
           (REAL)
          Length = 1162

 Score =  189 bits (481), Expect = 2e-48,   Method: Compositional matrix adjust.
 Identities = 118/374 (31%), Positives = 197/374 (52%), Gaps = 39/374 (10%)

Query: 17  TIGPWKLGETLGFGSTGKVQLAQHERTGHRTAVKVI---SKSIFNNNGNHS-----NDDS 68
           ++G W+  ET+G GS GKV+L +H +T     +K++   SK+  +    HS     N++ 
Sbjct: 103 SLGDWEFLETVGAGSMGKVKLVKHRQTKEVCVIKIVNRASKAYLHKQ--HSLPSPKNENE 160

Query: 69  VLPYN--IEREIV----------IMKLLSHPNVLSLYDVWETNNNLYLILEYAEKGELFN 116
           VL     +E+EI           + ++L HP++  L+++   +N+ Y++ EY   G+L +
Sbjct: 161 VLERQKRLEKEIARDKRTIREASLGQILYHPHICRLFEMCTMSNHFYMLFEYVSGGQLLD 220

Query: 117 LLVDHGPLPEREAINCFRQIIIGISYCHALGIVHRDLKPENLLLDSFYNIKIADFGMAAL 176
            ++ HG L E  A    R I   + Y H+  IVHRDLK EN+++ S   IKI DFG++ +
Sbjct: 221 YIIQHGSLKEHHARKFARGIASALQYLHSNNIVHRDLKIENIMISSSGEIKIIDFGLSNI 280

Query: 177 QTDADLLETSCGSPHYAAPEIVSGLPYEGFASDVWSCGVILFALLTGRLPFDEENGNVRD 236
                 L T CGS ++AAPE++   PY G   D+WS G++L+ L+ G++PFD+EN ++  
Sbjct: 281 FDYRKQLHTFCGSLYFAAPELLKAQPYTGPEVDIWSFGIVLYVLVCGKVPFDDENSSI-- 338

Query: 237 LLLKVQKGQFEMPNDTEISRDAQDLIGKILVVDPRQRIKIRDILSHPLLKKYQTIKDSKS 296
           L  K++KG+ + P  + +S +A  L+ K++VVDP +R  ++ ++ HP + +    K    
Sbjct: 339 LHEKIKKGKVDYP--SHLSIEAISLLTKMIVVDPLRRATLKTVVDHPWMNRGYDFKAPSY 396

Query: 297 IKDLPRENTYLYPLADSNNHTSASIDDSILQNLVVLWHGRHADDIVSKLKENGTNKEKIL 356
           I +         PL      T   ID  +L+ +  L      +D    L    T KE I 
Sbjct: 397 ILN-------RVPL------TPEMIDGQVLKEMYRLEFIDDIEDARRSLIRLVTEKEYIQ 443

Query: 357 YALLYRFKLDSVRG 370
            +  Y  KL + +G
Sbjct: 444 LSQEYWDKLSNAKG 457

>Skud_15.399 Chr15 (714789..717212) [2424 bp, 807 aa] {ON} YOR233W
           (REAL)
          Length = 807

 Score =  187 bits (475), Expect = 2e-48,   Method: Compositional matrix adjust.
 Identities = 113/315 (35%), Positives = 171/315 (54%), Gaps = 14/315 (4%)

Query: 16  STIGPWKLGETLGFGSTGKVQLAQHERTGHRTAVKVISKSIFNNNGNHSNDDSVLPYNIE 75
           +T GP+ +G TLG G  GKV+L   +        K ++  +   +    + D  +   I 
Sbjct: 41  ATFGPYIVGSTLGEGEFGKVKLGWTKAFSPNEVPKQVAIKLIRRDSIKKDADKEV--KIY 98

Query: 76  REIVIMKLLSHPNVLSLYDVWETNNNLYLILEYAEKGELFNLLVDHGPLPEREAINCFRQ 135
           REI  +K L+HPN++ L +V + +  + ++LE+   GE +  +     L E  A   F Q
Sbjct: 99  REINALKHLTHPNIIYLEEVLQNSKYIGIVLEFVSGGEFYKYIQRKRRLKESSACRLFAQ 158

Query: 136 IIIGISYCHALGIVHRDLKPENLLLDSFYNIKIADFGMA-ALQTDADLLETSCGSPHYAA 194
           +I G+ Y H+ G+VHRDLK ENLLLD   N+ I DFG       D +L+ TSCGSP YAA
Sbjct: 159 LISGVDYMHSKGLVHRDLKLENLLLDKHENLVITDFGFVNEFFEDNELMRTSCGSPCYAA 218

Query: 195 PE-IVSGLPYEGFASDVWSCGVILFALLTGRLPFDEENGN-----VRDLLLKVQKGQFEM 248
           PE +VS   YE   +DVWSCGVIL+A+L G LP+D+++ N     +  L   + +   + 
Sbjct: 219 PELVVSTKAYEARKADVWSCGVILYAMLAGYLPWDDDHENPTGDDIARLYQYITQTPLKF 278

Query: 249 PNDTEISRDAQDLIGKILVVDPRQRIKIRDILSHPLLKKYQ---TIKDSKSIKDLPRENT 305
           P    I+   +DL+ +ILV +PR+R+ +R I  H  LK +    +I+ +   + L +E  
Sbjct: 279 PE--YITPVPRDLLRRILVPNPRRRVSVRAIQRHEWLKPHHAFLSIQPNYWDEQLRKERP 336

Query: 306 YLYPLADSNNHTSAS 320
            L    D   HT+ S
Sbjct: 337 QLSTRGDVGRHTTYS 351

>YPL141C Chr16 complement(283464..286061) [2598 bp, 865 aa] {ON}
           FRK1Protein kinase of unknown cellular role; similar to
           Kin4p; green fluorescent protein (GFP)-fusion protein
           localizes to the cytoplasm; interacts with rRNA
           transcription and ribosome biogenesis factors and the
           long chain fatty acyl-CoA synthetase Faa3
          Length = 865

 Score =  187 bits (476), Expect = 3e-48,   Method: Compositional matrix adjust.
 Identities = 110/292 (37%), Positives = 161/292 (55%), Gaps = 26/292 (8%)

Query: 17  TIGPWKLGETLGFGSTGKVQLAQHERTGH----------RTAVKVISKSIFNNNGNHSND 66
           T GP+ LG TLG G  GKV+L   +   +          + A+K+I +   +N       
Sbjct: 37  TFGPYILGSTLGEGEFGKVKLGWPKNFSNSSNSTFDFPKQVAIKLIKRDSISN------- 89

Query: 67  DSVLPYNIEREIVIMKLLSHPNVLSLYDVWETNNNLYLILEYAEKGELFNLLVDHGPLPE 126
           D      I REI  +K LSHPN++ L +V + +  + ++LEYA  GE +  +     L E
Sbjct: 90  DYRKEVKIYREINALKHLSHPNIVKLEEVLQNSRYIGIVLEYACGGEFYKYIQKKRRLKE 149

Query: 127 REAINCFRQIIIGISYCHALGIVHRDLKPENLLLDSFYNIKIADFGMA-ALQTDADLLET 185
             A   F Q+I G+ Y H+ G+VHRDLK ENLLLD   N+ I DFG      +  +L++T
Sbjct: 150 MNACRLFSQLISGVHYIHSKGLVHRDLKLENLLLDKNENLVITDFGFVNEFCSRNELMKT 209

Query: 186 SCGSPHYAAPEIV-SGLPYEGFASDVWSCGVILFALLTGRLPFDE-----ENGNVRDLLL 239
           SCGSP YAAPE+V S  PYE   +D+WSCGVIL+A+L G LP+D+     E  ++  L  
Sbjct: 210 SCGSPCYAAPELVISAEPYEARKADIWSCGVILYAILAGYLPWDDDPNNPEGSDIGRLYN 269

Query: 240 KVQKGQFEMPNDTEISRDAQDLIGKILVVDPRQRIKIRDILSHPLLKKYQTI 291
            +     + P+   I    +DL+ ++LV DP++RI ++ I  H  LK + + 
Sbjct: 270 YINSTPLKFPD--YILPIPRDLLRRMLVSDPKKRINLKQIKKHEWLKPHSSF 319

>Skud_16.140 Chr16 complement(255090..257687) [2598 bp, 865 aa] {ON}
           YPL141C (REAL)
          Length = 865

 Score =  187 bits (476), Expect = 3e-48,   Method: Compositional matrix adjust.
 Identities = 109/289 (37%), Positives = 160/289 (55%), Gaps = 26/289 (8%)

Query: 17  TIGPWKLGETLGFGSTGKVQLAQHERTGH----------RTAVKVISKSIFNNNGNHSND 66
           T GP+ LG TLG G  GKV+L   +   +          + AVK+I +   +NN      
Sbjct: 37  TFGPYILGSTLGEGEFGKVKLGWPKNFSNSSATTFEFPKQVAVKLIKRDTISNNYKKE-- 94

Query: 67  DSVLPYNIEREIVIMKLLSHPNVLSLYDVWETNNNLYLILEYAEKGELFNLLVDHGPLPE 126
                  I REI  +K LSHPN++ L +V + +  + ++LEYA  GE +  +     L E
Sbjct: 95  -----VKIYREINALKHLSHPNIVKLEEVLQNSRYIGIVLEYACGGEFYKYIQKKRRLKE 149

Query: 127 REAINCFRQIIIGISYCHALGIVHRDLKPENLLLDSFYNIKIADFGMA-ALQTDADLLET 185
             A   F Q++ G+ Y H+ G+VHRDLK ENLLLD   N+ I DFG      +  +L++T
Sbjct: 150 TNACRLFSQLVSGVYYIHSKGLVHRDLKLENLLLDKNENLVITDFGFVNEFCSRNELMKT 209

Query: 186 SCGSPHYAAPEIV-SGLPYEGFASDVWSCGVILFALLTGRLPFDEENGN-----VRDLLL 239
           SCGSP YAAPE+V S  PYE   +D+WSCGVIL+A+L G LP+D+++ N     +  L  
Sbjct: 210 SCGSPCYAAPELVISAEPYEARKADIWSCGVILYAMLAGYLPWDDDSNNPEGSDIGRLYN 269

Query: 240 KVQKGQFEMPNDTEISRDAQDLIGKILVVDPRQRIKIRDILSHPLLKKY 288
            +     + P+   I    +DL+ +ILV DP++R+ ++ I  H  L  +
Sbjct: 270 YINSTPLKFPD--YILPIPRDLLRRILVPDPKKRMNLKQIKKHEWLNSH 316

>KLLA0F19536g Chr6 (1808263..1811577) [3315 bp, 1104 aa] {ON}
           similar to uniprot|P13186 Saccharomyces cerevisiae
           YLR096W KIN2 Serine/threonine protein kinase involved in
           regulation of exocytosis localizes to the cytoplasmic
           face of the plasma membrane closely related to Kin1p and
           to YDR122W uniprot|P13185 Saccharomyces cerevisiae
           YDR122W KIN1 Serine/threonine protein kinase involved in
           regulation of exocytosis; localizes to the cytoplasmic
           face of the plasma membrane; closely related to Kin2p
          Length = 1104

 Score =  189 bits (479), Expect = 3e-48,   Method: Compositional matrix adjust.
 Identities = 98/291 (33%), Positives = 163/291 (56%), Gaps = 26/291 (8%)

Query: 17  TIGPWKLGETLGFGSTGKVQLAQHERTGHRTAVKVISKSIFNNNGNHSNDDSVLPYNIE- 75
           ++G W   ET+G GS GKV+LA+H  T    A+K+++++    +  H  +    P   E 
Sbjct: 94  SLGDWDFLETVGAGSMGKVKLAKHRLTNEVCAIKIVNRAA--KSYMHKQNQLPPPKTEEE 151

Query: 76  -------------------REIVIMKLLSHPNVLSLYDVWETNNNLYLILEYAEKGELFN 116
                              RE  + ++L HP++  L+++   +N+ Y++ EY   G+L +
Sbjct: 152 LMERKKKLEKELSRDRRTIREASLGQILYHPHICRLFEMCTMSNHFYMLFEYVSGGQLLD 211

Query: 117 LLVDHGPLPEREAINCFRQIIIGISYCHALGIVHRDLKPENLLLDSFYNIKIADFGMAAL 176
            ++ HG L ER A    R I   + Y H   IVHRDLK EN+++ +   IKI DFG++ L
Sbjct: 212 YIIQHGSLRERHARKFVRGIASALQYLHLNNIVHRDLKIENIMISTSGEIKIIDFGLSNL 271

Query: 177 QTDADLLETSCGSPHYAAPEIVSGLPYEGFASDVWSCGVILFALLTGRLPFDEENGNVRD 236
             +   L T CGS ++AAPE++   PY G   D+WS GV+++ L+ G++PFD+EN +V  
Sbjct: 272 YDNKKQLHTFCGSLYFAAPELLKANPYIGPEVDIWSFGVVIYVLVCGKVPFDDENASV-- 329

Query: 237 LLLKVQKGQFEMPNDTEISRDAQDLIGKILVVDPRQRIKIRDILSHPLLKK 287
           L  K++KG+ E P    +S +   L+ K+LVVDP +R  ++ + +H  +++
Sbjct: 330 LHEKIKKGKVEYPQ--HLSIECISLLSKMLVVDPLKRASLKQVCNHQWMQR 378

>Skud_12.164 Chr12 (315700..319182) [3483 bp, 1160 aa] {ON} YLR096W
           (REAL)
          Length = 1160

 Score =  189 bits (479), Expect = 3e-48,   Method: Compositional matrix adjust.
 Identities = 95/289 (32%), Positives = 170/289 (58%), Gaps = 22/289 (7%)

Query: 17  TIGPWKLGETLGFGSTGKVQLAQHERTGHRTAVKVI---SKSIFNNNG---NHSNDDSVL 70
           ++G W+  ET+G GS GKV+L +H +T     +K++   SK+  +      +  N++ +L
Sbjct: 102 SLGDWEFLETVGAGSMGKVKLVKHRQTKEVCVIKIVNRASKAYLHKQHTLPSPKNENEIL 161

Query: 71  PYN--IEREIV----------IMKLLSHPNVLSLYDVWETNNNLYLILEYAEKGELFNLL 118
                +E+EI           + ++L HP++  L+++   +N+ Y++ EY   G+L + +
Sbjct: 162 ERQKRLEKEIARDKRTVREASLGQILYHPHICRLFEMCTMSNHFYMLFEYVSGGQLLDYI 221

Query: 119 VDHGPLPEREAINCFRQIIIGISYCHALGIVHRDLKPENLLLDSFYNIKIADFGMAALQT 178
           + HG L E  A    R I   + Y HA  IVHRDLK EN+++ S   IKI DFG++ +  
Sbjct: 222 IQHGSLKEHHARKFARGIASALQYLHANNIVHRDLKIENIMISSSGEIKIIDFGLSNIFD 281

Query: 179 DADLLETSCGSPHYAAPEIVSGLPYEGFASDVWSCGVILFALLTGRLPFDEENGNVRDLL 238
               L T CGS ++AAPE++   PY G   D+WS G++L+ L+ G++PFD+EN ++  L 
Sbjct: 282 YRKQLHTFCGSLYFAAPELLKAQPYTGPEVDIWSFGIVLYVLVCGKVPFDDENSSI--LH 339

Query: 239 LKVQKGQFEMPNDTEISRDAQDLIGKILVVDPRQRIKIRDILSHPLLKK 287
            K++KG+ + P  + +S +A  L+ +++V+DP +R  +++++ HP + +
Sbjct: 340 EKIKKGKVDYP--SHLSIEAISLLTRMIVIDPLKRATLKNVVDHPWMNR 386

>KNAG0G02110 Chr7 (477260..480838) [3579 bp, 1192 aa] {ON} Anc_8.279
           YLR096W
          Length = 1192

 Score =  189 bits (479), Expect = 3e-48,   Method: Compositional matrix adjust.
 Identities = 105/303 (34%), Positives = 170/303 (56%), Gaps = 23/303 (7%)

Query: 18  IGPWKLGETLGFGSTGKVQLAQHERTGHRTAVKVI---SKSIFNNNGN---HSNDDSVLP 71
           +G W   ET+G GS GKV+LA+H  T    A+K++   +K+  +   N     ++  +L 
Sbjct: 106 LGDWDFLETVGAGSMGKVKLAKHHHTNEICAIKIVNRATKAFLHKEQNLPPPKSEQEILQ 165

Query: 72  YN--IEREIV----------IMKLLSHPNVLSLYDVWETNNNLYLILEYAEKGELFNLLV 119
               +E+EI           + ++L HP++  L+++   +N+ Y++ EY   G+L + ++
Sbjct: 166 RQKRLEKEISRDKRTIREASLGQILYHPHICRLFEMCTMSNHFYMLFEYVSGGQLLDYII 225

Query: 120 DHGPLPEREAINCFRQIIIGISYCHALGIVHRDLKPENLLLDSFYNIKIADFGMAALQTD 179
            HG L E  A    R I   + Y HA  IVHRDLK EN+++ +   IKI DFG++ +   
Sbjct: 226 QHGSLREHHARKFARGIGSALQYLHANNIVHRDLKIENIMISTSGEIKIIDFGLSNVYDP 285

Query: 180 ADLLETSCGSPHYAAPEIVSGLPYEGFASDVWSCGVILFALLTGRLPFDEENGNVRDLLL 239
              L T CGS ++AAPE++   PY G   DVWS GV+L+ L+ G++PFD+E  +V  L  
Sbjct: 286 RKQLHTFCGSLYFAAPELLKARPYLGPEVDVWSFGVVLYVLVCGKVPFDDEVSSV--LHE 343

Query: 240 KVQKGQFEMPNDTEISRDAQDLIGKILVVDPRQRIKIRDILSHPLLKK-YQTIKDSKSIK 298
           K+++G  E PN   +S +   L+ K+LVVDP +R  ++ ++ HP + + Y  I  S   K
Sbjct: 344 KIKQGNVEYPN--HLSIEVLSLLSKMLVVDPERRASLKQVIEHPWMNRGYDYITPSYLPK 401

Query: 299 DLP 301
            +P
Sbjct: 402 RIP 404

>KLTH0D10714g Chr4 (880389..883007) [2619 bp, 872 aa] {ON} similar
           to uniprot|Q03002 Saccharomyces cerevisiae YPL141C
           Hypothetical ORF
          Length = 872

 Score =  187 bits (474), Expect = 4e-48,   Method: Compositional matrix adjust.
 Identities = 105/285 (36%), Positives = 158/285 (55%), Gaps = 22/285 (7%)

Query: 17  TIGPWKLGETLGFGSTGKVQLAQHERTG------HRTAVKVISKSIFNNNGNHSNDDSVL 70
           T GP+ +G TLG G  GKV++   + +        + A+K+I +     N          
Sbjct: 36  TFGPYIVGSTLGEGEFGKVKMGWSKTSSSSMDVPKQVAIKLIRRDTIPKNSEKE------ 89

Query: 71  PYNIEREIVIMKLLSHPNVLSLYDVWETNNNLYLILEYAEKGELFNLLVDHGPLPEREAI 130
              I REI  +K L+HPN++ L +V + +  + ++LEYA  GE +  +     L E  A 
Sbjct: 90  -VKIYREINALKHLNHPNIVRLEEVLQNSKYIGIVLEYASGGEFYKYIQKKRRLKESAAC 148

Query: 131 NCFRQIIIGISYCHALGIVHRDLKPENLLLDSFYNIKIADFGMA-ALQTDADLLETSCGS 189
             F Q+I G+ Y H+ G+VHRDLK ENLLLD   N+ I DFG       + +L++TSCGS
Sbjct: 149 RLFAQLISGVYYMHSKGLVHRDLKLENLLLDKNENLLITDFGFVNEFLPENELMKTSCGS 208

Query: 190 PHYAAPE-IVSGLPYEGFASDVWSCGVILFALLTGRLPFDEENGN-----VRDLLLKVQK 243
           P YAAPE +V+  PYE   +D+WSCGVI++A+L G LP+D++  N     +  L   + +
Sbjct: 209 PCYAAPELVVTARPYEARKADIWSCGVIMYAMLAGYLPWDDDPENPDGDDIGKLYRYITR 268

Query: 244 GQFEMPNDTEISRDAQDLIGKILVVDPRQRIKIRDILSHPLLKKY 288
              + P+   I+   +DL+  ILV DP++RI I   L H  L+ +
Sbjct: 269 TPLKFPD--YIAPVPRDLLRAILVADPKKRITIAQTLHHQWLQPH 311

>Kwal_26.8709 s26 (907885..910374) [2490 bp, 829 aa] {ON} YPL141C -
           Hypothetical ORF [contig 67] FULL
          Length = 829

 Score =  186 bits (473), Expect = 5e-48,   Method: Compositional matrix adjust.
 Identities = 107/285 (37%), Positives = 159/285 (55%), Gaps = 22/285 (7%)

Query: 17  TIGPWKLGETLGFGSTGKVQLAQHERTG------HRTAVKVISKSIFNNNGNHSNDDSVL 70
           T GP+ +G TLG G  GKV+L   + +        + A+K+I +     N          
Sbjct: 36  TFGPYIVGSTLGEGEFGKVKLGWSKTSNSSMDVPKQVAIKLIRRDTIPKNSEKE------ 89

Query: 71  PYNIEREIVIMKLLSHPNVLSLYDVWETNNNLYLILEYAEKGELFNLLVDHGPLPEREAI 130
              I REI  +K L+HPN++ L +V + +  + ++LEYA  GE +  +     L E  A 
Sbjct: 90  -IKIYREINALKHLNHPNIVRLEEVLQNSKYIGIVLEYASGGEFYKYIQKKRRLKEGPAC 148

Query: 131 NCFRQIIIGISYCHALGIVHRDLKPENLLLDSFYNIKIADFGMA-ALQTDADLLETSCGS 189
             F Q+I G+ Y H+ G+VHRDLK ENLLLD   N+ I DFG       + +L++TSCGS
Sbjct: 149 RLFAQLISGVYYMHSKGLVHRDLKLENLLLDKNENLLITDFGFVNEFLPENELMKTSCGS 208

Query: 190 PHYAAPE-IVSGLPYEGFASDVWSCGVILFALLTGRLPFDEENGN-----VRDLLLKVQK 243
           P YAAPE +V+  PYE   +DVWSCGVIL+A+L G LP+D++  N     +  L   + +
Sbjct: 209 PCYAAPELVVTARPYEARKADVWSCGVILYAMLAGYLPWDDDPENPDGDDIGKLYRYITR 268

Query: 244 GQFEMPNDTEISRDAQDLIGKILVVDPRQRIKIRDILSHPLLKKY 288
              + P+   I+   +DL+ +IL+ DP++RI I   L H  L+ +
Sbjct: 269 TPLKFPD--YIAPVPRDLLREILIPDPKRRITISKTLKHQWLQPH 311

>CAGL0J03872g Chr10 (368472..370457) [1986 bp, 661 aa] {ON} similar
           to uniprot|Q01919 Saccharomyces cerevisiae YOR233w KIN4
           ser/thr protein kinase or and similar to uniprot|Q03002
           Saccharomyces cerevisiae YPL141c
          Length = 661

 Score =  184 bits (467), Expect = 5e-48,   Method: Compositional matrix adjust.
 Identities = 111/297 (37%), Positives = 160/297 (53%), Gaps = 26/297 (8%)

Query: 10  SAAKPSSTIGPWKLGETLGFGSTGKVQLA----------QHERTGHRTAVKVISKSIFNN 59
           S  K   T GP+ +G TLG G  GKV+L           Q      + A+K+I +     
Sbjct: 33  SRGKKHVTFGPYIVGSTLGEGEFGKVKLGWTRTPSTGPEQRPAVSKQVAIKLIRRDTIVK 92

Query: 60  NGNHSNDDSVLPYNIEREIVIMKLLSHPNVLSLYDVWETNNNLYLILEYAEKGELFNLLV 119
           N       S     I REI  +K L+HPNV+ L +V + +  + ++LEYA  GE +  + 
Sbjct: 93  N-------SEKEIKIYREINALKHLTHPNVVRLEEVLQNSKYIGIVLEYASGGEFYKYIQ 145

Query: 120 DHGPLPEREAINCFRQIIIGISYCHALGIVHRDLKPENLLLDSFYNIKIADFGMA-ALQT 178
               L E  A   F Q+I G++Y H+  +VHRDLK ENLLLD   N+ I DFG       
Sbjct: 146 RKRRLKESTACRLFAQLISGVTYMHSKNLVHRDLKLENLLLDKNENLVITDFGFVNEFLP 205

Query: 179 DADLLETSCGSPHYAAPEIV-SGLPYEGFASDVWSCGVILFALLTGRLPFDEENGN---- 233
           D + ++TSCGSP YAAPE+V S  PY    +DVWSCG+IL+A+L G LP+D+++ N    
Sbjct: 206 DNEYMKTSCGSPCYAAPELVISTRPYVARKADVWSCGIILYAMLAGYLPWDDDSTNPEGD 265

Query: 234 -VRDLLLKVQKGQFEMPNDTEISRDAQDLIGKILVVDPRQRIKIRDILSHPLLKKYQ 289
            +  L   + +   + P    I+   +DL+ KILV DP +R+ ++ I  H  LK ++
Sbjct: 266 DIGKLYQYITRTPLKFPE--YITPIPRDLLRKILVPDPNKRVNMQYIHRHEWLKPHR 320

>Smik_6.339 Chr6 (538177..540774) [2598 bp, 865 aa] {ON} YPL141C
           (REAL)
          Length = 865

 Score =  186 bits (473), Expect = 6e-48,   Method: Compositional matrix adjust.
 Identities = 112/289 (38%), Positives = 159/289 (55%), Gaps = 26/289 (8%)

Query: 17  TIGPWKLGETLGFGSTGKVQLAQHE----------RTGHRTAVKVISKSIFNNNGNHSND 66
           T GP+ LG TLG G  GKV+L   +              + AVK+I +   +N       
Sbjct: 37  TFGPYILGSTLGEGEFGKVKLGWPKSFPSSSNATLEFPKQVAVKLIKRDTISN------- 89

Query: 67  DSVLPYNIEREIVIMKLLSHPNVLSLYDVWETNNNLYLILEYAEKGELFNLLVDHGPLPE 126
           D      I REI  +K LSHPN++ L +V + +  + ++LEYA  GE +  +     L E
Sbjct: 90  DYKKEVKIYREINALKHLSHPNIVKLEEVLQNSRYIGIVLEYACGGEFYRYIQKRRRLKE 149

Query: 127 REAINCFRQIIIGISYCHALGIVHRDLKPENLLLDSFYNIKIADFGMA-ALQTDADLLET 185
             A   F Q+I G+ Y H+ G+VHRDLK ENLLLD   N+ I DFG      +  +L++T
Sbjct: 150 INACRLFSQLISGVHYIHSKGLVHRDLKLENLLLDKNENLVITDFGFVNEFCSRNELMKT 209

Query: 186 SCGSPHYAAPEIV-SGLPYEGFASDVWSCGVILFALLTGRLPFDE-----ENGNVRDLLL 239
           SCGSP YAAPE+V S  PYE   +D+WSCGVIL+A+L G LP+D+     E  ++  L  
Sbjct: 210 SCGSPCYAAPELVISAEPYEARKADIWSCGVILYAMLAGYLPWDDDPNNPEGSDIGRLYN 269

Query: 240 KVQKGQFEMPNDTEISRDAQDLIGKILVVDPRQRIKIRDILSHPLLKKY 288
            +     + P+   I    +DL+ +ILV DP++RI ++ I  H  LK +
Sbjct: 270 YISLTPLKFPD--YILPIPRDLLRRILVSDPKRRINLKQIKKHEWLKPH 316

>YOR233W Chr15 (775846..778248) [2403 bp, 800 aa] {ON}
           KIN4Serine/threonine protein kinase that inhibits the
           mitotic exit network (MEN) when the spindle position
           checkpoint is activated; localized asymmetrically to
           mother cell cortex, spindle pole body and bud neck
          Length = 800

 Score =  186 bits (472), Expect = 6e-48,   Method: Compositional matrix adjust.
 Identities = 106/290 (36%), Positives = 162/290 (55%), Gaps = 11/290 (3%)

Query: 9   HSAAKPSSTIGPWKLGETLGFGSTGKVQLAQHERTGHRTAVKVISKSIFNNNGNHSNDDS 68
           H   +  +T GP+ +G TLG G  GKV+L   + +      K ++  +   +    + D 
Sbjct: 34  HKNQRKHATFGPYIIGSTLGEGEFGKVKLGWTKASSSNEVPKQVAIKLIRRDTIKKDADK 93

Query: 69  VLPYNIEREIVIMKLLSHPNVLSLYDVWETNNNLYLILEYAEKGELFNLLVDHGPLPERE 128
            +   I REI  +K L+HPN++ L +V + +  + ++LE+   GE +  +     L E  
Sbjct: 94  EI--KIYREINALKHLTHPNIIYLEEVLQNSKYIGIVLEFVSGGEFYKYIQRKRRLKESS 151

Query: 129 AINCFRQIIIGISYCHALGIVHRDLKPENLLLDSFYNIKIADFGMA-ALQTDADLLETSC 187
           A   F Q+I G++Y H  G+VHRDLK ENLLLD   N+ I DFG       D +L++TSC
Sbjct: 152 ACRLFAQLISGVNYMHYKGLVHRDLKLENLLLDKHENLVITDFGFVNEFFEDNELMKTSC 211

Query: 188 GSPHYAAPE-IVSGLPYEGFASDVWSCGVILFALLTGRLPFDEENGN-----VRDLLLKV 241
           GSP YAAPE +VS   YE   +DVWSCGVIL+A+L G LP+D+++ N     +  L   +
Sbjct: 212 GSPCYAAPELVVSTKAYEARKADVWSCGVILYAMLAGYLPWDDDHENPTGDDIARLYKYI 271

Query: 242 QKGQFEMPNDTEISRDAQDLIGKILVVDPRQRIKIRDILSHPLLKKYQTI 291
            +   + P    I+   +DL+ +ILV +PR+RI ++ I  H  LK ++  
Sbjct: 272 TQTPLKFPE--YITPIPRDLLRRILVPNPRRRINLQTIKRHVWLKPHEAF 319

>YLR096W Chr12 (332590..336033) [3444 bp, 1147 aa] {ON}
           KIN2Serine/threonine protein kinase involved in
           regulation of exocytosis; localizes to the cytoplasmic
           face of the plasma membrane; closely related to Kin1p
          Length = 1147

 Score =  188 bits (477), Expect = 7e-48,   Method: Compositional matrix adjust.
 Identities = 115/374 (30%), Positives = 196/374 (52%), Gaps = 39/374 (10%)

Query: 17  TIGPWKLGETLGFGSTGKVQLAQHERTGHRTAVKVI---SKSIFNNNGNHS-----NDDS 68
           ++G W+  ET+G GS GKV+L +H +T     +K++   SK+  +    HS     N+  
Sbjct: 95  SLGDWEFLETVGAGSMGKVKLVKHRQTKEICVIKIVNRASKAYLHKQ--HSLPSPKNESE 152

Query: 69  VLPYN--IEREIV----------IMKLLSHPNVLSLYDVWETNNNLYLILEYAEKGELFN 116
           +L     +E+EI           + ++L HP++  L+++   +N+ Y++ EY   G+L +
Sbjct: 153 ILERQKRLEKEIARDKRTVREASLGQILYHPHICRLFEMCTMSNHFYMLFEYVSGGQLLD 212

Query: 117 LLVDHGPLPEREAINCFRQIIIGISYCHALGIVHRDLKPENLLLDSFYNIKIADFGMAAL 176
            ++ HG L E  A    R I   + Y HA  IVHRDLK EN+++ S   IKI DFG++ +
Sbjct: 213 YIIQHGSLKEHHARKFARGIASALQYLHANNIVHRDLKIENIMISSSGEIKIIDFGLSNI 272

Query: 177 QTDADLLETSCGSPHYAAPEIVSGLPYEGFASDVWSCGVILFALLTGRLPFDEENGNVRD 236
                 L T CGS ++AAPE++   PY G   D+WS G++L+ L+ G++PFD+EN ++  
Sbjct: 273 FDYRKQLHTFCGSLYFAAPELLKAQPYTGPEVDIWSFGIVLYVLVCGKVPFDDENSSI-- 330

Query: 237 LLLKVQKGQFEMPNDTEISRDAQDLIGKILVVDPRQRIKIRDILSHPLLKKYQTIKDSKS 296
           L  K++KG+ + P  + +S +   L+ +++VVDP +R  +++++ HP + +    K    
Sbjct: 331 LHEKIKKGKVDYP--SHLSIEVISLLTRMIVVDPLRRATLKNVVEHPWMNRGYDFKAPSY 388

Query: 297 IKDLPRENTYLYPLADSNNHTSASIDDSILQNLVVLWHGRHADDIVSKLKENGTNKEKIL 356
           + +         PL      T   ID  +L+ +  L      +D    L    T KE I 
Sbjct: 389 VPN-------RVPL------TPEMIDSQVLKEMYRLEFIDDIEDTRRSLIRLVTEKEYIQ 435

Query: 357 YALLYRFKLDSVRG 370
            +  Y  KL + +G
Sbjct: 436 LSQEYWDKLSNAKG 449

>KAFR0H02540 Chr8 complement(483399..485852) [2454 bp, 817 aa] {ON}
           Anc_8.654 YPL141C
          Length = 817

 Score =  186 bits (472), Expect = 7e-48,   Method: Compositional matrix adjust.
 Identities = 113/335 (33%), Positives = 171/335 (51%), Gaps = 52/335 (15%)

Query: 17  TIGPWKLGETLGFGSTGKVQLAQHERTGHR-------------------------TAVKV 51
           T GP+ +G T+G G  GKV+L   +   ++                          A+K+
Sbjct: 57  TFGPYIIGSTIGQGEFGKVKLGWSKSISNKQSHSPSANGLGLYATPALPIEVPKQVAIKL 116

Query: 52  ISKSIFNNNGNHSNDDSVLPYNIEREIVIMKLLSHPNVLSLYDVWETNNNLYLILEYAEK 111
           I +   +        D      I REI  +K L+HPN++ L +V + +  + ++LEYA  
Sbjct: 117 IRRDTISK-------DPRREIKIYREINALKQLTHPNIVKLDEVLQNSKYIGIVLEYASG 169

Query: 112 GELFNLLVDHGPLPEREAINCFRQIIIGISYCHALGIVHRDLKPENLLLDSFYNIKIADF 171
           GE +  +     L E  A   F Q+I G++Y H+ G++HRDLK EN+LLD   N+ I DF
Sbjct: 170 GEFYKYIQRKKRLKETIACKLFAQLISGVNYIHSKGLIHRDLKLENILLDKNENLIITDF 229

Query: 172 GMA-ALQTDADLLETSCGSPHYAAPEIV-SGLPYEGFASDVWSCGVILFALLTGRLPFDE 229
           G      T  +L++TSCGSP YAAPE+V S  PYE    D+WSCG+ILFA+L G LP+D+
Sbjct: 230 GFVNEFVTSNELMKTSCGSPCYAAPELVISSQPYEARKVDIWSCGIILFAMLAGYLPWDD 289

Query: 230 E-----NGNVRDLLLKVQKGQFEMPNDTEISRDAQDLIGKILVVDPRQRIKIRDILSHPL 284
           +       N+  L   +     + P    I+   +DL+ +IL+ DP++R+ +R IL H  
Sbjct: 290 DPENPSGENIAKLYFYITTTPLKFPE--YITAIPRDLLRRILIADPKKRVDLRYILKHQW 347

Query: 285 LK-----------KYQTIKDSKSIKDLPRENTYLY 308
           LK           ++  I  S+SI  LP+ +   Y
Sbjct: 348 LKPHTPFLSISPEEWDNISRSQSILRLPKHSKKQY 382

>NDAI0E01290 Chr5 complement(255593..257782) [2190 bp, 729 aa] {ON}
           Anc_8.654
          Length = 729

 Score =  184 bits (466), Expect = 2e-47,   Method: Compositional matrix adjust.
 Identities = 114/308 (37%), Positives = 163/308 (52%), Gaps = 31/308 (10%)

Query: 6   TETHSAAKPSST-------IGPWKLGETLGFGSTGKVQL--------AQHERTGHRTAVK 50
           TE  S+++P S         G + LG TLG G  GKV+L        A  +    + A+K
Sbjct: 24  TEKRSSSRPLSRGKKEKLRFGNYILGATLGEGEFGKVKLGWSTASPTASLDSNSKQIAIK 83

Query: 51  VISKSIFNNNGNHSNDDSVLPYNIEREIVIMKLLSHPNVLSLYDVWETNNNLYLILEYAE 110
           +I +       +           I REI  +KLL+HPN++ L +V + +  + ++LE+A 
Sbjct: 84  LIRRDYVKKGSDKE-------IKIYREINALKLLTHPNIVRLEEVLQNSKYIGIVLEFAS 136

Query: 111 KGELFNLLVDHGPLPEREAINCFRQIIIGISYCHALGIVHRDLKPENLLLDSFYNIKIAD 170
            GE +  L     L E  A   F Q+I G++Y H+ G+VHRDLK ENLLLD   N+ I D
Sbjct: 137 GGEFYKYLQRKRRLKEPHACQLFAQLISGVTYMHSKGLVHRDLKLENLLLDKNENLIITD 196

Query: 171 FGMA-ALQTDADLLETSCGSPHYAAPEIV-SGLPYEGFASDVWSCGVILFALLTGRLPFD 228
           FG         +L++ SCGSP YAAPE+V S  PY     D+WSCG+IL+A+L G LP+D
Sbjct: 197 FGFVNEFFGSNELMKRSCGSPCYAAPELVLSTEPYRARKVDIWSCGIILYAMLAGYLPWD 256

Query: 229 EENGN-----VRDLLLKVQKGQFEMPNDTEISRDAQDLIGKILVVDPRQRIKIRDILSHP 283
           +++ N     +  L   + K   + P    IS  A+DLI KIL  +P +RI I  I  H 
Sbjct: 257 DDSQNPNGDDIGKLYQYITKTALKFP--AYISPLARDLIRKILTANPSRRISISYICKHD 314

Query: 284 LLKKYQTI 291
            LK + + 
Sbjct: 315 WLKPHASF 322

>KLTH0G13288g Chr7 complement(1139058..1142486) [3429 bp, 1142 aa]
           {ON} similar to uniprot|P13186 Saccharomyces cerevisiae
           YLR096W KIN2 Serine/threonine protein kinase involved in
           regulation of exocytosis localizes to the cytoplasmic
           face of the plasma membrane closely related to Kin1p and
           to YDR122W uniprot|P13185 Saccharomyces cerevisiae
           YDR122W KIN1 Serine/threonine protein kinase involved in
           regulation of exocytosis; localizes to the cytoplasmic
           face of the plasma membrane; closely related to Kin2p
          Length = 1142

 Score =  186 bits (473), Expect = 2e-47,   Method: Compositional matrix adjust.
 Identities = 99/289 (34%), Positives = 166/289 (57%), Gaps = 22/289 (7%)

Query: 17  TIGPWKLGETLGFGSTGKVQLAQHERTGHRTAVKVI---SKSIFNNNGNHS---NDDSVL 70
           ++G W   ET+G GS GKV+LA+H  T    A+K++   +K++ +           + VL
Sbjct: 180 SLGDWDFLETVGAGSMGKVKLAKHRLTHEVCAIKIVNRATKALIHKESQQPPPRTQEEVL 239

Query: 71  PY--NIEREIV----------IMKLLSHPNVLSLYDVWETNNNLYLILEYAEKGELFNLL 118
                +E+EI           + ++L HP++  L+++   +N+ Y++ EY   G+L + +
Sbjct: 240 ERERKLEKEISRDKRTIRESSLGQILYHPHICRLFEMCTMSNHFYMLFEYVSGGQLLDYI 299

Query: 119 VDHGPLPEREAINCFRQIIIGISYCHALGIVHRDLKPENLLLDSFYNIKIADFGMAALQT 178
           + HG L ER A    R I   + Y H   IVHRDLK EN+++ +   IKI DFG++ +  
Sbjct: 300 IQHGSLRERSARKFARGIASALQYLHLNNIVHRDLKIENIMISTSGEIKIIDFGLSNMFN 359

Query: 179 DADLLETSCGSPHYAAPEIVSGLPYEGFASDVWSCGVILFALLTGRLPFDEENGNVRDLL 238
               L T CGS ++AAPE++   PY G   DVWS GV+L+ L+ G++PFD+EN +V  L 
Sbjct: 360 PKKQLHTFCGSLYFAAPELLKACPYTGPEVDVWSFGVVLYVLVCGKVPFDDENSSV--LH 417

Query: 239 LKVQKGQFEMPNDTEISRDAQDLIGKILVVDPRQRIKIRDILSHPLLKK 287
            K+++G+ E P    +S +   L+ K+LVVDP +R  ++ +++H  +++
Sbjct: 418 EKIKQGKVEYPQ--HLSIEVISLLSKMLVVDPSKRATLKQVVNHQWMQR 464

>Ecym_8339 Chr8 (684113..686875) [2763 bp, 920 aa] {ON} similar to
           Ashbya gossypii ACR119W
          Length = 920

 Score =  185 bits (469), Expect = 3e-47,   Method: Compositional matrix adjust.
 Identities = 106/282 (37%), Positives = 156/282 (55%), Gaps = 19/282 (6%)

Query: 17  TIGPWKLGETLGFGSTGKVQL----AQHERTGHRTAVKVISKSIFNNNGNHSNDDSVLPY 72
           T GP+ +G TLG G  GKV+L    ++ E      A+K++ +        HS  +     
Sbjct: 61  TFGPYIVGPTLGEGEFGKVKLGWSNSKPEEGSKNVAIKLVRRDTI---PKHSEKE----V 113

Query: 73  NIEREIVIMKLLSHPNVLSLYDVWETNNNLYLILEYAEKGELFNLLVDHGPLPEREAINC 132
            I REI  +K L+HPN++ L +V + +  + ++L+YA  GE +  +     L E  A   
Sbjct: 114 KIYREINALKHLNHPNIVRLEEVLQNSKYIGIVLQYASGGEFYKYIQKKRRLKEPPACRL 173

Query: 133 FRQIIIGISYCHALGIVHRDLKPENLLLDSFYNIKIADFGMAALQTDADLLETSCGSPHY 192
           F Q+I G+ Y H  G+ HRDLK ENLLLD   N+ I DFG        DL++TSCGSP Y
Sbjct: 174 FAQLISGVYYMHHKGLAHRDLKLENLLLDEHENLMITDFGFVNEFHKNDLMKTSCGSPCY 233

Query: 193 AAPE-IVSGLPYEGFASDVWSCGVILFALLTGRLPFDE-----ENGNVRDLLLKVQKGQF 246
           AAPE +V+  PYE   +DVWSCGVIL+A+L G LP+D+     E  ++  L   + K   
Sbjct: 234 AAPELVVTARPYEARKADVWSCGVILYAMLAGYLPWDDDPENPEGDDIAKLYHYITKSAL 293

Query: 247 EMPNDTEISRDAQDLIGKILVVDPRQRIKIRDILSHPLLKKY 288
           + P    I    +DL+ +ILV +P  R+ + +I +H  L+ +
Sbjct: 294 KFPE--YIKPLPRDLLRRILVSNPDTRLSVMEIKNHEWLRPH 333

>ZYRO0D06776g Chr4 complement(583027..586641) [3615 bp, 1204 aa]
           {ON} similar to uniprot|P13186 Saccharomyces cerevisiae
           YLR096W KIN2 Serine/threonine protein kinase involved in
           regulation of exocytosis localizes to the cytoplasmic
           face of the plasma membrane closely related to Kin1p and
           to YDR122W uniprot|P13185 Saccharomyces cerevisiae
           YDR122W KIN1 Serine/threonine protein kinase involved in
           regulation of exocytosis; localizes to the cytoplasmic
           face of the plasma membrane; closely related to Kin2p
          Length = 1204

 Score =  185 bits (470), Expect = 5e-47,   Method: Compositional matrix adjust.
 Identities = 98/286 (34%), Positives = 157/286 (54%), Gaps = 26/286 (9%)

Query: 17  TIGPWKLGETLGFGSTGKVQLAQHERTGHRTAVKVISKSIFNNNGNHSNDDSVLPYNIE- 75
            +G W   ET+G GS GKV++A+H  T    A+K+I+++       H       P N + 
Sbjct: 136 ALGDWDFLETVGAGSMGKVKIAKHHYTNEICAIKIINRA--TKAFLHKEQQLPPPQNEQE 193

Query: 76  -------------------REIVIMKLLSHPNVLSLYDVWETNNNLYLILEYAEKGELFN 116
                              RE  + + L HP++  L+++   +N+ Y++ EY   G+L +
Sbjct: 194 ALERQKKLEKEISRDKRTIREASLGQALYHPHICRLFEMCTMSNHFYMLFEYVSGGQLLD 253

Query: 117 LLVDHGPLPEREAINCFRQIIIGISYCHALGIVHRDLKPENLLLDSFYNIKIADFGMAAL 176
            ++ HG L E  A    R I   + Y HA  IVHRDLK EN+++ +   IKI DFG++ +
Sbjct: 254 YIIQHGSLREHHARKFARGIASALQYLHANNIVHRDLKIENIMISTSGEIKIIDFGLSNM 313

Query: 177 QTDADLLETSCGSPHYAAPEIVSGLPYEGFASDVWSCGVILFALLTGRLPFDEENGNVRD 236
                 L T CGS ++AAPE++   PY G   DVWS GV+L+ L+ G++PFD+EN +V  
Sbjct: 314 FDPRTQLHTFCGSLYFAAPELLKASPYVGPEVDVWSFGVVLYVLVCGKVPFDDENSSV-- 371

Query: 237 LLLKVQKGQFEMPNDTEISRDAQDLIGKILVVDPRQRIKIRDILSH 282
           L  K+++G+ + P    +S +   L+ K+LVVDPR+R  ++ ++ H
Sbjct: 372 LHEKIKQGKVDYPQ--HLSIEVISLLSKMLVVDPRKRASLKQVVEH 415

>TBLA0B03970 Chr2 complement(904167..907793) [3627 bp, 1208 aa] {ON}
           Anc_8.654 YPL141C
          Length = 1208

 Score =  185 bits (469), Expect = 6e-47,   Method: Compositional matrix adjust.
 Identities = 109/287 (37%), Positives = 162/287 (56%), Gaps = 32/287 (11%)

Query: 17  TIGPWKLGETLGFGSTGKVQLAQHERTGHRT------AVKVISKSIFNNNGNHSNDDSVL 70
           T GP+ +G TLG G  GKV+L   + + + T      A+K+I +            D+++
Sbjct: 68  TFGPYIVGSTLGEGEFGKVKLGWVKASPNDTQVPKQVAIKLIRR------------DAIV 115

Query: 71  P-----YNIEREIVIMKLLSHPNVLSLYDVWETNNNLYLILEYAEKGELFNLLVDHGPLP 125
                   I REI  +K L+HPN++ L +V + +  + ++LEYA  GE +  +     L 
Sbjct: 116 KGSEKEIKIYREINALKHLTHPNIVRLEEVLQNSKYIGIVLEYASGGEFYKYIQKKRRLK 175

Query: 126 EREAINCFRQIIIGISYCHALGIVHRDLKPENLLLDSFYNIKIADFGMA-ALQTDADLLE 184
           E  A N F Q++ G+ Y H  G+VHRDLK ENLLLD + N+ I DFG        ++L++
Sbjct: 176 ESVASNLFSQLVSGVYYMHCKGLVHRDLKLENLLLDKYGNLIITDFGFVNEFSKFSELMK 235

Query: 185 TSCGSPHYAAPEIV-SGLPYEGFASDVWSCGVILFALLTGRLPFDEE----NGN-VRDLL 238
           TSCGSP YAAPE+V S  PYE   +D+WSCG+ILFA+L G LP+D++    +GN +  L 
Sbjct: 236 TSCGSPCYAAPELVISTRPYEARKADIWSCGIILFAMLAGYLPWDDDPKNPDGNDIAKLY 295

Query: 239 LKVQKGQFEMPNDTEISRDAQDLIGKILVVDPRQRIKIRDILSHPLL 285
             +     + P    IS  A+DL+  IL+  P++R  ++ IL H  L
Sbjct: 296 KYITTTPLKFPE--YISPMARDLLRNILIPYPQKRATLKQILKHQWL 340

>ACR119W Chr3 (560761..563556) [2796 bp, 931 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YPL141C and YOR233W
           (KIN4)
          Length = 931

 Score =  183 bits (464), Expect = 1e-46,   Method: Compositional matrix adjust.
 Identities = 110/299 (36%), Positives = 158/299 (52%), Gaps = 22/299 (7%)

Query: 3   VANTETHSAA---KPSSTIGPWKLGETLGFGSTGKVQL----AQHERTGHRTAVKVISKS 55
           ++ +  H+A    K   T GP+ +G TLG G  GKV+L    A+ +      A+K+I + 
Sbjct: 24  LSGSRGHAAGRSKKKQVTFGPYIIGPTLGEGEFGKVKLGWSKARLDGDSRNVAIKLIRRD 83

Query: 56  IFNNNGNHSNDDSVLPYNIEREIVIMKLLSHPNVLSLYDVWETNNNLYLILEYAEKGELF 115
               N             I RE+  +KLLSHPN++ L +V + +  + ++L+YA  GE +
Sbjct: 84  TVPKNSEKE-------IKIYRELNALKLLSHPNIVRLEEVLQNSKYIGIVLQYASGGEFY 136

Query: 116 NLLVDHGPLPEREAINCFRQIIIGISYCHALGIVHRDLKPENLLLDSFYNIKIADFGMAA 175
             +     L E  A   F Q+I G+ Y H  G+ HRDLK ENLLLD   N+ I DFG   
Sbjct: 137 KYIQKKRRLKEPPACRLFAQLISGVHYIHYKGLAHRDLKLENLLLDEHENLIITDFGFVN 196

Query: 176 LQTDADLLETSCGSPHYAAPE-IVSGLPYEGFASDVWSCGVILFALLTGRLPFDE----- 229
                DL+ TSCGSP YAAPE +VS  PY    +DVWSCGVIL+A+L G LP+D+     
Sbjct: 197 EFHKNDLMRTSCGSPCYAAPELVVSSKPYSAQKADVWSCGVILYAMLAGYLPWDDDPENP 256

Query: 230 ENGNVRDLLLKVQKGQFEMPNDTEISRDAQDLIGKILVVDPRQRIKIRDILSHPLLKKY 288
           E  ++  L   +     + P    I    +DL+ +ILV +P  R+ + DI  H  L+ +
Sbjct: 257 EGEDIAKLYQYITHTSLKFPE--YIKPIPRDLLKRILVSNPEVRLTVADIEQHAWLQPH 313

>CAGL0B01925g Chr2 (176316..179150) [2835 bp, 944 aa] {ON} similar
           to uniprot|P13185 Saccharomyces cerevisiae YDR122w KIN1
           or uniprot|P13186 Saccharomyces cerevisiae YLR096w KIN2
          Length = 944

 Score =  182 bits (461), Expect = 3e-46,   Method: Compositional matrix adjust.
 Identities = 99/291 (34%), Positives = 158/291 (54%), Gaps = 23/291 (7%)

Query: 17  TIGPWKLGETLGFGSTGKVQLAQHERTGHRTAVKVISKSI------------------FN 58
           ++  W   ET+G GS GKV+LA+++ +    A+K++ ++                     
Sbjct: 63  SLSGWDFMETVGAGSMGKVKLAKNKNSNEVCAIKIVHRATKAYMHKAQQLPPPADENEAK 122

Query: 59  NNGNHSNDDSVLPYNIEREIVIMKLLSHPNVLSLYDVWETNNNLYLILEYAEKGELFNLL 118
                 N +        RE  + ++L HPNV  LY++   +N+ Y+  E+   G+L + +
Sbjct: 123 ERQKRLNKEISRDKRTVREASLGQILFHPNVCKLYEMQTLSNHYYMFFEFISGGQLLDYI 182

Query: 119 VDHGPLPEREAINCFRQIIIGISYCHALGIVHRDLKPENLLLDSFYNIKIADFGMAALQT 178
           + HG L E  A    R I+  + Y HA  IVHRDLK EN++L     IK+ DFG++ +  
Sbjct: 183 IQHGSLKENHARKVSRGILSALQYLHANNIVHRDLKIENIMLSKTGEIKLIDFGLSNMYD 242

Query: 179 DADLLETSCGSPHYAAPEIVSGLPYEGFASDVWSCGVILFALLTGRLPFDEENGNVRDLL 238
               L+T CGS ++AAPE++   PY G   DVWS GV+L+ L+ G++PFD+EN +   L 
Sbjct: 243 PRKSLQTFCGSLYFAAPELLKAHPYLGPEVDVWSFGVVLYVLVCGKVPFDDENSSA--LH 300

Query: 239 LKVQKGQFEMPNDTEISRDAQDLIGKILVVDPRQRIKIRDILSHP-LLKKY 288
            K++KG+   P    I  D   L+ KILVVDP++R  ++ +++H  +LK Y
Sbjct: 301 EKIKKGKVTYPQFLSI--DVISLLSKILVVDPQKRATLQQVVNHQWMLKGY 349

>KNAG0A03040 Chr1 complement(372150..374084) [1935 bp, 644 aa] {ON}
           Anc_8.654 YPL141C
          Length = 644

 Score =  178 bits (452), Expect = 3e-46,   Method: Compositional matrix adjust.
 Identities = 107/302 (35%), Positives = 162/302 (53%), Gaps = 27/302 (8%)

Query: 2   TVANTETHSAAKPSSTIGPWKLGETLGFGSTGKVQLAQ-----------HERTGHRTAVK 50
           T +N+    + K + T GP+ +G TLG G  GKV++              +RT  + A+K
Sbjct: 31  TSSNSIGTRSRKRNVTFGPYIVGSTLGEGEFGKVKMGWTRPVTDGNVGPSQRTPRQVAIK 90

Query: 51  VISKSIFNNNGNHSNDDSVLPYNIEREIVIMKLLSHPNVLSLYDVWETNNNLYLILEYAE 110
           +I +     N +           I REI  +K L+HPN++ L ++ + +  + ++LEYA 
Sbjct: 91  LIRRDTIVRNSDKET-------KIYREINALKHLTHPNIIVLEEILQNSKYIGIVLEYAS 143

Query: 111 KGELFNLLVDHGPLPEREAINCFRQIIIGISYCHALGIVHRDLKPENLLLDSFYNIKIAD 170
            GE +  +     L E  A   F Q++ G+ Y H+ G+VHRDLK ENLLLD   N+ I D
Sbjct: 144 GGEFYKYIQRKRRLKEVNASRLFSQLVSGVHYMHSKGLVHRDLKLENLLLDKNENLMITD 203

Query: 171 FGMA-ALQTDADLLETSCGSPHYAAPE-IVSGLPYEGFASDVWSCGVILFALLTGRLPFD 228
           FG       +  L++TSCGSP YAAPE +VS   Y G   D+WSCGVIL+A+L G LP+D
Sbjct: 204 FGFVNEFSNENVLMKTSCGSPCYAAPELVVSREAYVGVKVDIWSCGVILYAMLAGYLPWD 263

Query: 229 EENGN-----VRDLLLKVQKGQFEMPNDTEISRDAQDLIGKILVVDPRQRIKIRDILSHP 283
           ++  N     +  L   +     + P+   ++   +DL+ +ILV DPR+R  +  I +H 
Sbjct: 264 DDPSNPNGDDISKLYSYITATPLKFPD--YVNPLPRDLLRRILVADPRRRYTLGHIENHE 321

Query: 284 LL 285
            L
Sbjct: 322 WL 323

>TPHA0D01140 Chr4 (238656..240524) [1869 bp, 622 aa] {ON} Anc_8.654
           YPL141C
          Length = 622

 Score =  178 bits (451), Expect = 3e-46,   Method: Compositional matrix adjust.
 Identities = 105/307 (34%), Positives = 163/307 (53%), Gaps = 34/307 (11%)

Query: 10  SAAKPSSTIGPWKLGETLGFGSTGKVQLA------------------QHERTGHRTAVKV 51
           S  K     G + LG+TLG G  GKV+L                    +     + A+K+
Sbjct: 48  SRKKKQPRFGLYTLGQTLGEGEFGKVKLGYINNDNIDTLNSSGSKLGNYSHMPKQVAIKL 107

Query: 52  ISKSIFNNNGNHSNDDSVLPYNIEREIVIMKLLSHPNVLSLYDVWETNNNLYLILEYAEK 111
           I +   +     S +  +  Y   REI  +K+L+HPN++ L +V + +  + ++LEYA  
Sbjct: 108 IRRDTLSA----SKESEIKLY---REINALKMLTHPNIVKLEEVLQNSKYIGIVLEYASG 160

Query: 112 GELFNLLVDHGPLPEREAINCFRQIIIGISYCHALGIVHRDLKPENLLLDSFYNIKIADF 171
           GE +  +     L E +A   F Q+I G+SY H+ G+VHRDLK ENLLLD   N+ I DF
Sbjct: 161 GEFYKYIKFKKRLKESKACTIFAQLISGVSYIHSKGLVHRDLKLENLLLDKAGNLLITDF 220

Query: 172 GMAALQTDAD-LLETSCGSPHYAAPEIVSGL-PYEGFASDVWSCGVILFALLTGRLPFDE 229
           G     T  + L+ T CGSP YAAPE+V+ + PY    +D+WSCGVIL+A+L G LP+D+
Sbjct: 221 GFVNEVTKTNKLMHTPCGSPCYAAPELVTSVEPYNARKADIWSCGVILYAMLAGYLPWDD 280

Query: 230 ENGNVR-----DLLLKVQKGQFEMPNDTEISRDAQDLIGKILVVDPRQRIKIRDILSHPL 284
           +  N+       L   ++    + P    I+   +DL+ ++L +DP +R+ ++ IL H  
Sbjct: 281 DPKNINGTDIVKLYKYIENQPLKFPE--YINMVPRDLLRRMLEIDPAKRMSMKHILQHAW 338

Query: 285 LKKYQTI 291
           +  +Q  
Sbjct: 339 ITPHQVF 345

>TBLA0C01750 Chr3 (412762..415707) [2946 bp, 981 aa] {ON} Anc_8.654
           YPL141C
          Length = 981

 Score =  181 bits (460), Expect = 5e-46,   Method: Compositional matrix adjust.
 Identities = 117/315 (37%), Positives = 171/315 (54%), Gaps = 40/315 (12%)

Query: 2   TVANTETHSAAKPSST----IGPWKLGETLGFGSTGKVQLAQHERTGH-------RTAVK 50
           TV++  T ++ KP        GP+ L  TLG G  GKV+L   + +         + A+K
Sbjct: 61  TVSSNSTINSQKPKKKKYVPFGPYILSSTLGEGEFGKVKLGWSKASTQASNEIPKQVAIK 120

Query: 51  VISKSIFNNNGNHSNDDSVLP------YNIEREIVIMKLLSHPNVLSLYDVWETNNNLYL 104
           +I +S            S+LP        + REI  +K L HPN++ L DV + +  + +
Sbjct: 121 LIKRS------------SILPKGSNKEIKVYREINALKQLCHPNIVKLDDVLQNSKYIGI 168

Query: 105 ILEYAEKGELFNLLVDHGPLPEREAINCFRQIIIGISYCHALGIVHRDLKPENLLLDSFY 164
           +LEYA  GE +  +     L E  A   F Q+I G+ Y H+ G+VHRDLK ENLLLD   
Sbjct: 169 VLEYASGGEFYKYIQRKKRLKEINASKLFSQLISGVHYMHSKGLVHRDLKLENLLLDKHE 228

Query: 165 NIKIADFGMAA--LQTDADLLETSCGSPHYAAPEIV-SGLPYEGFASDVWSCGVILFALL 221
           N+ I DFG      QT+ +L+ T CGSP YAAPE+V S  PYE   +D+WSCG+IL+A+L
Sbjct: 229 NLIITDFGFVNEFFQTN-ELMLTPCGSPCYAAPELVISKHPYEARKADLWSCGIILYAML 287

Query: 222 TGRLPFDEE----NGN-VRDLLLKVQKGQFEMPNDTEISRDAQDLIGKILVVDPRQRIKI 276
            G LP+D++    +GN +  L   +     + P    I    +DL+ KILV + ++RI +
Sbjct: 288 AGYLPWDDDIKNPDGNDIARLYYYITTTPLKFPE--YIQPLPRDLLRKILVPNYKKRINM 345

Query: 277 RDILSHPLLKKYQTI 291
           R I++H  LK + T 
Sbjct: 346 RRIINHEWLKPHFTF 360

>CAGL0M02299g Chr13 (273725..276406) [2682 bp, 893 aa] {ON} similar
           to uniprot|Q12152 Saccharomyces cerevisiae YPL150w
          Length = 893

 Score =  181 bits (458), Expect = 5e-46,   Method: Compositional matrix adjust.
 Identities = 104/280 (37%), Positives = 145/280 (51%), Gaps = 30/280 (10%)

Query: 18  IGPWKLGETLGFGSTGKVQLAQHERTGHRTAVKVISKSIFNNNGNHSNDDSVLPYNIERE 77
           +G +K+ + +G GS GKV LA H  T  +  +K   KS                 N+ RE
Sbjct: 39  VGNYKIQKQIGEGSFGKVYLATHRPTKQKVVLKTGDKS---------------DPNVVRE 83

Query: 78  IVIMKLLSHPNVLSLYDVWETNNNLYLILEYAEKGELFNLLVDHGPLPEREAINCFRQII 137
           +   +   +P +  LY+V  T   +++ LEY    EL++ L+    LP  E    F QI 
Sbjct: 84  VFYHRQFDYPYITKLYEVIVTETKVWMALEYCPGKELYDHLLSKSRLPTLECAELFAQIT 143

Query: 138 IGISYCHALGIVHRDLKPENLLLDSFYNIKIADFGMAALQTDADLLETSCGSPHYAAPEI 197
             + Y H L  VHRDLK EN+LLD   N K+ DFG         +LET CG+  Y APE+
Sbjct: 144 GAVHYAHTLNCVHRDLKLENVLLDKNGNAKLTDFGFTRESMTKAVLETVCGTTVYMAPEM 203

Query: 198 VSGLPYEGFASDVWSCGVILFALLTGRLPFDEENGNVRDLLLKVQKGQFEMPNDTEISR- 256
           +   PY+GF  D+WS GVIL+ LL G LPFDE++    DLL K +     + NDT +   
Sbjct: 204 IQHKPYDGFKVDIWSLGVILYTLLCGCLPFDEDD----DLLTKQK-----IINDTPVIDE 254

Query: 257 -----DAQDLIGKILVVDPRQRIKIRDILSHPLLKKYQTI 291
                +AQ+LI ++L  DP +R     IL HP L+ Y T+
Sbjct: 255 RITIPEAQNLIEQLLSKDPTERPNTSAILLHPFLQPYGTL 294

>KNAG0H03140 Chr8 complement(589553..592363) [2811 bp, 936 aa] {ON}
           Anc_8.279 YLR096W
          Length = 936

 Score =  181 bits (459), Expect = 5e-46,   Method: Compositional matrix adjust.
 Identities = 98/284 (34%), Positives = 160/284 (56%), Gaps = 22/284 (7%)

Query: 17  TIGPWKLGETLGFGSTGKVQLAQHERTGHRTAVKVISKSIF------------NNNGNHS 64
           ++G W    T+G GS GKV+LA+H       AVK+++++               +  +  
Sbjct: 114 SLGDWDFQTTVGAGSMGKVKLARHRYDDTVCAVKIVNRATKTFLYRQQSAPAPQSKADIK 173

Query: 65  NDDSVLPYNIE------REIVIMKLLSHPNVLSLYDVWETNNNLYLILEYAEKGELFNLL 118
             + +L   I       RE  + ++LSH N+  LY +   +N+ Y++ EY   G+L + +
Sbjct: 174 ERERLLAKEIARDTRTVREASLGQVLSHQNICQLYQMCTMSNHFYMMFEYVSGGQLLDYI 233

Query: 119 VDHGPLPEREAINCFRQIIIGISYCHALGIVHRDLKPENLLLDSFYNIKIADFGMAALQT 178
           + HG L E  A +  R I  G++Y HA  +VHRDLK EN++L +   IKI DFG++ L  
Sbjct: 234 IQHGSLREPLARSFARAIASGLAYLHANNVVHRDLKIENIMLTAAGEIKIIDFGLSNLFD 293

Query: 179 DADLLETSCGSPHYAAPEIVSGLPYEGFASDVWSCGVILFALLTGRLPFDEENGNVRDLL 238
               L T CGS ++AAPE++   PY G   D+WS GVIL+ L+ G++PFD+EN N   L 
Sbjct: 294 PRAKLTTYCGSLYFAAPELLRAKPYIGPEIDIWSFGVILYVLVVGKVPFDDENSNA--LH 351

Query: 239 LKVQKGQFEMPNDTEISRDAQDLIGKILVVDPRQRIKIRDILSH 282
            K+++G+   P    +S +   L+ K+L V+P++R  +++I++H
Sbjct: 352 EKIKRGKVSYP--ATLSIECISLLTKMLTVNPKRRATLKEIVTH 393

>KNAG0D01090 Chr4 complement(183319..184437) [1119 bp, 372 aa] {ON} 
          Length = 372

 Score =  170 bits (430), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 93/273 (34%), Positives = 150/273 (54%), Gaps = 23/273 (8%)

Query: 23  LGETLGFGSTGKVQLAQHERTGHRTAVKVISKSIFNNNGNHSNDDSVLPYNIEREIV--- 79
           +G  LG G  GKV   +H+ +G   A+KV+ K+             +L Y +ER+ +   
Sbjct: 115 IGLKLGKGKFGKVFCVRHKESGFICALKVMQKT------------DILQYKLERQFIREV 162

Query: 80  -IMKLLSHPNVLSLYDVWETNNNLYLILEYAEKGELFNLLVDHGPLPEREAINCFRQIII 138
            I   L+HPN+  LY  +     +YLI+EY   GEL+  L  HGP     A N   QI  
Sbjct: 163 EIQSSLNHPNIAKLYGYFHDEKRVYLIMEYMLYGELYKTLEIHGPFENAVATNYVYQIAS 222

Query: 139 GISYCHALGIVHRDLKPENLLLDSFYNIKIADFGMAALQTDADLLETSCGSPHYAAPEIV 198
            I Y H   I+HRD+KPEN+L+     +K+ DFG + +        T CG+  Y +PEIV
Sbjct: 223 AILYLHQRHIIHRDIKPENILIGPHNQLKLTDFGWSIINPKGLRRRTFCGTIDYLSPEIV 282

Query: 199 SGLPYEGFASDVWSCGVILFALLTGRLPFDEENGNVRDLLL-KVQKGQFEMPNDTEISRD 257
               Y+    D+W+ G++ + LL G  PF+E   N +DL   ++++G    P   +++ +
Sbjct: 283 DYKEYD-HNVDIWALGIVAYELLVGSPPFEE---NTKDLTYERIRRGDIVFPK--QVTPE 336

Query: 258 AQDLIGKILVVDPRQRIKIRDILSHPLLKKYQT 290
           A+D I +ILV++P++R+ +++I+SHP + KY++
Sbjct: 337 ARDFIERILVLEPKKRMTLKEIMSHPWILKYKS 369

>SAKL0H06754g Chr8 (594995..597649) [2655 bp, 884 aa] {ON} similar
           to uniprot|Q12152 Saccharomyces cerevisiae YPL150W
           Hypothetical ORF
          Length = 884

 Score =  179 bits (454), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 97/271 (35%), Positives = 148/271 (54%), Gaps = 18/271 (6%)

Query: 18  IGPWKLGETLGFGSTGKVQLAQHERTGHRTAVKVISKSIFNNNGNHSNDDSVLPYNIERE 77
           IG +K+ + +G GS GKV LA H  T  +  +K  +K          ND +V+     RE
Sbjct: 34  IGNYKIVKLIGEGSFGKVYLANHRLTHQKVVLKTGNK----------NDPNVV-----RE 78

Query: 78  IVIMKLLSHPNVLSLYDVWETNNNLYLILEYAEKGELFNLLVDHGPLPEREAINCFRQII 137
           +   +    P++  LY+V  T + +++ LEY    EL+  L+    +   E+   F QI+
Sbjct: 79  VFYHRQFDFPHITKLYEVIVTESKVWMALEYCPGKELYEYLLMQHRISLEESGKLFAQIV 138

Query: 138 IGISYCHALGIVHRDLKPENLLLDSFYNIKIADFGMAALQTDADLLETSCGSPHYAAPEI 197
             + Y H+L  VHRDLK EN+LLD     KI DFG         +LET CG+  Y APE+
Sbjct: 139 SAVYYAHSLQCVHRDLKLENILLDKKGRAKITDFGFTRECATKTMLETVCGTTVYMAPEL 198

Query: 198 VSGLPYEGFASDVWSCGVILFALLTGRLPFDEENGNVRDLLLKVQKGQFEMPNDTEISRD 257
           +    Y+GF  D+WS GVIL+ ++ G +PFDEE+       +  ++  +   ND  +S+D
Sbjct: 199 IERKSYDGFKIDIWSLGVILYTMIHGTMPFDEEDETKTKWKIINEEPFY---NDDVVSKD 255

Query: 258 AQDLIGKILVVDPRQRIKIRDILSHPLLKKY 288
           A+DLI ++L  DP QR ++  +L+HP L+ Y
Sbjct: 256 AKDLISQLLCKDPSQRPQLSQVLAHPFLQPY 286

>NDAI0E02390 Chr5 complement(496256..498907) [2652 bp, 883 aa] {ON}
           Anc_8.668
          Length = 883

 Score =  179 bits (454), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 99/276 (35%), Positives = 149/276 (53%), Gaps = 22/276 (7%)

Query: 18  IGPWKLGETLGFGSTGKVQLAQHERTGHRTAVKVISKSIFNNNGNHSNDDSVLPYNIERE 77
           +G +K+ + +G GS GKV LA H  T  +  +K  +KS                 NI RE
Sbjct: 35  VGNYKILDQIGEGSFGKVYLASHRLTHCKVVLKTSNKS---------------DPNIVRE 79

Query: 78  IVIMKLLSHPNVLSLYDVWETNNNLYLILEYAEKGELFNLLVDHGPLPEREAINCFRQII 137
           +   +   +P +  LY+V  T + +++  EY    +L++ ++    +P    I  F QI+
Sbjct: 80  VFYHRQFDYPYITQLYEVIVTESKVWMAQEYCPGKDLYDHVLSLQRVPSSACIELFTQIV 139

Query: 138 IGISYCHALGIVHRDLKPENLLLDSFYNIKIADFGMAALQTDADLLETSCGSPHYAAPEI 197
             + Y H+L  VHRDLK EN+LLD   N K+ DFG          LET CG+  Y APE+
Sbjct: 140 GAVYYAHSLNCVHRDLKLENILLDKNGNAKLTDFGFTRECMTKTSLETICGTTVYMAPEL 199

Query: 198 VSGLPYEGFASDVWSCGVILFALLTGRLPFDEENGNVRDLLLKVQKGQFEMP--NDTEIS 255
           +    Y+GF  D+WS GVIL+ +L G +PFDE++    +      K   EMP  NDT +S
Sbjct: 200 IKRESYDGFKIDIWSLGVILYTMLNGSMPFDEDDETKTEW-----KIMNEMPVFNDTILS 254

Query: 256 RDAQDLIGKILVVDPRQRIKIRDILSHPLLKKYQTI 291
            DA+DL+ K+L  DP +R  +++IL HP L+ Y ++
Sbjct: 255 EDAKDLLIKLLSKDPNERPSMQEILHHPFLQPYGSL 290

>NCAS0B01470 Chr2 (241003..243186) [2184 bp, 727 aa] {ON} Anc_8.654
          Length = 727

 Score =  176 bits (447), Expect = 4e-45,   Method: Compositional matrix adjust.
 Identities = 104/284 (36%), Positives = 152/284 (53%), Gaps = 25/284 (8%)

Query: 18  IGPWKLGETLGFGSTGKVQLAQHERT---------GHRTAVKVISKSIFNNNGNHSNDDS 68
            GP+ +G TLG G  GKV++     +           + A+K+I +             S
Sbjct: 35  FGPYIVGATLGEGEFGKVKMGWSTTSSSSGKITEDSKQVAIKLIRRDFIKKG-------S 87

Query: 69  VLPYNIEREIVIMKLLSHPNVLSLYDVWETNNNLYLILEYAEKGELFNLLVDHGPLPERE 128
                I REI  +K L+HPN++ L +V + +  + ++LEYA  GE +  +     L E  
Sbjct: 88  EKEMKIFREINSLKHLTHPNIVRLEEVLQNSKYIGIVLEYASGGEFYKYVQRKRRLKEAT 147

Query: 129 AINCFRQIIIGISYCHALGIVHRDLKPENLLLDSFYNIKIADFGMA-ALQTDADLLETSC 187
           A   F Q+I G+SY H+ GIVHRDLK ENLLLD   N+ I DFG       D +L++TSC
Sbjct: 148 ACRLFAQLISGVSYMHSKGIVHRDLKLENLLLDKHENLIITDFGFVNEFYADNELMKTSC 207

Query: 188 GSPHYAAPEIV-SGLPYEGFASDVWSCGVILFALLTGRLPFDEENGN-----VRDLLLKV 241
           GSP YAAPE+V +  PY+   +D+WSCG+IL+ +L G LP+D++  N     +  L   +
Sbjct: 208 GSPCYAAPELVITTEPYKARKADIWSCGIILYGMLAGYLPWDDDKQNPNGEDIVRLYHYI 267

Query: 242 QKGQFEMPNDTEISRDAQDLIGKILVVDPRQRIKIRDILSHPLL 285
            K   + P    I+   +DL+  ILV +P +R+  R I  H  L
Sbjct: 268 TKTPLKFPE--YITPLPRDLLRHILVSNPVRRMSSRHIKKHEWL 309

>NCAS0C01670 Chr3 complement(306682..309372) [2691 bp, 896 aa] {ON}
           Anc_8.668
          Length = 896

 Score =  178 bits (451), Expect = 4e-45,   Method: Compositional matrix adjust.
 Identities = 96/271 (35%), Positives = 146/271 (53%), Gaps = 18/271 (6%)

Query: 18  IGPWKLGETLGFGSTGKVQLAQHERTGHRTAVKVISKSIFNNNGNHSNDDSVLPYNIERE 77
           +G +K+ + +G GS GKV LAQH      T  KV+ KS   N+ N           I RE
Sbjct: 35  VGNYKILDQIGEGSFGKVYLAQH----RPTHTKVVLKSSDKNDPN-----------IVRE 79

Query: 78  IVIMKLLSHPNVLSLYDVWETNNNLYLILEYAEKGELFNLLVDHGPLPEREAINCFRQII 137
           +   +   +P +  LY+V  T   +++ LEY    EL++ ++    +P  E +  F QI+
Sbjct: 80  VFYHRQFDYPYITKLYEVIITETKVWMALEYCPGKELYDRVLSMHRVPTDECVQLFAQIV 139

Query: 138 IGISYCHALGIVHRDLKPENLLLDSFYNIKIADFGMAALQTDADLLETSCGSPHYAAPEI 197
            G+ Y H+L  VHRDLK EN+LLD   + K+ DFG          LET CG+  Y APE+
Sbjct: 140 GGVHYAHSLNCVHRDLKLENILLDKSGDAKLTDFGFTRECMTKTTLETICGTTVYMAPEL 199

Query: 198 VSGLPYEGFASDVWSCGVILFALLTGRLPFDEENGNVRDLLLKVQKGQFEMPNDTEISRD 257
           +    Y+GF  D+WS GVIL+ ++ G +PFDE++    +  +  Q  Q    N+  ++ D
Sbjct: 200 IERKSYDGFKIDIWSLGVILYTMINGSMPFDEDDETKTEWKIVHQTPQL---NENIVTAD 256

Query: 258 AQDLIGKILVVDPRQRIKIRDILSHPLLKKY 288
           A+DLI ++L  +P  R  +  IL HP L+ +
Sbjct: 257 AKDLILRLLAKNPNDRPTVEQILKHPFLQPF 287

>ZYRO0F07194g Chr6 complement(581438..584254) [2817 bp, 938 aa] {ON}
           similar to uniprot|Q12152 Saccharomyces cerevisiae
           YPL150W Hypothetical ORF
          Length = 938

 Score =  175 bits (444), Expect = 4e-44,   Method: Compositional matrix adjust.
 Identities = 100/288 (34%), Positives = 148/288 (51%), Gaps = 18/288 (6%)

Query: 16  STIGPWKLGETLGFGSTGKVQLAQHERTGHRTAVKVISKSIFNNNGNHSNDDSVLPYNIE 75
           S +G +K+ + +G GS GKV LA H+ T  +  +K   KS                 N+ 
Sbjct: 32  SEVGNYKILKQIGEGSFGKVYLASHKPTHRKVVLKTSDKS---------------DPNLV 76

Query: 76  REIVIMKLLSHPNVLSLYDVWETNNNLYLILEYAEKGELFNLLVDHGPLPEREAINCFRQ 135
           RE+   +    P +  LY+V  T   +++ LEY    EL+  L+    +P  E    F Q
Sbjct: 77  REVFYHRQFDFPYITKLYEVIVTETKVWMALEYCPGRELYEHLLMLHRIPLDECAKLFAQ 136

Query: 136 IIIGISYCHALGIVHRDLKPENLLLDSFYNIKIADFGMAALQTDADLLETSCGSPHYAAP 195
           I+  + Y H+L  VHRDLK EN+LLD   N K+ DFG          LET CG+  Y AP
Sbjct: 137 IVSAVHYAHSLNCVHRDLKLENILLDKNGNAKLTDFGFTRECVSKSSLETICGTTVYMAP 196

Query: 196 EIVSGLPYEGFASDVWSCGVILFALLTGRLPFDEENGNVRDLLLKVQKGQFEMPNDTEIS 255
           E++    Y+GF  D+WS GVIL+ ++ G +PFDE++       +      F   ND  +S
Sbjct: 197 ELIQRQAYDGFKIDIWSLGVILYTMINGTMPFDEDDETKTKWKI---VNDFPNFNDNFVS 253

Query: 256 RDAQDLIGKILVVDPRQRIKIRDILSHPLLKKYQTIKDSKSIKDLPRE 303
            +A+DLI ++L   P +R  +  ILSHP L+ Y  I  S++ K + R+
Sbjct: 254 HEAKDLIKRLLAKCPSERPTMEQILSHPFLQPYGQIMLSRTEKIIKRQ 301

>KLLA0F11319g Chr6 (1042436..1044967) [2532 bp, 843 aa] {ON} similar
           to uniprot|Q12152 Saccharomyces cerevisiae YPL150W
           Hypothetical ORF
          Length = 843

 Score =  173 bits (439), Expect = 9e-44,   Method: Compositional matrix adjust.
 Identities = 114/356 (32%), Positives = 174/356 (48%), Gaps = 44/356 (12%)

Query: 16  STIGPWKLGETLGFGSTGKVQLAQHERTGHRTAVKVISKSIFNNNGNHSNDDSVLPYNIE 75
           S IG +K+ + +G GS GKV LA H  T  +  +K          GN  +       N+ 
Sbjct: 32  SEIGNYKISKFIGEGSFGKVYLATHRLTHQKVVLKT---------GNKRDP------NVV 76

Query: 76  REIVIMKLLSHPNVLSLYDVWETNNNLYLILEYAEKGELFNLLVDHGPLPEREAINCFRQ 135
           RE+   +    P +  LY+V  T + ++++LEY    EL+  L+    L   E+   F Q
Sbjct: 77  REVFYHRQFDFPYITKLYEVIVTESRVWMVLEYCSGHELYEHLLKEQRLSLEESKKLFSQ 136

Query: 136 IIIGISYCHALGIVHRDLKPENLLLDSFYNIKIADFGMAALQTDADLLETSCGSPHYAAP 195
           I   + Y H L  VHRDLK EN+LLD   + K+ DFG          LET CG+  Y AP
Sbjct: 137 IASAVYYAHELKCVHRDLKLENVLLDGNGHAKLTDFGFTREMATRSQLETICGTTVYMAP 196

Query: 196 EIVSGLPYEGFASDVWSCGVILFALLTGRLPFDEENGNVRDLLLKVQKGQFEMPNDTE-I 254
           E++    Y+GF  D+WS G+IL+ ++ G +PFDE++    D+  K++    E+  + E I
Sbjct: 197 ELIERKCYDGFKVDIWSLGIILYTMINGYMPFDEDD----DIKTKLKIVNDELDFNQEWI 252

Query: 255 SRDAQDLIGKILVVDPRQRIKIRDILSHPLLKKYQTIKDSKSIKDLPRENTYLYPLADSN 314
           S DA DLI  +L  +P +RI +  +LSHP L+ +  +   K+ K L         L    
Sbjct: 253 SDDAIDLIQGMLRKNPNERISLAQVLSHPFLQPWGVVAKEKTDKVL---------LKQRG 303

Query: 315 NHTSASIDDSILQNLVVLWHGRHADDIVSKLKENGTNKEKILYALLYRFKLDSVRG 370
            H              V +H +H   ++ +LK+ G +   I  ++  R K DS+ G
Sbjct: 304 GH--------------VHFHSKHEKRLLKRLKQCGFDTGSIKNSVNKR-KCDSLSG 344

>KLLA0D07348g Chr4 (626999..629728) [2730 bp, 909 aa] {ON} similar
           to uniprot|Q03002 Saccharomyces cerevisiae YPL141C
           Hypothetical ORF
          Length = 909

 Score =  172 bits (436), Expect = 3e-43,   Method: Compositional matrix adjust.
 Identities = 105/282 (37%), Positives = 153/282 (54%), Gaps = 19/282 (6%)

Query: 17  TIGPWKLGETLGFGSTGKVQLAQHERTGHRT---AVKVISKSIFNNNGNHSNDDSVLPYN 73
           T GP+ +G TLG G  GKV+L   +     +   A+K+I +     N       S     
Sbjct: 52  TFGPYIIGPTLGEGEFGKVKLGWSKSNSDESKNVAIKLIRRDTIPKN-------SEKEVK 104

Query: 74  IEREIVIMKLLSHPNVLSLYDVWETNNNLYLILEYAEKGELFNLLVDHGPLPEREAINCF 133
           I REI  +K L+HPN+++L +V + +  + ++L YA  GE +  +     L E  A   F
Sbjct: 105 IYREINALKHLAHPNIVTLEEVLQNSKYIGIVLHYASGGEFYKYIQKKRRLKEPAACRLF 164

Query: 134 RQIIIGISYCHALGIVHRDLKPENLLLDSFYNIKIADFGMA-ALQTDADLLETSCGSPHY 192
            Q+I G+ Y H  G+ HRDLK ENLLLD   N+ I DFG      +  DL++TSCGSP Y
Sbjct: 165 AQLISGVHYMHHKGLAHRDLKLENLLLDEHENLIITDFGFVNEFSSRNDLMKTSCGSPCY 224

Query: 193 AAPE-IVSGLPYEGFASDVWSCGVILFALLTGRL-----PFDEENGNVRDLLLKVQKGQF 246
           AAPE +V+   YE   +DVWSCGVIL+A+L G L     P + +  ++  L   + K   
Sbjct: 225 AAPELVVTTKAYEARKADVWSCGVILYAMLAGYLPWDDDPDNPDGDDIAKLYNYITKTSL 284

Query: 247 EMPNDTEISRDAQDLIGKILVVDPRQRIKIRDILSHPLLKKY 288
           + P    I+   +D++ +ILV DP +RI +  IL H  L+ +
Sbjct: 285 KFPE--YINPIPRDILRRILVSDPSKRITVELILKHQWLQPH 324

>KNAG0J01670 Chr10 complement(304021..307050) [3030 bp, 1009 aa]
           {ON} 
          Length = 1009

 Score =  172 bits (435), Expect = 6e-43,   Method: Compositional matrix adjust.
 Identities = 97/275 (35%), Positives = 149/275 (54%), Gaps = 18/275 (6%)

Query: 16  STIGPWKLGETLGFGSTGKVQLAQHERTGHRTAVKVISKSIFNNNGNHSNDDSVLPYNIE 75
           + +G +K+ E +G GS GKV LA H R  HR   KV+ KS   N+ N           I 
Sbjct: 41  TVVGNYKILEQIGEGSFGKVYLAMH-RPTHR---KVVIKSSVKNDPN-----------IV 85

Query: 76  REIVIMKLLSHPNVLSLYDVWETNNNLYLILEYAEKGELFNLLVDHGPLPEREAINCFRQ 135
           RE+   +   +  +  LY++  T + +++ LEY    EL++ ++    +P  E I  F Q
Sbjct: 86  REVFYHRQFEYHYITKLYEIIVTESKVWMALEYCPGRELYDHVLQMKRIPAEECIQLFSQ 145

Query: 136 IIIGISYCHALGIVHRDLKPENLLLDSFYNIKIADFGMAALQTDADLLETSCGSPHYAAP 195
           I+  + Y H+L  VHRDLK EN+LLD   N K+ DFG      +   LET CG+  Y AP
Sbjct: 146 IVGAVYYAHSLNCVHRDLKLENILLDKDGNAKLTDFGFTRECMEKVNLETICGTTVYMAP 205

Query: 196 EIVSGLPYEGFASDVWSCGVILFALLTGRLPFDEENGNVRDLLLKVQKGQFEMPNDTEIS 255
           E+    PY+GF  D+WS GVIL+ +L+G +PFDE++       +  ++ ++   N   ++
Sbjct: 206 ELTERKPYDGFKIDIWSLGVILYTMLSGSMPFDEDDEAKTKWKIINEEPEY---NSKFMT 262

Query: 256 RDAQDLIGKILVVDPRQRIKIRDILSHPLLKKYQT 290
            + +DL+ K+L  D   R  +R+IL H  L+ Y T
Sbjct: 263 AEGEDLVRKLLQKDSNLRPSVREILQHEFLQPYGT 297

>TBLA0B03860 Chr2 (887855..890821) [2967 bp, 988 aa] {ON} Anc_8.668
           YPL150W
          Length = 988

 Score =  170 bits (430), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 98/276 (35%), Positives = 143/276 (51%), Gaps = 22/276 (7%)

Query: 18  IGPWKLGETLGFGSTGKVQLAQHERTGHRTAVKVISKSIFNNNGNHSNDDSVLPYNIERE 77
           +G +++   +G GS GKV LA H  T  +  +K  +KS                 N+ RE
Sbjct: 34  VGNYRILRQIGEGSFGKVYLAHHLPTHRKVVLKSSAKS---------------DPNVVRE 78

Query: 78  IVIMKLLSHPNVLSLYDVWETNNNLYLILEYAEKGELFNLLVDHGPLPEREAINCFRQII 137
           +   +    P +  LY++  T   +++ LEY    EL+  L+    +P  E    F QI 
Sbjct: 79  VFYHRQFEFPYITKLYEIIVTETKVWMALEYCPGKELYEHLLRLHRIPVDECSRLFAQIS 138

Query: 138 IGISYCHALGIVHRDLKPENLLLDSFYNIKIADFGMAALQTDADLLETSCGSPHYAAPEI 197
             + Y H+L  VHRDLK EN+LLD   N K+ DFG        ++LET CG+  Y APE+
Sbjct: 139 GAMYYAHSLNCVHRDLKLENILLDKVGNAKLTDFGFTRECASKNILETICGTTVYMAPEL 198

Query: 198 VSGLPYEGFASDVWSCGVILFALLTGRLPFDEENGNVRDLLLKVQKGQFEMP--NDTEIS 255
           +    Y+GF  DVWS GVIL+ LL G +PFDEE    ++   K+     EMP  + T + 
Sbjct: 199 IKRERYDGFKIDVWSLGVILYTLLNGFMPFDEEQQ--KNTEWKIVN---EMPSFDSTLLG 253

Query: 256 RDAQDLIGKILVVDPRQRIKIRDILSHPLLKKYQTI 291
            DA DL+ K+L  DP  R  ++++L HP L+ Y  +
Sbjct: 254 PDAVDLLSKLLAKDPIDRPSMKEVLEHPYLQPYGNV 289

>Kwal_26.8751 s26 complement(928853..931399) [2547 bp, 848 aa] {ON}
           YPL150W - Hypothetical ORF [contig 67] FULL
          Length = 848

 Score =  169 bits (427), Expect = 3e-42,   Method: Compositional matrix adjust.
 Identities = 93/272 (34%), Positives = 145/272 (53%), Gaps = 20/272 (7%)

Query: 18  IGPWKLGETLGFGSTGKVQLAQHERTGHRTAVKVISKSIFNNNGNHSNDDSVLPYNIERE 77
           +G +K+ + +G GS GKV LA H  T  +  +K+ SK          ND +V+     RE
Sbjct: 34  VGNYKILKIVGEGSFGKVYLASHCLTHQKVVLKMGSK----------NDPNVV-----RE 78

Query: 78  IVIMKLLSHPNVLSLYDVWETNNNLYLILEYAEKGELFNLLVDHGPLPEREAINCFRQII 137
           +   +   + ++  LY+V  T N +++ LEY    EL+  L+    +P  E    F QI+
Sbjct: 79  VFYHRQFDYSHITKLYEVIVTENYVWMALEYCPGKELYEYLLAKKHIPLEECSELFSQIV 138

Query: 138 IGISYCHALGIVHRDLKPENLLLDSFYNIKIADFGMAALQTDADLLETSCGSPHYAAPEI 197
             + Y H++  VHRDLK EN+LLD   + K+ DFG         +LET CG+  Y APE+
Sbjct: 139 GAVYYAHSMKCVHRDLKLENILLDKKGHAKLTDFGFTRECATKGILETICGTTVYMAPEL 198

Query: 198 VSGLPYEGFASDVWSCGVILFALLTGRLPFDEENGNVRDLLLKVQKGQFEMPNDTE-ISR 256
           +   PYEG+  D WS G+IL+ ++ G +PFDE    V ++  K +   +    D + I  
Sbjct: 199 IERKPYEGYKIDTWSLGIILYTMIHGTMPFDE----VDEVKTKYKIVHYNPTYDNDYIDS 254

Query: 257 DAQDLIGKILVVDPRQRIKIRDILSHPLLKKY 288
           + ++LI ++L  DP QR  +  +L HP L+ Y
Sbjct: 255 NGKELISQLLEKDPNQRPSLTQVLQHPFLQPY 286

>KLTH0D11242g Chr4 (918232..920619) [2388 bp, 795 aa] {ON} similar
           to uniprot|P22216 Saccharomyces cerevisiae YPL153C RAD53
           Protein kinase required for cell-cycle arrest in
           response to DNA damage activated by trans
           autophosphorylation when interacting with
           hyperphosphorylated Rad9p
          Length = 795

 Score =  167 bits (424), Expect = 5e-42,   Method: Compositional matrix adjust.
 Identities = 97/286 (33%), Positives = 154/286 (53%), Gaps = 27/286 (9%)

Query: 25  ETLGFGSTGKVQLAQHERTGHRTAVKVISKSIFNNNGNHSNDDSVLPYNIEREIVIMKLL 84
           E +G G+   V+ A   RTG   AVK+I+K     N +           + RE+ +++ L
Sbjct: 192 EVVGQGAFATVKKAIERRTGKTHAVKIINKRKVMGNMD----------GVTRELEVLRRL 241

Query: 85  SHPNVLSLYDVWETNNNLYLILEYAEKGELFNLLVDHGPLPEREAINCFRQIIIGISYCH 144
           +HP ++SL   +E   + YL++E+   G+L + +  HG + E       RQ++  + Y H
Sbjct: 242 NHPRIVSLKGFYEDKESYYLVMEFVSGGDLMDFVAAHGSVGEDAGREITRQVLEAVKYIH 301

Query: 145 ALGIVHRDLKPENLLL--DSFYNIKIADFGMAALQTDADLLETSCGSPHYAAPEIVSGLP 202
           A+GI HRDLKP+N+L+  D    +KI DFG+A +Q +   ++T CG+  Y APE++SG  
Sbjct: 302 AMGISHRDLKPDNILIERDDPVLVKITDFGLAKIQDNGTFMKTFCGTLAYVAPEVISGKN 361

Query: 203 YE-----GFAS--DVWSCGVILFALLTGRLPFDEENGNVRDLLLKVQKGQF-EMP-NDTE 253
            E      ++S  D+WS G +++ +LTG LPF       ++L  ++  G + E P  D  
Sbjct: 362 SEEKEGNKYSSLVDMWSIGCLVYVILTGHLPF--SGSTQQELYKQISAGSYHEGPLKDYR 419

Query: 254 ISRDAQDLIGKILVVDPRQRIKIRDILSHPLLKKYQTIKDSKSIKD 299
           IS DA+D I   L V+PR R+     L HP ++      DS+S  D
Sbjct: 420 ISDDARDFIESFLQVNPRDRMTAEQALKHPWIR----TADSQSFID 461

>Kwal_26.8796 s26 (946406..948796) [2391 bp, 796 aa] {ON} YPL153C
           (RAD53) - protein kinase, Mec1p and Tel1p regulate
           rad53p phosphorylation [contig 68] FULL
          Length = 796

 Score =  166 bits (421), Expect = 1e-41,   Method: Compositional matrix adjust.
 Identities = 101/286 (35%), Positives = 154/286 (53%), Gaps = 27/286 (9%)

Query: 25  ETLGFGSTGKVQLAQHERTGHRTAVKVISKSIFNNNGNHSNDDSVLPYNIEREIVIMKLL 84
           E +G G+   V+ A   +TG   AVK+ISK       +           + RE+ +++ L
Sbjct: 192 EVVGQGAFATVKKAIERKTGKTHAVKIISKRKVVGVMD----------GVARELEVLQRL 241

Query: 85  SHPNVLSLYDVWETNNNLYLILEYAEKGELFNLLVDHGPLPEREAINCFRQIIIGISYCH 144
            HP ++SL   +E  ++ YL++E+   G+L + +  HG + E       RQI+  + Y H
Sbjct: 242 DHPRIVSLKGFYEDKDSHYLVMEFVSGGDLMDFVAAHGSVGEDAGREITRQILEAVKYIH 301

Query: 145 ALGIVHRDLKPENLLL--DSFYNIKIADFGMAALQTDADLLETSCGSPHYAAPEIVSGL- 201
           ++GI HRDLKP+N+L+  D    +KI DFG+A +Q +   ++T CG+  Y APE++SG  
Sbjct: 302 SMGISHRDLKPDNILIERDDPVLVKITDFGLAKIQGNGTFMKTFCGTLAYVAPEVISGKN 361

Query: 202 --PYEG--FAS--DVWSCGVILFALLTGRLPFDEENGNVRDLLLKVQKGQF-EMP-NDTE 253
               EG  ++S  D+WS G +++ +LTG LPF     N  DL  ++  G + E P  D  
Sbjct: 362 SGEKEGNTYSSLVDMWSIGCLVYVILTGHLPFSGSTQN--DLYKQITAGSYHEGPLKDYR 419

Query: 254 ISRDAQDLIGKILVVDPRQRIKIRDILSHPLLKKYQTIKDSKSIKD 299
           IS DA+D I   L VDPR R+     L HP +K      DS+S  D
Sbjct: 420 ISDDARDFIESFLQVDPRNRMTAEQALRHPWIKA----ADSQSYVD 461

>KLTH0D11044g Chr4 complement(901388..903937) [2550 bp, 849 aa] {ON}
           similar to uniprot|Q12152 Saccharomyces cerevisiae
           YPL150W
          Length = 849

 Score =  166 bits (421), Expect = 1e-41,   Method: Compositional matrix adjust.
 Identities = 92/268 (34%), Positives = 143/268 (53%), Gaps = 18/268 (6%)

Query: 18  IGPWKLGETLGFGSTGKVQLAQHERTGHRTAVKVISKSIFNNNGNHSNDDSVLPYNIERE 77
           +G +++ + +G GS GKV LA H  T  +  +K+ SK          ND      N+ RE
Sbjct: 34  VGNYRILKIVGEGSFGKVYLASHRLTHQKVVLKMGSK----------NDP-----NVVRE 78

Query: 78  IVIMKLLSHPNVLSLYDVWETNNNLYLILEYAEKGELFNLLVDHGPLPEREAINCFRQII 137
           +   +   +  +  LY+V  T N++++ LEY    EL+  L+    +P  E  + F QI+
Sbjct: 79  VFYHRQFDYVYITKLYEVIVTENSVWMALEYCPGKELYEYLLIKKRIPLDECSHLFSQIV 138

Query: 138 IGISYCHALGIVHRDLKPENLLLDSFYNIKIADFGMAALQTDADLLETSCGSPHYAAPEI 197
             + Y H++  VHRDLK EN+LLD     K+ DFG         +LET CG+  Y APE+
Sbjct: 139 GAVFYAHSMKCVHRDLKLENILLDKKGQAKLTDFGFTRECATKGILETVCGTTVYMAPEL 198

Query: 198 VSGLPYEGFASDVWSCGVILFALLTGRLPFDEENGNVRDLLLKVQKGQFEMPNDTEISRD 257
           +   PYEG+  D WS G+IL+ ++ G +PFDEE+ +++     V    F   +D  I  +
Sbjct: 199 IERKPYEGYKIDTWSLGIILYTMIHGAMPFDEED-DIKTKYRIVNNEPFY--DDNFIDAN 255

Query: 258 AQDLIGKILVVDPRQRIKIRDILSHPLL 285
            +DLI ++L  DP QR  +  +L HP +
Sbjct: 256 GKDLIMQLLQKDPSQRPSLTQVLQHPFM 283

>TPHA0G01630 Chr7 (336511..339126) [2616 bp, 871 aa] {ON} Anc_8.668
           YPL150W
          Length = 871

 Score =  166 bits (420), Expect = 2e-41,   Method: Compositional matrix adjust.
 Identities = 92/271 (33%), Positives = 145/271 (53%), Gaps = 18/271 (6%)

Query: 18  IGPWKLGETLGFGSTGKVQLAQHERTGHRTAVKVISKSIFNNNGNHSNDDSVLPYNIERE 77
           +G +K+ + +G GS GKV LA H  T  +  +K  SK+                 N+ RE
Sbjct: 34  VGNYKILKQVGEGSFGKVYLAIHRPTHRKVVLKSSSKT---------------DPNVVRE 78

Query: 78  IVIMKLLSHPNVLSLYDVWETNNNLYLILEYAEKGELFNLLVDHGPLPEREAINCFRQII 137
           +   +   HP +  LY++  T   +++ LEY    EL++ L+    +P  E    F QI+
Sbjct: 79  VFYHRQFDHPYITKLYEIIITETKVWMSLEYCPGKELYDYLLVMRRIPLDECSRLFAQIV 138

Query: 138 IGISYCHALGIVHRDLKPENLLLDSFYNIKIADFGMAALQTDADLLETSCGSPHYAAPEI 197
             + Y H+L  VHRDLK EN+LLD   N K+ADFG        + LET CG+  Y APE+
Sbjct: 139 GAVYYAHSLNCVHRDLKLENILLDMQGNAKLADFGFTRECATKNQLETICGTTVYMAPEL 198

Query: 198 VSGLPYEGFASDVWSCGVILFALLTGRLPFDEENGNVRDLLLKVQKGQFEMPNDTEISRD 257
           +    Y+GF  D+WS GVIL+ L+ G +PFDEE+    +  +  ++  +   N+   + +
Sbjct: 199 LRRDTYDGFKIDIWSLGVILYTLINGSMPFDEEDETRTEWKIINEEPDY---NEKIFNAN 255

Query: 258 AQDLIGKILVVDPRQRIKIRDILSHPLLKKY 288
           + +LI  +L+ DP++R  + +IL H  L+ Y
Sbjct: 256 SIELIKSLLIKDPKKRPSMTEILKHKFLEPY 286

>TDEL0A06140 Chr1 complement(1074016..1076601) [2586 bp, 861 aa]
           {ON} Anc_8.668 YPL150W
          Length = 861

 Score =  166 bits (419), Expect = 2e-41,   Method: Compositional matrix adjust.
 Identities = 100/279 (35%), Positives = 144/279 (51%), Gaps = 22/279 (7%)

Query: 12  AKPSSTIGPWKLGETLGFGSTGKVQLAQHERTGHRTAVKVISKSIFNNNGNHSNDDSVLP 71
           A+  S +G +K+ + +G GS GKV LA H+ T  +  +K   K          ND     
Sbjct: 28  AEELSEVGNYKIMKQIGEGSFGKVYLASHKPTHRKVVLKTSDK----------NDP---- 73

Query: 72  YNIEREIVIMKLLSHPNVLSLYDVWETNNNLYLILEYAEKGELFNLLVDHGPLPEREAIN 131
            N+ RE+   +   +  +  LY+V  T   +++ LEY    EL+  L+    +   E   
Sbjct: 74  -NVVREVFYHRQFDYLYITRLYEVIVTETKVWMALEYCPGKELYEHLLALKRISLDECSR 132

Query: 132 CFRQIIIGISYCHALGIVHRDLKPENLLLDSFYNIKIADFGMAALQTDADLLETSCGSPH 191
            F QI+  I Y H+L  VHRDLK EN+LLD   N K+ DFG          L+T CG+  
Sbjct: 133 LFAQIVGAIYYAHSLNCVHRDLKLENILLDKKGNAKLTDFGFTRECVSKSQLDTICGTTV 192

Query: 192 YAAPEIVSGLPYEGFASDVWSCGVILFALLTGRLPFDEENGNVRDLLLKVQKGQFEMP-- 249
           Y APE+     Y+GF  D+W+ GVIL+ ++ G +PFDE+     D      K   EMP  
Sbjct: 193 YMAPELTERKSYDGFKIDIWALGVILYTMINGSMPFDED-----DEAKTKWKIVNEMPEI 247

Query: 250 NDTEISRDAQDLIGKILVVDPRQRIKIRDILSHPLLKKY 288
           N+  +S DA+DLI ++L  DP +R  I  IL+HP L+ Y
Sbjct: 248 NEDLVSPDAKDLIEQLLAKDPNERPSIEKILTHPFLQPY 286

>Suva_16.160 Chr16 (277393..280149) [2757 bp, 918 aa] {ON} YPL150W
           (REAL)
          Length = 918

 Score =  166 bits (420), Expect = 3e-41,   Method: Compositional matrix adjust.
 Identities = 101/290 (34%), Positives = 149/290 (51%), Gaps = 22/290 (7%)

Query: 18  IGPWKLGETLGFGSTGKVQLAQHERTGHRTAVKVISKSIFNNNGNHSNDDSVLPYNIERE 77
           +G +K+ + +G GS GKV LA H  T  +  +K   K          ND      NI RE
Sbjct: 38  VGNYKILKQVGEGSFGKVYLALHRPTHRKVCLKTSDK----------NDP-----NIVRE 82

Query: 78  IVIMKLLSHPNVLSLYDVWETNNNLYLILEYAEKGELFNLLVDHGPLPEREAINCFRQII 137
           +   +    P +  LY+V  T   +++ LEY    EL++ L+    +   E    F QI 
Sbjct: 83  VFYHRQFDFPYITKLYEVIVTETKVWMALEYCPGKELYDHLLSLHRISLLECAELFAQIS 142

Query: 138 IGISYCHALGIVHRDLKPENLLLDSFYNIKIADFGMAALQTDADLLETSCGSPHYAAPEI 197
             + Y H++  VHRDLK EN+LLD   N K+ DFG          LET CG+  Y APE+
Sbjct: 143 GAVYYAHSMHCVHRDLKLENILLDKNGNAKLTDFGFTRECMTKTTLETVCGTTVYMAPEL 202

Query: 198 VSGLPYEGFASDVWSCGVILFALLTGRLPFDEENGNVRDLLLKVQKGQFEMPN--DTEIS 255
           +    Y+GF  D+WS GVIL+ L+TG LPFD++     D +    K   E PN   T I 
Sbjct: 203 IERRTYDGFKIDIWSLGVILYTLITGSLPFDDD-----DEVKTKWKIVNEEPNYDSTLIP 257

Query: 256 RDAQDLIGKILVVDPRQRIKIRDILSHPLLKKYQTIKDSKSIKDLPRENT 305
            DA+DLI ++L  +P++R  +  +L H  L+ Y ++   ++ K L R+ +
Sbjct: 258 DDAKDLISRLLAKNPKERPSLPQVLHHQFLQPYGSVVLDQTEKTLSRQRS 307

>CAGL0M02233g Chr13 complement(267332..269635) [2304 bp, 767 aa]
           {ON} highly similar to uniprot|P22216 Saccharomyces
           cerevisiae YPL153c SPK1 ser/thr/tyr protein kinase
          Length = 767

 Score =  165 bits (417), Expect = 3e-41,   Method: Compositional matrix adjust.
 Identities = 96/292 (32%), Positives = 158/292 (54%), Gaps = 33/292 (11%)

Query: 25  ETLGFGSTGKVQLAQHERTGHRTAVKVISKSIFNNNGNHSNDDSVLPYNIEREIVIMKLL 84
           E +G G+   V+ A    TG   AVK+I+K     N +           + RE+ +++ L
Sbjct: 192 EVVGTGAFATVKKAVERNTGKTFAVKIINKRKVVGNMD----------GVSRELEVLQKL 241

Query: 85  SHPNVLSLYDVWETNNNLYLILEYAEKGELFNLLVDHGPLPEREAINCFRQIIIGISYCH 144
           +HP ++SL   +E   N Y+++E+   G+L + +  HG + E       RQI+  I Y H
Sbjct: 242 NHPRIVSLKAFYEDEANYYMVMEFISGGDLMDFVAAHGAVGEEAGREISRQILEAIQYIH 301

Query: 145 ALGIVHRDLKPENLLL--DSFYNIKIADFGMAALQTDADLLETSCGSPHYAAPEIVSGLP 202
           + GI HRDLKP+N+L+  D    +KI DFG+A +Q +  +++T CG+  Y APE++ G  
Sbjct: 302 SKGISHRDLKPDNILIEQDDPVLVKITDFGLAKVQGNGSIMKTFCGTLAYVAPEVIGGFT 361

Query: 203 --------------YEGFASDVWSCGVILFALLTGRLPFDEENGNVRDLLL-KVQKGQF- 246
                         Y     D+WS G ++F +LTG LPF   +G+ ++ L  +++KG + 
Sbjct: 362 GATGEEETEEERIEYSSLV-DMWSMGCLVFVILTGHLPF---SGSTQEQLYEQIRKGSYH 417

Query: 247 EMP-NDTEISRDAQDLIGKILVVDPRQRIKIRDILSHPLLKKYQTIKDSKSI 297
           E P  D  IS +A+D I  +L VD  +R+ + D L+HP +K+  +  D+ S+
Sbjct: 418 EGPLKDFRISDEARDFIDGLLQVDQSKRMTVDDALNHPWIKQCSSQFDANSM 469

>TPHA0E02820 Chr5 complement(589816..590970) [1155 bp, 384 aa] {ON}
           Anc_6.222 YPL209C
          Length = 384

 Score =  155 bits (393), Expect = 1e-40,   Method: Compositional matrix adjust.
 Identities = 88/258 (34%), Positives = 141/258 (54%), Gaps = 23/258 (8%)

Query: 35  VQLAQHERTGHRTAVKVISKSIFNNNGNHSNDDSVLPYNIER----EIVIMKLLSHPNVL 90
           V   +H +TG   A+K++ KS             +L YN+ +    EI I   L+H N+ 
Sbjct: 140 VYCCRHIKTGFICAIKIMDKS------------EILTYNVTKQFRNEIEIQSNLNHENLT 187

Query: 91  SLYDVWETNNNLYLILEYAEKGELFNLLVDHGPLPEREAINCFRQIIIGISYCHALGIVH 150
            LY  +  +  +YLI+EY   GEL+++L  +GP  +  A N   Q+   I Y H   I+H
Sbjct: 188 KLYGFFHDSKRVYLIMEYIYNGELYSILKKNGPFNDIVASNFVFQLTNAIRYLHKKRIIH 247

Query: 151 RDLKPENLLLDSFYNIKIADFGMAALQTDADLLETSCGSPHYAAPEIVSGLPYEGFASDV 210
           RDLKPEN+L+D    IKI DFG +      +  +T CG+  Y +PE+++   Y+G   DV
Sbjct: 248 RDLKPENILIDFNNVIKITDFGWSVYNEAGNKRKTLCGTIDYLSPELINSKEYDGLI-DV 306

Query: 211 WSCGVILFALLTGRLPFDEENGNVRDLLLK-VQKGQFEMPNDTEISRDAQDLIGKILVVD 269
           W+ G+I + L+ G  PF+E+    ++L  K ++      P    +S+DA++LI  +L ++
Sbjct: 307 WALGIIAYELIVGTPPFEED---TKELTYKRIKNCDLNFP--AHVSQDAKNLISSLLKLN 361

Query: 270 PRQRIKIRDILSHPLLKK 287
           P +RI + D+L HP + K
Sbjct: 362 PSERITLTDVLKHPWINK 379

>SAKL0D07656g Chr4 complement(627469..628767) [1299 bp, 432 aa] {ON}
           similar to uniprot|P22517 Saccharomyces cerevisiae
           YOL016C CMK2 Calmodulin-dependent protein kinase and
           uniprot|P27466 Saccharomyces cerevisiae YFR014C CMK1
          Length = 432

 Score =  157 bits (396), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 99/281 (35%), Positives = 152/281 (54%), Gaps = 20/281 (7%)

Query: 11  AAKPSSTIGP--WKLGETLGFGSTGKVQLAQHERTGHRTAVKVISKSIFNNNGNHSNDDS 68
           + +PSS +    +  G+TLG GS G V+ A+   TG   AVK++ K     N        
Sbjct: 34  SGQPSSYVNKSDYIFGKTLGAGSFGVVRQARKISTGDNVAVKILLKKALKGN-------D 86

Query: 69  VLPYNIEREIVIMKLLSHPNVLSLYDVWETNNNLYLILEYAEKGELFNLLVDHGPLPERE 128
           V    +  E++I++ L+HPN++   D +E+    Y++ + A  GELF+ ++  G   E +
Sbjct: 87  VQLQMLYDELMILQKLNHPNIVKFKDWFESKEKFYIVTQLATGGELFDRILQKGKFTEVD 146

Query: 129 AINCFRQIIIGISYCHALGIVHRDLKPENLL-LDSFYN--IKIADFGMAA-LQTDADLLE 184
           A+    QI+  + Y H+  IVHRDLKPENLL LD   N  + + DFG+A  L+ D DL+ 
Sbjct: 147 AVKIVVQILKAVEYLHSRNIVHRDLKPENLLYLDKSDNSQLVLGDFGIAKELKNDGDLIH 206

Query: 185 TSCGSPHYAAPEIVSGLPYEGFASDVWSCGVILFALLTGRLPFDEENGNVRDLLLKVQKG 244
            + GS  Y APE+++   + G   D+WS GVI + LL G  PF  E  +V   L +   G
Sbjct: 207 KAAGSMGYVAPEVLTSNGH-GKPCDIWSIGVITYTLLCGYSPFIAE--SVDGFLEECTSG 263

Query: 245 Q----FEMPNDTEISRDAQDLIGKILVVDPRQRIKIRDILS 281
           Q    F  P    IS++A+  I ++L + P++R    D+LS
Sbjct: 264 QYPVTFHKPYWNNISKEAKLFILRVLTISPKKRPTATDLLS 304

>YPL150W Chr16 (268188..270893) [2706 bp, 901 aa] {ON} Protein
           kinase of unknown cellular role; binds
           phosphatidylinositols and cardiolipin in a large-scale
           study
          Length = 901

 Score =  162 bits (409), Expect = 6e-40,   Method: Compositional matrix adjust.
 Identities = 96/288 (33%), Positives = 150/288 (52%), Gaps = 18/288 (6%)

Query: 18  IGPWKLGETLGFGSTGKVQLAQHERTGHRTAVKVISKSIFNNNGNHSNDDSVLPYNIERE 77
           +G +K+ + +G GS GKV LA H  T  +  +K   K          ND      NI RE
Sbjct: 38  VGNYKILKQIGEGSFGKVYLALHRPTHRKVCLKTSDK----------NDP-----NIVRE 82

Query: 78  IVIMKLLSHPNVLSLYDVWETNNNLYLILEYAEKGELFNLLVDHGPLPEREAINCFRQII 137
           +   +    P +  LY+V  T + +++ LEY    EL++ L+    +   E    F QI 
Sbjct: 83  VFYHRQFDFPYITKLYEVIVTESKVWMALEYCPGKELYDHLLSLRRISLLECGELFAQIS 142

Query: 138 IGISYCHALGIVHRDLKPENLLLDSFYNIKIADFGMAALQTDADLLETSCGSPHYAAPEI 197
             + Y H++  VHRDLK EN+LLD   N K+ DFG          LET CG+  Y APE+
Sbjct: 143 GAVYYAHSMHCVHRDLKLENILLDKNGNAKLTDFGFTRECMTKTTLETVCGTTVYMAPEL 202

Query: 198 VSGLPYEGFASDVWSCGVILFALLTGRLPFDEENGNVRDLLLKVQKGQFEMPNDTEISRD 257
           +    Y+GF  D+WS GVIL+ L+TG LPFD+++       +  ++ +++      I  D
Sbjct: 203 IERRTYDGFKIDIWSLGVILYTLITGYLPFDDDDEAKTKWKIVNEEPKYDAK---VIPDD 259

Query: 258 AQDLIGKILVVDPRQRIKIRDILSHPLLKKYQTIKDSKSIKDLPRENT 305
           A+DLI ++L  +P +R  +  +L HP L+ Y ++   ++ K L R+ +
Sbjct: 260 ARDLISRLLAKNPGERPSLSQVLRHPFLQPYGSVVLDQTQKILCRQRS 307

>CAGL0L07326g Chr12 (810529..812049) [1521 bp, 506 aa] {ON} similar
           to uniprot|P39009 Saccharomyces cerevisiae YDL101c DUN1
           protein kinase
          Length = 506

 Score =  157 bits (396), Expect = 8e-40,   Method: Compositional matrix adjust.
 Identities = 103/316 (32%), Positives = 155/316 (49%), Gaps = 40/316 (12%)

Query: 13  KPSSTIGPWKLGETLGFGSTGKVQLAQHERTGHRTAVKVISKSIFNNNGNHSNDDSVLPY 72
           KP S    + LG+ LG G    V+ A+++ TG   AVK+             NDD     
Sbjct: 185 KPLSFFDKYLLGKDLGSGHYAIVKEAKNKTTGETVAVKIFHP--------QQNDDQKKNK 236

Query: 73  NIEREIVIMKLLSHPNVLSLYD-----VWETNNNLYLILEYAEKGELFNLLVDHGPLPER 127
               E  I+  + HPN+++L D     + +T    YL+LE  + GELF+ +V    LP+ 
Sbjct: 237 QFREETTILMKIHHPNIVNLLDSFVEPISKTQIQKYLVLEKIDDGELFDRIVKKTSLPQE 296

Query: 128 EAINCFRQIIIGISYCHALGIVHRDLKPENLLLDSF-------------------YNIKI 168
           E+   F+QI+ G+ Y H+  I+HRD+KPEN+LL+                       +KI
Sbjct: 297 ESKAIFKQILTGLKYLHSQNIIHRDIKPENILLNIRRRQSPDERQLGPWDEDEIDIQVKI 356

Query: 169 ADFGMAALQTDADLLETSCGSPHYAAPEIVSGLPYEGFAS--DVWSCGVILFALLTGRLP 226
           ADFG+A    +     T CG+P Y APE+   L  +G+ S  D+WS GVIL+  L G  P
Sbjct: 357 ADFGLAKFTGEMQFTNTLCGTPSYVAPEV---LVKKGYTSKVDLWSAGVILYVCLCGFPP 413

Query: 227 FDEENG--NVRDLLLKVQKGQFEMPNDTEISRDAQDLIGKILVVDPRQRIKIRDILSHPL 284
           F ++ G  ++++ ++   K  F  P   EI   A  LI  +LV+DP  R  +    +HP 
Sbjct: 414 FSDQLGPPSLKEQIMSA-KYAFYSPYWDEIDDAALHLISNLLVLDPENRYDVDAAAAHPW 472

Query: 285 LKKYQTIKDSKSIKDL 300
           L     +  S ++K L
Sbjct: 473 LDSVSHLDVSHNLKRL 488

>Smik_6.350 Chr6 (559997..562465) [2469 bp, 822 aa] {ON} YPL153C
           (REAL)
          Length = 822

 Score =  160 bits (406), Expect = 8e-40,   Method: Compositional matrix adjust.
 Identities = 96/283 (33%), Positives = 155/283 (54%), Gaps = 34/283 (12%)

Query: 23  LGETLGFGSTGKVQLAQHERTGHRTAVKVISKS--IFNNNGNHSNDDSVLPYNIEREIVI 80
           + E +G G+   V+ A    TG   AVK+ISK   I N +G            + RE+ +
Sbjct: 200 IDEVVGQGAFATVKKAIERTTGKTFAVKIISKRKVIGNMDG------------VTRELEV 247

Query: 81  MKLLSHPNVLSLYDVWETNNNLYLILEYAEKGELFNLLVDHGPLPEREAINCFRQIIIGI 140
           ++ L+HP ++ L   +E  ++ Y+++E+   G+L + +  HG + E       RQI+  +
Sbjct: 248 LQKLNHPRIVRLKGFYEDADSYYMVMEFVSGGDLMDFVAAHGAVGEDAGREISRQILTAV 307

Query: 141 SYCHALGIVHRDLKPENLLL--DSFYNIKIADFGMAALQTDADLLETSCGSPHYAAPEIV 198
            Y H++GI HRDLKP+N+L+  D    +KI DFG+A +Q +   ++T CG+  Y APE++
Sbjct: 308 KYIHSMGISHRDLKPDNILIEQDDPVLVKITDFGLAKVQGNGSFMKTFCGTLAYVAPEVI 367

Query: 199 SGL-------PYE---GFAS--DVWSCGVILFALLTGRLPFDEENGNVRDLLLK-VQKGQ 245
            G         YE    ++S  D+WS G +++ +LTG LPF   +G+ +D L K + +G 
Sbjct: 368 RGKDSSASPDEYEERNEYSSLVDMWSMGCLVYVILTGHLPF---SGSTQDQLYKQIGRGS 424

Query: 246 F-EMP-NDTEISRDAQDLIGKILVVDPRQRIKIRDILSHPLLK 286
           + E P  D  IS +A+D I  +L VDP  R+     L HP +K
Sbjct: 425 YHEGPLKDFRISEEARDFIDSLLQVDPSNRLTAAKALDHPWIK 467

>SAKL0H06534g Chr8 complement(575439..577853) [2415 bp, 804 aa] {ON}
           similar to uniprot|P22216 Saccharomyces cerevisiae
           YPL153C RAD53 Protein kinase required for cell-cycle
           arrest in response to DNA damage activated by trans
           autophosphorylation when interacting with
           hyperphosphorylated Rad9p
          Length = 804

 Score =  160 bits (406), Expect = 9e-40,   Method: Compositional matrix adjust.
 Identities = 91/276 (32%), Positives = 153/276 (55%), Gaps = 27/276 (9%)

Query: 25  ETLGFGSTGKVQLAQHERTGHRTAVKVISKSIFNNNGNHSNDDSVLPYNIEREIVIMKLL 84
           E +G G+   V+ A   +TG   AVK+ISK     N +           + RE+ +++ L
Sbjct: 192 EVVGQGAFAIVKKAVERKTGKTFAVKIISKRKVMGNID----------GVTRELEVLRRL 241

Query: 85  SHPNVLSLYDVWETNNNLYLILEYAEKGELFNLLVDHGPLPEREAINCFRQIIIGISYCH 144
           +HP ++ L   +E + + YL++E+   G+L + +  HG + E       +Q++  + Y H
Sbjct: 242 NHPRIVRLKGFYEDDESYYLLMEFVSGGDLMDFVAAHGSVGEDAGREITKQVLEAVKYIH 301

Query: 145 ALGIVHRDLKPENLLL--DSFYNIKIADFGMAALQTDADLLETSCGSPHYAAPEIVSGLP 202
            +GI HRDLKP+N+L+  D    +KI DFG+A +Q +   ++T CG+  Y APE++SG  
Sbjct: 302 GMGISHRDLKPDNILIEQDDPVMVKITDFGLAKIQGNGTFMKTFCGTLAYVAPEVISGKN 361

Query: 203 YEG-------FAS--DVWSCGVILFALLTGRLPFDEENGNVRDLLLK-VQKGQF-EMP-N 250
            E        ++S  D+WS G +++ +LTG LPF   +G+ +D L K + +G + E P  
Sbjct: 362 SEDKSQNKNKYSSLVDMWSIGCLVYVILTGHLPF---SGSTQDQLYKQISRGSYHEGPLK 418

Query: 251 DTEISRDAQDLIGKILVVDPRQRIKIRDILSHPLLK 286
           D  IS +A++ I  +L V+P+ R+     L HP +K
Sbjct: 419 DFRISDEARNFIDSLLQVNPKDRLTAEKALDHPWIK 454

>YPL209C Chr16 complement(156490..157593) [1104 bp, 367 aa] {ON}
           IPL1Aurora kinase subunit of the conserved chromosomal
           passenger complex (CPC; Ipl1p-Sli15p-Bir1p-Nbl1p),
           involved in regulating kinetochore-microtubule
           attachments; helps maintain condensed chromosomes during
           anaphase and early telophase; required for SPB cohesion
           and prevention of multipolar spindle formation
          Length = 367

 Score =  153 bits (386), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 90/268 (33%), Positives = 146/268 (54%), Gaps = 23/268 (8%)

Query: 35  VQLAQHERTGHRTAVKVISKSIFNNNGNHSNDDSVLPYNIE----REIVIMKLLSHPNVL 90
           V   +H  TG+  A+KV+ K            + ++ YN++    RE+ I   L+HPN+ 
Sbjct: 118 VYCVRHRSTGYICALKVMEK------------EEIIKYNLQKQFRREVEIQTSLNHPNLT 165

Query: 91  SLYDVWETNNNLYLILEYAEKGELFNLLVDHGPLPEREAINCFRQIIIGISYCHALGIVH 150
             Y  +     +YL++EY   GE++ LL  HGP  +  A +   QI   + Y H   I+H
Sbjct: 166 KSYGYFHDEKRVYLLMEYLVNGEMYKLLRLHGPFNDILASDYIYQIANALDYMHKKNIIH 225

Query: 151 RDLKPENLLLDSFYNIKIADFGMAALQTDADLLETSCGSPHYAAPEIVSGLPYEGFASDV 210
           RD+KPEN+L+     IK+ DFG + +    +  +T CG+  Y +PE+V    Y+    D 
Sbjct: 226 RDIKPENILIGFNNVIKLTDFGWSIINPPENRRKTVCGTIDYLSPEMVESREYDH-TIDA 284

Query: 211 WSCGVILFALLTGRLPFDEENGNVRDLLLK-VQKGQFEMPNDTEISRDAQDLIGKILVVD 269
           W+ GV+ F LLTG  PF+EE   ++D   K +     +MP++  IS+DAQDLI K+L  D
Sbjct: 285 WALGVLAFELLTGAPPFEEE---MKDTTYKRIAALDIKMPSN--ISQDAQDLILKLLKYD 339

Query: 270 PRQRIKIRDILSHPLLKKYQTIKDSKSI 297
           P+ R+++ D+  HP + + +   ++K +
Sbjct: 340 PKDRMRLGDVKMHPWILRNKPFWENKRL 367

>Ecym_2405 Chr2 (788655..791222) [2568 bp, 855 aa] {ON} similar to
           Ashbya gossypii ACR133C
          Length = 855

 Score =  160 bits (406), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 95/276 (34%), Positives = 139/276 (50%), Gaps = 22/276 (7%)

Query: 18  IGPWKLGETLGFGSTGKVQLAQHERTGHRTAVKVISKSIFNNNGNHSNDDSVLPYNIERE 77
           +G +K+ + +G GS GKV LA H+ T  +  +K   K                  N+ RE
Sbjct: 34  VGNYKILKQVGEGSFGKVYLANHKLTHQKVVLKTGEKK---------------DPNVVRE 78

Query: 78  IVIMKLLSHPNVLSLYDVWETNNNLYLILEYAEKGELFNLLVDHGPLPEREAINCFRQII 137
           +   +    P +  LY+V  T + +++ LEY    EL++ L+    +P  E    F QI+
Sbjct: 79  VFYHRQFDFPFITKLYEVIVTESKVWMALEYCPGNELYDYLLQKQRIPLDETSKLFAQIV 138

Query: 138 IGISYCHALGIVHRDLKPENLLLDSFYNIKIADFGMAALQTDADLLETSCGSPHYAAPEI 197
             + Y H+L  VHRDLK EN+LLD      + DFG          LET CG+  Y APE+
Sbjct: 139 GAVFYAHSLQCVHRDLKLENILLDKQGYAMLTDFGFTRECATKTQLETICGTTVYMAPEL 198

Query: 198 VSGLPYEGFASDVWSCGVILFALLTGRLPFDEENGNVRDLLLKVQKGQFEMPN--DTEIS 255
           +    Y+G+  D WS G+IL+ +L G +PFDEE+  +  L     K   EMP   D   +
Sbjct: 199 IKRESYDGYKVDTWSLGIILYTMLHGFMPFDEEDPTLTGL-----KIMNEMPPIVDAYTN 253

Query: 256 RDAQDLIGKILVVDPRQRIKIRDILSHPLLKKYQTI 291
             A+DLI K+L   P +R  +  +L HP L+ Y TI
Sbjct: 254 VHAKDLILKLLRKTPSERPSLNKVLEHPFLQPYGTI 289

>Kpol_1072.19 s1072 (44906..47596) [2691 bp, 896 aa] {ON}
           (44906..47596) [2691 nt, 897 aa]
          Length = 896

 Score =  160 bits (406), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 91/271 (33%), Positives = 144/271 (53%), Gaps = 18/271 (6%)

Query: 18  IGPWKLGETLGFGSTGKVQLAQHERTGHRTAVKVISKSIFNNNGNHSNDDSVLPYNIERE 77
           +G +K+ + +G GS GKV LA H+ T H+   KV+ KS           D   P N+ RE
Sbjct: 36  VGNYKILKQIGEGSFGKVYLALHKPT-HK---KVVLKS----------SDKTDP-NVVRE 80

Query: 78  IVIMKLLSHPNVLSLYDVWETNNNLYLILEYAEKGELFNLLVDHGPLPEREAINCFRQII 137
           I   +    P +  LY+V  T   +++++EY    EL++ L+    +   E+   F QI+
Sbjct: 81  IFYHRQFDFPYITKLYEVIITETKVWMVIEYCPNKELYDYLLSKKRISLDESARIFAQIV 140

Query: 138 IGISYCHALGIVHRDLKPENLLLDSFYNIKIADFGMAALQTDADLLETSCGSPHYAAPEI 197
             + Y H+L  VHRDLK EN+LLD   N K+ DFG     +    LET CG+  Y APE+
Sbjct: 141 GAVYYAHSLSCVHRDLKLENILLDKDNNAKLTDFGFTRDFSKNTQLETICGTTVYMAPEL 200

Query: 198 VSGLPYEGFASDVWSCGVILFALLTGRLPFDEENGNVRDLLLKVQKGQFEMPNDTEISRD 257
           +    Y+G+  D+W+ G++L+ ++ G +PFDE++    +L +      ++   +   + D
Sbjct: 201 LRREKYDGYKIDIWALGILLYTIINGTMPFDEDDPKKTELKIISASPDYD---NKYFNDD 257

Query: 258 AQDLIGKILVVDPRQRIKIRDILSHPLLKKY 288
           + DL+ ++L  DP  R  I  IL HP L  Y
Sbjct: 258 SIDLVNRLLSKDPSMRPTIEQILMHPFLASY 288

>Skud_16.132 Chr16 (239797..242571) [2775 bp, 924 aa] {ON} YPL150W
           (REAL)
          Length = 924

 Score =  160 bits (406), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 98/294 (33%), Positives = 150/294 (51%), Gaps = 30/294 (10%)

Query: 18  IGPWKLGETLGFGSTGKVQLAQHERTGHRTAVKVISKSIFNNNGNHSNDDSVLPYNIERE 77
           +G +K+ + +G GS GKV LA H  T  +  +K   K          ND      NI RE
Sbjct: 38  VGNYKILKQIGEGSFGKVYLALHRPTHRKVCLKTSDK----------NDP-----NIVRE 82

Query: 78  IVIMKLLSHPNVLSLYDVWETNNNLYLILEYAEKGELFNLLVDHGPLPEREAINCFRQII 137
           +   +    P +  LY+V  T + +++ LEY    EL++ L+    +   E    F QI 
Sbjct: 83  VFYHRQFDFPYITKLYEVIVTESKVWMALEYCPGKELYDHLLSLHRISLLECGELFAQIS 142

Query: 138 IGISYCHALGIVHRDLKPENLLLDSFYNIKIADFGMAALQTDADLLETSCGSPHYAAPEI 197
             + Y H++  VHRDLK EN+LLD   N K+ DFG          LET CG+  Y APE+
Sbjct: 143 GAVYYAHSMHCVHRDLKLENILLDKNGNAKLTDFGFTRECMTKTTLETVCGTTVYMAPEL 202

Query: 198 VSGLPYEGFASDVWSCGVILFALLTGRLPFDEENGNVRDLLLKVQKGQFEMPNDTE---- 253
           +    Y+GF  D WS GVIL+ L+TG LPFD+++           K ++++ N+      
Sbjct: 203 IGRKTYDGFKIDTWSLGVILYTLITGSLPFDDDDE---------AKTKWKIVNEEPKYDP 253

Query: 254 --ISRDAQDLIGKILVVDPRQRIKIRDILSHPLLKKYQTIKDSKSIKDLPRENT 305
             I  DA+DLI ++L  +P +R  +  +L HP L+ Y ++   ++ K L R+ +
Sbjct: 254 KLIPDDAKDLISRLLAKNPGERPSLPQVLRHPFLQPYGSVVLDQTEKILCRQRS 307

>KLLA0F11143g Chr6 complement(1026129..1028570) [2442 bp, 813 aa]
           {ON} similar to uniprot|P22216 Saccharomyces cerevisiae
           YPL153C RAD53 Protein kinase required for cell-cycle
           arrest in response to DNA damage activated by trans
           autophosphorylation when interacting with
           hyperphosphorylated Rad9p
          Length = 813

 Score =  160 bits (404), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 90/272 (33%), Positives = 150/272 (55%), Gaps = 24/272 (8%)

Query: 27  LGFGSTGKVQLAQHERTGHRTAVKVISKSIFNNNGNHSNDDSVLPYNIEREIVIMKLLSH 86
           +G G+   V+ A    TG   AVK+I K    +  +           ++RE+ +++ L+H
Sbjct: 198 VGQGAFATVKKAVERSTGKTFAVKIIHKRKVMDKFD----------GVKRELDVLQKLNH 247

Query: 87  PNVLSLYDVWETNNNLYLILEYAEKGELFNLLVDHGPLPEREAINCFRQIIIGISYCHAL 146
           P ++ L D +E N+N Y+++E+   G+L + +  HG + E       RQ++  + Y H  
Sbjct: 248 PRIVKLKDFFEDNDNYYMLMEFVSGGDLMDFVAAHGTVGEDAGREITRQVLEAVKYMHDQ 307

Query: 147 GIVHRDLKPENLLL--DSFYNIKIADFGMAALQTDADLLETSCGSPHYAAPEIVSGLPYE 204
           GI HRDLKP+N+++  D    IKI DFG+A +Q     L T CG+  Y APE++ G   E
Sbjct: 308 GISHRDLKPDNIMIEQDDPVLIKITDFGLAKVQNQNTFLNTFCGTLAYVAPEVIDGKNAE 367

Query: 205 G------FAS--DVWSCGVILFALLTGRLPFDEENGNVRDLLLKVQKGQF-EMP-NDTEI 254
                  ++S  D+WS G +++ +LTG LPF  ++ N  +L  ++++G + E P  D  I
Sbjct: 368 DKTNRDLYSSLVDMWSIGCLVYVILTGHLPFSGQSQN--ELFKQIKRGSYHEGPLKDYRI 425

Query: 255 SRDAQDLIGKILVVDPRQRIKIRDILSHPLLK 286
           S +A++ I  +L VDP++R+     L HP +K
Sbjct: 426 SEEARNFIDCLLNVDPKERMNAGKALQHPWMK 457

>YPL153C Chr16 complement(261727..264192) [2466 bp, 821 aa] {ON}
           RAD53Protein kinase, required for cell-cycle arrest in
           response to DNA damage; activated by trans
           autophosphorylation when interacting with
           hyperphosphorylated Rad9p; also interacts with ARS1 and
           plays a role in initiation of DNA replication
          Length = 821

 Score =  160 bits (404), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 97/281 (34%), Positives = 153/281 (54%), Gaps = 34/281 (12%)

Query: 25  ETLGFGSTGKVQLAQHERTGHRTAVKVISKS--IFNNNGNHSNDDSVLPYNIEREIVIMK 82
           E +G G+   V+ A    TG   AVK+ISK   I N +G            + RE+ +++
Sbjct: 202 EVVGQGAFATVKKAIERTTGKTFAVKIISKRKVIGNMDG------------VTRELEVLQ 249

Query: 83  LLSHPNVLSLYDVWETNNNLYLILEYAEKGELFNLLVDHGPLPEREAINCFRQIIIGISY 142
            L+HP ++ L   +E   + Y+++E+   G+L + +  HG + E       RQI+  I Y
Sbjct: 250 KLNHPRIVRLKGFYEDTESYYMVMEFVSGGDLMDFVAAHGAVGEDAGREISRQILTAIKY 309

Query: 143 CHALGIVHRDLKPENLLL--DSFYNIKIADFGMAALQTDADLLETSCGSPHYAAPEIVSG 200
            H++GI HRDLKP+N+L+  D    +KI DFG+A +Q +   ++T CG+  Y APE++ G
Sbjct: 310 IHSMGISHRDLKPDNILIEQDDPVLVKITDFGLAKVQGNGSFMKTFCGTLAYVAPEVIRG 369

Query: 201 L-------PYE---GFAS--DVWSCGVILFALLTGRLPFDEENGNVRDLLLK-VQKGQF- 246
                    YE    ++S  D+WS G +++ +LTG LPF   +G+ +D L K + +G + 
Sbjct: 370 KDTSVSPDEYEERNEYSSLVDMWSMGCLVYVILTGHLPF---SGSTQDQLYKQIGRGSYH 426

Query: 247 EMP-NDTEISRDAQDLIGKILVVDPRQRIKIRDILSHPLLK 286
           E P  D  IS +A+D I  +L VDP  R      L+HP +K
Sbjct: 427 EGPLKDFRISEEARDFIDSLLQVDPNNRSTAAKALNHPWIK 467

>Smik_6.347 Chr6 complement(553316..556069) [2754 bp, 917 aa] {ON}
           YPL150W (REAL)
          Length = 917

 Score =  160 bits (405), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 100/289 (34%), Positives = 152/289 (52%), Gaps = 20/289 (6%)

Query: 18  IGPWKLGETLGFGSTGKVQLAQHERTGHRTAVKVISKSIFNNNGNHSNDDSVLPYNIERE 77
           +G +K+ + +G GS GKV LA H  T  +  +K   K          ND      NI RE
Sbjct: 38  VGNYKILKQIGEGSFGKVYLALHRPTHRKVCLKTSDK----------NDP-----NIVRE 82

Query: 78  IVIMKLLSHPNVLSLYDVWETNNNLYLILEYAEKGELFNLLVDHGPLPEREAINCFRQII 137
           +   +    P +  LY+V  T + +++ LEY    EL++ L+    L   E    F QI 
Sbjct: 83  VFYHRQFDFPYITKLYEVIVTESKVWMALEYCPGKELYDHLLSLRRLSLLECGELFAQIS 142

Query: 138 IGISYCHALGIVHRDLKPENLLLDSFYNIKIADFGMAALQTDADLLETSCGSPHYAAPEI 197
             + Y H++  VHRDLK EN+LLD   N K+ DFG          LET CG+  Y APE+
Sbjct: 143 GAVYYAHSMHCVHRDLKLENILLDRNGNAKLTDFGFTRECMTKTTLETVCGTTVYMAPEL 202

Query: 198 VSGLPYEGFASDVWSCGVILFALLTGRLPFDEENGNVRDLLLKVQKGQFEMPNDTE-ISR 256
           +    Y+GF  D+WS GVIL+ L+TG LPFD+++    ++  K +    E   D++ I  
Sbjct: 203 IERKTYDGFKIDIWSLGVILYTLITGYLPFDDDD----EVKTKWKIVNEEPKYDSKFIPD 258

Query: 257 DAQDLIGKILVVDPRQRIKIRDILSHPLLKKYQTIKDSKSIKDLPRENT 305
           DA+DLI ++L  +P +R  +  +L HP L+ Y ++   ++ K L R+ +
Sbjct: 259 DAKDLISRLLAKNPGERPSLPQVLRHPFLQPYGSVVLDQTEKILCRQRS 307

>CAGL0E05720g Chr5 (569265..570341) [1077 bp, 358 aa] {ON} similar
           to uniprot|P38991 Saccharomyces cerevisiae YPL209c IPL1
           ser/thr protein kinase
          Length = 358

 Score =  152 bits (383), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 90/272 (33%), Positives = 150/272 (55%), Gaps = 23/272 (8%)

Query: 21  WKLGETLGFGSTGKVQLAQHERTGHRTAVKVISKSIFNNNGNHSNDDSVLPYNI----ER 76
           +++G  LG G  GKV   +H+++G   A+K I K            + +L +N+    +R
Sbjct: 100 FEVGRKLGKGKFGKVYCVRHKKSGFICALKAIEK------------NEILQFNLLKQLKR 147

Query: 77  EIVIMKLLSHPNVLSLYDVWETNNNLYLILEYAEKGELFNLLVDHGPLPEREAINCFRQI 136
           E+ I   + HPN++ LY  +     +YL++E++  GEL+  L ++GP  +  A +   QI
Sbjct: 148 EVDIQLGMDHPNIIKLYAHFHDEKRVYLLMEHSINGELYKSLKNNGPFNDVLASHYIYQI 207

Query: 137 IIGISYCHALGIVHRDLKPENLLLDSFYNIKIADFGMAALQTDADLLETSCGSPHYAAPE 196
              + Y H   I+HRD+KPEN+L+     +K+ADFG + L  +    +T CG+  Y +PE
Sbjct: 208 ADALHYMHKKRIIHRDVKPENVLIGFDNVVKLADFGWSILNPEGSKRKTLCGTIDYLSPE 267

Query: 197 IVSGLPYEGFASDVWSCGVILFALLTGRLPFDEENGNVRDLLLK-VQKGQFEMPNDTEIS 255
           +++   Y+    DVW+ GV+ + L+ G  PF+E   N ++L  K + K     P    IS
Sbjct: 268 MITPREYDE-QVDVWALGVLAYELVVGVPPFEE---NSKELTYKRILKCDLNFPES--IS 321

Query: 256 RDAQDLIGKILVVDPRQRIKIRDILSHPLLKK 287
           +DA+DLI K+LV D  QR+ +  + +HP + K
Sbjct: 322 KDAKDLISKLLVTDTTQRLSLTGVKTHPWILK 353

>TBLA0A02050 Chr1 (495735..497039) [1305 bp, 434 aa] {ON} 
          Length = 434

 Score =  154 bits (388), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 90/273 (32%), Positives = 151/273 (55%), Gaps = 24/273 (8%)

Query: 21  WKLGETLGFGSTGKVQLAQHERTGHRTAVKVISKSIFNNNGNHSNDDSVLPYNIE----R 76
           +++G  LG G  GKV   +H+++G  +A+KV+ K              ++ YN E    R
Sbjct: 175 FEIGRGLGKGKFGKVYCVKHKQSGFISALKVMKKK------------EIVSYNAEKQFKR 222

Query: 77  EIVIMKLLSHPNVLSLYDVWETNNNLYLILEYAEKGELF-NLLVDHGPLPEREAINCFRQ 135
           E+ +   L+HPN++ ++  ++    +YLI+EY   GEL+ +L  ++GP  +  A N   Q
Sbjct: 223 EVEVQNSLNHPNIVKIFGFFQDEIFVYLIMEYLINGELYKSLKNNNGPFNDILASNYIYQ 282

Query: 136 IIIGISYCHALGIVHRDLKPENLLLDSFYNIKIADFGMAALQTDADLLETSCGSPHYAAP 195
           I   + Y H+  I+HRD+KPEN++L     IK+ADFG +         +T CG+  Y AP
Sbjct: 283 IADALKYMHSKHIIHRDIKPENIVLGFNNKIKLADFGWSICTPPNLRRKTICGTIDYLAP 342

Query: 196 EIVSGLPYEGFASDVWSCGVILFALLTGRLPFDEENGNVRDLLLK-VQKGQFEMPNDTEI 254
           E+V+   Y+ +  D+W+ G++ + L+ G  PF+EE    +DL  K +       P    +
Sbjct: 343 ELVTFKEYD-YNVDIWALGILTYELIVGNPPFEEE---TKDLTYKRIINVDLNFPQ--TV 396

Query: 255 SRDAQDLIGKILVVDPRQRIKIRDILSHPLLKK 287
           S DA+DLI ++L  DP +R+ + D++ HP + K
Sbjct: 397 SMDARDLITRLLRFDPSKRMPLVDVMKHPWITK 429

>Skud_16.70 Chr16 complement(129918..131021) [1104 bp, 367 aa] {ON}
           YPL209C (REAL)
          Length = 367

 Score =  152 bits (383), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 85/267 (31%), Positives = 144/267 (53%), Gaps = 21/267 (7%)

Query: 35  VQLAQHERTGHRTAVKVISKSIFNNNGNHSNDDSVLPYNIER----EIVIMKLLSHPNVL 90
           V   +H+ TG+  A+KV+ K            + ++ YN++R    E+ I   L+HPN+ 
Sbjct: 118 VYCVRHKSTGYICALKVMEK------------EEIIRYNLQRQFRREVEIQMSLNHPNLT 165

Query: 91  SLYDVWETNNNLYLILEYAEKGELFNLLVDHGPLPEREAINCFRQIIIGISYCHALGIVH 150
             Y  +     +YL++EY   GE++ LL  HGP  +  A +   QI   + Y H   I+H
Sbjct: 166 KSYGYFHDEKRVYLLMEYLVNGEMYKLLRSHGPFNDILASDYIYQIANALDYMHKKNIIH 225

Query: 151 RDLKPENLLLDSFYNIKIADFGMAALQTDADLLETSCGSPHYAAPEIVSGLPYEGFASDV 210
           RD+KPEN+L+     IK+ DFG + +       +T CG+  Y +PE++    Y+    D 
Sbjct: 226 RDIKPENILIGFNNTIKLTDFGWSIINPPESRRKTVCGTIDYLSPEMIESREYDH-TIDA 284

Query: 211 WSCGVILFALLTGRLPFDEENGNVRDLLLKVQKGQFEMPNDTEISRDAQDLIGKILVVDP 270
           W+ G++ F LLTG  PF+EE   ++D   K +    ++   + +S+DAQDLI K+L  DP
Sbjct: 285 WALGILAFELLTGAPPFEEE---MKDTTYK-RIAALDIKIPSNVSQDAQDLILKLLKYDP 340

Query: 271 RQRIKIRDILSHPLLKKYQTIKDSKSI 297
           + R+++ D+  HP + + +   ++K +
Sbjct: 341 KDRMRLEDVKMHPWILRNKPFWENKRL 367

>KAFR0H02430 Chr8 complement(464446..466800) [2355 bp, 784 aa] {ON}
           Anc_8.676 YPL153C
          Length = 784

 Score =  159 bits (402), Expect = 3e-39,   Method: Compositional matrix adjust.
 Identities = 94/277 (33%), Positives = 152/277 (54%), Gaps = 28/277 (10%)

Query: 25  ETLGFGSTGKVQLAQHERTGHRTAVKVISKSIFNNNGNHSNDDSVLPYNIEREIVIMKLL 84
           E +G G+   V+ A    TG   AVK+I+K     N +           + RE+ ++K L
Sbjct: 191 EVVGQGAFATVKKAVERTTGKTYAVKIINKRKVMGNLD----------GVTRELEVLKRL 240

Query: 85  SHPNVLSLYDVWETNNNLYLILEYAEKGELFNLLVDHGPLPEREAINCFRQIIIGISYCH 144
           +HP ++SL   +E N + Y+++E+   G+L + +  HG + E       RQI+  + Y H
Sbjct: 241 NHPRIVSLKGFYEDNESYYMVMEFVSGGDLMDFVAAHGAVGEDAGKEISRQILEAVKYIH 300

Query: 145 ALGIVHRDLKPENLLL--DSFYNIKIADFGMAALQTDADLLETSCGSPHYAAPEIV-SGL 201
           ++GI HRDLKP+N+L+  D    +KI DFG+A +Q +   ++T CG+  Y APE++ S  
Sbjct: 301 SMGISHRDLKPDNILIEQDDPVLVKITDFGLAKVQGNGTFMKTFCGTLAYVAPEVIGSSS 360

Query: 202 PY-------EGFAS--DVWSCGVILFALLTGRLPFDEENGNVRDLLLK-VQKGQF-EMP- 249
            Y         ++S  D+WS G +++ +LTG LPF   +G+ ++ L K + +G + E P 
Sbjct: 361 KYNEEDEERNEYSSLVDMWSMGCLVYVILTGHLPF---SGSTQEQLYKQISRGSYHEGPL 417

Query: 250 NDTEISRDAQDLIGKILVVDPRQRIKIRDILSHPLLK 286
            D  IS +A+D I  +L VDP  R+     L HP +K
Sbjct: 418 KDYRISDEARDFIDSLLQVDPSNRLTAARALEHPWIK 454

>Suva_16.157 Chr16 complement(270891..273389) [2499 bp, 832 aa] {ON}
           YPL153C (REAL)
          Length = 832

 Score =  159 bits (402), Expect = 3e-39,   Method: Compositional matrix adjust.
 Identities = 96/281 (34%), Positives = 152/281 (54%), Gaps = 34/281 (12%)

Query: 25  ETLGFGSTGKVQLAQHERTGHRTAVKVISKS--IFNNNGNHSNDDSVLPYNIEREIVIMK 82
           E +G G+   V+ A    TG   AVK+ISK   I N +G            + RE+ +++
Sbjct: 202 EVVGQGAFATVKKAIERTTGKTFAVKIISKRKVIGNMDG------------VTRELEVLQ 249

Query: 83  LLSHPNVLSLYDVWETNNNLYLILEYAEKGELFNLLVDHGPLPEREAINCFRQIIIGISY 142
            L HP ++ L   +E   + Y+++E+   G+L + +  HG + E       RQI+  + Y
Sbjct: 250 KLHHPRIVRLKGFYEDTESYYMVMEFVSGGDLMDFVAAHGAVGEDAGREISRQILEAVKY 309

Query: 143 CHALGIVHRDLKPENLLL--DSFYNIKIADFGMAALQTDADLLETSCGSPHYAAPEIVSG 200
            H++GI HRDLKP+N+L+  D    +KI DFG+A +Q +   ++T CG+  Y APE++ G
Sbjct: 310 IHSMGISHRDLKPDNILIEQDDPVLVKITDFGLAKVQGNGSFMKTFCGTLAYVAPEVIRG 369

Query: 201 L-------PYE---GFAS--DVWSCGVILFALLTGRLPFDEENGNVRDLLLK-VQKGQF- 246
                    YE    ++S  D+WS G +++ +LTG LPF   +G+ +D L K + +G + 
Sbjct: 370 KDSSVSPDEYEERNEYSSLVDMWSMGCLVYVILTGHLPF---SGSTQDQLYKQIGRGSYH 426

Query: 247 EMP-NDTEISRDAQDLIGKILVVDPRQRIKIRDILSHPLLK 286
           E P  D  IS +A+D I  +L VDP  R+     L HP +K
Sbjct: 427 EGPLKDFRISEEARDFIDSLLQVDPNNRLTAAKALCHPWIK 467

>Kwal_56.24091 s56 (845680..846825) [1146 bp, 381 aa] {ON} YPL209C
           (IPL1) - Protein kinase [contig 166] FULL
          Length = 381

 Score =  152 bits (384), Expect = 3e-39,   Method: Compositional matrix adjust.
 Identities = 86/258 (33%), Positives = 138/258 (53%), Gaps = 23/258 (8%)

Query: 35  VQLAQHERTGHRTAVKVISKSIFNNNGNHSNDDSVLPYNIE----REIVIMKLLSHPNVL 90
           V   +H+RTG   A+K + KS             ++ YN++    RE+ I   L HPN+ 
Sbjct: 137 VYCVKHKRTGFICALKAMKKS------------EIVQYNVQKQFRREVEIQSSLKHPNLT 184

Query: 91  SLYDVWETNNNLYLILEYAEKGELFNLLVDHGPLPEREAINCFRQIIIGISYCHALGIVH 150
            LY  +     +YL++EY   GEL+  L  HGP  +  A +   Q+   ++Y H+  I+H
Sbjct: 185 RLYGYFHDEKRVYLLMEYLVNGELYKHLRSHGPFNDITASHFVHQMADALNYMHSKNILH 244

Query: 151 RDLKPENLLLDSFYNIKIADFGMAALQTDADLLETSCGSPHYAAPEIVSGLPYEGFASDV 210
           RD+KPEN+LL     +K+ DFG +         +T CG+  Y +PE++    Y+    DV
Sbjct: 245 RDIKPENILLGFQNTLKLTDFGWSVSNVGNSKRKTLCGTMDYLSPELIKSREYDN-KVDV 303

Query: 211 WSCGVILFALLTGRLPFDEENGNVRDLLLK-VQKGQFEMPNDTEISRDAQDLIGKILVVD 269
           W+ GV+ + LL G  PF+E+    ++L  K + K     P+  ++S  A+DLI ++L  D
Sbjct: 304 WALGVLTYELLVGSPPFEED---TKELTYKRIIKRDLRFPD--QVSPHARDLISRLLEYD 358

Query: 270 PRQRIKIRDILSHPLLKK 287
           P+ RI ++D+  HP +KK
Sbjct: 359 PQNRIPLKDVKRHPWIKK 376

>Smik_4.135 Chr4 complement(256861..258402) [1542 bp, 513 aa] {ON}
           YDL101C (REAL)
          Length = 513

 Score =  155 bits (391), Expect = 3e-39,   Method: Compositional matrix adjust.
 Identities = 101/317 (31%), Positives = 157/317 (49%), Gaps = 40/317 (12%)

Query: 1   MTVANTETHSAAKPSSTIGPWKLGETLGFGSTGKVQLAQHERTGHRTAVKVISKSIFNNN 60
           +T + T   S  KP S    + LG+ LG G    V+ A++++TG + AVK+         
Sbjct: 180 ITGSVTRKSSKTKPVSFFDKYLLGKELGSGHYALVKEAKNKKTGQQVAVKIFHA------ 233

Query: 61  GNHSNDDSVLPYNIEREIVIMKLLSHPNVLSLYD-----VWETNNNLYLILEYAEKGELF 115
               NDD         E  I+  + HPN+++L D     + ++    YL+LE  + GELF
Sbjct: 234 --QQNDDQKKNKQFREETNILMRVQHPNIVNLLDSFVEPISKSQIQKYLVLEKIDDGELF 291

Query: 116 NLLVDHGPLPEREAINCFRQIIIGISYCHALGIVHRDLKPENLLLDSF------------ 163
             +V    L + E+   F+Q++ G+ Y H   I+HRD+KPEN+LL+              
Sbjct: 292 ERIVRKTCLRQDESKALFKQLLTGLKYLHEQNIIHRDIKPENVLLNITRRKNSSQVQLGP 351

Query: 164 -------YNIKIADFGMAALQTDADLLETSCGSPHYAAPEIVSGLPYEGFAS--DVWSCG 214
                    +KIADFG+A    +     T CG+P Y APE+   L  +G+ S  D+WS G
Sbjct: 352 WDEDEIDIQVKIADFGLAKFTGEMQFTNTLCGTPSYVAPEV---LTKKGYTSKVDLWSAG 408

Query: 215 VILFALLTGRLPFDEENG--NVRDLLLKVQKGQFEMPNDTEISRDAQDLIGKILVVDPRQ 272
           VIL+  L G  PF ++ G  ++++ +L+  K  F  P   +I      LI  +LV++P +
Sbjct: 409 VILYVCLCGFPPFSDQLGPPSLKEQILQA-KYAFYSPYWDKIDDSVLHLISNLLVLNPDE 467

Query: 273 RIKIRDILSHPLLKKYQ 289
           R  I D ++HP  K  Q
Sbjct: 468 RYNIDDAMNHPWFKDTQ 484

>NDAI0G05300 Chr7 (1289208..1290521) [1314 bp, 437 aa] {ON}
           Anc_1.374
          Length = 437

 Score =  153 bits (386), Expect = 4e-39,   Method: Compositional matrix adjust.
 Identities = 98/291 (33%), Positives = 159/291 (54%), Gaps = 16/291 (5%)

Query: 3   VANTETHSAAKPSSTIGP--WKLGETLGFGSTGKVQLAQHERTGHRTAVKVISKSIFNNN 60
           VA      + +P+S +    +  G+TLG G+ G V+ A+   TG   AVK++ K     N
Sbjct: 32  VAKFLNKMSGQPASYVNKTNYIFGKTLGAGTFGVVRQARKLTTGEDVAVKILLKKALKGN 91

Query: 61  GNHSNDDSVLPYNIEREIVIMKLLSHPNVLSLYDVWETNNNLYLILEYAEKGELFNLLVD 120
               N    + Y+   E+ I++ L HPN+++  D +E+ +  Y++ + A  GELF+ ++ 
Sbjct: 92  ----NVQLQMLYD---ELAILQKLHHPNIVAFKDWFESKDKFYIVTQLATGGELFDRIIK 144

Query: 121 HGPLPEREAINCFRQIIIGISYCHALGIVHRDLKPENLL-LDSFYN--IKIADFGMAA-L 176
            G   E +A++   Q+I  +SY H+  IVHRDLKPEN+L LD+  N  + IADFG+A  L
Sbjct: 145 KGKFSEVDAVSIMVQLISAVSYIHSQNIVHRDLKPENVLYLDNSDNSQLVIADFGIAKEL 204

Query: 177 QTDADLLETSCGSPHYAAPEIVSGLPYEGFASDVWSCGVILFALLTGRLPFDEEN--GNV 234
           +++ DL+    GS  Y APE+++   + G   D+WS GVI + LL+G   F  E+  G +
Sbjct: 205 KSNDDLIFKGAGSLGYVAPEVLTREGH-GKPCDIWSLGVITYTLLSGYSAFIAESVEGFL 263

Query: 235 RDLLLKVQKGQFEMPNDTEISRDAQDLIGKILVVDPRQRIKIRDILSHPLL 285
            +        +F  P    IS++A+D I + L +DP  R    ++L  P +
Sbjct: 264 EECTRSTYPVKFHSPYWDNISQEAKDFILRALTIDPNDRPTAEELLQDPWI 314

>Kpol_1065.3 s1065 complement(4445..5575) [1131 bp, 376 aa] {ON}
           complement(4445..5575) [1131 nt, 377 aa]
          Length = 376

 Score =  151 bits (382), Expect = 4e-39,   Method: Compositional matrix adjust.
 Identities = 88/268 (32%), Positives = 148/268 (55%), Gaps = 15/268 (5%)

Query: 21  WKLGETLGFGSTGKVQLAQHERTGHRTAVKVISK-SIFNNNGNHSNDDSVLPYNIEREIV 79
           +++G  LG G  GKV   +H+ +G   A+KV++K  I N N         +    +REI 
Sbjct: 118 FEIGRKLGKGKFGKVYCVRHKPSGLICALKVMNKMEIVNFN---------VQKQFKREID 168

Query: 80  IMKLLSHPNVLSLYDVWETNNNLYLILEYAEKGELFNLLVDHGPLPEREAINCFRQIIIG 139
           I   L+H N+  LY  +  + N+YL++EY   GEL+ LL  +GP+ +  A N   Q+   
Sbjct: 169 IQYHLNHKNLTKLYAFFHDSKNVYLVMEYLIGGELYKLLKKNGPMNDITASNYVYQMTDA 228

Query: 140 ISYCHALGIVHRDLKPENLLLDSFYNIKIADFGMAALQTDADLLETSCGSPHYAAPEIVS 199
           ++Y H   I+HRDLKPEN+L+     IK+ DFG +    +    +T CG+  Y +PE++S
Sbjct: 229 LNYMHKRKIIHRDLKPENILIGFNNQIKLTDFGWSIYNPNNQKRKTLCGTIDYLSPELIS 288

Query: 200 GLPYEGFASDVWSCGVILFALLTGRLPFDEENGNVRDLLLKVQKGQFEMPNDTEISRDAQ 259
              Y+    DVW+ G++ + L+ G  PF+E+         ++ K   + P +  +S +A+
Sbjct: 289 SREYDE-NVDVWALGILTYELVVGAPPFEEDTK--EQTYKRIAKSDLKFPPN--VSSEAR 343

Query: 260 DLIGKILVVDPRQRIKIRDILSHPLLKK 287
           DLI  +L V P +R  ++ +++HP ++K
Sbjct: 344 DLITNLLKVVPSERFNLQQVMNHPWIEK 371

>Skud_16.129 Chr16 complement(233341..235824) [2484 bp, 827 aa] {ON}
           YPL153C (REAL)
          Length = 827

 Score =  158 bits (400), Expect = 5e-39,   Method: Compositional matrix adjust.
 Identities = 96/283 (33%), Positives = 154/283 (54%), Gaps = 34/283 (12%)

Query: 23  LGETLGFGSTGKVQLAQHERTGHRTAVKVISKS--IFNNNGNHSNDDSVLPYNIEREIVI 80
           + E +G G+   V+ A    TG   AVK+ISK   I N +G            + RE+ +
Sbjct: 200 IDEVVGQGAFATVKKAIERTTGKTFAVKIISKRKVIGNMDG------------VTRELEV 247

Query: 81  MKLLSHPNVLSLYDVWETNNNLYLILEYAEKGELFNLLVDHGPLPEREAINCFRQIIIGI 140
           ++ L+HP ++ L   +E   + Y+++E+   G+L + +  HG + E       RQI+  +
Sbjct: 248 LQKLNHPRIVRLKGFYEDAESYYMVMEFVSGGDLMDFVAAHGAVGEDAGREISRQILAAV 307

Query: 141 SYCHALGIVHRDLKPENLLL--DSFYNIKIADFGMAALQTDADLLETSCGSPHYAAPEIV 198
            Y H++GI HRDLKP+N+L+  D    +KI DFG+A +Q +   ++T CG+  Y APE++
Sbjct: 308 KYIHSMGISHRDLKPDNILIEQDDPVLVKITDFGLAKVQGNGSFMKTFCGTLAYVAPEVI 367

Query: 199 SG-----LPYEG-----FAS--DVWSCGVILFALLTGRLPFDEENGNVRDLLLK-VQKGQ 245
            G      P E      ++S  D+WS G +++ +LTG LPF   +G+ +D L K + +G 
Sbjct: 368 RGKDSSVSPDECEERNEYSSLVDMWSMGCLVYVILTGHLPF---SGSTQDQLYKQIGRGS 424

Query: 246 F-EMP-NDTEISRDAQDLIGKILVVDPRQRIKIRDILSHPLLK 286
           + E P  D  IS +A+D I  +L VDP  R+     L HP +K
Sbjct: 425 YHEGPLKDFRISEEARDFIDLLLQVDPNNRLTAAKALDHPWIK 467

>KNAG0J01700 Chr10 (309962..312424) [2463 bp, 820 aa] {ON} 
          Length = 820

 Score =  158 bits (400), Expect = 5e-39,   Method: Compositional matrix adjust.
 Identities = 91/280 (32%), Positives = 146/280 (52%), Gaps = 31/280 (11%)

Query: 25  ETLGFGSTGKVQLAQHERTGHRTAVKVISKSIFNNNGNHSNDDSVLPYNIEREIVIMKLL 84
           E +G G+   V+ A    TG   AVK+I+K     N +           + RE+ +++ L
Sbjct: 206 EVVGQGAFATVKKAIETATGRTYAVKIINKRKVMGNLD----------GVTRELTVLQKL 255

Query: 85  SHPNVLSLYDVWETNNNLYLILEYAEKGELFNLLVDHGPLPEREAINCFRQIIIGISYCH 144
            HP++++L   +E  +N Y+++E+   G+L + +  HGP+ E       RQI+  + Y H
Sbjct: 256 DHPSIVTLKGFYEDKDNYYMVMEFVSGGDLMDFVAAHGPVGEDAGREITRQILEAVKYIH 315

Query: 145 ALGIVHRDLKPENLLL--DSFYNIKIADFGMAALQTDADLLETSCGSPHYAAPEIVSG-- 200
           ++GI HRDLKP+N+L+  D    +KI DFG+A +Q     + T CG+  Y APE+V+G  
Sbjct: 316 SVGISHRDLKPDNILIKQDDPVLVKITDFGLAKMQEHGAFMNTFCGTLAYVAPEVVNGRQ 375

Query: 201 ------LP------YEGFASDVWSCGVILFALLTGRLPFDEENGNVRDLLLKVQKGQF-E 247
                 +P      Y     D+WS G +++ +LTG LPF       + L  ++ K  + E
Sbjct: 376 QTSEPAVPKGERSHYSSLV-DMWSMGCLVYVILTGHLPF--SGSTPQQLYEQIGKASYHE 432

Query: 248 MP-NDTEISRDAQDLIGKILVVDPRQRIKIRDILSHPLLK 286
           +P  D  IS  A+D I  +L VDP  R+     L HP ++
Sbjct: 433 VPLKDCRISDQARDFIDCLLQVDPNNRLSAARALEHPWIQ 472

>NDAI0E02110 Chr5 complement(430989..433700) [2712 bp, 903 aa] {ON} 
          Length = 903

 Score =  157 bits (398), Expect = 1e-38,   Method: Compositional matrix adjust.
 Identities = 98/286 (34%), Positives = 148/286 (51%), Gaps = 34/286 (11%)

Query: 25  ETLGFGSTGKVQLAQHERTGHRTAVKVISKSIFNNNGNHSNDDSVLPYNIEREIVIMKLL 84
           E +G G+   V+ A    TG   AVK+ISK         SN D V      RE+ +++ L
Sbjct: 206 EVVGQGAFATVKKAVERSTGKTFAVKIISKRKVMG----SNMDGV-----SRELEVLQRL 256

Query: 85  SHPNVLSLYDVWETNNNLYLILEYAEKGELFNLLVDHGPLPEREAINCFRQIIIGISYCH 144
            HP ++ L   +E + N Y+++E+   G+L + +  HG + E       RQI+  I Y H
Sbjct: 257 DHPRIVRLKGFYEDHENYYMLMEFVSGGDLMDFVAAHGAVGEDAGREISRQILEAIKYIH 316

Query: 145 ALGIVHRDLKPENLLL--DSFYNIKIADFGMAALQTDADLLETSCGSPHYAAPEIVSGL- 201
           ++GI HRDLKP+N+L+  D    +KI DFG+A +Q +   ++T CG+  Y APEI+SG  
Sbjct: 317 SMGISHRDLKPDNILIEQDDPVLVKITDFGLAKVQDNGTFMKTFCGTLAYVAPEIISGKN 376

Query: 202 ---------------PYEGFASDVWSCGVILFALLTGRLPFDEENGNVRDLLLK-VQKGQ 245
                           Y     D+WS G +++ +LTG LPF   +G+ +  L K + +G 
Sbjct: 377 DGELRENADANSERNEYSSLV-DMWSMGCLVYVILTGHLPF---SGSTQKQLYKQISRGS 432

Query: 246 F-EMP-NDTEISRDAQDLIGKILVVDPRQRIKIRDILSHPLLKKYQ 289
           + E P  D  IS +A+D I  +L V P  R+     L HP +K  Q
Sbjct: 433 YHEGPLKDFRISDEARDFIDSLLQVKPNDRLTAEKALEHPWIKMAQ 478

>Kwal_56.23717 s56 complement(674222..676798) [2577 bp, 858 aa] {ON}
           YDR122W (KIN1) - Serine/threonine protein kinase [contig
           174] PARTIAL
          Length = 858

 Score =  157 bits (398), Expect = 1e-38,   Method: Compositional matrix adjust.
 Identities = 74/189 (39%), Positives = 117/189 (61%), Gaps = 4/189 (2%)

Query: 99  NNNLYLILEYAEKGELFNLLVDHGPLPEREAINCFRQIIIGISYCHALGIVHRDLKPENL 158
           +N+ Y++ EY   G+L + ++ HG L ER A    R I   + Y H   IVHRDLK EN+
Sbjct: 5   SNHFYMLFEYVSGGQLLDYIIQHGSLRERSARKFARGIASALQYLHMNNIVHRDLKIENI 64

Query: 159 LLDSFYNIKIADFGMAALQTDADLLETSCGSPHYAAPEIVSGLPYEGFASDVWSCGVILF 218
           ++ +   IKI DFG++ +      L T CGS ++AAPE++   PY G   DVWS GV+LF
Sbjct: 65  MISTSGEIKIIDFGLSNMYNPKKQLHTFCGSLYFAAPELLKACPYTGPEVDVWSFGVVLF 124

Query: 219 ALLTGRLPFDEENGNVRDLLLKVQKGQFEMPNDTEISRDAQDLIGKILVVDPRQRIKIRD 278
            L+ G++PFD+EN +V  L  K+++G+ E P    +S +   L+ K+LVVDP +R  ++ 
Sbjct: 125 VLVCGKVPFDDENSSV--LHEKIKQGKVEYPQ--HLSIEVISLLSKMLVVDPTKRASLKQ 180

Query: 279 ILSHPLLKK 287
           +++H  +++
Sbjct: 181 VVNHQWMQR 189

>ACR133C Chr3 complement(581468..584023) [2556 bp, 851 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YPL150W
          Length = 851

 Score =  157 bits (397), Expect = 1e-38,   Method: Compositional matrix adjust.
 Identities = 93/273 (34%), Positives = 140/273 (51%), Gaps = 22/273 (8%)

Query: 18  IGPWKLGETLGFGSTGKVQLAQHERTGHRTAVKVISKSIFNNNGNHSNDDSVLPYNIERE 77
           +G +++ + +G GS GKV LA H+ T  +  +K  +KS                 N+ RE
Sbjct: 34  VGNYRIVKQVGEGSFGKVYLATHKLTHQKVVLKTGAKS---------------DPNVVRE 78

Query: 78  IVIMKLLSHPNVLSLYDVWETNNNLYLILEYAEKGELFNLLVDHGPLPEREAINCFRQII 137
           +   +   +P +  LY+V  T   +++ LEY    EL++ L+    +P  E    F QI+
Sbjct: 79  VFYHRQFEYPFITKLYEVIVTETRVWMALEYCPGNELYDYLLLKQRIPLDETRRLFAQIV 138

Query: 138 IGISYCHALGIVHRDLKPENLLLDSFYNIKIADFGMAALQTDADLLETSCGSPHYAAPEI 197
             + Y H+L  VHRDLK EN+LLD      + DFG          LET CG+  Y APE+
Sbjct: 139 SAVFYAHSLQCVHRDLKLENILLDKNGYAMLTDFGFTRECATKTQLETVCGTTVYMAPEL 198

Query: 198 VSGLPYEGFASDVWSCGVILFALLTGRLPFDEENGNVRDLLLKVQKGQFEMPN--DTEIS 255
           +    Y+G+  D WS G+IL+ +L G +PFDE++  VR  L    K   E P   D   S
Sbjct: 199 IKREAYDGYKVDTWSLGIILYTMLHGYMPFDEDD-TVRTGL----KIMHEEPAVLDEYTS 253

Query: 256 RDAQDLIGKILVVDPRQRIKIRDILSHPLLKKY 288
             A+DLI ++L  +  QR  + ++L HP L+ Y
Sbjct: 254 PQAKDLIVRLLDKNAAQRPNLNEVLQHPFLQPY 286

>Smik_6.414 Chr6 (666806..667909) [1104 bp, 367 aa] {ON} YPL209C
           (REAL)
          Length = 367

 Score =  149 bits (377), Expect = 1e-38,   Method: Compositional matrix adjust.
 Identities = 87/267 (32%), Positives = 142/267 (53%), Gaps = 21/267 (7%)

Query: 35  VQLAQHERTGHRTAVKVISKSIFNNNGNHSNDDSVLPYNIER----EIVIMKLLSHPNVL 90
           V   +H  TG   A+KV+ K            + ++ YN++R    E+ I   L+HPN+ 
Sbjct: 118 VYCVRHRSTGFICALKVMEK------------EEIIKYNLQRQFRREVEIQTSLNHPNLT 165

Query: 91  SLYDVWETNNNLYLILEYAEKGELFNLLVDHGPLPEREAINCFRQIIIGISYCHALGIVH 150
             Y  +     +YL++EY   GE++ LL  HGP  +  A +   QI   + Y H   I+H
Sbjct: 166 KSYGYFHDEKRVYLLMEYLVNGEMYKLLRSHGPFNDILASDYVYQIANALDYMHKKNIIH 225

Query: 151 RDLKPENLLLDSFYNIKIADFGMAALQTDADLLETSCGSPHYAAPEIVSGLPYEGFASDV 210
           RD+KPEN+L+     IK+ DFG + +       +T CG+  Y +PE++    Y+    D 
Sbjct: 226 RDIKPENILIGFNNIIKLTDFGWSIINPPDSRRKTVCGTIDYLSPEMIESREYDH-TIDA 284

Query: 211 WSCGVILFALLTGRLPFDEENGNVRDLLLKVQKGQFEMPNDTEISRDAQDLIGKILVVDP 270
           W+ GV+ F LLTG  PF+EE   ++D   K +    ++   + IS+DAQDLI K+L  DP
Sbjct: 285 WALGVLAFELLTGAPPFEEE---MKDTTYK-RIAALDIKIPSNISQDAQDLILKLLKYDP 340

Query: 271 RQRIKIRDILSHPLLKKYQTIKDSKSI 297
           + R+++ D+  HP + + +   ++K +
Sbjct: 341 KDRMRLEDVKMHPWILRNKPFWENKRL 367

>NCAS0A08880 Chr1 (1756271..1757539) [1269 bp, 422 aa] {ON}
           Anc_1.374
          Length = 422

 Score =  150 bits (378), Expect = 3e-38,   Method: Compositional matrix adjust.
 Identities = 95/291 (32%), Positives = 156/291 (53%), Gaps = 16/291 (5%)

Query: 3   VANTETHSAAKPSSTIGP--WKLGETLGFGSTGKVQLAQHERTGHRTAVKVISKSIFNNN 60
           VA +    + +P S +    +  G+TLG G+ G V+ A+   +    AVK++ K+    N
Sbjct: 18  VAKSLNKFSGQPDSYVNKTNYIFGKTLGAGTFGVVRQARQLSSQEDVAVKILLKNALKGN 77

Query: 61  GNHSNDDSVLPYNIEREIVIMKLLSHPNVLSLYDVWETNNNLYLILEYAEKGELFNLLVD 120
                   V    +  E+ I++ L HPN+++  D +E+ +  Y++ + A  GELF+ ++ 
Sbjct: 78  -------DVQLQMLYDELSILQRLHHPNIVAFKDWFESRDKFYIVTQLATGGELFDRIIK 130

Query: 121 HGPLPEREAINCFRQIIIGISYCHALGIVHRDLKPENLL-LD--SFYNIKIADFGMAA-L 176
            G   E +A+N   Q++  + Y H+  IVHRDLKPEN+L LD      + IADFG+A  L
Sbjct: 131 KGKFTEVDAVNIMVQLLDAVKYIHSQNIVHRDLKPENVLYLDPSDESQLVIADFGIAKEL 190

Query: 177 QTDADLLETSCGSPHYAAPEIVSGLPYEGFASDVWSCGVILFALLTGRLPFDEEN--GNV 234
           +++ DL+    GS  Y APE+++   + G   D+WS GVI + LL+G  PF  E+  G +
Sbjct: 191 KSNDDLIFKGAGSLGYVAPEVLTKEGH-GKPCDIWSLGVITYTLLSGYSPFIAESVEGFL 249

Query: 235 RDLLLKVQKGQFEMPNDTEISRDAQDLIGKILVVDPRQRIKIRDILSHPLL 285
            +        QF  P    IS +A+D I K L +DP +R    ++++ P +
Sbjct: 250 EECTRSRYPVQFHKPYWDSISDEAKDFILKALTIDPEERPSAEELMNDPWI 300

>TPHA0O01120 Chr15 complement(217462..218751) [1290 bp, 429 aa] {ON}
           Anc_1.374 YFR014C
          Length = 429

 Score =  150 bits (378), Expect = 4e-38,   Method: Compositional matrix adjust.
 Identities = 92/283 (32%), Positives = 152/283 (53%), Gaps = 16/283 (5%)

Query: 11  AAKPSSTIGP--WKLGETLGFGSTGKVQLAQHERTGHRTAVKVISKSIFNNNGNHSNDDS 68
           + +PSS I    +  G+TLG GS G V+ A+   TG   AVK++ K     N  H     
Sbjct: 26  SGQPSSYINKEDYIFGKTLGAGSFGVVRQARRISTGEDVAVKILLKKALQGNEVHLQ--- 82

Query: 69  VLPYNIEREIVIMKLLSHPNVLSLYDVWETNNNLYLILEYAEKGELFNLLVDHGPLPERE 128
            + Y+   E+ I++ L HP++++  D +E+ +  Y++ + A  GELF+ ++  G   E +
Sbjct: 83  -MLYD---ELSILQRLHHPHIVAFKDWFESKDKFYIVTQLATGGELFDRILARGKFTEND 138

Query: 129 AINCFRQIIIGISYCHALGIVHRDLKPENLLL---DSFYNIKIADFGMA-ALQTDADLLE 184
           A+    Q++  + Y H+  +VHRDLKPEN+L        ++ IADFG+A  L+ + D++ 
Sbjct: 139 AVKIIYQLLDAVKYIHSQNVVHRDLKPENILYVNNSDNSDLVIADFGIAKQLKNNDDMIF 198

Query: 185 TSCGSPHYAAPEIVSGLPYEGFASDVWSCGVILFALLTGRLPFDEEN--GNVRDLLLKVQ 242
            + GS  Y APE+++ +   G A D+WS GVI + LL+G   F  E+  G + +      
Sbjct: 199 KAAGSLGYVAPEVLT-VNGHGKACDIWSLGVITYTLLSGYSAFIAESVEGFLEECTSSTY 257

Query: 243 KGQFEMPNDTEISRDAQDLIGKILVVDPRQRIKIRDILSHPLL 285
              F  P   +IS +A+  I   L ++P +R     +LSHP +
Sbjct: 258 PVTFHRPYWDKISDEAKKFILSALTIEPEERPTAEQLLSHPWI 300

>KAFR0K00280 Chr11 complement(64906..65988) [1083 bp, 360 aa] {ON}
           Anc_6.222 YPL209C
          Length = 360

 Score =  147 bits (371), Expect = 7e-38,   Method: Compositional matrix adjust.
 Identities = 80/257 (31%), Positives = 139/257 (54%), Gaps = 21/257 (8%)

Query: 35  VQLAQHERTGHRTAVKVISKSIFNNNGNHSNDDSVLPYNIE----REIVIMKLLSHPNVL 90
           V   +H+++G   A+K + K            + ++ YN++    REI I  +L+HPN+ 
Sbjct: 116 VYCVKHKKSGFICALKAMEK------------NEIIQYNLQKQVRREIEIQTILNHPNLT 163

Query: 91  SLYDVWETNNNLYLILEYAEKGELFNLLVDHGPLPEREAINCFRQIIIGISYCHALGIVH 150
            LY  +     +Y+++EY  +GEL+ LL  HGP  +  A N   QI   + Y H   I+H
Sbjct: 164 KLYSFFHDEKRIYIVMEYLIQGELYKLLQSHGPFNDVLASNYVYQIADALDYLHQKHIIH 223

Query: 151 RDLKPENLLLDSFYNIKIADFGMAALQTDADLLETSCGSPHYAAPEIVSGLPYEGFASDV 210
           RD+KPEN+L+     +K+ DFG + +       +T CG+  Y +PEI++   Y+    D+
Sbjct: 224 RDIKPENILIGFNNTVKLTDFGWSIINPKGIRRKTLCGTIDYLSPEIITSKEYD-HTVDI 282

Query: 211 WSCGVILFALLTGRLPFDEENGNVRDLLLKVQKGQFEMPNDTEISRDAQDLIGKILVVDP 270
           W+ GV+ + L+ G   F+EE   +     ++ KG+ + P    +    +DLI +ILV++P
Sbjct: 283 WALGVLAYELVVGSPAFEEETKEM--TYKRIVKGELKFPE--HLPNIVRDLIQRILVIEP 338

Query: 271 RQRIKIRDILSHPLLKK 287
            +R+ +++I  HP + K
Sbjct: 339 SKRMSLKEIKRHPWILK 355

>Kpol_1072.16 s1072 complement(37585..39972) [2388 bp, 795 aa] {ON}
           complement(37585..39972) [2388 nt, 796 aa]
          Length = 795

 Score =  154 bits (388), Expect = 1e-37,   Method: Compositional matrix adjust.
 Identities = 91/277 (32%), Positives = 147/277 (53%), Gaps = 29/277 (10%)

Query: 25  ETLGFGSTGKVQLAQHERTGHRTAVKVISKSIFNNNGNHSNDDSVLPYNIEREIVIMKLL 84
           E +G G+   V+ A    TG   AVK+I+K     N +           + RE+ +++ L
Sbjct: 197 EVVGQGAFAIVKKAVERSTGKTFAVKIINKRKVMGNMD----------GVTRELDVLRKL 246

Query: 85  SHPNVLSLYDVWETNNNLYLILEYAEKGELFNLLVDHGPLPEREAINCFRQIIIGISYCH 144
            HP ++ L   +E  ++ YL++E+   G+L + +  HG + E       RQI+  + Y H
Sbjct: 247 DHPRIVRLKGFYEDEDSYYLLMEFVSGGDLMDFVAAHGSVGEDAGREITRQILEAVKYIH 306

Query: 145 ALGIVHRDLKPENLLL--DSFYNIKIADFGMAALQTDADLLETSCGSPHYAAPEIVSG-- 200
             GI HRDLKP+N+L+  D    +KI DFG+A +Q +   ++T CG+  Y APE++ G  
Sbjct: 307 LQGISHRDLKPDNILIEQDDPVLVKITDFGLAKVQGNGTFMKTFCGTLAYVAPEVIGGKN 366

Query: 201 --------LPYEGFASDVWSCGVILFALLTGRLPFDEENGNVRDLLLK-VQKGQF-EMP- 249
                   + Y     D+WS G +++ +LTG LPF   +G+ +D L K + +G + E P 
Sbjct: 367 SAEENEDRIEYSSLV-DMWSIGCLVYVILTGHLPF---SGSTQDQLYKQICRGSYHEGPL 422

Query: 250 NDTEISRDAQDLIGKILVVDPRQRIKIRDILSHPLLK 286
            D  IS +A+D I  +L V P +R+     L+HP +K
Sbjct: 423 KDFRISDEARDFIDSLLQVSPNKRLTAIKALNHPWIK 459

>TBLA0B03840 Chr2 complement(881914..884490) [2577 bp, 858 aa] {ON}
           Anc_8.676 YPL153C
          Length = 858

 Score =  154 bits (389), Expect = 1e-37,   Method: Compositional matrix adjust.
 Identities = 89/276 (32%), Positives = 145/276 (52%), Gaps = 27/276 (9%)

Query: 25  ETLGFGSTGKVQLAQHERTGHRTAVKVISKSIFNNNGNHSNDDSVLPYNIEREIVIMKLL 84
           E +G G+   V+ A    TG   AVK+I+K      GN S         + RE+ I++ L
Sbjct: 201 EVVGQGAFATVKKAVERSTGRTFAVKIINKRKVM--GNLSG--------VTRELEILRKL 250

Query: 85  SHPNVLSLYDVWETNNNLYLILEYAEKGELFNLLVDHGPLPEREAINCFRQIIIGISYCH 144
            HP ++ L   +E   + YL++E+   G+L + +  HG + E       RQI+  ++Y H
Sbjct: 251 DHPRIVRLKGFYEDEESYYLVMEFVSGGDLMDFVAAHGSVGEDAGREITRQILEAVAYMH 310

Query: 145 ALGIVHRDLKPENLLL--DSFYNIKIADFGMAALQTDADLLETSCGSPHYAAPEIVSG-- 200
             GI HRD+KP+N+L+  D    +KI DFG+A +Q +   ++T CG+  Y APE++SG  
Sbjct: 311 EKGISHRDIKPDNILIEQDDPVLVKITDFGLAKVQGNGTFMKTFCGTLAYVAPEVISGKN 370

Query: 201 --------LPYEGFASDVWSCGVILFALLTGRLPFDEENGNVRDLLLKVQKGQF-EMP-N 250
                   + Y     D+WS G +++ +LT  LPF       ++L  ++ +G + E P  
Sbjct: 371 AATENDDRIEYSSLV-DMWSIGCLVYVILTAHLPF--SGSTQQELYEQINRGSYHEGPLK 427

Query: 251 DTEISRDAQDLIGKILVVDPRQRIKIRDILSHPLLK 286
           D  +S +A+D I  ++ VDP  R+  +D L H  +K
Sbjct: 428 DYRVSEEARDFIESLIQVDPNNRLTAKDALKHEWIK 463

>TDEL0A06220 Chr1 (1088622..1091006) [2385 bp, 794 aa] {ON}
           Anc_8.676 YPL153C
          Length = 794

 Score =  154 bits (388), Expect = 1e-37,   Method: Compositional matrix adjust.
 Identities = 90/277 (32%), Positives = 147/277 (53%), Gaps = 29/277 (10%)

Query: 25  ETLGFGSTGKVQLAQHERTGHRTAVKVISKSIFNNNGNHSNDDSVLPYNIEREIVIMKLL 84
           E +G G+   V+ A    TG   A K+ISK     N +           + RE+ +++ L
Sbjct: 197 EVVGQGAFATVKKAVERSTGKTFAAKIISKRKVMGNMD----------GVTRELEVLRKL 246

Query: 85  SHPNVLSLYDVWETNNNLYLILEYAEKGELFNLLVDHGPLPEREAINCFRQIIIGISYCH 144
           +HP ++ L   +E +   YL++E+   G+L + +  HG + E       RQ++ G+ Y H
Sbjct: 247 NHPKIVRLKGFYEDDEFYYLLMEFVSGGDLMDFVAAHGSVGEDAGREITRQVLEGVKYIH 306

Query: 145 ALGIVHRDLKPENLLL--DSFYNIKIADFGMAALQTDADLLETSCGSPHYAAPEIVSGLP 202
           + GI HRDLKP+N+L+  D    +KI DFG+A +Q +   ++T CG+  Y APE+++G  
Sbjct: 307 SQGISHRDLKPDNILIEQDDPVLVKITDFGLAKVQGNGTFMKTFCGTLAYVAPEVIAGKA 366

Query: 203 ----------YEGFASDVWSCGVILFALLTGRLPFDEENGNVRDLLLK-VQKGQF-EMP- 249
                     Y     D+WS G +++ +LTG LPF   +G+ ++ L K ++ G + E P 
Sbjct: 367 NAEENEKRNEYSSLV-DMWSMGCLVYVILTGHLPF---SGSTQEQLYKQIKNGSYHEGPL 422

Query: 250 NDTEISRDAQDLIGKILVVDPRQRIKIRDILSHPLLK 286
            D  IS +A+D I  +L V+P  R   +  L HP +K
Sbjct: 423 KDFRISDEARDFIDSLLQVNPNARPTAKKALEHPWIK 459

>NCAS0B04490 Chr2 (814474..815523) [1050 bp, 349 aa] {ON} Anc_8.141
          Length = 349

 Score =  146 bits (368), Expect = 1e-37,   Method: Compositional matrix adjust.
 Identities = 86/256 (33%), Positives = 137/256 (53%), Gaps = 23/256 (8%)

Query: 35  VQLAQHERTGHRTAVKVISKSIFNNNGNHSNDDSVLPYNIE----REIVIMKLLSHPNVL 90
           V   +H+ TG   A+KV+ K+             ++ YN++    RE+ I   L+HPN+ 
Sbjct: 105 VYCVRHKETGFICALKVMDKA------------EIVQYNLQKQFRREVEIQTSLNHPNLT 152

Query: 91  SLYDVWETNNNLYLILEYAEKGELFNLLVDHGPLPEREAINCFRQIIIGISYCHALGIVH 150
            LY  +     +YL++EY   GEL+ LL  HGP  +  A     QI   ++Y H   I+H
Sbjct: 153 KLYGHFHDEKRVYLLMEYLVYGELYKLLRSHGPFNDVIASRFVFQIADALNYLHDKQIIH 212

Query: 151 RDLKPENLLLDSFYNIKIADFGMAALQTDADLLETSCGSPHYAAPEIVSGLPYEGFASDV 210
           RDLKPEN+L+     IK+ DFG + +       +T CG+  Y +PE++    Y+    DV
Sbjct: 213 RDLKPENILIGFNNVIKLTDFGWSIINPRGVKRKTLCGTIDYLSPEMIRSREYDD-KVDV 271

Query: 211 WSCGVILFALLTGRLPFDEENGNVRDLLLK-VQKGQFEMPNDTEISRDAQDLIGKILVVD 269
           W+ GV+ + L+ G  PF+E+    ++L  K + K   + P    +S D +DLI K+L  +
Sbjct: 272 WALGVLTYELIVGSPPFEED---TKELTYKRILKNDIKFPE--TVSHDVKDLISKLLKYN 326

Query: 270 PRQRIKIRDILSHPLL 285
           P +RI +RD++ HP +
Sbjct: 327 PSERISMRDVMKHPWI 342

>Suva_16.97 Chr16 complement(165977..167083) [1107 bp, 368 aa] {ON}
           YPL209C (REAL)
          Length = 368

 Score =  147 bits (370), Expect = 1e-37,   Method: Compositional matrix adjust.
 Identities = 89/268 (33%), Positives = 147/268 (54%), Gaps = 23/268 (8%)

Query: 35  VQLAQHERTGHRTAVKVISKSIFNNNGNHSNDDSVLPYNIER----EIVIMKLLSHPNVL 90
           V   +H+ TG+  A+KV+ K            + ++ Y ++R    E+ I   L+HPN+ 
Sbjct: 119 VYCVRHKTTGYICALKVMEK------------EKIIQYKLQRQFRREVEIQSSLNHPNLT 166

Query: 91  SLYDVWETNNNLYLILEYAEKGELFNLLVDHGPLPEREAINCFRQIIIGISYCHALGIVH 150
            LY  +     +YL++EY   GE++ LL  HGP  +  A +   QI   + Y H   I+H
Sbjct: 167 KLYGYFHDEKRVYLLMEYLVNGEMYKLLRSHGPFNDILASDYIYQIANALDYMHRKHIIH 226

Query: 151 RDLKPENLLLDSFYNIKIADFGMAALQTDADLLETSCGSPHYAAPEIVSGLPYEGFASDV 210
           RD+K EN+++     IK+ DFG + +    +  +T CG+  Y +PE+V    Y+    DV
Sbjct: 227 RDIKLENIIIGFNNIIKLTDFGWSIINPPENRRKTVCGTIDYLSPEMVEFREYDH-TVDV 285

Query: 211 WSCGVILFALLTGRLPFDEENGNVRDLLLK-VQKGQFEMPNDTEISRDAQDLIGKILVVD 269
           W+ GV+ F LLTG  PF+EE   ++D   K +     + PN+  IS+DAQDLI K+L  D
Sbjct: 286 WALGVLTFELLTGAPPFEEE---MKDTTYKRIAALDIKFPNN--ISQDAQDLILKLLKYD 340

Query: 270 PRQRIKIRDILSHPLLKKYQTIKDSKSI 297
           P++R+++ D+  HP + + +   ++K +
Sbjct: 341 PKERMRLEDVKMHPWILRNKPFWENKGL 368

>Ecym_2397 Chr2 complement(771343..773961) [2619 bp, 872 aa] {ON}
           similar to Ashbya gossypii ACR142W
          Length = 872

 Score =  154 bits (389), Expect = 1e-37,   Method: Compositional matrix adjust.
 Identities = 92/279 (32%), Positives = 150/279 (53%), Gaps = 27/279 (9%)

Query: 25  ETLGFGSTGKVQLAQHERTGHRTAVKVISKSIFNNNGNHSNDDSVLPYNIEREIVIMKLL 84
           E +G G+   V+ A   +TG   AVK+ISK     N             + RE+ ++  L
Sbjct: 194 EVVGQGAFATVKKAVERKTGKTFAVKIISKRKVMGNVE----------GVTRELEVLHRL 243

Query: 85  SHPNVLSLYDVWETNNNLYLILEYAEKGELFNLLVDHGPLPEREAINCFRQIIIGISYCH 144
           +HP ++SL   +E   + YL++E+   G+L + +  HG + E       RQI+  + Y H
Sbjct: 244 NHPRIVSLKGFYEDEESYYLLMEFVSGGDLMDFVAAHGSVGEDAGREITRQILEAVKYIH 303

Query: 145 ALGIVHRDLKPENLLL--DSFYNIKIADFGMAALQTDADLLETSCGSPHYAAPEIVSGLP 202
              I HRDLKP+N+L+  D    +KI DFG+A +Q +   ++T CG+  Y APE++ G  
Sbjct: 304 QQEISHRDLKPDNILIEQDDPVLVKITDFGLAKIQDNGTFMKTFCGTLAYVAPEVIDGKS 363

Query: 203 YEG-------FAS--DVWSCGVILFALLTGRLPFDEENGNVRDLLL-KVQKGQF-EMP-N 250
            E        ++S  D+WS G +++ +LTG LPF   +G+ ++ L  ++ +G + E P  
Sbjct: 364 LEEKSVNKNLYSSLVDMWSIGCLVYVILTGHLPF---SGSTQEQLYEQISRGSYHEGPLK 420

Query: 251 DTEISRDAQDLIGKILVVDPRQRIKIRDILSHPLLKKYQ 289
           D +IS +A+D I  +L V+PR R+     L HP ++  Q
Sbjct: 421 DFKISDEARDFIDALLQVNPRDRLTAAKALKHPWIQMAQ 459

>ACR142W Chr3 (597519..600032) [2514 bp, 837 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YPL153C (RAD53)
          Length = 837

 Score =  154 bits (388), Expect = 1e-37,   Method: Compositional matrix adjust.
 Identities = 92/281 (32%), Positives = 149/281 (53%), Gaps = 27/281 (9%)

Query: 25  ETLGFGSTGKVQLAQHERTGHRTAVKVISKSIFNNNGNHSNDDSVLPYNIEREIVIMKLL 84
           E +G G+   V+ A    TG   AVK+I+K     N +           + RE+ +++ L
Sbjct: 221 EVVGQGAFATVKKAVERNTGKTFAVKIINKRKVMGNVD----------GVTRELEVLRRL 270

Query: 85  SHPNVLSLYDVWETNNNLYLILEYAEKGELFNLLVDHGPLPEREAINCFRQIIIGISYCH 144
           +HP ++SL   +E + + YL++E+   G+L + +  HG + E       RQI+  + Y H
Sbjct: 271 NHPRIVSLKGFYEDDESYYLLMEFVSGGDLMDFVAAHGSVGEDAGREITRQILEAVRYIH 330

Query: 145 ALGIVHRDLKPENLLL--DSFYNIKIADFGMAALQTDADLLETSCGSPHYAAPEIVSGLP 202
             GI HRDLKP+N+L+  D    +KI DFG+A +Q +   ++T CG+  Y APE++ G  
Sbjct: 331 EQGISHRDLKPDNILIEQDDPVLVKITDFGLAKIQDNTTFMKTFCGTLAYVAPEVIGGKN 390

Query: 203 YEGFAS---------DVWSCGVILFALLTGRLPFDEENGNVRDLLLK-VQKGQF-EMP-N 250
            EG  +         D+WS G +++ +LTG LPF   +G+ ++ L K +  G + E P  
Sbjct: 391 PEGNGANGNLYSSLVDMWSIGCLVYVILTGHLPF---SGSTQEQLYKQIANGSYHEGPLK 447

Query: 251 DTEISRDAQDLIGKILVVDPRQRIKIRDILSHPLLKKYQTI 291
           D  IS +A+D I  +L ++P  R+     L HP L    +I
Sbjct: 448 DYWISDEARDFIDSLLQINPVDRLTAERALQHPWLHPCTSI 488

>NDAI0F01600 Chr6 complement(392424..393662) [1239 bp, 412 aa] {ON} 
          Length = 412

 Score =  147 bits (372), Expect = 1e-37,   Method: Compositional matrix adjust.
 Identities = 84/258 (32%), Positives = 143/258 (55%), Gaps = 23/258 (8%)

Query: 35  VQLAQHERTGHRTAVKVISKSIFNNNGNHSNDDSVLPYNIER----EIVIMKLLSHPNVL 90
           V   +H+ +G   A+K + KS             ++ YN++R    E+ I   L+HPN+ 
Sbjct: 168 VYCVKHKESGFICALKAMDKS------------EIIQYNLQRQFRREVEIQTSLNHPNLT 215

Query: 91  SLYDVWETNNNLYLILEYAEKGELFNLLVDHGPLPEREAINCFRQIIIGISYCHALGIVH 150
            LY  +  +  +YLI+EY   GEL+ LL  HGP  +  A     QI   +++ H  GI+H
Sbjct: 216 KLYGHFYDDKRVYLIMEYLVYGELYKLLRSHGPFNDIIASRFVYQIADALNHLHEKGIIH 275

Query: 151 RDLKPENLLLDSFYNIKIADFGMAALQTDADLLETSCGSPHYAAPEIVSGLPYEGFASDV 210
           RDLKPEN+L+     +K+ DFG + +       +T CG+  Y +PE++    Y+    DV
Sbjct: 276 RDLKPENILIGFNNVLKLTDFGWSIINPKGVKRKTLCGTIDYLSPEMIRSREYDD-TVDV 334

Query: 211 WSCGVILFALLTGRLPFDEENGNVRDLLLK-VQKGQFEMPNDTEISRDAQDLIGKILVVD 269
           W+ GV+ + L+ G  PF+E++   ++L  K + KG+   P    +S+D +DLI ++L  D
Sbjct: 335 WALGVLTYELVAGDPPFEEDS---KELTYKRILKGEIRFPG--TVSQDVRDLISRLLKND 389

Query: 270 PRQRIKIRDILSHPLLKK 287
           P++RI +++++ HP + +
Sbjct: 390 PKERILLKEVMVHPWIMR 407

>NCAS0C01370 Chr3 complement(250693..253092) [2400 bp, 799 aa] {ON}
           Anc_8.676
          Length = 799

 Score =  154 bits (388), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 90/278 (32%), Positives = 145/278 (52%), Gaps = 27/278 (9%)

Query: 25  ETLGFGSTGKVQLAQHERTGHRTAVKVISKSIFNNNGNHSNDDSVLPYNIEREIVIMKLL 84
           E +G G+   V+ A    TG   AVK+ISK     N             + RE+ +++ L
Sbjct: 199 EVVGQGAFATVKKAVERSTGKTFAVKIISKRKVMGNME----------GVSRELEVLQQL 248

Query: 85  SHPNVLSLYDVWETNNNLYLILEYAEKGELFNLLVDHGPLPEREAINCFRQIIIGISYCH 144
            HP ++ L   +E  ++ Y+++E+   G+L + +  HG + E       RQI+  + Y H
Sbjct: 249 DHPRIVRLKGFYEDKDSYYMVMEFVSGGDLMDFVAAHGAVGEEAGKEISRQILEAVKYIH 308

Query: 145 ALGIVHRDLKPENLLL--DSFYNIKIADFGMAALQTDADLLETSCGSPHYAAPEIVSGL- 201
           + GI HRDLKP+N+L+  D    +KI DFG+A +Q +   ++T CG+  Y APE++ G  
Sbjct: 309 SKGISHRDLKPDNILIEQDDPVLVKITDFGLAKVQGNGSFMKTFCGTLAYVAPEVIGGKG 368

Query: 202 -------PYEGFASDVWSCGVILFALLTGRLPFDEENGNVRDLLLK-VQKGQF-EMP-ND 251
                   Y     D+WS G +++ +LTG LPF   +G+ ++ L K + +G + E P  D
Sbjct: 369 ETNEERNEYSSLV-DMWSMGCLVYVILTGHLPF---SGSTQEQLYKQISRGSYHEGPLKD 424

Query: 252 TEISRDAQDLIGKILVVDPRQRIKIRDILSHPLLKKYQ 289
             IS +A+  I  +L V+P  R+     L HP +K  Q
Sbjct: 425 FRISDEARSFIDSLLQVNPGNRLTAARALEHPWIKMAQ 462

>YFR014C Chr6 complement(172537..173877) [1341 bp, 446 aa] {ON}
           CMK1Calmodulin-dependent protein kinase; may play a role
           in stress response, many Ca++/calmodulin dependent
           phosphorylation substrates demonstrated in vitro, amino
           acid sequence similar to Cmk2p and mammalian Cam Kinase
           II
          Length = 446

 Score =  148 bits (374), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 95/283 (33%), Positives = 150/283 (53%), Gaps = 20/283 (7%)

Query: 13  KPSSTIGPWK--LGETLGFGSTGKVQLAQHERTGHRTAVKVISKSIFNNNGNHSNDDSVL 70
           +P+S +   K   G+TLG G+ G V+ A++  TG   AVK++ K     N        V 
Sbjct: 27  QPASYVNKKKYVFGKTLGAGTFGVVRQAKNTETGEDVAVKILIKKALKGN-------KVQ 79

Query: 71  PYNIEREIVIMKLLSHPNVLSLYDVWETNNNLYLILEYAEKGELFNLLVDHGPLPEREAI 130
              +  E+ I++ L HPN+++  D +E+ +  Y+I + A+ GELF+ ++  G   E +A+
Sbjct: 80  LEALYDELDILQRLHHPNIVAFKDWFESKDKFYIITQLAKGGELFDRILKKGKFTEEDAV 139

Query: 131 NCFRQIIIGISYCHALGIVHRDLKPENLLLDSFYN---IKIADFGMAA-LQTDADLLETS 186
               +I+  + Y H+  IVHRDLKPENLL     +   + +ADFG+A  L++D +LL   
Sbjct: 140 RILVEILSAVKYMHSQNIVHRDLKPENLLYIDKSDESPLVVADFGIAKRLKSDEELLYKP 199

Query: 187 CGSPHYAAPEIVSGLPYEGFASDVWSCGVILFALLTGRLPFDEENGNVRDLLLKVQKGQ- 245
            GS  Y APE+++   + G   D+WS GVI + LL G   F  E   V+D L +   G+ 
Sbjct: 200 AGSLGYVAPEVLTQDGH-GKPCDIWSIGVITYTLLCGYSAFRAE--RVQDFLDECTTGEY 256

Query: 246 ---FEMPNDTEISRDAQDLIGKILVVDPRQRIKIRDILSHPLL 285
              F  P    +S  A+  I K L +DP +R    ++L  P +
Sbjct: 257 PVKFHRPYWDSVSNKAKQFILKALNLDPSKRPTAAELLEDPWI 299

>YDL101C Chr4 complement(280307..281848) [1542 bp, 513 aa] {ON}
           DUN1Cell-cycle checkpoint serine-threonine kinase
           required for DNA damage-induced transcription of certain
           target genes, phosphorylation of Rad55p and Sml1p, and
           transient G2/M arrest after DNA damage; also regulates
           postreplicative DNA repair
          Length = 513

 Score =  149 bits (377), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 101/323 (31%), Positives = 157/323 (48%), Gaps = 47/323 (14%)

Query: 2   TVANTETHSAA-------KPSSTIGPWKLGETLGFGSTGKVQLAQHERTGHRTAVKVISK 54
           T +   T SAA       +P S    + LG+ LG G    V+ A++++TG + AVK+   
Sbjct: 174 TSSQNATTSAAIRKLNKTRPVSFFDKYLLGKELGAGHYALVKEAKNKKTGQQVAVKIFHA 233

Query: 55  SIFNNNGNHSNDDSVLPYNIEREIVIMKLLSHPNVLSLYD-----VWETNNNLYLILEYA 109
                     NDD         E  I+  + HPN+++L D     + ++    YL+LE  
Sbjct: 234 --------QQNDDQKKNKQFREETNILMRVQHPNIVNLLDSFVEPISKSQIQKYLVLEKI 285

Query: 110 EKGELFNLLVDHGPLPEREAINCFRQIIIGISYCHALGIVHRDLKPENLLLDSF------ 163
           + GELF  +V    L + E+   F+Q++ G+ Y H   I+HRD+KPEN+LL+        
Sbjct: 286 DDGELFERIVRKTCLRQDESKALFKQLLTGLKYLHEQNIIHRDIKPENILLNITRRENPS 345

Query: 164 -------------YNIKIADFGMAALQTDADLLETSCGSPHYAAPEIVSGLPYEGFAS-- 208
                          +KIADFG+A    +     T CG+P Y APE+   L  +G+ S  
Sbjct: 346 QVQLGPWDEDEIDIQVKIADFGLAKFTGEMQFTNTLCGTPSYVAPEV---LTKKGYTSKV 402

Query: 209 DVWSCGVILFALLTGRLPFDEENG--NVRDLLLKVQKGQFEMPNDTEISRDAQDLIGKIL 266
           D+WS GVIL+  L G  PF ++ G  ++++ +L+  K  F  P   +I      LI  +L
Sbjct: 403 DLWSAGVILYVCLCGFPPFSDQLGPPSLKEQILQA-KYAFYSPYWDKIDDSVLHLISNLL 461

Query: 267 VVDPRQRIKIRDILSHPLLKKYQ 289
           V++P +R  I + L+HP     Q
Sbjct: 462 VLNPDERYNIDEALNHPWFNDIQ 484

>ZYRO0E07018g Chr5 (531316..532419) [1104 bp, 367 aa] {ON} similar
           to uniprot|P38991 Saccharomyces cerevisiae YPL209C IPL1
           Aurora kinase involved in regulating
           kinetochore-microtubule attachments associates with
           Sli5p which stimulates Ipl1p kinase activity and
           promotes its association with the mitotic spindle
           potential Cdc28p substrate
          Length = 367

 Score =  146 bits (368), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 83/258 (32%), Positives = 138/258 (53%), Gaps = 21/258 (8%)

Query: 34  KVQLAQHERTGHRTAVKVISKSIFNNNGNHSNDDSVLPYNIE----REIVIMKLLSHPNV 89
           +V   +H+ TG   A+KV+ K              ++ YN++    RE+ I   L+H N+
Sbjct: 122 RVYCVRHKVTGFICAMKVMEKQ------------EIMQYNVQKQFRREVEIQSSLNHQNL 169

Query: 90  LSLYDVWETNNNLYLILEYAEKGELFNLLVDHGPLPEREAINCFRQIIIGISYCHALGIV 149
             LY  +  +  +YL++EY   GEL+ LL   GPL +  A +   Q+   + Y H   I+
Sbjct: 170 TKLYGYFHDDKRVYLLMEYLVNGELYKLLRAKGPLDDIFASHYVYQMADALDYMHQRNII 229

Query: 150 HRDLKPENLLLDSFYNIKIADFGMAALQTDADLLETSCGSPHYAAPEIVSGLPYEGFASD 209
           HRD+KPEN+L+     +K+ DFG + +       +T CG+  Y +PE+++   Y+    D
Sbjct: 230 HRDVKPENILIGFDNTVKLTDFGWSIINPRGTKRKTMCGTLDYLSPELIASKEYDD-KVD 288

Query: 210 VWSCGVILFALLTGRLPFDEENGNVRDLLLKVQKGQFEMPNDTEISRDAQDLIGKILVVD 269
           VW+ GV+ F L+    PF+E++  +     ++ +G  + PN   IS DAQDLI K+L  +
Sbjct: 289 VWALGVLTFELVVNSPPFEEDSKELTS--KRIVRGDLKFPN--HISSDAQDLITKLLRHN 344

Query: 270 PRQRIKIRDILSHPLLKK 287
            + RI +R++  HP + K
Sbjct: 345 SKDRISLREVKQHPWITK 362

>KLTH0H11396g Chr8 complement(973355..974668) [1314 bp, 437 aa] {ON}
           similar to uniprot|P22517 Saccharomyces cerevisiae
           YOL016C CMK2 Calmodulin-dependent protein kinase and to
           YFR014C uniprot|P27466 Saccharomyces cerevisiae YFR014C
           CMK1 Calmodulin-dependent protein kinase
          Length = 437

 Score =  147 bits (372), Expect = 3e-37,   Method: Compositional matrix adjust.
 Identities = 93/285 (32%), Positives = 148/285 (51%), Gaps = 20/285 (7%)

Query: 11  AAKPSSTI--GPWKLGETLGFGSTGKVQLAQHERTGHRTAVKVISKSIFNNNGNHSNDDS 68
           + +P S +    +  G TLG GS G V+ A+   TG   AVK++ K              
Sbjct: 34  SGQPDSYVNKADYIFGRTLGAGSFGVVRQARKLSTGENVAVKILLKKALKGK-------D 86

Query: 69  VLPYNIEREIVIMKLLSHPNVLSLYDVWETNNNLYLILEYAEKGELFNLLVDHGPLPERE 128
           V    +  E+ I++ L HPN++   D +E+ +  Y++ + A  GELF+ ++  G   E++
Sbjct: 87  VQLQMLYDELSILQKLDHPNIVKFKDWFESKDKFYIVTQLAMGGELFDRILKKGKFTEKD 146

Query: 129 AINCFRQIIIGISYCHALGIVHRDLKPENLLLDSFYN---IKIADFGMAA-LQTDADLLE 184
           A+    QI+  + Y H+  IVHRDLKPENLL  +  +   + + DFG+A  L  + +L+ 
Sbjct: 147 AVRIVYQILKAVEYLHSRNIVHRDLKPENLLYLAEKDDSPLVLGDFGIAKELNNEDELIH 206

Query: 185 TSCGSPHYAAPEIVSGLPYEGFASDVWSCGVILFALLTGRLPFDEENGNVRDLLLKVQKG 244
            + GS  Y APE+++   + G   D+WS GV+ + LL G  PF  E  +V   L +   G
Sbjct: 207 KAAGSMGYVAPEVLTTSGH-GKPCDIWSLGVVTYTLLCGYSPFVAE--SVEGFLEECTSG 263

Query: 245 Q----FEMPNDTEISRDAQDLIGKILVVDPRQRIKIRDILSHPLL 285
           +    F  P  + IS DA+D I + L V PR R    ++L+H  +
Sbjct: 264 RYPVTFHKPYWSSISDDAKDFILQALTVTPRYRPSATELLNHKWI 308

>NCAS0D02100 Chr4 (385878..388058) [2181 bp, 726 aa] {ON} Anc_6.31
          Length = 726

 Score =  152 bits (383), Expect = 3e-37,   Method: Compositional matrix adjust.
 Identities = 79/207 (38%), Positives = 122/207 (58%), Gaps = 6/207 (2%)

Query: 77  EIVIMKLLSHPNVLSLYDVWETNNNLYLILEYAEKGELFNLLVDHGPLPEREAINCFRQI 136
           EI I K + HPN++   D +E + N+Y++LE    G L +L+     L E E      QI
Sbjct: 139 EIQIHKSMKHPNIVHFVDCFEDDTNVYILLEICSNGSLMDLMKKRKTLTEPEVRFFTTQI 198

Query: 137 IIGISYCHALGIVHRDLKPENLLLDSFYNIKIADFGMAA-LQTDADLLETSCGSPHYAAP 195
              + Y H+  ++HRDLK  N+  D  YN+K+ DFG+AA L  + +   T CG+P+Y AP
Sbjct: 199 CGAVKYMHSRRVIHRDLKLGNIFFDKDYNLKVGDFGLAAVLANNRERKYTVCGTPNYIAP 258

Query: 196 EIVSGLPYEG--FASDVWSCGVILFALLTGRLPFDEENGNVRDLLLKVQKGQFEMPNDTE 253
           E++ G  + G  F  D+WS GV+++ALL G+ PF  ++ NV  +  +++  Q+  P D  
Sbjct: 259 EVLMG-KHAGHSFEVDIWSIGVMIYALLVGKPPFQAKDVNV--IYDRIKACQYGYPKDKY 315

Query: 254 ISRDAQDLIGKILVVDPRQRIKIRDIL 280
           +S +A+ LI  IL VDP +R  IR+I+
Sbjct: 316 VSSEAKTLIADILCVDPVERPSIREII 342

>Suva_4.145 Chr4 complement(268826..270370) [1545 bp, 514 aa] {ON}
           YDL101C (REAL)
          Length = 514

 Score =  149 bits (375), Expect = 4e-37,   Method: Compositional matrix adjust.
 Identities = 95/303 (31%), Positives = 151/303 (49%), Gaps = 40/303 (13%)

Query: 12  AKPSSTIGPWKLGETLGFGSTGKVQLAQHERTGHRTAVKVISKSIFNNNGNHSNDDSVLP 71
            KP S    + LG+ LG G    V+ A++++TG + AVK+             NDD    
Sbjct: 192 TKPVSFFDKYLLGKELGAGHYALVKEAKNKKTGQQVAVKIFHA--------QQNDDQKKN 243

Query: 72  YNIEREIVIMKLLSHPNVLSLYD-----VWETNNNLYLILEYAEKGELFNLLVDHGPLPE 126
                E  I+  + HPN+++L D     + ++    YL+LE  + GELF  +V    L +
Sbjct: 244 KQFREETNILMRVHHPNIVNLLDSFVEPISKSQIQKYLVLEKIDDGELFERIVRKTCLGQ 303

Query: 127 REAINCFRQIIIGISYCHALGIVHRDLKPENLLLDSF-------------------YNIK 167
            E+   F+Q++ G+ Y H   I+HRD+KPEN+LL+                       +K
Sbjct: 304 DESRALFKQLLTGLKYLHEQNIIHRDIKPENILLNITRRENSNQVQLGPWDEDEIDIQVK 363

Query: 168 IADFGMAALQTDADLLETSCGSPHYAAPEIVSGLPYEGFAS--DVWSCGVILFALLTGRL 225
           IADFG+A    +     T CG+P Y APE+   L  +G+ S  D+WS GVIL+  L G  
Sbjct: 364 IADFGLAKFTGEMQFTNTLCGTPSYVAPEV---LTKKGYTSKVDLWSAGVILYVCLCGFP 420

Query: 226 PFDEENG--NVRDLLLKVQKGQFEMPNDTEISRDAQDLIGKILVVDPRQRIKIRDILSHP 283
           PF ++ G  ++++ +++  K  F  P   +I      LI  +LV++P +R  I + ++HP
Sbjct: 421 PFSDQLGPPSLKEQIMQA-KYAFYSPYWDKIDDSVLHLISNLLVLNPDERYNIDEAMNHP 479

Query: 284 LLK 286
             K
Sbjct: 480 WFK 482

>KAFR0K00330 Chr11 (74162..75283) [1122 bp, 373 aa] {ON} Anc_6.214
           YPL203W
          Length = 373

 Score =  145 bits (366), Expect = 4e-37,   Method: Compositional matrix adjust.
 Identities = 90/283 (31%), Positives = 148/283 (52%), Gaps = 24/283 (8%)

Query: 10  SAAKPSSTIGPWKLGETLGFGSTGKVQLAQHERTGHRTAVKVISKS--IFNNNGNHSNDD 67
           + +K   T+  +++  TLG GS G+V L +    G   A+KV+ K   +      H+ND 
Sbjct: 52  TVSKGKYTLNDFQIMRTLGTGSFGRVHLVRSVHNGRYYAIKVLKKQQIVKMKQIEHTND- 110

Query: 68  SVLPYNIEREIVIMKLLSHPNVLSLYDVWETNNNLYLILEYAEKGELFNLLVDHGPLPER 127
                  ER +  +KL+ HP ++ ++  ++ +NNL+++++Y E GELF+LL      P  
Sbjct: 111 -------ERRM--LKLVEHPFLIRMWGTFQDSNNLFMVMDYIEGGELFSLLRKSQRFPNP 161

Query: 128 EAINCFRQIIIGISYCHALGIVHRDLKPENLLLDSFYNIKIADFGMAALQTDADLLETSC 187
            A     ++++ + Y H   I++RDLKPEN+LLD   +IKI DFG A   T      T C
Sbjct: 162 VAKFYAAEVVLALEYLHFNNIIYRDLKPENILLDRNGHIKITDFGFAKEVTTVTW--TLC 219

Query: 188 GSPHYAAPEIVSGLPYEGFASDVWSCGVILFALLTGRLPFDEENGNVRDLLLKVQKGQFE 247
           G+P Y APE+++  PY   + D WS G++++ +L G  PF   +        K+  G+  
Sbjct: 220 GTPDYIAPEVIATKPYNK-SVDWWSLGILIYEMLAGYTPF--YDTTPMKTYEKILHGRVT 276

Query: 248 MPNDTEISRDAQDLIGKILVVDPRQRI-----KIRDILSHPLL 285
            P  +  + D  DL+ K++  D  +RI       ++I SHP  
Sbjct: 277 YP--SFFNSDVVDLLSKLITADLTRRIGNLQNGTQEIKSHPWF 317

>NCAS0A01100 Chr1 (218400..219464) [1065 bp, 354 aa] {ON} 
          Length = 354

 Score =  145 bits (365), Expect = 5e-37,   Method: Compositional matrix adjust.
 Identities = 94/282 (33%), Positives = 148/282 (52%), Gaps = 24/282 (8%)

Query: 11  AAKPSSTIGPWKLGETLGFGSTGKVQLAQHERTGHRTAVKVISKS--IFNNNGNHSNDDS 68
            +K   T+  +++  TLG GS G+V L +    G   A+KV+ K   +      H+ND  
Sbjct: 34  VSKGKYTLHDFQVMRTLGTGSFGRVHLVRSVHNGRYYAIKVLKKQQVVRMKQIEHTND-- 91

Query: 69  VLPYNIEREIVIMKLLSHPNVLSLYDVWETNNNLYLILEYAEKGELFNLLVDHGPLPERE 128
                 ER +  +KL+ HP ++ ++  ++ + NL+++++Y E GELF+LL      P   
Sbjct: 92  ------ERRM--LKLVEHPFLIRMWGTFQDSRNLFMVMDYIEGGELFSLLRKSQRFPNPV 143

Query: 129 AINCFRQIIIGISYCHALGIVHRDLKPENLLLDSFYNIKIADFGMAALQTDADLLETSCG 188
           A     ++ +G+ Y H+  I++RDLKPEN+LLD   +IKI DFG A  + D  +  T CG
Sbjct: 144 AKFYAAEVTLGLEYLHSHNIIYRDLKPENILLDRNGHIKITDFGFAK-EVDT-VTWTLCG 201

Query: 189 SPHYAAPEIVSGLPYEGFASDVWSCGVILFALLTGRLPFDEENGNVRDLLLKVQKGQFEM 248
            P Y APE+++  PY   + D WS GV++F +L G  PF +          K+ +G+   
Sbjct: 202 PPDYIAPEVIATKPYNK-SVDWWSLGVLIFEMLAGYTPFYDTTP--MKTYEKILQGKVVY 258

Query: 249 PNDTEISRDAQDLIGKILVVDPRQRI-----KIRDILSHPLL 285
           P  T    D  DL+GK++  D  +RI       +DI  HP  
Sbjct: 259 P--TFFHPDVVDLLGKLITADLTRRIGNLQSGSKDIKCHPWF 298

>KNAG0I01480 Chr9 (287733..289055) [1323 bp, 440 aa] {ON} Anc_1.374
           YFR014C
          Length = 440

 Score =  147 bits (370), Expect = 5e-37,   Method: Compositional matrix adjust.
 Identities = 90/273 (32%), Positives = 146/273 (53%), Gaps = 18/273 (6%)

Query: 21  WKLGETLGFGSTGKVQLAQHERTGHRTAVKVISKSIFNNNGNHSNDDSVLPYNIEREIVI 80
           ++ G+T+G G+ G V+ A    TG   AVK+I K     N         + Y+   E+ I
Sbjct: 41  YEFGKTMGAGTFGVVRKATKISTGEEVAVKIILKKALEGNDIQLQ----MLYD---ELAI 93

Query: 81  MKLLSHPNVLSLYDVWETNNNLYLILEYAEKGELFNLLVDHGPLPEREAINCFRQIIIGI 140
           ++ L HPN++     +E+ + +Y++ + A  GELF+ ++  G   E +A++   QI+  +
Sbjct: 94  LQQLKHPNIVEFKAWFESKDKIYIVTQLATGGELFDTILKRGKFTELDAVDIVVQILKAV 153

Query: 141 SYCHALGIVHRDLKPENLLL---DSFYNIKIADFGMAA-LQTDADLLETSCGSPHYAAPE 196
            Y H+  +VHRDLKPEN+L         I IADFG+A  L+ + DL+  + GS  Y APE
Sbjct: 154 EYIHSQNVVHRDLKPENILYVDESEKSQIVIADFGIAKRLEGEGDLIFKAAGSLGYVAPE 213

Query: 197 IV--SGLPYEGFASDVWSCGVILFALLTGRLPFDEE--NGNVRDLLLKVQKGQFEMPNDT 252
           ++  SG    G   D+WS G+I + LL G  PF  E  +G + +++   +   F  P   
Sbjct: 214 VLLNSG---HGKPCDIWSVGIIAYTLLCGYSPFVAEDVDGFLDEIVENEEPIAFHSPYWD 270

Query: 253 EISRDAQDLIGKILVVDPRQRIKIRDILSHPLL 285
           EIS +A+  I + + +DP QR    ++L  P +
Sbjct: 271 EISNEAKQFILRAVTIDPFQRPTATELLKDPWI 303

>Kpol_1004.19 s1004 (36090..36101,36217..37689) [1485 bp, 494 aa]
           {ON} (36090..36101,36217..37689) [1485 nt, 495 aa]
          Length = 494

 Score =  147 bits (372), Expect = 7e-37,   Method: Compositional matrix adjust.
 Identities = 92/297 (30%), Positives = 147/297 (49%), Gaps = 36/297 (12%)

Query: 12  AKPSSTIGPWKLGETLGFGSTGKVQLAQHERTGHRTAVKVISKSIFNNNGNHSNDDSVLP 71
           A+  S    + +G+ LG G    V+  ++++TG   A+K+    +        NDD    
Sbjct: 173 ARQESVFDKYIIGKELGSGHYAIVKEGRNKKTGQSVAIKIFHPQL--------NDDQKKN 224

Query: 72  YNIEREIVIMKLLSHPNVLSLYDVW-----ETNNNLYLILEYAEKGELFNLLVDHGPLPE 126
           +    E  I+  + HPN+++L D +     ++    YL+L+  + GELF+ +V    L +
Sbjct: 225 HQFREETDILMRVHHPNIVNLLDSYVEPLSKSQIQKYLVLDKIDDGELFDRIVRKTSLSQ 284

Query: 127 REAINCFRQIIIGISYCHALGIVHRDLKPENLLLDSF-------------------YNIK 167
            E    F+QI+ GI Y H   I+HRD+KPEN+LL+                       +K
Sbjct: 285 NETKALFKQILSGIQYLHGQNIIHRDIKPENILLNITRRTSNDQIKTGPWDEDEIDIQVK 344

Query: 168 IADFGMAALQTDADLLETSCGSPHYAAPEIVSGLPYEGFASDVWSCGVILFALLTGRLPF 227
           IADFG+A    +     T CG+P Y APE++    Y     D+WS GV+L+  L G  PF
Sbjct: 345 IADFGLAKFTGELQFTNTLCGTPSYVAPEVLRKTGYTS-KVDIWSTGVLLYVCLCGFPPF 403

Query: 228 DEENG--NVRDLLLKVQKGQFEMPNDTEISRDAQDLIGKILVVDPRQRIKIRDILSH 282
            ++ G   +++ +L+  K  F  P   EI+     LI  +LVV+P QR  I D+++H
Sbjct: 404 SDQLGPPTLKEQILQ-GKFAFFSPYWDEINDSVLHLISNLLVVNPAQRYSIEDMINH 459

>CAGL0J11638g Chr10 complement(1130744..1132984) [2241 bp, 746 aa]
           {ON} highly similar to uniprot|P32562 Saccharomyces
           cerevisiae YMR001c CDC5 involved in regulation of DNA
           replication
          Length = 746

 Score =  150 bits (380), Expect = 1e-36,   Method: Compositional matrix adjust.
 Identities = 83/215 (38%), Positives = 125/215 (58%), Gaps = 10/215 (4%)

Query: 77  EIVIMKLLSHPNVLSLYDVWETNNNLYLILEYAEKGELFNLLVDHGPLPEREAINCFRQI 136
           EI I K +SH N++   D +E N N+Y++LE    G L  L+     + E E      QI
Sbjct: 128 EIQIHKSMSHTNIVQFIDCFEDNVNVYILLEICPNGSLMELIKKRKTITEPEVRFFMTQI 187

Query: 137 IIGISYCHALGIVHRDLKPENLLLDSFYNIKIADFGMAA-LQTDADLLETSCGSPHYAAP 195
             GI Y H+  ++HRDLK  N+  D  YN+KI DFG+AA L  D +   T CG+P+Y AP
Sbjct: 188 CGGIQYMHSNRVIHRDLKLGNIFFDEHYNLKIGDFGLAAVLANDRERKFTICGTPNYIAP 247

Query: 196 EIV----SGLPYEGFASDVWSCGVILFALLTGRLPFDEENGNVRDLLLKVQKGQFEMPND 251
           E++    SG  YE    D+WS GV+L+ALL G+ PF  ++ N   +  ++++  F  P D
Sbjct: 248 EVLMGKHSGHSYE---VDIWSIGVMLYALLIGKPPFQAKDVNT--IYERIKQRNFAYPKD 302

Query: 252 TEISRDAQDLIGKILVVDPRQRIKIRDILSHPLLK 286
            +IS+DA+ LI  IL ++P +R  I++I+ +   +
Sbjct: 303 KKISQDAKYLIDDILSLNPMERPSIQEIMDYVWFR 337

>KLTH0H03982g Chr8 complement(363432..364628) [1197 bp, 398 aa] {ON}
           similar to uniprot|P38991 Saccharomyces cerevisiae
           YPL209C IPL1 Aurora kinase involved in regulating
           kinetochore-microtubule attachments associates with
           Sli5p which stimulates Ipl1p kinase activity and
           promotes its association with the mitotic spindle
           potential Cdc28p substrate
          Length = 398

 Score =  145 bits (365), Expect = 1e-36,   Method: Compositional matrix adjust.
 Identities = 82/257 (31%), Positives = 133/257 (51%), Gaps = 21/257 (8%)

Query: 35  VQLAQHERTGHRTAVKVISKSIFNNNGNHSNDDSVLPYNIE----REIVIMKLLSHPNVL 90
           V   +H++TG   A+K + K              ++ YN+E    RE+ I   L HPN+ 
Sbjct: 154 VYCVKHKQTGFICALKAMKKK------------EIIQYNVEKQFRREVEIQSSLKHPNLT 201

Query: 91  SLYDVWETNNNLYLILEYAEKGELFNLLVDHGPLPEREAINCFRQIIIGISYCHALGIVH 150
            LY  +     +YL++EY   GEL+  L  HGP  +  A +   Q+   + Y H+  I+H
Sbjct: 202 RLYGYFHDEKRVYLLMEYLVNGELYKHLRSHGPFNDIVASHFVYQMADALDYMHSKHIIH 261

Query: 151 RDLKPENLLLDSFYNIKIADFGMAALQTDADLLETSCGSPHYAAPEIVSGLPYEGFASDV 210
           RD+KPEN+LL     +K+ DFG +    +     T CG+  Y +PE++    Y+    DV
Sbjct: 262 RDIKPENILLGFQNTLKLTDFGWSVTNLNNSRRRTLCGTMDYLSPELIKSREYDN-KVDV 320

Query: 211 WSCGVILFALLTGRLPFDEENGNVRDLLLKVQKGQFEMPNDTEISRDAQDLIGKILVVDP 270
           W+ GV+ + LL G  PF E++  +     ++++   + P+   IS  A+D+I K+L  +P
Sbjct: 321 WALGVLTYELLVGTPPFLEDSKEM--TYKRIKRRDLKFPD--HISSQARDIISKLLEYEP 376

Query: 271 RQRIKIRDILSHPLLKK 287
             RI +RD+  HP + K
Sbjct: 377 NARIALRDVKKHPWILK 393

>Skud_10.50 Chr10 complement(84697..85890) [1194 bp, 397 aa] {ON}
           YJL164C (REAL)
          Length = 397

 Score =  144 bits (364), Expect = 1e-36,   Method: Compositional matrix adjust.
 Identities = 85/269 (31%), Positives = 140/269 (52%), Gaps = 24/269 (8%)

Query: 26  TLGFGSTGKVQLAQHERTGHRTAVKVISKSIFN--NNGNHSNDDSVLPYNIEREIVIMKL 83
           TLG GS G+V L +    G   A+KV+ K I        H+ND          E +++ +
Sbjct: 92  TLGTGSFGRVHLIRSRHNGRYYAMKVLKKEIVVRLKQVEHTND----------ERLMLSI 141

Query: 84  LSHPNVLSLYDVWETNNNLYLILEYAEKGELFNLLVDHGPLPEREAINCFRQIIIGISYC 143
           ++HP ++ ++  ++ +  +++I++Y E GELF+LL      P   A     ++ + + Y 
Sbjct: 142 VTHPFIIRMWGTFQDSQQIFMIMDYIEGGELFSLLRKSQRFPNPVAKFYAAEVCLALEYL 201

Query: 144 HALGIVHRDLKPENLLLDSFYNIKIADFGMAALQTDADLLETSCGSPHYAAPEIVSGLPY 203
           H+  I++RDLKPEN+LLD   +IKI DFG A      D+  T CG+P Y APE+VS  PY
Sbjct: 202 HSKDIIYRDLKPENILLDKNGHIKITDFGFAKYV--PDVTYTLCGTPDYIAPEVVSTKPY 259

Query: 204 EGFASDVWSCGVILFALLTGRLPFDEENGNVRDLLLKVQKGQFEMPNDTEISRDAQDLIG 263
              + D WS G++++ +L G  PF   + N      K+   +   P     + D +DL+ 
Sbjct: 260 NK-SIDWWSFGILIYEMLAGYTPF--YDSNTMKTYEKILNAELRFP--PFFNEDVKDLLS 314

Query: 264 KILVVDPRQRI-----KIRDILSHPLLKK 287
           +++  D  QR+        D+ +HP  K+
Sbjct: 315 RLITRDLSQRLGNLQNGTEDVKNHPWFKE 343

>SAKL0E05984g Chr5 complement(485895..487391,487462..487482) [1518
           bp, 505 aa] {ON} similar to uniprot|P39009 Saccharomyces
           cerevisiae YDL101C DUN1 Cell-cycle checkpoint
           serine-threonine kinase required for DNA damage-induced
           transcription of certain target genes phosphorylation of
           Rad55p and Sml1p and transient G2/M arrest after DNA
           damage also regulates postreplicative DNA repair
          Length = 505

 Score =  147 bits (370), Expect = 1e-36,   Method: Compositional matrix adjust.
 Identities = 100/325 (30%), Positives = 152/325 (46%), Gaps = 36/325 (11%)

Query: 2   TVANTETHSAAKPSSTIGPWKLGETLGFGSTGKVQLAQHERTGHRTAVKVISKSIFNNNG 61
           T +     +  KP S    +  G+ LG G    V+ A ++ TG   AVK+          
Sbjct: 170 TTSRKLAKTKEKPRSFFDKYIAGKELGTGHYAVVKEAINKETGQIAAVKIFHP------- 222

Query: 62  NHSNDDSVLPYNIEREIVIMKLLSHPNVLSLYD-----VWETNNNLYLILEYAEKGELFN 116
              NDD         E  I+  + H N++ L D     V +++   YL+LE    GELF+
Sbjct: 223 -QQNDDQKKTKQFRDETKILMRIQHKNIVKLLDRFVEPVSKSHIQTYLVLEKINDGELFD 281

Query: 117 LLVDHGPLPEREAINCFRQIIIGISYCHALGIVHRDLKPENLLL---------------- 160
            +V    L + E    F+Q++ G+ Y H+  I+HRD+KPEN+LL                
Sbjct: 282 RIVRKTKLEQDETRAIFKQLLNGLKYLHSENIIHRDIKPENILLSIQKRKSSEEKCLGPW 341

Query: 161 ---DSFYNIKIADFGMAALQTDADLLETSCGSPHYAAPEIVSGLPYEGFASDVWSCGVIL 217
              +    +KIADFG+A    +     T CG+P Y APE+++   Y     D+WS GV+L
Sbjct: 342 DRDEIDIKVKIADFGLAKFTGEMKFTNTLCGTPSYVAPEVLTKTGYTA-KVDMWSAGVLL 400

Query: 218 FALLTGRLPFDEENG--NVRDLLLKVQKGQFEMPNDTEISRDAQDLIGKILVVDPRQRIK 275
           +  L G  PF E+    ++++ +L+  K  F  P   EI   A  LI  +LVV+P QR  
Sbjct: 401 YVCLCGFPPFSEQLSPPSMKEQILQ-GKYAFYSPYWDEIDDSALHLISNLLVVNPAQRFS 459

Query: 276 IRDILSHPLLKKYQTIKDSKSIKDL 300
           + D ++HP     +    S S+K L
Sbjct: 460 VNDTINHPWFDGMRQDSMSSSMKRL 484

>KAFR0H02510 Chr8 complement(476574..479213) [2640 bp, 879 aa] {ON}
           Anc_8.668 YPL150W
          Length = 879

 Score =  151 bits (381), Expect = 1e-36,   Method: Compositional matrix adjust.
 Identities = 97/273 (35%), Positives = 141/273 (51%), Gaps = 22/273 (8%)

Query: 18  IGPWKLGETLGFGSTGKVQLAQHERTGHRTAVKVISKSIFNNNGNHSNDDSVLPYNIERE 77
           +G +++ + +G GS GKV LA H  T  +  +K   K          ND      NI RE
Sbjct: 38  VGNYRILKQIGEGSFGKVYLALHRPTHRKVVLKTSDK----------NDP-----NIVRE 82

Query: 78  IVIMKLLSHPNVLSLYDVWETNNNLYLILEYAEKGELFNLLVDHGPLPEREAINCFRQII 137
           +   +   +P +  +Y++  T   +++ LEY    EL++ L+    +P  E    F QI+
Sbjct: 83  VFYHRQFDYPYITKVYEIIVTETKVWMALEYCPGKELYDHLLFSKRIPIAECTELFAQIV 142

Query: 138 IGISYCHALGIVHRDLKPENLLLDSFYNIKIADFGMAALQTDADLLETSCGSPHYAAPEI 197
             + Y H+L  VHRDLK EN+LLD     K+ DFG          LET CG+  Y APE+
Sbjct: 143 GAVYYAHSLNCVHRDLKLENILLDKHGRAKLTDFGFTRECMTRSTLETVCGTTVYMAPEL 202

Query: 198 VSGLPYEGFASDVWSCGVILFALLTGRLPFDEENGNVRDLLLKVQKGQFEMPNDTE--IS 255
           +    Y+GF  D+W+ GVIL+ ++ G +PFDE+     D +    K   E P+ T    S
Sbjct: 203 IERKSYDGFKIDIWALGVILYTMIYGAMPFDED-----DEVKTKWKIVNEDPDFTNNISS 257

Query: 256 RDAQDLIGKILVVDPRQRIKIRDILSHPLLKKY 288
            D +DLI K+L  DP +R  IR+IL H  LK Y
Sbjct: 258 NDVKDLIKKLLKKDPTERPTIREILKHDFLKPY 290

>Suva_15.155 Chr15 complement(267680..269038) [1359 bp, 452 aa] {ON}
           YOL016C (REAL)
          Length = 452

 Score =  145 bits (367), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 92/269 (34%), Positives = 143/269 (53%), Gaps = 14/269 (5%)

Query: 23  LGETLGFGSTGKVQLAQHERTGHRTAVKVISKSIFNNNGNHSNDDSVLPYNIEREIVIMK 82
            G TLG GS G V+ A+   T    A+K++ K     N       ++    +  E+ I++
Sbjct: 49  FGRTLGAGSFGVVRQARKLSTNEDVAIKILLKKALQGN-------NIQLQMLYEELSILQ 101

Query: 83  LLSHPNVLSLYDVWETNNNLYLILEYAEKGELFNLLVDHGPLPEREAINCFRQIIIGISY 142
            LSHPN++S  D +E+ +  Y++ + A  GELF+ ++  G   E +A+    QI+  + Y
Sbjct: 102 KLSHPNIVSFKDWFESKDKFYIVTQLATGGELFDRILSRGKFTEIDAVEIIVQILGAVEY 161

Query: 143 CHALGIVHRDLKPENLL-LDSFYN--IKIADFGMA-ALQTDADLLETSCGSPHYAAPEIV 198
            H+  +VHRDLKPEN+L +D   N  + IADFG+A  L+   DL+  + GS  Y APE++
Sbjct: 162 IHSKNVVHRDLKPENVLYVDKSDNSPLVIADFGIAKQLKGKEDLIYKAAGSLGYVAPEVL 221

Query: 199 SGLPYEGFASDVWSCGVILFALLTGRLPFDEEN--GNVRDLLLKVQKGQFEMPNDTEISR 256
           +   + G   D+WS GVI + LL G  PF  E+  G + +         F MP    IS 
Sbjct: 222 TQDGH-GKPCDIWSVGVITYTLLCGYSPFIAESVEGFMEECTASRYPVTFHMPYWDNISV 280

Query: 257 DAQDLIGKILVVDPRQRIKIRDILSHPLL 285
           DA+  I K L+++P  R    ++L  P +
Sbjct: 281 DAKRFILKALILNPADRPTATELLDDPWI 309

>TPHA0G01600 Chr7 complement(329313..331850) [2538 bp, 845 aa] {ON}
           Anc_8.676 YPL153C
          Length = 845

 Score =  150 bits (380), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 92/277 (33%), Positives = 145/277 (52%), Gaps = 29/277 (10%)

Query: 25  ETLGFGSTGKVQLAQHERTGHRTAVKVISKSIFNNNGNHSNDDSVLPYNIEREIVIMKLL 84
           E +G G+   V+ A    TG   AVK+ISK     N +           + RE+ +++ L
Sbjct: 201 EVVGQGAFAIVKKAVERSTGKTFAVKIISKRKVMGNMD----------GVTRELEVLRKL 250

Query: 85  SHPNVLSLYDVWETNNNLYLILEYAEKGELFNLLVDHGPLPEREAINCFRQIIIGISYCH 144
            HP ++ L   +E   + YL++E+   G+L + +  HG + E       RQI+  + Y H
Sbjct: 251 DHPRIVRLKGFYEDEESYYLLMEFVSGGDLMDFVAAHGSVGEDAGREITRQILEAVKYIH 310

Query: 145 ALGIVHRDLKPENLLL--DSFYNIKIADFGMAALQTDADLLETSCGSPHYAAPEIVSG-- 200
           +  I HRDLKP+N+L+  D    +KI DFG+A +Q +   ++T CG+  Y APEI+SG  
Sbjct: 311 SKCISHRDLKPDNILIEQDDPVLVKITDFGLAKVQGNGTFMKTFCGTLAYVAPEIISGSN 370

Query: 201 --------LPYEGFASDVWSCGVILFALLTGRLPFDEENGNVRDLLLK-VQKGQF-EMP- 249
                     Y     D+WS G +++ +LTG LPF   +G+ ++ L K V+ G + E P 
Sbjct: 371 NLEENEERNEYSSLV-DMWSIGCLVYVILTGHLPF---SGSTQEQLYKQVRNGSYHEGPL 426

Query: 250 NDTEISRDAQDLIGKILVVDPRQRIKIRDILSHPLLK 286
            D  IS +A++ I  +L V+P  R+     L HP +K
Sbjct: 427 KDFRISDEARNFIDSLLQVNPNDRLSAERALQHPWIK 463

>Skud_4.154 Chr4 complement(275783..277324) [1542 bp, 513 aa] {ON}
           YDL101C (REAL)
          Length = 513

 Score =  147 bits (370), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 96/306 (31%), Positives = 152/306 (49%), Gaps = 40/306 (13%)

Query: 12  AKPSSTIGPWKLGETLGFGSTGKVQLAQHERTGHRTAVKVISKSIFNNNGNHSNDDSVLP 71
            KP S    + LG+ LG G    V+ A+++++G + AVK+             NDD    
Sbjct: 191 TKPVSFFDKYLLGKELGAGHYALVKEAKNKKSGQQVAVKIFHA--------QQNDDQKKN 242

Query: 72  YNIEREIVIMKLLSHPNVLSLYD-----VWETNNNLYLILEYAEKGELFNLLVDHGPLPE 126
                E  I+  + HPN+++L D     + ++    YL+LE  + GELF  +V    L +
Sbjct: 243 KQFREETNILMRVHHPNIVNLLDSFVEPISKSQIQKYLVLEKIDDGELFERIVRKTCLRQ 302

Query: 127 REAINCFRQIIIGISYCHALGIVHRDLKPENLLLDSF-------------------YNIK 167
            E+   F+Q++ G+ Y H   I+HRD+KPEN+LL+                       +K
Sbjct: 303 DESKALFKQLLTGLKYLHEQNIIHRDIKPENILLNITRRENSNQAQLGPWDEDEIDIQVK 362

Query: 168 IADFGMAALQTDADLLETSCGSPHYAAPEIVSGLPYEGFAS--DVWSCGVILFALLTGRL 225
           IADFG+A    +     T CG+P Y APE+   L  +G++S  D+WS GVIL+  L G  
Sbjct: 363 IADFGLAKFTGEMQFTNTLCGTPSYVAPEV---LTKKGYSSKVDLWSAGVILYVCLCGFP 419

Query: 226 PFDEENG--NVRDLLLKVQKGQFEMPNDTEISRDAQDLIGKILVVDPRQRIKIRDILSHP 283
           PF ++ G  ++++ +L+  K  F  P   +I      LI  +LV++P +R  I + + HP
Sbjct: 420 PFSDQLGPPSLKEQILQA-KYAFYSPYWDKIDDLVLHLISNLLVLNPDERYNIDEAMDHP 478

Query: 284 LLKKYQ 289
             K  Q
Sbjct: 479 WFKDLQ 484

>Suva_6.78 Chr6 (135988..137325) [1338 bp, 445 aa] {ON} YFR014C
           (REAL)
          Length = 445

 Score =  145 bits (366), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 94/284 (33%), Positives = 151/284 (53%), Gaps = 20/284 (7%)

Query: 12  AKPSSTIGP--WKLGETLGFGSTGKVQLAQHERTGHRTAVKVISKSIFNNNGNHSNDDSV 69
           A+P+S      +  G+TLG G+ G V+ A++  TG   AVK++ K     N        +
Sbjct: 26  AQPASYANKKNYVFGKTLGAGTFGVVRQARNSETGEDVAVKILIKKALKGN-------KI 78

Query: 70  LPYNIEREIVIMKLLSHPNVLSLYDVWETNNNLYLILEYAEKGELFNLLVDHGPLPEREA 129
               +  E+ I++ L HPN+++  D +E+N+  Y+I + A+ GELF+ ++  G   E +A
Sbjct: 79  QLEALYDELDILQRLHHPNIVAFKDWFESNDKFYIITQLAKGGELFDRILKKGKFTEVDA 138

Query: 130 INCFRQIIIGISYCHALGIVHRDLKPENLLLDSFYN---IKIADFGMAA-LQTDADLLET 185
           +    +I+  + Y H+  IVHRDLKPENLL     +   + IADFG+A  L++D +L+  
Sbjct: 139 VRILVEILSAVKYMHSQNIVHRDLKPENLLYIDKSDESPLVIADFGIAKRLKSDEELIYK 198

Query: 186 SCGSPHYAAPEIVSGLPYEGFASDVWSCGVILFALLTGRLPFDEENGNVRDLLLKVQKGQ 245
           + GS  Y APE+++   + G   D+WS GVI + LL G   F  E   V D L +   G+
Sbjct: 199 AAGSLGYVAPEVLTQDGH-GKPCDIWSIGVITYTLLCGYSAFKAE--RVLDFLDECTTGK 255

Query: 246 ----FEMPNDTEISRDAQDLIGKILVVDPRQRIKIRDILSHPLL 285
               F  P    +S  A+  I K L ++P +R    ++L  P +
Sbjct: 256 YPVTFHRPYWDSVSDKAKRFILKALDLNPAKRPTAAELLEDPWI 299

>ZYRO0F07370g Chr6 (595931..598219) [2289 bp, 762 aa] {ON} similar
           to uniprot|P22216 Saccharomyces cerevisiae YPL153C RAD53
           Protein kinase required for cell-cycle arrest in
           response to DNA damage activated by trans
           autophosphorylation when interacting with
           hyperphosphorylated Rad9p
          Length = 762

 Score =  150 bits (378), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 86/276 (31%), Positives = 144/276 (52%), Gaps = 28/276 (10%)

Query: 25  ETLGFGSTGKVQLAQHERTGHRTAVKVISKSIFNNNGNHSNDDSVLPYNIEREIVIMKLL 84
           E +G G+   V+ A    TG   A K+ISK     N +           ++RE+ +++ L
Sbjct: 190 EVVGQGAFAVVKKAVERSTGKTFAAKIISKRKLMGNWD----------GVDRELAVLRKL 239

Query: 85  SHPNVLSLYDVWETNNNLYLILEYAEKGELFNLLVDHGPLPEREAINCFRQIIIGISYCH 144
            HP ++ L   +E     YL++E+   G+L + +  HG + E       RQ++  ++Y H
Sbjct: 240 HHPRIVRLKGFYEDKECYYLLMEFVSGGDLMDFVAAHGSVGEDAGREITRQVLEAVAYIH 299

Query: 145 ALGIVHRDLKPENLLL--DSFYNIKIADFGMAALQTDADLLETSCGSPHYAAPEIVSGL- 201
           + GI HRDLKP+N+L+  D    +K+ DFG+A +Q +   ++T CG+  Y APE++ G  
Sbjct: 300 SRGISHRDLKPDNILIEQDDPVLVKVTDFGLAKVQGNGTFMKTFCGTLAYVAPEVIGGKN 359

Query: 202 --------PYEGFASDVWSCGVILFALLTGRLPFDEENGNVRDLLL-KVQKGQF-EMP-N 250
                    Y     D+WS G +++ +LTG LPF   +G+ ++ L  ++ +G + E P  
Sbjct: 360 DNTEEEKNEYSSLV-DMWSMGCLVYVILTGHLPF---SGSTQEQLYEQISRGSYHEGPLK 415

Query: 251 DTEISRDAQDLIGKILVVDPRQRIKIRDILSHPLLK 286
           D  IS +A+D I  +L V+P  R      L HP ++
Sbjct: 416 DFRISDEARDFIDSLLQVNPNLRTTAEKALQHPWIR 451

>KLLA0B02332g Chr2 complement(206863..207948) [1086 bp, 361 aa] {ON}
           similar to uniprot|P38991 Saccharomyces cerevisiae
           YPL209C IPL1 Aurora kinase involved in regulating
           kinetochore-microtubule attachments associates with
           Sli5p which stimulates Ipl1p kinase activity and
           promotes its association with the mitotic spindle
           potential Cdc28p substrate
          Length = 361

 Score =  143 bits (360), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 85/281 (30%), Positives = 141/281 (50%), Gaps = 21/281 (7%)

Query: 9   HSAAKPSSTIGPWKLGETLGFGSTGKVQLAQHERTGHRTAVKVISKSIFNNNGNHSNDDS 68
           H+    + T+  +++G+ LG G  GKV   +H  TG   A+K + K              
Sbjct: 88  HNDKFENMTLQDFEIGKILGKGKFGKVYCVKHRETGLICALKAMEKK------------E 135

Query: 69  VLPYNIE----REIVIMKLLSHPNVLSLYDVWETNNNLYLILEYAEKGELFNLLVDHGPL 124
           ++ Y I+    RE+ I     H N+  LY  +     +YL++EY   GEL+  L ++GPL
Sbjct: 136 IVQYTIQKQFRREVEIQGSFKHKNLTQLYGFFYDEKRVYLLMEYVYYGELYKFLKNNGPL 195

Query: 125 PEREAINCFRQIIIGISYCHALGIVHRDLKPENLLLDSFYNIKIADFGMAALQTDADLLE 184
            E  A     Q+   + Y H+  I+HRD+KPEN+L+     IK+ DFG +    D    +
Sbjct: 196 NETLASYFVYQMANALDYMHSKNILHRDIKPENILIGFNNTIKLTDFGWSVYNEDGQKRK 255

Query: 185 TSCGSPHYAAPEIVSGLPYEGFASDVWSCGVILFALLTGRLPFDEENGNVRDLLLKVQKG 244
           T CG+  Y +PE++    Y     DVW+ GV+ + LL G  PF+E+   +     ++ + 
Sbjct: 256 TLCGTIDYLSPELIKSREYNN-KVDVWALGVLTYELLVGSPPFEEDTKEM--TYRRILRC 312

Query: 245 QFEMPNDTEISRDAQDLIGKILVVDPRQRIKIRDILSHPLL 285
             + P    +S  A+DLI ++L  +P +RI + ++ SH  +
Sbjct: 313 DLKFP--LNVSPQARDLIVRLLQFEPSKRIPLSEVKSHAWI 351

>Skud_15.144 Chr15 complement(254620..255969) [1350 bp, 449 aa] {ON}
           YOL016C (REAL)
          Length = 449

 Score =  145 bits (366), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 93/269 (34%), Positives = 142/269 (52%), Gaps = 14/269 (5%)

Query: 23  LGETLGFGSTGKVQLAQHERTGHRTAVKVISKSIFNNNGNHSNDDSVLPYNIEREIVIMK 82
            G TLG GS G V+ A+   T    A+K++ K     N       +V    +  E+ I++
Sbjct: 49  FGRTLGAGSFGVVRQARKLSTNEDVAIKILLKKALQGN-------NVQLQMLYEELSILQ 101

Query: 83  LLSHPNVLSLYDVWETNNNLYLILEYAEKGELFNLLVDHGPLPEREAINCFRQIIIGISY 142
            LSHPN+++  D +E+ +  Y++ + A  GELF+ ++  G   E +A+    QI+  + Y
Sbjct: 102 KLSHPNIVAFKDWFESKDKFYIVTQLATGGELFDRILSRGKFTEVDAVEIVVQILGAVEY 161

Query: 143 CHALGIVHRDLKPENLL-LDSFYN--IKIADFGMA-ALQTDADLLETSCGSPHYAAPEIV 198
            H+  +VHRDLKPEN+L +D   N  + IADFG+A  L+   DL+  + GS  Y APE++
Sbjct: 162 MHSKNVVHRDLKPENVLYVDKSENSPLVIADFGIAKQLKGKEDLIYKAAGSLGYVAPEVL 221

Query: 199 SGLPYEGFASDVWSCGVILFALLTGRLPFDEEN--GNVRDLLLKVQKGQFEMPNDTEISR 256
           +   + G   D+WS GVI + LL G  PF  E+  G + +         F MP    IS 
Sbjct: 222 TQDGH-GKPCDIWSIGVITYTLLCGYSPFIAESVEGFMEECTAYRYPVTFHMPYWDSISV 280

Query: 257 DAQDLIGKILVVDPRQRIKIRDILSHPLL 285
           DA+  I K L +DP  R    ++L  P +
Sbjct: 281 DAKHFILKALRLDPADRPTATELLDDPWI 309

>YJL164C Chr10 complement(109966..111159) [1194 bp, 397 aa] {ON}
           TPK1cAMP-dependent protein kinase catalytic subunit;
           promotes vegetative growth in response to nutrients via
           the Ras-cAMP signaling pathway; inhibited by regulatory
           subunit Bcy1p in the absence of cAMP; partially
           redundant with Tpk2p and Tpk3p
          Length = 397

 Score =  144 bits (363), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 92/301 (30%), Positives = 151/301 (50%), Gaps = 31/301 (10%)

Query: 1   MTVANTETHSA--AKPSSTIGPWKLGE-----TLGFGSTGKVQLAQHERTGHRTAVKVIS 53
           +T  N E +    A+   T G + L +     TLG GS G+V L +    G   A+KV+ 
Sbjct: 60  VTYYNEEQYKQFIAQARVTSGKYSLQDFQILRTLGTGSFGRVHLIRSRHNGRYYAMKVLK 119

Query: 54  KSIFN--NNGNHSNDDSVLPYNIEREIVIMKLLSHPNVLSLYDVWETNNNLYLILEYAEK 111
           K I        H+ND          E +++ +++HP ++ ++  ++    +++I++Y E 
Sbjct: 120 KEIVVRLKQVEHTND----------ERLMLSIVTHPFIIRMWGTFQDAQQIFMIMDYIEG 169

Query: 112 GELFNLLVDHGPLPEREAINCFRQIIIGISYCHALGIVHRDLKPENLLLDSFYNIKIADF 171
           GELF+LL      P   A     ++ + + Y H+  I++RDLKPEN+LLD   +IKI DF
Sbjct: 170 GELFSLLRKSQRFPNPVAKFYAAEVCLALEYLHSKDIIYRDLKPENILLDKNGHIKITDF 229

Query: 172 GMAALQTDADLLETSCGSPHYAAPEIVSGLPYEGFASDVWSCGVILFALLTGRLPFDEEN 231
           G A      D+  T CG+P Y APE+VS  PY   + D WS G++++ +L G  PF   +
Sbjct: 230 GFAKYV--PDVTYTLCGTPDYIAPEVVSTKPYNK-SIDWWSFGILIYEMLAGYTPF--YD 284

Query: 232 GNVRDLLLKVQKGQFEMPNDTEISRDAQDLIGKILVVDPRQRI-----KIRDILSHPLLK 286
            N      K+   +   P     + D +DL+ +++  D  QR+        D+ +HP  K
Sbjct: 285 SNTMKTYEKILNAELRFP--PFFNEDVKDLLSRLITRDLSQRLGNLQNGTEDVKNHPWFK 342

Query: 287 K 287
           +
Sbjct: 343 E 343

>SAKL0A04246g Chr1 complement(396019..397221) [1203 bp, 400 aa] {ON}
           similar to uniprot|P38991 Saccharomyces cerevisiae
           YPL209C IPL1 Aurora kinase involved in regulating
           kinetochore-microtubule attachments associates with
           Sli5p which stimulates Ipl1p kinase activity and
           promotes its association with the mitotic spindle
           potential Cdc28p substrate
          Length = 400

 Score =  144 bits (363), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 83/257 (32%), Positives = 137/257 (53%), Gaps = 21/257 (8%)

Query: 35  VQLAQHERTGHRTAVKVISKSIFNNNGNHSNDDSVLPYNIE----REIVIMKLLSHPNVL 90
           V   +H++TG   A+K + K              +  YN++    RE+ I   L HPN+ 
Sbjct: 154 VYCVRHKKTGFICALKAMEKK------------EITQYNVQKQFRREVEIQASLRHPNLT 201

Query: 91  SLYDVWETNNNLYLILEYAEKGELFNLLVDHGPLPEREAINCFRQIIIGISYCHALGIVH 150
            LY  +  +  +YL++EY   GEL+  L  +GP  +  A     Q+   ++Y H   ++H
Sbjct: 202 QLYGYFYDDKRVYLLMEYLVNGELYRHLRVNGPFNDILASYYVNQMADALNYMHDRNVLH 261

Query: 151 RDLKPENLLLDSFYNIKIADFGMAALQTDADLLETSCGSPHYAAPEIVSGLPYEGFASDV 210
           RD+KPEN+L+     +K+ DFG + + T     +T CG+  Y +PE+V    Y+    DV
Sbjct: 262 RDIKPENILIGFQNTLKLTDFGWSVISTTGAKRKTLCGTLDYLSPELVKYREYDE-KVDV 320

Query: 211 WSCGVILFALLTGRLPFDEENGNVRDLLLKVQKGQFEMPNDTEISRDAQDLIGKILVVDP 270
           W+ GV+ + LL G  PF+E +  +     ++ +     P+  ++S DA+DLIG++L  DP
Sbjct: 321 WALGVLAYELLVGTPPFEEASKEL--TYKRIVRRDLRFPD--QMSIDARDLIGRLLENDP 376

Query: 271 RQRIKIRDILSHPLLKK 287
             RI ++D+LSHP + K
Sbjct: 377 STRISLKDVLSHPWIVK 393

>Smik_7.319 Chr7 complement(534132..535472) [1341 bp, 446 aa] {ON}
           YFR014C (REAL)
          Length = 446

 Score =  145 bits (365), Expect = 3e-36,   Method: Compositional matrix adjust.
 Identities = 94/288 (32%), Positives = 151/288 (52%), Gaps = 22/288 (7%)

Query: 8   THSAAKPSSTIGP--WKLGETLGFGSTGKVQLAQHERTGHRTAVKVISKSIFNNNGNHSN 65
           TH   +P+S +    +  G+TLG G+ G V+ A++  TG   AVK++ K     N     
Sbjct: 24  TH--VQPASYVNKKNYVFGKTLGAGTFGVVRQARNTETGEDVAVKILIKKALKGN----- 76

Query: 66  DDSVLPYNIEREIVIMKLLSHPNVLSLYDVWETNNNLYLILEYAEKGELFNLLVDHGPLP 125
              +    +  E+ I++ L HPN+++  D +E+ +  Y+I + A+ GELF+ ++  G   
Sbjct: 77  --KIQLEALYDELDILQRLHHPNIVAFKDWFESKDKFYIITQLAKGGELFDRILKKGKFT 134

Query: 126 EREAINCFRQIIIGISYCHALGIVHRDLKPENLLLDSFYN---IKIADFGMAA-LQTDAD 181
           E +A+    +I+  + Y H+  IVHRDLKPENLL     +   + +ADFG+A  L++D +
Sbjct: 135 EVDAVRILVEILSAVKYMHSQNIVHRDLKPENLLYIDKSDESPLVVADFGIAKRLKSDEE 194

Query: 182 LLETSCGSPHYAAPEIVSGLPYEGFASDVWSCGVILFALLTGRLPFDEENGNVRDLLLKV 241
           L+    GS  Y APE+++   + G   D+WS GVI + LL G   F  E   V+D L + 
Sbjct: 195 LIYKPAGSLGYVAPEVLTQDGH-GKPCDIWSLGVITYTLLCGYSAFKAE--RVQDFLDEC 251

Query: 242 QKGQ----FEMPNDTEISRDAQDLIGKILVVDPRQRIKIRDILSHPLL 285
             G+    F  P    +S  A+  I K L +DP +R     +L  P +
Sbjct: 252 TTGEYPVRFHRPYWDSVSDKAKQFILKALNLDPSKRPTAAQLLEDPWI 299

>YPL203W Chr16 (166256..167398) [1143 bp, 380 aa] {ON}
           TPK2cAMP-dependent protein kinase catalytic subunit;
           promotes vegetative growth in response to nutrients via
           the Ras-cAMP signaling pathway; partially redundant with
           Tpk1p and Tpk3p; localizes to P-bodies during stationary
           phase
          Length = 380

 Score =  143 bits (361), Expect = 3e-36,   Method: Compositional matrix adjust.
 Identities = 93/283 (32%), Positives = 148/283 (52%), Gaps = 26/283 (9%)

Query: 11  AAKPSSTIGPWKLGETLGFGSTGKVQLAQHERTGHRTAVKVISKS--IFNNNGNHSNDDS 68
            +K   T+  +++  TLG GS G+V L +    G   A+KV+ K   +      H+ND  
Sbjct: 60  VSKGKYTLHDFQIMRTLGTGSFGRVHLVRSVHNGRYYAIKVLKKQQVVKMKQVEHTND-- 117

Query: 69  VLPYNIEREIVIMKLLSHPNVLSLYDVWETNNNLYLILEYAEKGELFNLLVDHGPLPERE 128
                 ER +  +KL+ HP ++ ++  ++   N++++++Y E GELF+LL      P   
Sbjct: 118 ------ERRM--LKLVEHPFLIRMWGTFQDARNIFMVMDYIEGGELFSLLRKSQRFPNPV 169

Query: 129 AINCFRQIIIGISYCHALGIVHRDLKPENLLLDSFYNIKIADFGMAA-LQTDADLLETSC 187
           A     ++I+ + Y HA  I++RDLKPEN+LLD   +IKI DFG A  +QT   +  T C
Sbjct: 170 AKFYAAEVILALEYLHAHNIIYRDLKPENILLDRNGHIKITDFGFAKEVQT---VTWTLC 226

Query: 188 GSPHYAAPEIVSGLPYEGFASDVWSCGVILFALLTGRLPFDEENGNVRDLLLKVQKGQFE 247
           G+P Y APE+++  PY   + D WS GV+++ +L G  PF +          K+ +G+  
Sbjct: 227 GTPDYIAPEVITTKPYNK-SVDWWSLGVLIYEMLAGYTPFYDTTP--MKTYEKILQGKVV 283

Query: 248 MPNDTEISRDAQDLIGKILVVDPRQRI-----KIRDILSHPLL 285
            P       D  DL+ K++  D  +RI       RDI +HP  
Sbjct: 284 YP--PYFHPDVVDLLSKLITADLTRRIGNLQSGSRDIKAHPWF 324

>Skud_6.89 Chr6 (166257..167594) [1338 bp, 446 aa] {ON} YFR014C
           (REAL)
          Length = 446

 Score =  145 bits (365), Expect = 3e-36,   Method: Compositional matrix adjust.
 Identities = 92/283 (32%), Positives = 149/283 (52%), Gaps = 20/283 (7%)

Query: 13  KPSSTIGP--WKLGETLGFGSTGKVQLAQHERTGHRTAVKVISKSIFNNNGNHSNDDSVL 70
           +P+S +    +  G+TLG G+ G V+ A++  TG   AVK++ K     N        + 
Sbjct: 27  QPASYVNKKNYVFGKTLGAGTFGVVRQARNTETGEDVAVKILIKKALKGN-------KIQ 79

Query: 71  PYNIEREIVIMKLLSHPNVLSLYDVWETNNNLYLILEYAEKGELFNLLVDHGPLPEREAI 130
              +  E+ I++ L HPN+++  D +E+ +  Y+I + A+ GELF+ ++  G   E +A+
Sbjct: 80  LEALYDELDILQRLHHPNIVAFKDWFESKDKFYIITQLAKGGELFDRILKKGKFTEVDAV 139

Query: 131 NCFRQIIIGISYCHALGIVHRDLKPENLLLDSFYN---IKIADFGMAA-LQTDADLLETS 186
               +I+  + Y H+  IVHRDLKPENLL     +   + +ADFG+A  L++D +L+   
Sbjct: 140 RILVEILSAVKYMHSQNIVHRDLKPENLLYVDKSDESPLVVADFGIAKRLKSDEELIYKP 199

Query: 187 CGSPHYAAPEIVSGLPYEGFASDVWSCGVILFALLTGRLPFDEENGNVRDLLLKVQKGQ- 245
            GS  Y APE+++   + G   D+WS GVI + LL G   F  E   V+D L +   G+ 
Sbjct: 200 AGSLGYVAPEVLTQDGH-GKPCDIWSIGVITYTLLCGYSAFKAE--RVQDFLDECTTGEH 256

Query: 246 ---FEMPNDTEISRDAQDLIGKILVVDPRQRIKIRDILSHPLL 285
              F  P    +S  A+  I K L +DP +R     +L  P +
Sbjct: 257 PVRFHRPYWDSVSGKAKQFILKALNLDPAERPTAAQLLDDPWI 299

>KLTH0C10912g Chr3 (898372..900465) [2094 bp, 697 aa] {ON} highly
           similar to uniprot|P32562 Saccharomyces cerevisiae
           YMR001C
          Length = 697

 Score =  149 bits (375), Expect = 3e-36,   Method: Compositional matrix adjust.
 Identities = 78/213 (36%), Positives = 124/213 (58%), Gaps = 6/213 (2%)

Query: 77  EIVIMKLLSHPNVLSLYDVWETNNNLYLILEYAEKGELFNLLVDHGPLPEREAINCFRQI 136
           EI I K + H N++   D +E + N+Y++LE    G L +LL     L E E      QI
Sbjct: 126 EIQIHKSMRHFNIVQFIDCFEDDTNVYILLEICPNGSLMDLLKRRKVLTEPEVRFFTTQI 185

Query: 137 IIGISYCHALGIVHRDLKPENLLLDSFYNIKIADFGMAA-LQTDADLLETSCGSPHYAAP 195
           +  + Y H+  ++HRDLK  N+  D  YN+KI DFG+AA L  D +   T CG+P+Y AP
Sbjct: 186 VGAVKYMHSRRVIHRDLKLGNIFFDKHYNLKIGDFGLAAVLANDRERKYTVCGTPNYIAP 245

Query: 196 EIVSGLPYEG--FASDVWSCGVILFALLTGRLPFDEENGNVRDLLLKVQKGQFEMPNDTE 253
           E+++G  + G  +  D+WSCGV+++ALL G+ PF  +  N+  +  +++ G +  P D  
Sbjct: 246 EVLTG-KHTGHSYEVDIWSCGVMIYALLIGKPPFQAKEVNI--IYERIKCGDYVFPRDKC 302

Query: 254 ISRDAQDLIGKILVVDPRQRIKIRDILSHPLLK 286
           IS++A  LI  IL +DP +R  + +I+ +   +
Sbjct: 303 ISQEALTLIRDILSIDPLERPSLDEIIDYVWFR 335

>CAGL0F04741g Chr6 (478256..479584) [1329 bp, 442 aa] {ON} similar
           to uniprot|P22517 Saccharomyces cerevisiae YOL016c CMK2
           Ca2+/calmodulin-dependent ser/thr protein kinase type II
          Length = 442

 Score =  144 bits (364), Expect = 3e-36,   Method: Compositional matrix adjust.
 Identities = 89/271 (32%), Positives = 145/271 (53%), Gaps = 18/271 (6%)

Query: 23  LGETLGFGSTGKVQLAQHERTGHRTAVKVISKSIFNNNGNHSNDDSVLPYNIEREIVIMK 82
            G+TLG G+ G V+ A++  T    AVK++ K     N        V    +  E+ I++
Sbjct: 47  FGKTLGAGTFGVVRQARYSPTNEDVAVKILLKKALKGN-------DVQLQMLYDELSILQ 99

Query: 83  LLSHPNVLSLYDVWETNNNLYLILEYAEKGELFNLLVDHGPLPEREAINCFRQIIIGISY 142
           +L HPN++   D +E+ +  Y++ + A  GELF+ ++  G   ER+A++   QI+  + Y
Sbjct: 100 MLKHPNIVEFKDWFESKDKFYIVTQLAVGGELFDRILAKGKFTERDAVSITMQILSAVDY 159

Query: 143 CHALGIVHRDLKPENLLL-----DSFYNIKIADFGMA-ALQTDADLLETSCGSPHYAAPE 196
            H+  +VHRDLKPEN+L      DS   + IADFG+A  LQ + DL+  + GS  Y APE
Sbjct: 160 MHSKNVVHRDLKPENVLYIDKSDDS--QLVIADFGIAKQLQDNDDLIFKAAGSLGYVAPE 217

Query: 197 IVSGLPYEGFASDVWSCGVILFALLTGRLPFDEE--NGNVRDLLLKVQKGQFEMPNDTEI 254
           +++   + G   D+WS GVI++ LL G   F  E  +G + +         F  P    I
Sbjct: 218 VLTNNGH-GKPCDIWSIGVIVYTLLCGYSAFVAETVDGFLEECTQNKYPVTFHKPYWDNI 276

Query: 255 SRDAQDLIGKILVVDPRQRIKIRDILSHPLL 285
           S +A++ I + L +DP +R    +++  P +
Sbjct: 277 SDEAKNFILRALTLDPAERPTAAELMKDPWI 307

>Skud_16.76 Chr16 (139571..140719) [1149 bp, 382 aa] {ON} YPL203W
           (REAL)
          Length = 382

 Score =  143 bits (360), Expect = 4e-36,   Method: Compositional matrix adjust.
 Identities = 93/283 (32%), Positives = 148/283 (52%), Gaps = 26/283 (9%)

Query: 11  AAKPSSTIGPWKLGETLGFGSTGKVQLAQHERTGHRTAVKVISKS--IFNNNGNHSNDDS 68
            +K   T+  +++  TLG GS G+V L +    G   A+KV+ K   +      H+ND  
Sbjct: 62  VSKGKYTLHDFQIMRTLGTGSFGRVHLVRSVHNGRYYAIKVLKKQQVVKMKQVEHTND-- 119

Query: 69  VLPYNIEREIVIMKLLSHPNVLSLYDVWETNNNLYLILEYAEKGELFNLLVDHGPLPERE 128
                 ER +  +KL+ HP ++ ++  ++   N++++++Y E GELF+LL      P   
Sbjct: 120 ------ERRM--LKLVEHPFLIRMWGTFQDAKNIFMVMDYIEGGELFSLLRKSQRFPNPV 171

Query: 129 AINCFRQIIIGISYCHALGIVHRDLKPENLLLDSFYNIKIADFGMAA-LQTDADLLETSC 187
           A     ++I+ + Y HA  I++RDLKPEN+LLD   +IKI DFG A  +QT   +  T C
Sbjct: 172 AKFYAAEVILALEYLHAHNIIYRDLKPENILLDRNGHIKITDFGFAKEVQT---VTWTLC 228

Query: 188 GSPHYAAPEIVSGLPYEGFASDVWSCGVILFALLTGRLPFDEENGNVRDLLLKVQKGQFE 247
           G+P Y APE+++  PY   + D WS GV+++ +L G  PF +          K+ +G+  
Sbjct: 229 GTPDYIAPEVITTKPYNK-SVDWWSLGVLIYEMLAGYTPFYDTTP--MKTYEKILQGKVI 285

Query: 248 MPNDTEISRDAQDLIGKILVVDPRQRI-----KIRDILSHPLL 285
            P       D  DL+ K++  D  +RI       RDI +HP  
Sbjct: 286 YP--PYFHPDVVDLLSKLITADLTRRIGNLQSGSRDIKAHPWF 326

>Smik_10.66 Chr10 complement(108043..109236) [1194 bp, 397 aa] {ON}
           YJL164C (REAL)
          Length = 397

 Score =  143 bits (361), Expect = 4e-36,   Method: Compositional matrix adjust.
 Identities = 85/269 (31%), Positives = 139/269 (51%), Gaps = 24/269 (8%)

Query: 26  TLGFGSTGKVQLAQHERTGHRTAVKVISKSIFN--NNGNHSNDDSVLPYNIEREIVIMKL 83
           TLG GS G+V L +    G   A+KV+ K I        H+ND          E +++ +
Sbjct: 92  TLGTGSFGRVHLIRSRHNGRYYAMKVLKKEIVVRLKQVEHTND----------ERLMLSI 141

Query: 84  LSHPNVLSLYDVWETNNNLYLILEYAEKGELFNLLVDHGPLPEREAINCFRQIIIGISYC 143
           ++HP ++ ++  ++    +++I++Y E GELF+LL      P   A     ++ + + Y 
Sbjct: 142 VTHPFIIRMWGTFQDAQQIFMIMDYIEGGELFSLLRKSQRFPNPVAKFYAAEVCLALEYL 201

Query: 144 HALGIVHRDLKPENLLLDSFYNIKIADFGMAALQTDADLLETSCGSPHYAAPEIVSGLPY 203
           H+  I++RDLKPEN+LLD   +IKI DFG A      D+  T CG+P Y APE+VS  PY
Sbjct: 202 HSKDIIYRDLKPENILLDKNGHIKITDFGFAKYV--PDVTYTLCGTPDYIAPEVVSTKPY 259

Query: 204 EGFASDVWSCGVILFALLTGRLPFDEENGNVRDLLLKVQKGQFEMPNDTEISRDAQDLIG 263
              + D WS G++++ +L G  PF   + N      K+   +   P     + D +DL+ 
Sbjct: 260 NK-SIDWWSFGILIYEMLAGYTPF--YDSNTMKTYEKILNAELRFP--PFFNEDVKDLLS 314

Query: 264 KILVVDPRQRI-----KIRDILSHPLLKK 287
           +++  D  QR+        D+ +HP  K+
Sbjct: 315 RLITRDLSQRLGNLQNGTEDVKNHPWFKE 343

>KLLA0E01585g Chr5 (149305..149370,149488..150960) [1539 bp, 512 aa]
           {ON} similar to uniprot|P39009 Saccharomyces cerevisiae
           YDL101C DUN1 Cell-cycle checkpoint serine-threonine
           kinase required for DNA damage-induced transcription of
           certain target genes phosphorylation of Rad55p and Sml1p
           and transient G2/M arrest after DNA damage also
           regulates postreplicative DNA repair
          Length = 512

 Score =  145 bits (367), Expect = 4e-36,   Method: Compositional matrix adjust.
 Identities = 97/304 (31%), Positives = 141/304 (46%), Gaps = 36/304 (11%)

Query: 8   THSAAKPSSTIGPWKLGETLGFGSTGKVQLAQHERTGHRTAVKVISKSIFNNNGNHSNDD 67
           + +  +P S    +  G+ LG G    V+ A+++ TG   AVK+             NDD
Sbjct: 185 SRTREQPRSFFDKYLAGKELGTGHYAIVKEARNKETGETVAVKIFHP--------QQNDD 236

Query: 68  SVLPYNIEREIVIMKLLSHPNVLSLYD-----VWETNNNLYLILEYAEKGELFNLLVDHG 122
                    E  I+  + HPN++ L D     V +T    YL+LE    GELF  +V   
Sbjct: 237 DKRTKKFTEETKILLSIQHPNIVKLIDRFVEPVSKTQIQTYLVLEKINDGELFERIVRKN 296

Query: 123 PLPEREAINCFRQIIIGISYCHALGIVHRDLKPENLLL------------------DSF- 163
            L E E    FRQ++ G+ Y H+  I+HRD+KPEN+LL                  D   
Sbjct: 297 NLREDETKALFRQLLNGLKYLHSRNIIHRDIKPENILLSISKRRSPEEIALGPWDDDELD 356

Query: 164 YNIKIADFGMAALQTDADLLETSCGSPHYAAPEIVSGLPYEGFASDVWSCGVILFALLTG 223
             +KIADFG+A    +     T CG+P Y APE++    Y     D+WS GV+L+  L G
Sbjct: 357 IQVKIADFGLAKFTGEMKFTNTLCGTPSYVAPEVLVKTGYTSRV-DMWSAGVLLYVCLCG 415

Query: 224 RLPFDEENG--NVRDLLLKVQKGQFEMPNDTEISRDAQDLIGKILVVDPRQRIKIRDILS 281
             PF E+    ++++ +L+  K  F  P    I      LI  +LVV+P  R  + D L+
Sbjct: 416 FPPFSEQLAPPSMKEQILQ-GKFAFYSPYWDNIDDSVLHLISNLLVVNPASRFSVNDALT 474

Query: 282 HPLL 285
           HP  
Sbjct: 475 HPWF 478

>Smik_6.408 Chr6 complement(657018..658163) [1146 bp, 381 aa] {ON}
           YPL203W (REAL)
          Length = 381

 Score =  143 bits (360), Expect = 4e-36,   Method: Compositional matrix adjust.
 Identities = 93/283 (32%), Positives = 148/283 (52%), Gaps = 26/283 (9%)

Query: 11  AAKPSSTIGPWKLGETLGFGSTGKVQLAQHERTGHRTAVKVISKS--IFNNNGNHSNDDS 68
            +K   T+  +++  TLG GS G+V L +    G   A+KV+ K   +      H+ND  
Sbjct: 61  VSKGKYTLHDFQIMRTLGTGSFGRVHLVRSVHNGRYYAIKVLKKQQVVKMKQVEHTND-- 118

Query: 69  VLPYNIEREIVIMKLLSHPNVLSLYDVWETNNNLYLILEYAEKGELFNLLVDHGPLPERE 128
                 ER +  +KL+ HP ++ ++  ++   N++++++Y E GELF+LL      P   
Sbjct: 119 ------ERRM--LKLVEHPFLIRMWGTFQDAKNIFMVMDYIEGGELFSLLRKSQRFPNPV 170

Query: 129 AINCFRQIIIGISYCHALGIVHRDLKPENLLLDSFYNIKIADFGMAA-LQTDADLLETSC 187
           A     ++I+ + Y HA  I++RDLKPEN+LLD   +IKI DFG A  +QT   +  T C
Sbjct: 171 AKFYAAEVILALEYLHAHNIIYRDLKPENILLDRNGHIKITDFGFAKEVQT---VTWTLC 227

Query: 188 GSPHYAAPEIVSGLPYEGFASDVWSCGVILFALLTGRLPFDEENGNVRDLLLKVQKGQFE 247
           G+P Y APE+++  PY   + D WS GV+++ +L G  PF   +        K+ +G+  
Sbjct: 228 GTPDYIAPEVITTKPYNK-SVDWWSLGVLIYEMLAGYTPF--YDTTPMKTYEKILQGKVI 284

Query: 248 MPNDTEISRDAQDLIGKILVVDPRQRI-----KIRDILSHPLL 285
            P       D  DL+ K++  D  +RI       RDI +HP  
Sbjct: 285 YP--PYFHPDVVDLLSKLITADLTRRIGNLQSGSRDIKAHPWF 325

>TBLA0D05010 Chr4 complement(1234934..1236238) [1305 bp, 434 aa]
           {ON} Anc_1.374 YFR014C
          Length = 434

 Score =  144 bits (363), Expect = 4e-36,   Method: Compositional matrix adjust.
 Identities = 96/286 (33%), Positives = 149/286 (52%), Gaps = 20/286 (6%)

Query: 11  AAKPSSTIGP--WKLGETLGFGSTGKVQLAQHERTGHRTAVKVISKSIFNNNGNHSNDDS 68
           + +PSS I    +  G+TLG GS G V+ A+   T    AVK+I K     N        
Sbjct: 35  SGQPSSYINKSDYVFGKTLGAGSFGVVRQAKKLSTDENVAVKIILKKALKGN-------D 87

Query: 69  VLPYNIEREIVIMKLLSHPNVLSLYDVWETNNNLYLILEYAEKGELFNLLVDHGPLPERE 128
           V    +  E+ I++ L HPN++   D +E+    Y++ + A  GELF+ ++  G   E +
Sbjct: 88  VQLQMLYDELSILQRLHHPNIVQFKDWFESKEKFYIVTQLATGGELFDRILKRGKFTEVD 147

Query: 129 AINCFRQIIIGISYCHALGIVHRDLKPENLLL-----DSFYNIKIADFGMAA-LQTDADL 182
           A+    Q++  I Y H+  IVHRDLKPEN+L      DS   + IADFG+A  L+   DL
Sbjct: 148 AVKIIIQMLKAIEYIHSQNIVHRDLKPENVLYIDPSDDS--QLVIADFGIAKELKDGDDL 205

Query: 183 LETSCGSPHYAAPEIVSGLPYEGFASDVWSCGVILFALLTGRLPFDEEN--GNVRDLLLK 240
           +  + GS  Y APE+++   + G   D+WS GVI + LL G   F  E   G + +    
Sbjct: 206 IFKAAGSLGYVAPEVLTTNGH-GKPCDIWSLGVITYTLLCGYSAFIAETVEGFLEECTSN 264

Query: 241 VQKGQFEMPNDTEISRDAQDLIGKILVVDPRQRIKIRDILSHPLLK 286
           +   +F  P    +SR+A++ I K L ++P +R    ++L+ P +K
Sbjct: 265 IYPVKFHEPYWNNVSREAKEFILKALTLNPDERPTATELLNDPWIK 310

>KLTH0H04180g Chr8 (381111..382172) [1062 bp, 353 aa] {ON} highly
           similar to uniprot|P06245 Saccharomyces cerevisiae
           YPL203W TPK2 Involved in nutrient control of cell growth
           and division cAMP-dependent protein kinase catalytic
           subunit
          Length = 353

 Score =  142 bits (357), Expect = 4e-36,   Method: Compositional matrix adjust.
 Identities = 91/283 (32%), Positives = 149/283 (52%), Gaps = 24/283 (8%)

Query: 10  SAAKPSSTIGPWKLGETLGFGSTGKVQLAQHERTGHRTAVKVISKS--IFNNNGNHSNDD 67
           + +K   ++  +++  TLG GS G+V L +    G   A+KV+ K   I      H+ND 
Sbjct: 32  AVSKGKYSLNDFQILRTLGTGSFGRVHLVRSVHNGRYYAIKVLKKEQVIRMKQIEHTND- 90

Query: 68  SVLPYNIEREIVIMKLLSHPNVLSLYDVWETNNNLYLILEYAEKGELFNLLVDHGPLPER 127
                  ER +  +KL+ HP ++ ++  ++ + NL+++++Y E GELF+LL      P  
Sbjct: 91  -------ERRM--LKLVDHPFLIRMWGTFQDSRNLFMVMDYIEGGELFSLLRKSQRFPNP 141

Query: 128 EAINCFRQIIIGISYCHALGIVHRDLKPENLLLDSFYNIKIADFGMAALQTDADLLETSC 187
            A     ++I+ + Y HA  I++RDLKPEN+LLD   +IKI DFG A  + D  +  T C
Sbjct: 142 VAKFYAAEVILALEYLHAHDIIYRDLKPENILLDRNGHIKITDFGFAK-EVDT-VTWTLC 199

Query: 188 GSPHYAAPEIVSGLPYEGFASDVWSCGVILFALLTGRLPFDEENGNVRDLLLKVQKGQFE 247
           G+P Y APE+++  PY   + D WS G+++F +L G  PF   +        K+ +G+  
Sbjct: 200 GTPDYIAPEVIATKPYNK-SVDWWSLGILIFEMLAGYTPF--YDATPMKTYEKILQGKVA 256

Query: 248 MPNDTEISRDAQDLIGKILVVDPRQRI-----KIRDILSHPLL 285
            P       D  DL+ K++  D  +R+       +D+ SHP  
Sbjct: 257 YP--PFFHPDVVDLLSKLITADLTRRLGNLQSGPQDVKSHPWF 297

>TBLA0A02030 Chr1 complement(491365..492576) [1212 bp, 403 aa] {ON}
           Anc_6.214 YPL203W
          Length = 403

 Score =  143 bits (361), Expect = 4e-36,   Method: Compositional matrix adjust.
 Identities = 93/293 (31%), Positives = 151/293 (51%), Gaps = 29/293 (9%)

Query: 5   NTETHSAAKPSSTIGPWKLGE-----TLGFGSTGKVQLAQHERTGHRTAVKVISKS--IF 57
           N   H   + + T G + L +     TLG GS G+V L +    G   A+KV+ K   I 
Sbjct: 72  NEVVHKHQRSTVTKGKYGLQDFQIMRTLGTGSFGRVHLVRSVHNGRYYAIKVLKKQQIIK 131

Query: 58  NNNGNHSNDDSVLPYNIEREIVIMKLLSHPNVLSLYDVWETNNNLYLILEYAEKGELFNL 117
                H+ND        ER +  +KL+ HP ++ L+  ++ + NL+++++Y E GELF+L
Sbjct: 132 MKQIEHTND--------ERRM--LKLVEHPFIIRLWGTFQDSRNLFMVMDYIEGGELFSL 181

Query: 118 LVDHGPLPEREAINCFRQIIIGISYCHALGIVHRDLKPENLLLDSFYNIKIADFGMAALQ 177
           L      P   A     ++++ + Y HA  I++RDLKPEN+LLD   +IK+ADFG A  +
Sbjct: 182 LRKSQRFPNPVAKFYAAEVVLALEYLHANNIIYRDLKPENILLDRNGHIKVADFGFA--K 239

Query: 178 TDADLLETSCGSPHYAAPEIVSGLPYEGFASDVWSCGVILFALLTGRLPFDEENGNVRDL 237
             + +  T CG+P Y APE+++  PY   + D WS GV+++ +L G  PF +        
Sbjct: 240 EVSSVTWTLCGTPDYIAPEVIATKPYNK-SVDWWSLGVLIYEMLAGYTPFYDVTP--MKT 296

Query: 238 LLKVQKGQFEMPNDTEISRDAQDLIGKILVVDPRQRI-----KIRDILSHPLL 285
             K+ +G+   P       D  DL+ +++  D  +R+       RD+ +HP  
Sbjct: 297 YEKILQGKINFPQG--FHPDVIDLLTRLITSDLTKRLGNLQNGSRDVKNHPWF 347

>Kwal_0.96 s0 complement(46082..47365) [1284 bp, 427 aa] {ON}
           YOL016C (CMK2) - Calmodulin-dependent protein kinase
           [contig 76] FULL
          Length = 427

 Score =  144 bits (362), Expect = 4e-36,   Method: Compositional matrix adjust.
 Identities = 89/273 (32%), Positives = 143/273 (52%), Gaps = 20/273 (7%)

Query: 11  AAKPSSTIGP--WKLGETLGFGSTGKVQLAQHERTGHRTAVKVISKSIFNNNGNHSNDDS 68
           + +P+S +    +  G+TLG GS G V+ A+   +G   A+K++ K              
Sbjct: 34  SGQPNSYVNKSDYIFGKTLGAGSFGVVRQARQVSSGENVAIKILLKKALKGK-------D 86

Query: 69  VLPYNIEREIVIMKLLSHPNVLSLYDVWETNNNLYLILEYAEKGELFNLLVDHGPLPERE 128
           V    +  E+ I++ L HPN++   D +E+ +  Y++ + A  GELF+ ++  G   E +
Sbjct: 87  VELQMLYDELSILQKLDHPNIVKFKDWFESKDKFYIVTQLATGGELFDRILKQGKFTEED 146

Query: 129 AINCFRQIIIGISYCHALGIVHRDLKPENLLL-----DSFYNIKIADFGMAA-LQTDADL 182
           A+    QI+  + Y H+  IVHRDLKPENLL      DS   + + DFG+A  L+ D +L
Sbjct: 147 AVRIVYQILKAVEYLHSRNIVHRDLKPENLLYLTEAADS--QLVLGDFGIAKELKNDDEL 204

Query: 183 LETSCGSPHYAAPEIVSGLPYEGFASDVWSCGVILFALLTGRLPFDEEN--GNVRDLLLK 240
           +  + GS  Y APE+V+   + G   D+WS GV+ + LL G  PF  E+  G + +  + 
Sbjct: 205 IHKAAGSMGYVAPEVVTTSGH-GKPCDIWSLGVVTYTLLCGYSPFVAESVEGFLEECTIG 263

Query: 241 VQKGQFEMPNDTEISRDAQDLIGKILVVDPRQR 273
                F  P  + IS +A+D I + L V+P  R
Sbjct: 264 RTPVTFHKPYWSNISNEAKDFILRALTVNPHDR 296

>TDEL0E05310 Chr5 (972769..973893) [1125 bp, 374 aa] {ON} Anc_6.222
           YPL209C
          Length = 374

 Score =  142 bits (358), Expect = 5e-36,   Method: Compositional matrix adjust.
 Identities = 80/262 (30%), Positives = 140/262 (53%), Gaps = 21/262 (8%)

Query: 34  KVQLAQHERTGHRTAVKVISKSIFNNNGNHSNDDSVLPYNIE----REIVIMKLLSHPNV 89
           +V   +H++TG   A+K + KS             ++ YN++    RE+ I   LSHPN+
Sbjct: 129 RVYCVKHKKTGFICAMKAMEKS------------ELVQYNVQKQFRREVEIQSSLSHPNL 176

Query: 90  LSLYDVWETNNNLYLILEYAEKGELFNLLVDHGPLPEREAINCFRQIIIGISYCHALGIV 149
             LY  +  +  +YL++EY   GEL+ +L   GP  +  A +   Q+   + + H   I+
Sbjct: 177 TKLYGFFHDDKRVYLLMEYLVNGELYKVLKARGPFNDIVASHYVYQMADALDFMHQKNII 236

Query: 150 HRDLKPENLLLDSFYNIKIADFGMAALQTDADLLETSCGSPHYAAPEIVSGLPYEGFASD 209
           HRD+KPEN+L+     +K+ DFG + +       +T CG+  Y +PE+++   Y+    D
Sbjct: 237 HRDVKPENILMGFGNVVKLTDFGWSIISARGVRRKTLCGTIDYLSPELITSREYDD-KVD 295

Query: 210 VWSCGVILFALLTGRLPFDEENGNVRDLLLKVQKGQFEMPNDTEISRDAQDLIGKILVVD 269
           VW+ GV+ + L+    PF+E++ +      ++  G  + P+   IS DAQDLI K+L   
Sbjct: 296 VWALGVLTYELIVNSPPFEEDSKD--STYKRIVSGDLKFPD--TISSDAQDLIRKLLRHK 351

Query: 270 PRQRIKIRDILSHPLLKKYQTI 291
            + RI ++D+  HP + K+++ 
Sbjct: 352 AKDRISLQDVKRHPWILKHKSF 373

>TDEL0D05320 Chr4 complement(965082..968255) [3174 bp, 1057 aa] {ON}
           Anc_3.92 YDR490C
          Length = 1057

 Score =  149 bits (377), Expect = 5e-36,   Method: Compositional matrix adjust.
 Identities = 103/294 (35%), Positives = 152/294 (51%), Gaps = 24/294 (8%)

Query: 18  IGPWKLGETLGFGSTGKVQLAQHERTGHRTAVKVISKSIFNNNGNHSNDDSVLPYNIERE 77
           I  +K GETLG GS   V LA  + +G + AVKV+SK              V   NIE+ 
Sbjct: 164 IKDFKFGETLGDGSYSTVMLATSKESGKKYAVKVLSKEYL------IRQKKVKYVNIEKN 217

Query: 78  IVIMKLLSHPNVLSLYDVWETNNNLYLILEYAEKGELFNLLVDHGPLPEREAINCFRQII 137
             + +L +   ++ LY  ++  ++LY +LEYA  G+  +++  +G L E  A     QII
Sbjct: 218 -ALQRLNNSRGIVKLYFTFQDESSLYFLLEYAPNGDFLSIMKKYGSLNEDCACYYSAQII 276

Query: 138 IGISYCHALGIVHRDLKPENLLLDSFYNIKIADFGMAAL------QTDA-DLLETS---C 187
             I + H+ GIVHRD+KPEN+LLD  + +K+ DFG A +       TD+ DLL  S    
Sbjct: 277 DAIDFLHSKGIVHRDIKPENILLDKDFKVKLTDFGTAKILEPKPNTTDSYDLLSRSKSFV 336

Query: 188 GSPHYAAPEIVSGLPYEGFASDVWSCGVILFALLTGRLPFDEENGNVRDLLLKVQKGQFE 247
           G+  Y +PE+++   Y  +  D+W+ G ILF ++ G+ PF   N  +     KV K Q+ 
Sbjct: 337 GTAEYVSPELLND-NYVDYRCDIWAFGCILFQMIAGKPPFKATNEYL--TFQKVMKVQYA 393

Query: 248 MPNDTEISRDAQDLIGKILVVDPRQRIKIRDILSHPLLKKYQTIKDSKSIKDLP 301
                 +    +DL+  IL+  P QR+ I  I SH   K  +  KD  SI D P
Sbjct: 394 FTAGFPLV--VRDLVKGILIKQPAQRLTIPQIKSHHFFKD-KNFKDG-SIWDEP 443

>KAFR0K02450 Chr11 (504087..504131,504190..505680) [1536 bp, 511 aa]
           {ON} 
          Length = 511

 Score =  145 bits (366), Expect = 6e-36,   Method: Compositional matrix adjust.
 Identities = 95/293 (32%), Positives = 140/293 (47%), Gaps = 40/293 (13%)

Query: 21  WKLGETLGFGSTGKVQLAQHERTGHRTAVKVISKSIFNNNGNHSNDDSVLPYNIEREIVI 80
           + LG  LG G    V+  ++++TG   AVK+             NDD         E  I
Sbjct: 197 YTLGRELGSGHYAIVKEGKNKQTGQTVAVKIFHP--------QQNDDQKKSKQFREETNI 248

Query: 81  MKLLSHPNVLSLYD-----VWETNNNLYLILEYAEKGELFNLLVDHGPLPEREAINCFRQ 135
           +  + HPN+++L D     + +     YL+LE  + GELF+ +V    L + E    F Q
Sbjct: 249 LMRIHHPNIVNLLDSFVEPISKQQTQKYLVLEKIDNGELFDRIVKKTCLRQDETKAIFTQ 308

Query: 136 IIIGISYCHALGIVHRDLKPENLLLDSF-------------------YNIKIADFGMAAL 176
           I+ G+ Y H   I+HRD+KPEN+LL+                       +KIADFG+A  
Sbjct: 309 ILHGLKYLHGQNIIHRDIKPENILLNITKRTSPDQKQLGPWDDDEIDVQVKIADFGLAKF 368

Query: 177 QTDADLLETSCGSPHYAAPEIVSGLPYEGFAS--DVWSCGVILFALLTGRLPFDEENG-- 232
             +     T CG+P Y APE+   L  +G+ S  D+WS GVIL+  L G  PF ++ G  
Sbjct: 369 TGEMQFTNTLCGTPSYVAPEV---LIKKGYTSKVDMWSSGVILYVCLCGFPPFSDQLGPP 425

Query: 233 NVRDLLLKVQKGQFEMPNDTEISRDAQDLIGKILVVDPRQRIKIRDILSHPLL 285
            +++ +L+  K  F  P    I      LI  +LV+DP QR  + D  +HP L
Sbjct: 426 ALKEQILQA-KFAFYTPYWDNIDDSILHLISHLLVLDPEQRYSVSDAFNHPWL 477

>Kwal_56.22476 s56 complement(145039..147132) [2094 bp, 697 aa] {ON}
           YMR001C (CDC5) - protein kinase which functions at the
           G(sub)2/M boundary [contig 185] FULL
          Length = 697

 Score =  147 bits (372), Expect = 6e-36,   Method: Compositional matrix adjust.
 Identities = 78/213 (36%), Positives = 123/213 (57%), Gaps = 6/213 (2%)

Query: 77  EIVIMKLLSHPNVLSLYDVWETNNNLYLILEYAEKGELFNLLVDHGPLPEREAINCFRQI 136
           EI I K + H N++   D +E + N+Y++LE    G L +LL     L E E      QI
Sbjct: 126 EIQIHKSMRHTNIVQFVDCFEDDTNVYILLEICPNGSLMDLLKRRKMLTEPEVRFFTTQI 185

Query: 137 IIGISYCHALGIVHRDLKPENLLLDSFYNIKIADFGMAA-LQTDADLLETSCGSPHYAAP 195
           +  + Y H+  ++HRDLK  N+  D  YN+K+ DFG+AA L  D +   T CG+P+Y AP
Sbjct: 186 VGAVKYMHSRRVIHRDLKLGNIFFDKHYNLKVGDFGLAAVLANDRERKYTVCGTPNYIAP 245

Query: 196 EIVSGLPYEG--FASDVWSCGVILFALLTGRLPFDEENGNVRDLLLKVQKGQFEMPNDTE 253
           E+++G  + G  +  D+WSCGV+++ALL G+ PF  +  N+  +  +++ G F  P D  
Sbjct: 246 EVLTG-KHTGHSYEVDIWSCGVMIYALLIGKPPFQAKEVNI--IYERIKCGDFVFPKDKF 302

Query: 254 ISRDAQDLIGKILVVDPRQRIKIRDILSHPLLK 286
           IS +A  LI  IL +DP +R  + +I+ +   +
Sbjct: 303 ISPEALVLIKDILSIDPLERPSLDEIIDYVWFR 335

>YOL016C Chr15 complement(294777..296120) [1344 bp, 447 aa] {ON}
           CMK2Calmodulin-dependent protein kinase; may play a role
           in stress response, many CA++/calmodulan dependent
           phosphorylation substrates demonstrated in vitro, amino
           acid sequence similar to Cmk1p and mammalian Cam Kinase
           II
          Length = 447

 Score =  143 bits (361), Expect = 8e-36,   Method: Compositional matrix adjust.
 Identities = 92/269 (34%), Positives = 142/269 (52%), Gaps = 14/269 (5%)

Query: 23  LGETLGFGSTGKVQLAQHERTGHRTAVKVISKSIFNNNGNHSNDDSVLPYNIEREIVIMK 82
            G TLG GS G V+ A+   T    A+K++ K     N       +V    +  E+ I++
Sbjct: 49  FGRTLGAGSFGVVRQARKLSTNEDVAIKILLKKALQGN-------NVQLQMLYEELSILQ 101

Query: 83  LLSHPNVLSLYDVWETNNNLYLILEYAEKGELFNLLVDHGPLPEREAINCFRQIIIGISY 142
            LSHPN++S  D +E+ +  Y++ + A  GELF+ ++  G   E +A+    QI+  + Y
Sbjct: 102 KLSHPNIVSFKDWFESKDKFYIVTQLATGGELFDRILSRGKFTEVDAVEIIVQILGAVEY 161

Query: 143 CHALGIVHRDLKPENLL-LDSFYN--IKIADFGMA-ALQTDADLLETSCGSPHYAAPEIV 198
            H+  +VHRDLKPEN+L +D   N  + IADFG+A  L+ + DL+  + GS  Y APE++
Sbjct: 162 MHSKNVVHRDLKPENVLYVDKSENSPLVIADFGIAKQLKGEEDLIYKAAGSLGYVAPEVL 221

Query: 199 SGLPYEGFASDVWSCGVILFALLTGRLPFDEEN--GNVRDLLLKVQKGQFEMPNDTEISR 256
           +   + G   D+WS GVI + LL G  PF  E+  G + +         F MP    IS 
Sbjct: 222 TQDGH-GKPCDIWSIGVITYTLLCGYSPFIAESVEGFMEECTASRYPVTFHMPYWDNISI 280

Query: 257 DAQDLIGKILVVDPRQRIKIRDILSHPLL 285
           D +  I K L ++P  R    ++L  P +
Sbjct: 281 DVKRFILKALRLNPADRPTATELLDDPWI 309

>KLLA0F23155g Chr6 (2157146..2158429) [1284 bp, 427 aa] {ON} similar
           to uniprot|P22517 Saccharomyces cerevisiae YOL016C CMK2
           Calmodulin-dependent protein kinase and uniprot|P27466
           Saccharomyces cerevisiae YFR014C CMK1
          Length = 427

 Score =  143 bits (360), Expect = 8e-36,   Method: Compositional matrix adjust.
 Identities = 92/282 (32%), Positives = 149/282 (52%), Gaps = 24/282 (8%)

Query: 12  AKPSSTIGP--WKLGETLGFGSTGKVQLAQHERTGHRTAVKVISKSIFNNNGNHSNDDSV 69
            +PSS +    +  G+TLG G+ G V+ A+   +G   AVK++ K             SV
Sbjct: 35  GQPSSYVNKSDYIFGKTLGAGTFGVVRQARCISSGENVAVKILLKKALKGQ-------SV 87

Query: 70  LPYNIEREIVIMKLLSHPNVLSLYDVWETNNNLYLILEYAEKGELFNLLVDHGPLPEREA 129
               +  E+ I++ L+HPN++   D +E+    Y++ + A  GELF+ +++ G   E +A
Sbjct: 88  QLQMLYDELSILQQLNHPNIVRFKDWFESKEKFYIVTQLATGGELFDRILEKGKFCEVDA 147

Query: 130 INCFRQIIIGISYCHALGIVHRDLKPENLLL-----DSFYNIKIADFGMAA-LQTDADLL 183
           +   +QI+ G+ Y H   IVHRDLKPEN+L      DS   + I DFG+A  L+ D +L+
Sbjct: 148 VFIVKQILQGVQYLHQRNIVHRDLKPENILYLNKSDDS--PLVIGDFGIAKELKDDNELI 205

Query: 184 ETSCGSPHYAAPEIVSGLPYEGFASDVWSCGVILFALLTGRLPFDEENGNVRDLLLKVQK 243
             + GS  Y APE+++   + G   D+WS GVI + LL G  PF  E+ +    + +   
Sbjct: 206 HKAAGSMGYVAPEVLTSSGH-GKPCDIWSIGVITYTLLCGYSPFLAESAD--GFIEECTS 262

Query: 244 GQ----FEMPNDTEISRDAQDLIGKILVVDPRQRIKIRDILS 281
           GQ    F  P    +S+ A++ I   L V P++R    D+++
Sbjct: 263 GQYPVVFHKPYWNNVSKTAKEFILWALTVSPKRRPTATDLIN 304

>Smik_15.153 Chr15 complement(261920..263248) [1329 bp, 442 aa] {ON}
           YOL016C (REAL)
          Length = 442

 Score =  143 bits (361), Expect = 9e-36,   Method: Compositional matrix adjust.
 Identities = 92/269 (34%), Positives = 143/269 (53%), Gaps = 14/269 (5%)

Query: 23  LGETLGFGSTGKVQLAQHERTGHRTAVKVISKSIFNNNGNHSNDDSVLPYNIEREIVIMK 82
            G TLG GS G V+ A+   T    A+K++ K     N       +V    +  E+ I++
Sbjct: 49  FGRTLGAGSFGVVRQARKLSTNEDVAIKILLKKALQGN-------NVQLQMLYEELSILQ 101

Query: 83  LLSHPNVLSLYDVWETNNNLYLILEYAEKGELFNLLVDHGPLPEREAINCFRQIIIGISY 142
            LSHPN++S  D +E+ +  Y++ + A  GELF+ ++  G   E +A+    QI+  + Y
Sbjct: 102 KLSHPNIVSFKDWFESKDKFYIVTQLATGGELFDRILSRGKFTEVDAVEIVVQILGAVEY 161

Query: 143 CHALGIVHRDLKPENLL-LDSFYN--IKIADFGMA-ALQTDADLLETSCGSPHYAAPEIV 198
            H+  +VHRDLKPEN+L +D   N  + IADFG+A  L+   DL+  + GS  Y APE++
Sbjct: 162 MHSKNVVHRDLKPENVLYVDKSENSPLVIADFGIAKQLKGKEDLIYKAAGSLGYVAPEVL 221

Query: 199 SGLPYEGFASDVWSCGVILFALLTGRLPFDEEN--GNVRDLLLKVQKGQFEMPNDTEISR 256
           +   + G   D+WS GVI + LL G  PF  E+  G + +         F +P    IS 
Sbjct: 222 TQDGH-GKPCDIWSIGVITYTLLCGYSPFIAESVEGFMEECTASRYPVTFHIPYWDNISI 280

Query: 257 DAQDLIGKILVVDPRQRIKIRDILSHPLL 285
           DA+  I K L ++P +R    ++L  P +
Sbjct: 281 DAKRFILKALRLNPTERPTATELLDDPWI 309

>Ecym_3035 Chr3 complement(70391..72613) [2223 bp, 740 aa] {ON}
           similar to Ashbya gossypii ACL006W
          Length = 740

 Score =  147 bits (372), Expect = 9e-36,   Method: Compositional matrix adjust.
 Identities = 81/213 (38%), Positives = 122/213 (57%), Gaps = 6/213 (2%)

Query: 77  EIVIMKLLSHPNVLSLYDVWETNNNLYLILEYAEKGELFNLLVDHGPLPEREAINCFRQI 136
           EI I K + HPN++   D +E + N+Y++LE    G L +LL     L E E      QI
Sbjct: 120 EIQIHKSMRHPNIVQFTDCFEDDTNVYILLEICPNGSLMDLLKQRKQLTEPEVRFFTTQI 179

Query: 137 IIGISYCHALGIVHRDLKPENLLLDSFYNIKIADFGMAA-LQTDADLLETSCGSPHYAAP 195
           +  I Y H+  I+HRDLK  N+  D  +N+KI DFG+AA L  D +   T CG+P+Y AP
Sbjct: 180 VGAIKYMHSRRIIHRDLKLGNIFFDKHFNLKIGDFGLAAVLANDRERKYTICGTPNYIAP 239

Query: 196 EIVSGLPYEG--FASDVWSCGVILFALLTGRLPFDEENGNVRDLLLKVQKGQFEMPNDTE 253
           E+++G  + G  F  DVWS GV+++ALL G+ PF  +  N   +  +++   F  P D  
Sbjct: 240 EVLTG-KHTGHSFEVDVWSIGVMIYALLIGKPPFQAKEVNT--IYERIKVCDFNFPRDKP 296

Query: 254 ISRDAQDLIGKILVVDPRQRIKIRDILSHPLLK 286
           IS +A+ LI  IL +DP +R  + +I+ +   +
Sbjct: 297 ISSEAKVLIKDILSLDPLERPSLTEIMEYVWFR 329

>NCAS0D00630 Chr4 complement(107310..108593) [1284 bp, 427 aa] {ON}
           Anc_1.374
          Length = 427

 Score =  143 bits (360), Expect = 9e-36,   Method: Compositional matrix adjust.
 Identities = 96/294 (32%), Positives = 151/294 (51%), Gaps = 22/294 (7%)

Query: 2   TVANTETHSAAKPSSTIGPWKLGETLGFGSTGKVQLAQHERTGHRTAVKVISKSIFNNNG 61
           +V + E+ S      T   ++ G+TLG GS G V+ A  +      A+K++ K     N 
Sbjct: 8   SVVSLESFSLFPSKVTKSDYEFGKTLGAGSFGVVREATKKSNNEEVAIKILLKKALEGN- 66

Query: 62  NHSNDDSVLPYNIEREIVIMKLLSHPNVLSLYDVWETNNNLYLILEYAEKGELFNLLVDH 121
                  V    +  E+ I+K L HPN++   + +ET++ +Y++ + A  GELF+ ++  
Sbjct: 67  ------QVQLQMLYDELTILKKLHHPNIVEFKNWFETDDKIYIVTQLATGGELFDRIIKK 120

Query: 122 GPLPEREAINCFRQIIIGISYCHALGIVHRDLKPENLLL-----DSFYNIKIADFGMAA- 175
           G   E +A+    QI+  + Y H+  IVHRDLKPENLL      DS   + IADFG+A  
Sbjct: 121 GRFSEDDAVKILIQILSAVEYIHSRDIVHRDLKPENLLYLTEKEDS--ELVIADFGIAKE 178

Query: 176 LQTDADLLETSCGSPHYAAPEIVSGLPYEGFASDVWSCGVILFALLTGRLPFDEENGNVR 235
           L+    L+  + GS  Y APE+++ +   G   D+WS GVI + LL+G   F  E   V 
Sbjct: 179 LKKGEQLIFKAAGSLGYVAPEVLT-VDGHGKPCDIWSIGVITYTLLSGYAAFVAE--TVE 235

Query: 236 DLLLKVQKG----QFEMPNDTEISRDAQDLIGKILVVDPRQRIKIRDILSHPLL 285
             L +   G    +F  P    IS DA++ I K L ++P++R    ++L  P +
Sbjct: 236 GFLDECTSGDYPVKFHKPYWDNISDDAKNFILKALDLNPQKRPTATELLDDPWI 289

>ACL006W Chr3 (344395..346521) [2127 bp, 708 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YMR001C (CDC5)
          Length = 708

 Score =  147 bits (371), Expect = 9e-36,   Method: Compositional matrix adjust.
 Identities = 80/213 (37%), Positives = 122/213 (57%), Gaps = 6/213 (2%)

Query: 77  EIVIMKLLSHPNVLSLYDVWETNNNLYLILEYAEKGELFNLLVDHGPLPEREAINCFRQI 136
           EI I K + HPN++   D +E + N+Y++LE    G L +LL     L E E      QI
Sbjct: 120 EIQIHKSMKHPNIVQFTDCFEDDTNVYILLEICPNGSLMDLLKQRKQLTEPEVRFFTTQI 179

Query: 137 IIGISYCHALGIVHRDLKPENLLLDSFYNIKIADFGMAA-LQTDADLLETSCGSPHYAAP 195
           +  I Y H+  I+HRDLK  N+  D  +N+KI DFG+AA L  D +   T CG+P+Y AP
Sbjct: 180 VGAIKYMHSRRIIHRDLKLGNIFFDKHFNLKIGDFGLAAVLANDRERKYTICGTPNYIAP 239

Query: 196 EIVSGLPYEG--FASDVWSCGVILFALLTGRLPFDEENGNVRDLLLKVQKGQFEMPNDTE 253
           E+++G  + G  F  D+WS GV+++ALL G+ PF  +  N   +  +++   F  P D  
Sbjct: 240 EVLTG-KHTGHSFEVDIWSIGVMIYALLIGKPPFQAKEVNT--IYERIKVCDFSFPKDKP 296

Query: 254 ISRDAQDLIGKILVVDPRQRIKIRDILSHPLLK 286
           IS +A+ LI  IL +DP +R  + +I+ +   +
Sbjct: 297 ISSEAKVLIKDILSLDPLERPSLAEIMEYVWFR 329

>CAGL0K10604g Chr11 complement(1030055..1031395) [1341 bp, 446 aa]
           {ON} similar to uniprot|P27466 Saccharomyces cerevisiae
           YFR014c CMK1 Ca2+/calmodulin-dependent ser/thr protein
           kinase type I
          Length = 446

 Score =  143 bits (360), Expect = 1e-35,   Method: Compositional matrix adjust.
 Identities = 95/267 (35%), Positives = 146/267 (54%), Gaps = 15/267 (5%)

Query: 26  TLGFGSTGKVQLAQHERTGHRTAVKVISKSIFNNNGNHSNDDSVLPYNIEREIVIMKLLS 85
           TLG GS G V+ A+   +    AVK++ K     NG       + P  I  E+ I++ L 
Sbjct: 70  TLGAGSFGVVKRAKQLHSDEDVAVKILLKRALEKNG------GLEP--IYDELNIIQHLD 121

Query: 86  HPNVLSLYDVWETNNNLYLILEYAEKGELFNLLVDHGPLPEREAINCFRQIIIGISYCHA 145
           HPN++   D +ET +  Y++ + A  GELF+ ++  G   E +A+N   QI+  + Y H+
Sbjct: 122 HPNIVKFKDWFETESKFYIVTQLASGGELFDRIMHDGKYTEEDAVNIVVQILKAVEYLHS 181

Query: 146 LGIVHRDLKPENLL-LDSFYN--IKIADFGMA-ALQTDADLLETSCGSPHYAAPEIVSGL 201
             I+HRDLKPENLL LD   +  I +ADFG+A  L+ D D++    GS  Y APE+ +  
Sbjct: 182 QNIIHRDLKPENLLYLDKSKDSRIVLADFGIARQLENDDDVIYRPAGSLGYVAPEVFTSD 241

Query: 202 PYEGFASDVWSCGVILFALLTGRLPFDEE--NGNVRDLLLKVQKGQFEMPNDTEISRDAQ 259
            + G  SD+WS GVI + LL G  PF  E  +G + ++       +F+ P    IS  A+
Sbjct: 242 GH-GKPSDIWSVGVITYTLLCGYSPFKAESVDGFLDEVTSDENPVKFQRPYWDGISELAK 300

Query: 260 DLIGKILVVDPRQRIKIRDILSHPLLK 286
           + I +IL +DP  R    ++L+ P ++
Sbjct: 301 NFILRILDLDPACRPSATELLNDPWIQ 327

>KLLA0B07205g Chr2 complement(624606..625973) [1368 bp, 455 aa] {ON}
           similar to uniprot|P05986 Saccharomyces cerevisiae
           YKL166C TPK3 Involved in nutrient control of cell growth
           and division cAMP-dependent protein kinase catalytic
           subunit and to YJL164C uniprot|P06244 Saccharomyces
           cerevisiae YJL164C TPK1 putative catalytic subunit of
           cAMP- dependent protein kinase
          Length = 455

 Score =  143 bits (360), Expect = 1e-35,   Method: Compositional matrix adjust.
 Identities = 91/276 (32%), Positives = 145/276 (52%), Gaps = 28/276 (10%)

Query: 21  WKLGETLGFGSTGKVQLAQHERTGHRTAVKVISKS--IFNNNGNHSNDDSVLPYNIEREI 78
           +++  TLG GS G+V L +    G   A+KV+ K+  +      H+ND        ER +
Sbjct: 145 FQILRTLGTGSFGRVHLVRSNHNGRFYAMKVLKKNTVVKLKQVEHTND--------ERNM 196

Query: 79  VIMKLLSHPNVLSLYDVWETNNNLYLILEYAEKGELFNLLVDHGPLPEREAINCFRQIII 138
             + ++SHP ++ ++  ++ +  L++I++Y E GELF+LL      P   A     ++ +
Sbjct: 197 --LSIVSHPFIIRMWGTFQDSQQLFMIMDYIEGGELFSLLRKSQRFPNPVAKFYAAEVCL 254

Query: 139 GISYCHALGIVHRDLKPENLLLDSFYNIKIADFGMAALQTDADLLETSCGSPHYAAPEIV 198
            + Y H+ GI++RDLKPEN+LLD   +IK+ DFG A  +   D+  T CG+P Y APE+V
Sbjct: 255 ALEYLHSKGIIYRDLKPENILLDKNGHIKLTDFGFA--KYVPDVTYTLCGTPDYIAPEVV 312

Query: 199 SGLPYEGFASDVWSCGVILFALLTGRLPFDEENGNVRDLLLKVQKGQFEMPNDTE--ISR 256
           S  PY   + D WS GV+++ +L G  PF + N       +K  +     P         
Sbjct: 313 STKPYNK-SVDWWSFGVLIYEMLAGYTPFYDSN------TIKTYENILNAPVRFPPFFHS 365

Query: 257 DAQDLIGKILVVDPRQRI-----KIRDILSHPLLKK 287
           DAQDLI K++  D  QR+        D+ +HP   +
Sbjct: 366 DAQDLISKLITRDLSQRLGNLQNGSEDVKNHPWFSE 401

>Suva_6.245 Chr6 (438131..439315) [1185 bp, 394 aa] {ON} YJL164C
           (REAL)
          Length = 394

 Score =  141 bits (356), Expect = 1e-35,   Method: Compositional matrix adjust.
 Identities = 84/269 (31%), Positives = 139/269 (51%), Gaps = 24/269 (8%)

Query: 26  TLGFGSTGKVQLAQHERTGHRTAVKVISKSIFN--NNGNHSNDDSVLPYNIEREIVIMKL 83
           TLG GS G+V L +    G   A+KV+ K I        H+ND          E +++ +
Sbjct: 89  TLGTGSFGRVHLIRSRHNGRYYAMKVLKKEIVVRLKQVEHTND----------ERLMLSI 138

Query: 84  LSHPNVLSLYDVWETNNNLYLILEYAEKGELFNLLVDHGPLPEREAINCFRQIIIGISYC 143
           ++HP ++ ++  ++    +++I++Y E GELF+LL      P   A     ++ + + Y 
Sbjct: 139 VTHPFIIRMWGTFQDAQQIFMIMDYIEGGELFSLLRKSQRFPNPVAKFYAAEVCLALEYL 198

Query: 144 HALGIVHRDLKPENLLLDSFYNIKIADFGMAALQTDADLLETSCGSPHYAAPEIVSGLPY 203
           H+  I++RDLKPEN+LLD   ++KI DFG A      D+  T CG+P Y APE+VS  PY
Sbjct: 199 HSKDIIYRDLKPENILLDKNGHVKITDFGFAKYV--PDVTYTLCGTPDYIAPEVVSTKPY 256

Query: 204 EGFASDVWSCGVILFALLTGRLPFDEENGNVRDLLLKVQKGQFEMPNDTEISRDAQDLIG 263
              + D WS G++++ +L G  PF   + N      K+   +   P     + D +DL+ 
Sbjct: 257 NK-SIDWWSFGILIYEMLAGYTPF--YDSNTMKTYEKILNAELRFP--PFFNDDVKDLLS 311

Query: 264 KILVVDPRQRI-----KIRDILSHPLLKK 287
           +++  D  QR+        D+ +HP  K+
Sbjct: 312 RLITRDLSQRLGNLQNGTEDVKNHPWFKE 340

>Suva_16.104 Chr16 (176201..177352) [1152 bp, 383 aa] {ON} YPL203W
           (REAL)
          Length = 383

 Score =  141 bits (355), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 92/283 (32%), Positives = 147/283 (51%), Gaps = 26/283 (9%)

Query: 11  AAKPSSTIGPWKLGETLGFGSTGKVQLAQHERTGHRTAVKVISKS--IFNNNGNHSNDDS 68
            +K   T+  +++  TLG GS G+V L +    G   A+KV+ K   +      H+ND  
Sbjct: 63  VSKGKYTLHDFQIMRTLGTGSFGRVHLVRSVHNGRYYAIKVLKKQQIVKMKQVEHTND-- 120

Query: 69  VLPYNIEREIVIMKLLSHPNVLSLYDVWETNNNLYLILEYAEKGELFNLLVDHGPLPERE 128
                 ER +  +KL+ HP ++ ++  ++   N++++++Y E GELF+LL      P   
Sbjct: 121 ------ERRM--LKLVEHPFLIRMWGTFQDARNIFMVMDYIEGGELFSLLRKSQRFPNPV 172

Query: 129 AINCFRQIIIGISYCHALGIVHRDLKPENLLLDSFYNIKIADFGMAA-LQTDADLLETSC 187
           A     ++I+ + Y H   I++RDLKPEN+LLD   +IKI DFG A  +QT   +  T C
Sbjct: 173 AKFYAAEVILALEYLHGHNIIYRDLKPENILLDRNGHIKITDFGFAKEVQT---VTWTLC 229

Query: 188 GSPHYAAPEIVSGLPYEGFASDVWSCGVILFALLTGRLPFDEENGNVRDLLLKVQKGQFE 247
           G+P Y APE+++  PY   + D WS GV+++ +L G  PF   +        K+ +G+  
Sbjct: 230 GTPDYIAPEVITTKPYNK-SVDWWSLGVLIYEMLAGYTPF--YDTTPMKTYEKILQGKVI 286

Query: 248 MPNDTEISRDAQDLIGKILVVDPRQRI-----KIRDILSHPLL 285
            P       D  DL+ K++  D  +RI       RDI +HP  
Sbjct: 287 YP--PYFHPDVVDLLSKLITADLTRRIGNLQSGSRDIKAHPWF 327

>KLLA0D03190g Chr4 (267933..269051) [1119 bp, 372 aa] {ON} highly
           similar to uniprot|P06245 Saccharomyces cerevisiae
           YPL203W TPK2 Involved in nutrient control of cell growth
           and division cAMP-dependent protein kinase catalytic
           subunit
          Length = 372

 Score =  140 bits (354), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 98/309 (31%), Positives = 157/309 (50%), Gaps = 28/309 (9%)

Query: 10  SAAKPSSTIGPWKLGETLGFGSTGKVQLAQHERTGHRTAVKVISKS--IFNNNGNHSNDD 67
           + +K   T+  +++  TLG GS G+V L +    G   A+KV+ K   I      H+ND 
Sbjct: 51  TVSKGKYTLHDFQIMRTLGTGSFGRVHLVRSVHNGRYYAIKVLKKHQIIRMKQIEHTND- 109

Query: 68  SVLPYNIEREIVIMKLLSHPNVLSLYDVWETNNNLYLILEYAEKGELFNLLVDHGPLPER 127
                  ER +  +KL+ HP ++ ++  ++ + NL+++++Y E GELF+LL      P  
Sbjct: 110 -------ERRM--LKLVEHPFLIRMWGTFQDSRNLFMVMDYIEGGELFSLLRKSQRFPNP 160

Query: 128 EAINCFRQIIIGISYCHALGIVHRDLKPENLLLDSFYNIKIADFGMAALQTDADLLETSC 187
            A     ++ + + Y H+  I++RDLKPEN+LLD   +IKI DFG A  +    +  T C
Sbjct: 161 VAKFYAAEVTLALEYLHSHNIIYRDLKPENILLDRNGHIKITDFGFA--KEVITVTWTLC 218

Query: 188 GSPHYAAPEIVSGLPYEGFASDVWSCGVILFALLTGRLPFDEENGNVRDLLLKVQKGQFE 247
           G+P Y APE+++  PY   + D WS G+++F +L G  PF +          K+  G+  
Sbjct: 219 GTPDYIAPEVITTKPYNK-SVDWWSLGILIFEMLAGYTPFYDVTP--MKTYEKILAGEVV 275

Query: 248 MPNDTEISRDAQDLIGKILVVDPRQRI-----KIRDILSHPLLKKYQTIKDSKSIKDLPR 302
            P       D  DL+GK++  D  +R+        DI SHP     + I +    KD+  
Sbjct: 276 YP--PFFHPDVVDLLGKLITADLTRRLGNLQSGPDDIKSHPWFA--EVIWEKLVAKDI-- 329

Query: 303 ENTYLYPLA 311
           E  Y  P+A
Sbjct: 330 ETPYEPPIA 338

>ZYRO0G08844g Chr7 complement(711678..712766) [1089 bp, 362 aa] {ON}
           highly similar to uniprot|P06245 Saccharomyces
           cerevisiae YPL203W TPK2 Involved in nutrient control of
           cell growth and division cAMP-dependent protein kinase
           catalytic subunit
          Length = 362

 Score =  140 bits (353), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 90/281 (32%), Positives = 146/281 (51%), Gaps = 24/281 (8%)

Query: 12  AKPSSTIGPWKLGETLGFGSTGKVQLAQHERTGHRTAVKVISKS--IFNNNGNHSNDDSV 69
           +K   ++  +++  TLG GS G+V L +    G   A+KV+ K   +      H+ND   
Sbjct: 43  SKGKYSLKDFQIMRTLGTGSFGRVHLVRSVHNGRYYAMKVLKKQQVVKMKQIEHTND--- 99

Query: 70  LPYNIEREIVIMKLLSHPNVLSLYDVWETNNNLYLILEYAEKGELFNLLVDHGPLPEREA 129
                ER +  +KL+ HP ++ ++  ++   NL+++++Y E GELF+LL      P   A
Sbjct: 100 -----ERHM--LKLVEHPFIIRMWGTFQDAKNLFMVIDYIEGGELFSLLRKSHRFPNPVA 152

Query: 130 INCFRQIIIGISYCHALGIVHRDLKPENLLLDSFYNIKIADFGMAALQTDADLLETSCGS 189
                ++ + + Y H+  I++RDLKPENLLLD   +IKI DFG A  +    +  T CG+
Sbjct: 153 KFYAAEVTLALDYLHSHNIIYRDLKPENLLLDRNGHIKITDFGFA--KEVVTVTWTLCGT 210

Query: 190 PHYAAPEIVSGLPYEGFASDVWSCGVILFALLTGRLPFDEENGNVRDLLLKVQKGQFEMP 249
           P Y APE+++  PY   + D WS GV++F +L G  PF   +        K+ +G+   P
Sbjct: 211 PDYIAPEVITTKPYNK-SVDWWSLGVLIFEMLAGYTPF--YDATAMKTYEKILQGKVNYP 267

Query: 250 NDTEISRDAQDLIGKILVVDPRQRI-----KIRDILSHPLL 285
                  D  DL+ K+++ D  +R+       +DI SHP  
Sbjct: 268 --PFFHPDVVDLLSKLIMADLTRRLGNLQSGSQDIKSHPWF 306

>KLLA0C06138g Chr3 (540409..542535) [2127 bp, 708 aa] {ON} similar
           to uniprot|P32562 Saccharomyces cerevisiae YMR001C
          Length = 708

 Score =  146 bits (369), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 79/206 (38%), Positives = 119/206 (57%), Gaps = 6/206 (2%)

Query: 77  EIVIMKLLSHPNVLSLYDVWETNNNLYLILEYAEKGELFNLLVDHGPLPEREAINCFRQI 136
           EI I K + HPN++   D +E + N+Y++LE    G +  LL     L E E   C  QI
Sbjct: 137 EIQIHKSMKHPNIVQFTDCFEDDTNVYILLEICPNGSVMELLRQRKHLTEPEVRFCMIQI 196

Query: 137 IIGISYCHALGIVHRDLKPENLLLDSFYNIKIADFGMAA-LQTDADLLETSCGSPHYAAP 195
           I  I Y H+  ++HRDLK  N+  D  YN+KI DFG+AA L  D +   T CG+P+Y AP
Sbjct: 197 IGAIRYMHSRRVIHRDLKLGNIFFDKEYNLKIGDFGLAAVLANDKERKYTICGTPNYIAP 256

Query: 196 EIVSGLPYEG--FASDVWSCGVILFALLTGRLPFDEENGNVRDLLLKVQKGQFEMPNDTE 253
           E+++G  + G  +  D+WS GV+L+ALL G+ PF  +   V  +  +++   F  P D  
Sbjct: 257 EVLTG-KHTGHSYEVDIWSIGVMLYALLFGKPPFQAK--EVETIYERIKCRDFIFPADKP 313

Query: 254 ISRDAQDLIGKILVVDPRQRIKIRDI 279
           +S DA++LI  +L ++P  R  + +I
Sbjct: 314 VSSDAKNLISHLLQLNPAARPSLYEI 339

>Kwal_56.24059 s56 complement(829673..830734) [1062 bp, 353 aa] {ON}
           YPL203W (TPK2) - cAMP-dependent protein kinase catalytic
           subunit [contig 166] FULL
          Length = 353

 Score =  140 bits (352), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 90/283 (31%), Positives = 149/283 (52%), Gaps = 24/283 (8%)

Query: 10  SAAKPSSTIGPWKLGETLGFGSTGKVQLAQHERTGHRTAVKVISKS--IFNNNGNHSNDD 67
           + +K   ++  +++  TLG GS G+V L +    G   A+KV+ K   I      H+ND 
Sbjct: 32  AVSKGKYSLNDFQILRTLGTGSFGRVHLVRSVHNGRYYAIKVLKKEQVIRMKQIEHTND- 90

Query: 68  SVLPYNIEREIVIMKLLSHPNVLSLYDVWETNNNLYLILEYAEKGELFNLLVDHGPLPER 127
                  ER +  +KL+ HP ++ ++  ++ + NL+++++Y E GELF+LL      P  
Sbjct: 91  -------ERRM--LKLVDHPFLIRMWGTFQDSRNLFMVMDYIEGGELFSLLRKSQRFPNP 141

Query: 128 EAINCFRQIIIGISYCHALGIVHRDLKPENLLLDSFYNIKIADFGMAALQTDADLLETSC 187
            A     ++I+ + Y H+  I++RDLKPEN+LLD   +IKI DFG A  + D  +  T C
Sbjct: 142 VAKFYAAEVILALEYLHSHDIIYRDLKPENILLDRNGHIKITDFGFAK-EVDT-VTWTLC 199

Query: 188 GSPHYAAPEIVSGLPYEGFASDVWSCGVILFALLTGRLPFDEENGNVRDLLLKVQKGQFE 247
           G+P Y APE+++  PY   + D WS G+++F +L G  PF   +        K+ +G+  
Sbjct: 200 GTPDYIAPEVIATKPYNK-SVDWWSLGILIFEMLAGYTPF--YDATPMKTYEKILQGKVA 256

Query: 248 MPNDTEISRDAQDLIGKILVVDPRQRI-----KIRDILSHPLL 285
            P       D  DL+ K++  D  +R+       +D+ SHP  
Sbjct: 257 YP--PFFHPDVVDLLCKLITSDLTRRLGNLQSGPQDVKSHPWF 297

>NDAI0H03520 Chr8 (860096..861472) [1377 bp, 458 aa] {ON} 
          Length = 458

 Score =  142 bits (359), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 92/277 (33%), Positives = 147/277 (53%), Gaps = 16/277 (5%)

Query: 5   NTETHSAAKPSSTIGP--WKLGETLGFGSTGKVQLAQHERTGHRTAVKVISKSIFNNNGN 62
           N+E      P S +    ++ G+TLG GS G V+ A+   +    AVK++ K     N  
Sbjct: 13  NSEIKDGKWPPSLVTKKDYEFGKTLGAGSFGIVRQAKRISSNEEVAVKILLKQALREN-- 70

Query: 63  HSNDDSVLPYNIEREIVIMKLLSHPNVLSLYDVWETNNNLYLILEYAEKGELFNLLVDHG 122
                ++    + +E+ I+K L H N++   + +ET++ LY++ + A  GELF+ ++  G
Sbjct: 71  -----AIQLRMLYQELSILKKLHHRNIVEFKNWFETDDKLYIVTQLATGGELFDRIIMEG 125

Query: 123 PLPEREAINCFRQIIIGISYCHALGIVHRDLKPENLLL---DSFYNIKIADFGMAA-LQT 178
              E +A+    QI+  + Y H+  IVHRDLKPENLL    +    + IADFG+A  L++
Sbjct: 126 KFTEDDAVKIIVQILSAVEYIHSKNIVHRDLKPENLLYLTKEKDSQLVIADFGIAKELKS 185

Query: 179 DADLLETSCGSPHYAAPEIVSGLPYEGFASDVWSCGVILFALLTGRLPFDEEN--GNVRD 236
             +L+  + GS  Y APE+++ +   G   D+WS GVI + LL G   F  E   G + +
Sbjct: 186 GEELIFKAAGSLGYVAPEVLT-VNGHGKPCDIWSLGVITYTLLCGYSAFKAETVEGFLDE 244

Query: 237 LLLKVQKGQFEMPNDTEISRDAQDLIGKILVVDPRQR 273
            +   Q  QF+ P    IS+ A++ I K L + P QR
Sbjct: 245 CIANDQPVQFQKPYWDNISQSAKNFILKCLDLTPEQR 281

>NDAI0F01650 Chr6 (403635..404738) [1104 bp, 367 aa] {ON} Anc_6.214
          Length = 367

 Score =  140 bits (352), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 89/281 (31%), Positives = 146/281 (51%), Gaps = 24/281 (8%)

Query: 12  AKPSSTIGPWKLGETLGFGSTGKVQLAQHERTGHRTAVKVISKS--IFNNNGNHSNDDSV 69
           +K   T+  +++  TLG GS G+V L +    G   A+KV+ K   +      H+ND   
Sbjct: 48  SKGKYTLQDFQIMRTLGTGSFGRVHLVRSVHNGRYYAIKVLKKHQIVRMKQIEHTND--- 104

Query: 70  LPYNIEREIVIMKLLSHPNVLSLYDVWETNNNLYLILEYAEKGELFNLLVDHGPLPEREA 129
                ER +  +KL+ HP ++ ++  ++ + N++++++Y E GELF+LL      P   A
Sbjct: 105 -----ERRM--LKLVEHPFLIRMWGTFQDSRNIFMVMDYIEGGELFSLLRKSQRFPNPVA 157

Query: 130 INCFRQIIIGISYCHALGIVHRDLKPENLLLDSFYNIKIADFGMAALQTDADLLETSCGS 189
                ++ + + Y H   I++RDLKPEN+LLD   +IKI DFG A  +    +  T CG+
Sbjct: 158 KFYAAEVTLALEYLHHHNIIYRDLKPENILLDRNGHIKITDFGFA--KEVETVTWTLCGT 215

Query: 190 PHYAAPEIVSGLPYEGFASDVWSCGVILFALLTGRLPFDEENGNVRDLLLKVQKGQFEMP 249
           P Y APE+++  PY   + D WS G+++F +L G  PF   +        K+ +G+   P
Sbjct: 216 PDYIAPEVIATKPYNK-SVDWWSLGILIFEMLAGYTPF--YDSTPMKTYEKILQGKVIFP 272

Query: 250 NDTEISRDAQDLIGKILVVDPRQRI-----KIRDILSHPLL 285
             T    D  DL+G+++  D  +RI       +DI  HP  
Sbjct: 273 --TFFHPDVVDLLGQLITADLTRRIGNLQSGSKDIKCHPWF 311

>Skud_13.154 Chr13 complement(255263..257380) [2118 bp, 705 aa] {ON}
           YMR001C (REAL)
          Length = 705

 Score =  145 bits (367), Expect = 3e-35,   Method: Compositional matrix adjust.
 Identities = 81/213 (38%), Positives = 122/213 (57%), Gaps = 6/213 (2%)

Query: 77  EIVIMKLLSHPNVLSLYDVWETNNNLYLILEYAEKGELFNLLVDHGPLPEREAINCFRQI 136
           EI I K +SHPN++   D +E ++N+Y++LE    G L  LL     L E E      QI
Sbjct: 129 EIQIHKSMSHPNIVQFIDCFEDDSNVYILLEICPNGSLMELLKRRKVLTEPEVRFFTTQI 188

Query: 137 IIGISYCHALGIVHRDLKPENLLLDSFYNIKIADFGMAA-LQTDADLLETSCGSPHYAAP 195
              I Y H+  ++HRDLK  N+  DS YN+KI DFG+AA L  +++   T CG+P+Y AP
Sbjct: 189 CGAIKYMHSRRVIHRDLKLGNIFFDSNYNLKIGDFGLAAVLANESERKYTICGTPNYIAP 248

Query: 196 EIVSGLPYEG--FASDVWSCGVILFALLTGRLPFDEENGNVRDLLLKVQKGQFEMPNDTE 253
           E++ G  + G  F  D+WS GV+L+ALL G+ PF   + N   +  +++   F  P D  
Sbjct: 249 EVLMG-KHSGHSFEVDIWSLGVMLYALLIGKPPFQARDVNT--IYERIKCRDFSFPKDKP 305

Query: 254 ISRDAQDLIGKILVVDPRQRIKIRDILSHPLLK 286
           IS + + LI  IL +DP +R  + +I+ +   +
Sbjct: 306 ISDEGKILIRDILSLDPIERPSLTEIMDYVWFR 338

>Suva_11.56 Chr11 complement(119479..120675) [1197 bp, 398 aa] {ON}
           YKL166C (REAL)
          Length = 398

 Score =  140 bits (354), Expect = 3e-35,   Method: Compositional matrix adjust.
 Identities = 86/276 (31%), Positives = 141/276 (51%), Gaps = 24/276 (8%)

Query: 17  TIGPWKLGETLGFGSTGKVQLAQHERTGHRTAVKVISKSIFNN--NGNHSNDDSVLPYNI 74
           ++G +++  TLG GS G+V L +    G   A+K + K          H+ND        
Sbjct: 84  SLGDFQILRTLGTGSFGRVHLIRSNHNGRFYALKTLKKHTIVKLKQVEHTND-------- 135

Query: 75  EREIVIMKLLSHPNVLSLYDVWETNNNLYLILEYAEKGELFNLLVDHGPLPEREAINCFR 134
           ER +  + ++SHP ++ ++  ++ +  ++++++Y E GELF+LL      P   A     
Sbjct: 136 ERRM--LSIVSHPFIIRMWGTFQDSQQVFMVMDYIEGGELFSLLRKSQRFPNPVAKFYAA 193

Query: 135 QIIIGISYCHALGIVHRDLKPENLLLDSFYNIKIADFGMAALQTDADLLETSCGSPHYAA 194
           ++ + + Y H+  I++RDLKPEN+LLD   +IKI DFG A    D     T CG+P Y A
Sbjct: 194 EVCLALEYLHSKDIIYRDLKPENILLDKNGHIKITDFGFAKFVPDVTY--TLCGTPDYIA 251

Query: 195 PEIVSGLPYEGFASDVWSCGVILFALLTGRLPFDEENGNVRDLLLKVQKGQFEMPNDTEI 254
           PE+VS  PY   + D WS G++++ +L G  PF   N N       +   + + P     
Sbjct: 252 PEVVSTKPYNK-SVDWWSFGILIYEMLAGYTPF--YNSNTMKTYENILNAELKFP--PFF 306

Query: 255 SRDAQDLIGKILVVDPRQRI-----KIRDILSHPLL 285
             DAQDL+ K++  D  +R+        D+ +HP  
Sbjct: 307 HPDAQDLLKKLITRDLSERLGNLQNGSEDVKNHPWF 342

>Kpol_1069.13 s1069 complement(27223..28506) [1284 bp, 427 aa] {ON}
           complement(27223..28506) [1284 nt, 428 aa]
          Length = 427

 Score =  141 bits (355), Expect = 3e-35,   Method: Compositional matrix adjust.
 Identities = 95/287 (33%), Positives = 151/287 (52%), Gaps = 24/287 (8%)

Query: 11  AAKPSSTIGP--WKLGETLGFGSTGKVQLAQHERTGHRTAVKVISKSIFNNNGNHSNDDS 68
           + +P+S +    +  G+TLG GS G V+ A+   TG   AVK++ K     N        
Sbjct: 26  SGQPASYVNKTDYVFGKTLGAGSFGVVRQARRISTGENVAVKILLKKALKGN-------C 78

Query: 69  VLPYNIEREIVIMKLLSHPNVLSLYDVWETNNNLYLILEYAEKGELFNLLVDHGPLPERE 128
           V    +  E+ I++ L HPN++     +E+ +  Y+  + A  GELF+ ++  G   E +
Sbjct: 79  VQIEMLYDELSILQKLHHPNIVDFKAWFESKDKFYIATQLATGGELFDRILARGKFTEVD 138

Query: 129 AINCFRQIIIGISYCHALGIVHRDLKPENLLL-----DSFYNIKIADFGMA-ALQTDADL 182
           A+    Q++ GI Y H+  IVHRDLKPEN+L      DS   + IADFG+A  L++  DL
Sbjct: 139 AVRIIVQLLQGIKYIHSKDIVHRDLKPENVLYIDKSDDS--PLVIADFGIAKQLKSGDDL 196

Query: 183 LETSCGSPHYAAPEIVSGLPYEGFASDVWSCGVILFALLTGRLPFDEENGNVRDLLLKVQ 242
           +  + GS  Y APE+++ +   G   D+WS GVI + LL G  PF  E  +V   L +  
Sbjct: 197 IFKAAGSLGYVAPEVLT-VNGHGKPCDIWSLGVITYTLLCGYSPFIAE--SVEGFLDECT 253

Query: 243 KG----QFEMPNDTEISRDAQDLIGKILVVDPRQRIKIRDILSHPLL 285
            G    +F  P    IS +A++ I + L+++P +R    ++L  P +
Sbjct: 254 SGKYPVKFHRPYWDTISDEAKEFILRALILEPSKRPTASELLEDPWI 300

>CAGL0G09020g Chr7 (860266..861351) [1086 bp, 361 aa] {ON} highly
           similar to uniprot|P06245 Saccharomyces cerevisiae
           YPL203w TPK2 cAMP-dependent protein kinase 2 catalytic
           chain
          Length = 361

 Score =  139 bits (351), Expect = 3e-35,   Method: Compositional matrix adjust.
 Identities = 90/283 (31%), Positives = 145/283 (51%), Gaps = 24/283 (8%)

Query: 10  SAAKPSSTIGPWKLGETLGFGSTGKVQLAQHERTGHRTAVKVISKS--IFNNNGNHSNDD 67
           + +K   ++  + +  TLG GS G+V L +    G   A+KV+ K+  +      H+ND 
Sbjct: 40  TVSKGKYSLQDFHIMRTLGTGSFGRVHLVRSVHNGRYYAIKVLKKAQVVKMKQIEHTND- 98

Query: 68  SVLPYNIEREIVIMKLLSHPNVLSLYDVWETNNNLYLILEYAEKGELFNLLVDHGPLPER 127
                  ER +  +KL+ HP ++ ++  ++ + NL+++++Y E GELF LL      P  
Sbjct: 99  -------ERRM--LKLVEHPFLIRMWGTFQDSRNLFMVMDYIEGGELFTLLRKSQRFPNP 149

Query: 128 EAINCFRQIIIGISYCHALGIVHRDLKPENLLLDSFYNIKIADFGMAALQTDADLLETSC 187
            A     ++ + + Y H   I++RDLKPEN+LLD   +IKI DFG A  +    +  T C
Sbjct: 150 VAKFYAAEVTLALEYLHFHNIIYRDLKPENILLDRNGHIKITDFGFA--KEVETVTWTLC 207

Query: 188 GSPHYAAPEIVSGLPYEGFASDVWSCGVILFALLTGRLPFDEENGNVRDLLLKVQKGQFE 247
           G+P Y APE+++  PY   + D WS GV+++ +L G  PF +          K+  G+  
Sbjct: 208 GTPDYIAPEVIATKPYNK-SVDWWSLGVLIYEMLAGYTPFYDTTP--MKTYEKILHGKVV 264

Query: 248 MPNDTEISRDAQDLIGKILVVDPRQRI-----KIRDILSHPLL 285
            P     + D  DL+ K+L  D  +RI       +DI SHP  
Sbjct: 265 YPQ--FFNSDVIDLLSKLLTADLTRRIGNLQKGAQDIKSHPWF 305

>YMR001C Chr13 complement(269019..271136) [2118 bp, 705 aa] {ON}
           CDC5Polo-like kinase with multiple functions in mitosis
           and cytokinesis through substrate phosphorylation, also
           functions in adaptation to DNA damage during meiosis;
           has similarity to Xenopus Plx1 and S. pombe Plo1p;
           possible Cdc28p substrate
          Length = 705

 Score =  145 bits (366), Expect = 3e-35,   Method: Compositional matrix adjust.
 Identities = 81/213 (38%), Positives = 122/213 (57%), Gaps = 6/213 (2%)

Query: 77  EIVIMKLLSHPNVLSLYDVWETNNNLYLILEYAEKGELFNLLVDHGPLPEREAINCFRQI 136
           EI I K +SHPN++   D +E ++N+Y++LE    G L  LL     L E E      QI
Sbjct: 129 EIQIHKSMSHPNIVQFIDCFEDDSNVYILLEICPNGSLMELLKRRKVLTEPEVRFFTTQI 188

Query: 137 IIGISYCHALGIVHRDLKPENLLLDSFYNIKIADFGMAA-LQTDADLLETSCGSPHYAAP 195
              I Y H+  ++HRDLK  N+  DS YN+KI DFG+AA L  +++   T CG+P+Y AP
Sbjct: 189 CGAIKYMHSRRVIHRDLKLGNIFFDSNYNLKIGDFGLAAVLANESERKYTICGTPNYIAP 248

Query: 196 EIVSGLPYEG--FASDVWSCGVILFALLTGRLPFDEENGNVRDLLLKVQKGQFEMPNDTE 253
           E++ G  + G  F  D+WS GV+L+ALL G+ PF   + N   +  +++   F  P D  
Sbjct: 249 EVLMG-KHSGHSFEVDIWSLGVMLYALLIGKPPFQARDVNT--IYERIKCRDFSFPRDKP 305

Query: 254 ISRDAQDLIGKILVVDPRQRIKIRDILSHPLLK 286
           IS + + LI  IL +DP +R  + +I+ +   +
Sbjct: 306 ISDEGKILIRDILSLDPIERPSLTEIMDYVWFR 338

>Ecym_2194 Chr2 complement(381633..382733) [1101 bp, 366 aa] {ON}
           similar to Ashbya gossypii AFL101C
          Length = 366

 Score =  139 bits (351), Expect = 4e-35,   Method: Compositional matrix adjust.
 Identities = 87/277 (31%), Positives = 139/277 (50%), Gaps = 23/277 (8%)

Query: 18  IGPWKLGETLGFGSTGKVQLAQHERTGHRTAVKVISKSIFNNNGNHSNDDSVLPYNIE-- 75
           +  +++G+ LG G  GKV   +H  +G   A+K + K              ++ YNIE  
Sbjct: 105 LADFEMGKILGKGKFGKVYCVRHIPSGFICALKAMEKK------------EIIQYNIEKQ 152

Query: 76  --REIVIMKLLSHPNVLSLYDVWETNNNLYLILEYAEKGELFNLLVDHGPLPEREAINCF 133
             RE+ I   L HPN+  LY  +     +YL++EY   GEL+  L       +  A    
Sbjct: 153 FRREVEIQSSLRHPNLTQLYGYFHDEKRVYLVMEYLVNGELYKHLKGRNHFSDEVASYYV 212

Query: 134 RQIIIGISYCHALGIVHRDLKPENLLLDSFYNIKIADFGMAALQTDADLLETSCGSPHYA 193
            Q+   + Y H   I+HRD+KPEN+++     IK+ DFG + + +     +T CG+  Y 
Sbjct: 213 YQMAGALDYMHERNILHRDIKPENIIIGFNNVIKLTDFGWSVINSKGFKRKTLCGTVDYL 272

Query: 194 APEIVSGLPYEGFASDVWSCGVILFALLTGRLPFDEENGNVRDLLLK-VQKGQFEMPNDT 252
           +PE++    Y+    DVW+ GV+ + LL G  PF+EE+   ++L  K + K     P+  
Sbjct: 273 SPELIKSREYDE-KVDVWALGVLTYELLVGSPPFEEES---KELTYKRILKRNLVFPD-- 326

Query: 253 EISRDAQDLIGKILVVDPRQRIKIRDILSHPLLKKYQ 289
            I  DA+ LI ++L  DP  RI ++D+  H  + K Q
Sbjct: 327 HIDPDARHLISRLLEYDPANRIALKDVRGHSWILKNQ 363

>KNAG0D01140 Chr4 (192308..193495) [1188 bp, 395 aa] {ON} 
          Length = 395

 Score =  140 bits (353), Expect = 4e-35,   Method: Compositional matrix adjust.
 Identities = 89/283 (31%), Positives = 147/283 (51%), Gaps = 24/283 (8%)

Query: 10  SAAKPSSTIGPWKLGETLGFGSTGKVQLAQHERTGHRTAVKVISKS--IFNNNGNHSNDD 67
           + +K   T+  +++  TLG GS G+V L +    G   A+KV+ K+  +      H+ND 
Sbjct: 73  TVSKGKYTLNDFQIMRTLGTGSFGRVHLVRSVHNGRYYAIKVLKKTQVVRMKQIEHTND- 131

Query: 68  SVLPYNIEREIVIMKLLSHPNVLSLYDVWETNNNLYLILEYAEKGELFNLLVDHGPLPER 127
                  ER +  +KL+ HP ++ ++  ++  +NL+++++Y E GELF+LL      P  
Sbjct: 132 -------ERRM--LKLVEHPFLIRMWGTFQDAHNLFMVMDYIEGGELFSLLRKSQRFPNP 182

Query: 128 EAINCFRQIIIGISYCHALGIVHRDLKPENLLLDSFYNIKIADFGMAALQTDADLLETSC 187
            A     ++++ + Y H   I++RDLKPEN+LLD   +IKI DFG A  +    +  T C
Sbjct: 183 VAKFYAAEVVLALEYLHFHNIIYRDLKPENILLDRNGHIKITDFGFA--KEVESVTWTLC 240

Query: 188 GSPHYAAPEIVSGLPYEGFASDVWSCGVILFALLTGRLPFDEENGNVRDLLLKVQKGQFE 247
           G+P Y APE+++  PY   + D WS G+++F +L G  PF   +        K+ +G+  
Sbjct: 241 GTPDYIAPEVIATKPYNK-SVDWWSLGILIFEMLAGYTPF--YDSTPMKTYEKILQGKVI 297

Query: 248 MPNDTEISRDAQDLIGKILVVDPRQRI-----KIRDILSHPLL 285
            P       D  DL+ K++  D  +RI       +DI  HP  
Sbjct: 298 YP--PFFHPDVVDLLSKLITADLTRRIGNLQSGSQDIKQHPWF 338

>Suva_13.163 Chr13 complement(259136..261253) [2118 bp, 705 aa] {ON}
           YMR001C (REAL)
          Length = 705

 Score =  145 bits (365), Expect = 5e-35,   Method: Compositional matrix adjust.
 Identities = 80/209 (38%), Positives = 121/209 (57%), Gaps = 6/209 (2%)

Query: 77  EIVIMKLLSHPNVLSLYDVWETNNNLYLILEYAEKGELFNLLVDHGPLPEREAINCFRQI 136
           EI I K ++HPN++   D +E ++N+Y++LE    G L  LL     L E E      QI
Sbjct: 129 EIQIHKSMAHPNIVQFVDCFEDDSNVYILLEICPNGSLMELLKRRKVLTEPEVRFFTTQI 188

Query: 137 IIGISYCHALGIVHRDLKPENLLLDSFYNIKIADFGMAA-LQTDADLLETSCGSPHYAAP 195
              I Y H+  ++HRDLK  N+  DS YN+KI DFG+AA L  +++   T CG+P+Y AP
Sbjct: 189 CGAIKYMHSRRVIHRDLKLGNIFFDSNYNLKIGDFGLAAVLANESERKYTICGTPNYIAP 248

Query: 196 EIVSGLPYEG--FASDVWSCGVILFALLTGRLPFDEENGNVRDLLLKVQKGQFEMPNDTE 253
           E++ G  + G  F  D+WS GV+L+ALL G+ PF   + N   +  +++   F  P D  
Sbjct: 249 EVLMG-KHSGHSFEVDIWSLGVMLYALLIGKPPFQARDVNT--IYERIKCRDFSFPKDKP 305

Query: 254 ISRDAQDLIGKILVVDPRQRIKIRDILSH 282
           IS + + LI  IL +DP +R  + +I+ +
Sbjct: 306 ISDEGKILIRDILSLDPIERPSLTEIMDY 334

>SAKL0A04466g Chr1 (413816..414937) [1122 bp, 373 aa] {ON} highly
           similar to uniprot|P06245 Saccharomyces cerevisiae
           YPL203W TPK2 Involved in nutrient control of cell growth
           and division cAMP-dependent protein kinase catalytic
           subunit
          Length = 373

 Score =  139 bits (350), Expect = 6e-35,   Method: Compositional matrix adjust.
 Identities = 90/283 (31%), Positives = 149/283 (52%), Gaps = 24/283 (8%)

Query: 10  SAAKPSSTIGPWKLGETLGFGSTGKVQLAQHERTGHRTAVKVISKS--IFNNNGNHSNDD 67
           + +K   ++  +++  TLG GS G+V L +    G   A+KV+ K   I      H+ND 
Sbjct: 52  TISKGKYSLQDFQIMRTLGTGSFGRVHLVRSVHNGRYYAIKVLKKQQIIRMKQIEHTND- 110

Query: 68  SVLPYNIEREIVIMKLLSHPNVLSLYDVWETNNNLYLILEYAEKGELFNLLVDHGPLPER 127
                  ER +  +KL+ HP ++ ++  ++ + NL+++++Y E GELF+LL      P  
Sbjct: 111 -------ERRM--LKLVEHPFLIRMWGTFQDSRNLFMVMDYIEGGELFSLLRKSQRFPNP 161

Query: 128 EAINCFRQIIIGISYCHALGIVHRDLKPENLLLDSFYNIKIADFGMAALQTDADLLETSC 187
            A     ++ + + Y H+  I++RDLKPEN+LLD   +IKI DFG A  + D  +  T C
Sbjct: 162 VAKFYAAEVTLALEYLHSHNIIYRDLKPENILLDRNGHIKITDFGFAK-EVDT-VTWTLC 219

Query: 188 GSPHYAAPEIVSGLPYEGFASDVWSCGVILFALLTGRLPFDEENGNVRDLLLKVQKGQFE 247
           G+P Y APE+++  PY   + D WS G+++F +L G  PF   +        K+ +G+  
Sbjct: 220 GTPDYIAPEVITTKPYNK-SVDWWSLGILIFEMLAGYTPF--YDVTPVKTYEKILQGKVV 276

Query: 248 MPNDTEISRDAQDLIGKILVVDPRQRI-----KIRDILSHPLL 285
            P       D  DL+G+++  D  +R+       +DI SHP  
Sbjct: 277 YP--PFFHPDVVDLLGRLITADLTRRLGNLQSGPQDIKSHPWF 317

>Smik_13.159 Chr13 complement(260249..262366) [2118 bp, 705 aa] {ON}
           YMR001C (REAL)
          Length = 705

 Score =  144 bits (364), Expect = 6e-35,   Method: Compositional matrix adjust.
 Identities = 80/213 (37%), Positives = 122/213 (57%), Gaps = 6/213 (2%)

Query: 77  EIVIMKLLSHPNVLSLYDVWETNNNLYLILEYAEKGELFNLLVDHGPLPEREAINCFRQI 136
           EI I K ++HPN++   D +E ++N+Y++LE    G L  LL     L E E      QI
Sbjct: 129 EIQIHKSMAHPNIVQFIDCFEDDSNVYILLEICPNGSLMELLKRRKVLSEPEVRFFTTQI 188

Query: 137 IIGISYCHALGIVHRDLKPENLLLDSFYNIKIADFGMAA-LQTDADLLETSCGSPHYAAP 195
              I Y H+  ++HRDLK  N+  DS YN+KI DFG+AA L  +++   T CG+P+Y AP
Sbjct: 189 CGAIKYMHSRRVIHRDLKLGNIFFDSNYNLKIGDFGLAAVLANESERKYTICGTPNYIAP 248

Query: 196 EIVSGLPYEG--FASDVWSCGVILFALLTGRLPFDEENGNVRDLLLKVQKGQFEMPNDTE 253
           E++ G  + G  F  D+WS GV+L+ALL G+ PF   + N   +  +++   F  P D  
Sbjct: 249 EVLMG-KHSGHSFEVDIWSLGVMLYALLIGKPPFQARDVNT--IYERIKCRDFSFPKDKP 305

Query: 254 ISRDAQDLIGKILVVDPRQRIKIRDILSHPLLK 286
           IS + + LI  IL +DP +R  + +I+ +   +
Sbjct: 306 ISDEGKILIRDILSLDPIERPSLTEIMDYVWFR 338

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.313    0.133    0.374 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 105,389,086
Number of extensions: 4868585
Number of successful extensions: 28156
Number of sequences better than 10.0: 2272
Number of HSP's gapped: 25058
Number of HSP's successfully gapped: 2605
Length of query: 1037
Length of database: 53,481,399
Length adjustment: 120
Effective length of query: 917
Effective length of database: 39,721,479
Effective search space: 36424596243
Effective search space used: 36424596243
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.9 bits)
S2: 71 (32.0 bits)