Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
YBR016W3.187ON128361237e-09
Suva_2.1443.187ON119361166e-08
Smik_2.1353.187ON127361132e-07
Skud_2.1283.187ON127361106e-07
CAGL0I04510g3.187ON11626840.002
YDL012C3.187ON10725780.015
KAFR0C008803.187ON12131750.047
KLTH0E15840g3.187ON11325720.10
Kwal_YGOB_Anc_3.1873.187ON11225710.18
Skud_4.2413.187ON10625700.20
ZYRO0A04972g3.187ON12227700.27
SAKL0C08008g3.187ON14527670.65
Suva_4.2373.187ON10325660.66
Ecym_52633.187ON12428632.6
NOTE: 10 genes in the same pillar as YBR016W were not hit in these BLAST results
LIST: Kpol_1036.51 CAGL0K01903g Smik_4.222 NCAS0I01900 TBLA0B01680 TBLA0F00730 KNAG0K01285 AER212W TDEL0D04340 Klac_YGOB_Anc_3.187

BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= YBR016W
         (128 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

YBR016W Chr2 (270247..270633) [387 bp, 128 aa] {ON} Tail-anchore...    52   7e-09
Suva_2.144 Chr2 (249704..250063) [360 bp, 119 aa] {ON} YBR016W (...    49   6e-08
Smik_2.135 Chr2 (250473..250856) [384 bp, 127 aa] {ON} YBR016W (...    48   2e-07
Skud_2.128 Chr2 (243786..244169) [384 bp, 127 aa] {ON} YBR016W (...    47   6e-07
CAGL0I04510g Chr9 complement(403225..403527,403675..403722) [351...    37   0.002
YDL012C Chr4 complement(431108..431386,431473..431517) [324 bp, ...    35   0.015
KAFR0C00880 Chr3 (178337..178375,178475..178801) [366 bp, 121 aa...    33   0.047
KLTH0E15840g Chr5 (1406256..1406303,1406400..1406693) [342 bp, 1...    32   0.10 
Kwal_YGOB_Anc_3.187 s27 complement(77867..78157,78226..78273) [3...    32   0.18 
Skud_4.241 Chr4 complement(425844..426119,426211..426255) [321 b...    32   0.20 
ZYRO0A04972g Chr1 (400197..400235,400324..400653) [369 bp, 122 a...    32   0.27 
SAKL0C08008g Chr3 complement(743966..744268,744380..744514) [438...    30   0.65 
Suva_4.237 Chr4 complement(424387..424653,424741..424785) [312 b...    30   0.66 
Ecym_5263 Chr5 complement(545614..545943,546179..546223) [375 bp...    29   2.6  

>YBR016W Chr2 (270247..270633) [387 bp, 128 aa] {ON} Tail-anchored
          plasma membrane protein containing a conserved CYSTM
          module; predicted to be palmitoylated; has similarity
          to hydrophilins, which are involved in the adaptive
          response to hyperosmotic conditions
          Length = 128

 Score = 52.0 bits (123), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 36/36 (100%), Positives = 36/36 (100%)

Query: 1  MSANDYYGGTAGEKSQYSRPSNPPPSSAHQNKTQER 36
          MSANDYYGGTAGEKSQYSRPSNPPPSSAHQNKTQER
Sbjct: 1  MSANDYYGGTAGEKSQYSRPSNPPPSSAHQNKTQER 36

>Suva_2.144 Chr2 (249704..250063) [360 bp, 119 aa] {ON} YBR016W
          (REAL)
          Length = 119

 Score = 49.3 bits (116), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 32/36 (88%), Positives = 33/36 (91%)

Query: 1  MSANDYYGGTAGEKSQYSRPSNPPPSSAHQNKTQER 36
          MSANDYYGGTAGEK+QYSRPSNPPPSS HQ  TQER
Sbjct: 1  MSANDYYGGTAGEKAQYSRPSNPPPSSTHQGSTQER 36

>Smik_2.135 Chr2 (250473..250856) [384 bp, 127 aa] {ON} YBR016W
          (REAL)
          Length = 127

 Score = 48.1 bits (113), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 33/36 (91%), Positives = 34/36 (94%)

Query: 1  MSANDYYGGTAGEKSQYSRPSNPPPSSAHQNKTQER 36
          MSANDYYGG  GEKSQYSRPSNPPPSSAHQN+TQER
Sbjct: 1  MSANDYYGGATGEKSQYSRPSNPPPSSAHQNETQER 36

>Skud_2.128 Chr2 (243786..244169) [384 bp, 127 aa] {ON} YBR016W
          (REAL)
          Length = 127

 Score = 47.0 bits (110), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 33/36 (91%), Positives = 34/36 (94%)

Query: 1  MSANDYYGGTAGEKSQYSRPSNPPPSSAHQNKTQER 36
          MSANDYYGG AGEKSQYSRPSNPPPSSA Q+KTQER
Sbjct: 1  MSANDYYGGAAGEKSQYSRPSNPPPSSAQQDKTQER 36

>CAGL0I04510g Chr9 complement(403225..403527,403675..403722) [351
          bp, 116 aa] {ON} similar to uniprot|P38216
          Saccharomyces cerevisiae YBR016w and similar to
          uniprot|Q12489 Saccharomyces cerevisiae YDL012c
          Length = 116

 Score = 37.0 bits (84), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 16/26 (61%), Positives = 18/26 (69%)

Query: 1  MSANDYYGGTAGEKSQYSRPSNPPPS 26
          MSA +YY G    K QYSRP+ PPPS
Sbjct: 1  MSAQEYYNGAGDSKQQYSRPTAPPPS 26

>YDL012C Chr4 complement(431108..431386,431473..431517) [324 bp,
          107 aa] {ON} Tail-anchored plasma membrane protein
          containing a conserved CYSTM module, possibly involved
          in response to stress; may contribute to non-homologous
          end-joining (NHEJ) based on ydl012c htz1 double null
          phenotype
          Length = 107

 Score = 34.7 bits (78), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 17/25 (68%), Positives = 20/25 (80%), Gaps = 1/25 (4%)

Query: 1  MSANDYYGGTAGEKSQYSRPSNPPP 25
          MSA DYYG +A ++S YSRPS PPP
Sbjct: 1  MSAQDYYGNSASKQS-YSRPSAPPP 24

>KAFR0C00880 Chr3 (178337..178375,178475..178801) [366 bp, 121 aa]
          {ON} Anc_3.187 YDL012C
          Length = 121

 Score = 33.5 bits (75), Expect = 0.047,   Method: Compositional matrix adjust.
 Identities = 17/31 (54%), Positives = 21/31 (67%), Gaps = 3/31 (9%)

Query: 1  MSANDYYGGTAGEKSQYSRPSNPPPSSAHQN 31
          MSA +YYG T   K+QY+RPS PPP    Q+
Sbjct: 1  MSAREYYGDT---KTQYNRPSAPPPQQQGQS 28

>KLTH0E15840g Chr5 (1406256..1406303,1406400..1406693) [342 bp,
          113 aa] {ON} similar to uniprot|Q12489 Saccharomyces
          cerevisiae YDL012C Plasma membrane protein of unknown
          function
          Length = 113

 Score = 32.3 bits (72), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 14/25 (56%), Positives = 18/25 (72%)

Query: 1  MSANDYYGGTAGEKSQYSRPSNPPP 25
          MSA +YY GT+  K QY+ P+ PPP
Sbjct: 1  MSAAEYYKGTSESKQQYTSPAGPPP 25

>Kwal_YGOB_Anc_3.187 s27 complement(77867..78157,78226..78273)
          [339 bp, 112 aa] {ON} ANNOTATED BY YGOB -
          Length = 112

 Score = 32.0 bits (71), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 14/25 (56%), Positives = 18/25 (72%)

Query: 1  MSANDYYGGTAGEKSQYSRPSNPPP 25
          MSA +YY GT+  + QY+ PS PPP
Sbjct: 1  MSAAEYYKGTSQPQQQYTSPSGPPP 25

>Skud_4.241 Chr4 complement(425844..426119,426211..426255) [321
          bp, 106 aa] {ON} YDL012C (REAL)
          Length = 106

 Score = 31.6 bits (70), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 15/25 (60%), Positives = 19/25 (76%), Gaps = 1/25 (4%)

Query: 1  MSANDYYGGTAGEKSQYSRPSNPPP 25
          MSA DYYG +  ++S YSRP+ PPP
Sbjct: 1  MSAQDYYGNSTSKQS-YSRPTAPPP 24

>ZYRO0A04972g Chr1 (400197..400235,400324..400653) [369 bp, 122
          aa] {ON} weakly similar to uniprot|P38216 Saccharomyces
          cerevisiae YBR016W
          Length = 122

 Score = 31.6 bits (70), Expect = 0.27,   Method: Compositional matrix adjust.
 Identities = 16/27 (59%), Positives = 19/27 (70%), Gaps = 3/27 (11%)

Query: 1  MSANDYYGGTAGEKSQYSRPSNPPPSS 27
          MSA +YYG +   K+ YSRP  PPPSS
Sbjct: 1  MSAQEYYGDS---KASYSRPQGPPPSS 24

>SAKL0C08008g Chr3 complement(743966..744268,744380..744514) [438
          bp, 145 aa] {ON} similar to uniprot|Q12489
          Saccharomyces cerevisiae YDL012C Plasma membrane
          protein of unknown function
          Length = 145

 Score = 30.4 bits (67), Expect = 0.65,   Method: Compositional matrix adjust.
 Identities = 15/27 (55%), Positives = 17/27 (62%), Gaps = 1/27 (3%)

Query: 1  MSANDYYGGTAGEKSQ-YSRPSNPPPS 26
          MSA DYY G A +  Q Y RP+  PPS
Sbjct: 29 MSAADYYSGAAADSKQTYQRPTGAPPS 55

>Suva_4.237 Chr4 complement(424387..424653,424741..424785) [312
          bp, 103 aa] {ON} YDL012C (REAL)
          Length = 103

 Score = 30.0 bits (66), Expect = 0.66,   Method: Compositional matrix adjust.
 Identities = 15/25 (60%), Positives = 17/25 (68%), Gaps = 1/25 (4%)

Query: 1  MSANDYYGGTAGEKSQYSRPSNPPP 25
          MSA DYYG +A  K  YS P+ PPP
Sbjct: 1  MSAQDYYGNSA-YKQSYSHPTAPPP 24

>Ecym_5263 Chr5 complement(545614..545943,546179..546223) [375 bp,
          124 aa] {ON} similar to Ashbya gossypii AER212W
          Length = 124

 Score = 28.9 bits (63), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 15/28 (53%), Positives = 19/28 (67%), Gaps = 1/28 (3%)

Query: 1  MSANDYYGGTAGEKSQYSRPSNPPPSSA 28
          MSA DYYG T   K  ++RPS PPP+ +
Sbjct: 1  MSAADYYG-TGDNKQSFNRPSAPPPNQS 27

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.304    0.122    0.353 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 5,804,660
Number of extensions: 115450
Number of successful extensions: 337
Number of sequences better than 10.0: 16
Number of HSP's gapped: 332
Number of HSP's successfully gapped: 16
Length of query: 128
Length of database: 53,481,399
Length adjustment: 96
Effective length of query: 32
Effective length of database: 42,473,463
Effective search space: 1359150816
Effective search space used: 1359150816
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 43 (21.9 bits)
S2: 59 (27.3 bits)