Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
TPHA0O014801.317ON82481338650.0
Kpol_1035.261.317ON83582423260.0
TDEL0D018601.317ON80981820650.0
ZYRO0G20724g1.317ON81282520010.0
KAFR0A017301.317ON82182319670.0
TBLA0F013301.317ON82782819080.0
SAKL0D06974g1.317ON81382719030.0
NCAS0A092201.317ON83182718810.0
NDAI0G057401.317ON85784818520.0
Kwal_14.25871.317ON80882618470.0
KLTH0H10736g1.317ON81085018150.0
KNAG0C058301.317ON83083018160.0
Ecym_62881.317ON80681817770.0
AEL166C1.317ON80682417580.0
CAGL0J05236g1.317ON84284517400.0
KLLA0F01705g1.317ON78782316930.0
Skud_10.1591.317ON83184316600.0
Smik_10.1781.317ON83184516540.0
YJL062W (LAS21)1.317ON83083516350.0
Suva_6.1381.317ON83083816180.0
Ecym_55594.28ON10143634084e-40
KNAG0J028204.28ON10173974076e-40
NDAI0H003204.28ON10344244041e-39
KLLA0C17534g4.28ON10053934004e-39
ZYRO0B01034g4.28ON10093603898e-38
KLTH0E06094g4.28ON10164223853e-37
YLL031C (GPI13)4.28ON10173583835e-37
Kwal_55.20667singletonOFF6023573766e-37
Kwal_YGOB_55.206644.28ON9563573801e-36
Smik_12.254.28ON10173543729e-36
SAKL0H25542g4.28ON10134073702e-35
CAGL0G04015g4.28ON10193643674e-35
Kpol_478.14.28ON10094213675e-35
KAFR0I014104.28ON10163633612e-34
Suva_10.414.28ON10173533612e-34
TDEL0F016904.28ON10053603612e-34
Skud_12.364.28ON10163543594e-34
TPHA0F003104.28ON10263673505e-33
NCAS0C058004.28ON10113563452e-32
AGR126C4.28ON10133933353e-31
TBLA0A085004.28ON10653603335e-31
TPHA0K021804.28ON10283733202e-29
TBLA0E014804.28ON10403511245e-06
Kpol_1044.184.28ON1022373930.020
NDAI0A009801.184ON925420910.037
NCAS0B082601.184ON924331840.23
Kwal_33.138561.184ON922334762.4
Ecym_80941.184ON926327743.9
KAFR0C015803.65ON21679715.0
Skud_11.601.184ON919200735.4
TPHA0B039501.454ON45158725.9
TPHA0B016104.341aON117045726.1
KNAG0B058204.195ON576115726.3
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= TPHA0O01480
         (824 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

TPHA0O01480 Chr15 complement(296533..299007) [2475 bp, 824 aa] {...  1493   0.0  
Kpol_1035.26 s1035 complement(61260..63767) [2508 bp, 835 aa] {O...   900   0.0  
TDEL0D01860 Chr4 (363606..366035) [2430 bp, 809 aa] {ON} Anc_1.3...   800   0.0  
ZYRO0G20724g Chr7 complement(1705835..1708273) [2439 bp, 812 aa]...   775   0.0  
KAFR0A01730 Chr1 complement(352169..354634) [2466 bp, 821 aa] {O...   762   0.0  
TBLA0F01330 Chr6 complement(333140..335623) [2484 bp, 827 aa] {O...   739   0.0  
SAKL0D06974g Chr4 complement(576570..579011) [2442 bp, 813 aa] {...   737   0.0  
NCAS0A09220 Chr1 complement(1823213..1825708) [2496 bp, 831 aa] ...   729   0.0  
NDAI0G05740 Chr7 (1421943..1424516) [2574 bp, 857 aa] {ON} Anc_1...   717   0.0  
Kwal_14.2587 s14 complement(824261..826687) [2427 bp, 808 aa] {O...   716   0.0  
KLTH0H10736g Chr8 complement(924558..926990) [2433 bp, 810 aa] {...   703   0.0  
KNAG0C05830 Chr3 (1132645..1135137) [2493 bp, 830 aa] {ON} Anc_1...   704   0.0  
Ecym_6288 Chr6 (540338..542758) [2421 bp, 806 aa] {ON} similar t...   689   0.0  
AEL166C Chr5 complement(322853..325273) [2421 bp, 806 aa] {ON} S...   681   0.0  
CAGL0J05236g Chr10 complement(504544..507072) [2529 bp, 842 aa] ...   674   0.0  
KLLA0F01705g Chr6 complement(159469..161832) [2364 bp, 787 aa] {...   656   0.0  
Skud_10.159 Chr10 complement(299147..301642) [2496 bp, 831 aa] {...   644   0.0  
Smik_10.178 Chr10 (309109..311604) [2496 bp, 831 aa] {ON} YJL062...   641   0.0  
YJL062W Chr10 (317284..319776) [2493 bp, 830 aa] {ON}  LAS21Inte...   634   0.0  
Suva_6.138 Chr6 complement(231325..233817) [2493 bp, 830 aa] {ON...   627   0.0  
Ecym_5559 Chr5 (1131115..1134159) [3045 bp, 1014 aa] {ON} simila...   161   4e-40
KNAG0J02820 Chr10 (539098..542151) [3054 bp, 1017 aa] {ON} Anc_4...   161   6e-40
NDAI0H00320 Chr8 complement(57504..60608) [3105 bp, 1034 aa] {ON...   160   1e-39
KLLA0C17534g Chr3 (1540967..1543984) [3018 bp, 1005 aa] {ON} sim...   158   4e-39
ZYRO0B01034g Chr2 (87543..90572) [3030 bp, 1009 aa] {ON} similar...   154   8e-38
KLTH0E06094g Chr5 complement(550258..553308) [3051 bp, 1016 aa] ...   152   3e-37
YLL031C Chr12 complement(77152..80205) [3054 bp, 1017 aa] {ON}  ...   152   5e-37
Kwal_55.20667 s55 complement(511335..513140) [1806 bp, 602 aa] {...   149   6e-37
Kwal_YGOB_55.20664 s55 complement(510269..511291,511293..513140)...   150   1e-36
Smik_12.25 Chr12 complement(61505..64558) [3054 bp, 1017 aa] {ON...   147   9e-36
SAKL0H25542g Chr8 (2236849..2239890) [3042 bp, 1013 aa] {ON} sim...   147   2e-35
CAGL0G04015g Chr7 (379330..382389) [3060 bp, 1019 aa] {ON} highl...   145   4e-35
Kpol_478.1 s478 complement(442..3471) [3030 bp, 1009 aa] {ON} co...   145   5e-35
KAFR0I01410 Chr9 (294241..297291) [3051 bp, 1016 aa] {ON} Anc_4....   143   2e-34
Suva_10.41 Chr10 complement(81579..84632) [3054 bp, 1017 aa] {ON...   143   2e-34
TDEL0F01690 Chr6 (313714..316731) [3018 bp, 1005 aa] {ON} Anc_4....   143   2e-34
Skud_12.36 Chr12 complement(68300..71350) [3051 bp, 1016 aa] {ON...   142   4e-34
TPHA0F00310 Chr6 complement(59665..62745) [3081 bp, 1026 aa] {ON...   139   5e-33
NCAS0C05800 Chr3 (1193195..1196230) [3036 bp, 1011 aa] {ON} Anc_...   137   2e-32
AGR126C Chr7 complement(989235..992276) [3042 bp, 1013 aa] {ON} ...   133   3e-31
TBLA0A08500 Chr1 complement(2089018..2092215) [3198 bp, 1065 aa]...   132   5e-31
TPHA0K02180 Chr11 (466234..469320) [3087 bp, 1028 aa] {ON} Anc_4...   127   2e-29
TBLA0E01480 Chr5 complement(337267..340389) [3123 bp, 1040 aa] {...    52   5e-06
Kpol_1044.18 s1044 complement(37667..40735) [3069 bp, 1022 aa] {...    40   0.020
NDAI0A00980 Chr1 complement(201468..204245) [2778 bp, 925 aa] {O...    40   0.037
NCAS0B08260 Chr2 (1574633..1577407) [2775 bp, 924 aa] {ON} Anc_1...    37   0.23 
Kwal_33.13856 s33 complement(424296..427064) [2769 bp, 922 aa] {...    34   2.4  
Ecym_8094 Chr8 (200835..203615) [2781 bp, 926 aa] {ON} similar t...    33   3.9  
KAFR0C01580 Chr3 (323154..323804) [651 bp, 216 aa] {ON} Anc_3.65...    32   5.0  
Skud_11.60 Chr11 complement(124115..126874) [2760 bp, 919 aa] {O...    33   5.4  
TPHA0B03950 Chr2 (931793..933148) [1356 bp, 451 aa] {ON} Anc_1.454     32   5.9  
TPHA0B01610 Chr2 complement(361146..364658) [3513 bp, 1170 aa] {...    32   6.1  
KNAG0B05820 Chr2 (1144434..1146164) [1731 bp, 576 aa] {ON} Anc_4...    32   6.3  

>TPHA0O01480 Chr15 complement(296533..299007) [2475 bp, 824 aa] {ON}
           Anc_1.317 YJL062W
          Length = 824

 Score = 1493 bits (3865), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 750/813 (92%), Positives = 750/813 (92%)

Query: 12  IAITIFCVGFFPSKNVLQGSGEFNFEKELQLTTKPVFTKLVFVVIDALRSDFLYEEQNSH 71
           IAITIFCVGFFPSKNVLQGSGEFNFEKELQLTTKPVFTKLVFVVIDALRSDFLYEEQNSH
Sbjct: 12  IAITIFCVGFFPSKNVLQGSGEFNFEKELQLTTKPVFTKLVFVVIDALRSDFLYEEQNSH 71

Query: 72  FHFVHRVLNSGEAWGFTAFSNPPTVTLPRLKGITTGSTPNFLDAILNVAEDDVSSSLKDQ 131
           FHFVHRVLNSGEAWGFTAFSNPPTVTLPRLKGITTGSTPNFLDAILNVAEDDVSSSLKDQ
Sbjct: 72  FHFVHRVLNSGEAWGFTAFSNPPTVTLPRLKGITTGSTPNFLDAILNVAEDDVSSSLKDQ 131

Query: 132 DSWLMQFYKHNKNIRFFGDDTWLKLFPLNIFSEYEGTNSFFVSDFEQVDLNVTRHLEKQF 191
           DSWLMQFYKHNKNIRFFGDDTWLKLFPLNIFSEYEGTNSFFVSDFEQVDLNVTRHLEKQF
Sbjct: 132 DSWLMQFYKHNKNIRFFGDDTWLKLFPLNIFSEYEGTNSFFVSDFEQVDLNVTRHLEKQF 191

Query: 192 KEKEQWDVLILHYLGLDHIGHKGGSQSKFMKGKHEEMDSILEDIYNSIGDTEDTLLCVXX 251
           KEKEQWDVLILHYLGLDHIGHKGGSQSKFMKGKHEEMDSILEDIYNSIGDTEDTLLCV  
Sbjct: 192 KEKEQWDVLILHYLGLDHIGHKGGSQSKFMKGKHEEMDSILEDIYNSIGDTEDTLLCVMG 251

Query: 252 XXXXXXXXXXXXXXXXETSAGLTMISKKFKKLAKPKDQINTVLPIKWNENLTEEEKDYKF 311
                           ETSAGLTMISKKFKKLAKPKDQINTVLPIKWNENLTEEEKDYKF
Sbjct: 252 DHGMNNGGNHGGSSSGETSAGLTMISKKFKKLAKPKDQINTVLPIKWNENLTEEEKDYKF 311

Query: 312 LSFVQQVDFVPTLSALFNLPMPINSVGVLIPELLRLLDPKLTRTKLKENFSQLTELSKSL 371
           LSFVQQVDFVPTLSALFNLPMPINSVGVLIPELLRLLDPKLTRTKLKENFSQLTELSKSL
Sbjct: 312 LSFVQQVDFVPTLSALFNLPMPINSVGVLIPELLRLLDPKLTRTKLKENFSQLTELSKSL 371

Query: 372 TTRNIYNAIDFQNDTIEDIISQMQSVQSELMKSATXXXXXXXXXXXXXXXXXXXXXXHKA 431
           TTRNIYNAIDFQNDTIEDIISQMQSVQSELMKSAT                      HKA
Sbjct: 372 TTRNIYNAIDFQNDTIEDIISQMQSVQSELMKSATNYNMNAIYIAIILLSIVTLIIIHKA 431

Query: 432 FSNYKFNILPVAVSLIIGLSSFASSFIEEEHQIWWWLITGMCAFSLVYNSDSKFSNFIVF 491
           FSNYKFNILPVAVSLIIGLSSFASSFIEEEHQIWWWLITGMCAFSLVYNSDSKFSNFIVF
Sbjct: 432 FSNYKFNILPVAVSLIIGLSSFASSFIEEEHQIWWWLITGMCAFSLVYNSDSKFSNFIVF 491

Query: 492 LCLRLIRGWNNSGQKYYYPFALSSLLKLKYVNYQWYLNTSTILYFMFKGXXXXXXXXXXX 551
           LCLRLIRGWNNSGQKYYYPFALSSLLKLKYVNYQWYLNTSTILYFMFKG           
Sbjct: 492 LCLRLIRGWNNSGQKYYYPFALSSLLKLKYVNYQWYLNTSTILYFMFKGSMNNFPSFMSS 551

Query: 552 XLLANLCLMYKVSWAIVNQEHVPDTIKHYVLVLCTHLMSARNVAPLQLFESTLIPLARLF 611
            LLANLCLMYKVSWAIVNQEHVPDTIKHYVLVLCTHLMSARNVAPLQLFESTLIPLARLF
Sbjct: 552 FLLANLCLMYKVSWAIVNQEHVPDTIKHYVLVLCTHLMSARNVAPLQLFESTLIPLARLF 611

Query: 612 FCCVVILLSLTLVIGKLSPTRLGNPVSNXXXXXXXXXXXQTSPENIGLYLLFGILETNLT 671
           FCCVVILLSLTLVIGKLSPTRLGNPVSN           QTSPENIGLYLLFGILETNLT
Sbjct: 612 FCCVVILLSLTLVIGKLSPTRLGNPVSNIKKIIIFLLIFQTSPENIGLYLLFGILETNLT 671

Query: 672 DIIDKHYSGNTQLITTISLVMQYFTFYQFGNTNSIATIDLTNAYNGVSEDYNIYFVGWMM 731
           DIIDKHYSGNTQLITTISLVMQYFTFYQFGNTNSIATIDLTNAYNGVSEDYNIYFVGWMM
Sbjct: 672 DIIDKHYSGNTQLITTISLVMQYFTFYQFGNTNSIATIDLTNAYNGVSEDYNIYFVGWMM 731

Query: 732 SISNYAPAIYWSMFPWIIDDNKQKWKKFIERKNIILLFNCISGLFLLITCTILRYHLFIW 791
           SISNYAPAIYWSMFPWIIDDNKQKWKKFIERKNIILLFNCISGLFLLITCTILRYHLFIW
Sbjct: 732 SISNYAPAIYWSMFPWIIDDNKQKWKKFIERKNIILLFNCISGLFLLITCTILRYHLFIW 791

Query: 792 SVFSPKLCYYMMWNIFMNVIIGWILETLVTYVM 824
           SVFSPKLCYYMMWNIFMNVIIGWILETLVTYVM
Sbjct: 792 SVFSPKLCYYMMWNIFMNVIIGWILETLVTYVM 824

>Kpol_1035.26 s1035 complement(61260..63767) [2508 bp, 835 aa] {ON}
           complement(61260..63767) [2508 nt, 836 aa]
          Length = 835

 Score =  900 bits (2326), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 450/824 (54%), Positives = 568/824 (68%), Gaps = 12/824 (1%)

Query: 6   LLLFQLIAITIFCVGFFPSKNVLQGSGEFNFEKELQLTTKPVFTKLVFVVIDALRSDFLY 65
           +L+ QLI++ IFC+GFFPSKNVL+G   F    + QL  KP F KLV VVIDALRSDFL+
Sbjct: 9   ILIIQLISVLIFCIGFFPSKNVLEGDAVFEISSDAQLNAKPAFNKLVLVVIDALRSDFLF 68

Query: 66  EEQNSHFHFVHRVLNSGEAWGFTAFSNPPTVTLPRLKGITTGSTPNFLDAILNVAEDDVS 125
           ++  S F+++H + N+G AWGFTAFSNPPTVTLPRLKGITTGSTPNFLDAILNVAEDD S
Sbjct: 69  DQDISQFNYIHELSNNGYAWGFTAFSNPPTVTLPRLKGITTGSTPNFLDAILNVAEDDSS 128

Query: 126 SSLKDQDSWLMQFYKHNKNIRFFGDDTWLKLFPLNIFSEYEGTNSFFVSDFEQVDLNVTR 185
           S+LK+QDSW MQF KH K IRFFGDDTWLKLFP  IF+EYEGTNSFFVSDFEQVD NVTR
Sbjct: 129 SNLKNQDSWPMQFAKHGKKIRFFGDDTWLKLFPHEIFTEYEGTNSFFVSDFEQVDHNVTR 188

Query: 186 HLEKQFKEKEQWDVLILHYLGLDHIGHKGGSQSKFMKGKHEEMDSILEDIYNSIGDTEDT 245
           HLEKQ KEK  WD LILHYLGLDHIGHKGG  SKFM  KH EMDSI+++++ ++G  E+T
Sbjct: 189 HLEKQIKEKNDWDALILHYLGLDHIGHKGGPTSKFMGPKHREMDSIIKNLFETVGQDENT 248

Query: 246 LLCVXXXXXXXXXXXXXXXXXXETSAGLTMISKKFKKLAKPKDQINTVLPIKWNENLTEE 305
           L+CV                  ETSAGL +ISKK K    P DQ    LPIK      EE
Sbjct: 249 LICVMGDHGMNEVGNHGGSSPGETSAGLVLISKKLKNFEVPSDQKGVKLPIKSVNVAPEE 308

Query: 306 EKDYKFLSFVQQVDFVPTLSALFNLPMPINSVGVLIPELLRLLDPKLTRTKLKENFSQLT 365
           +K YKFL+ +QQVD VPTLSALFN+P P N+VGV++P +L LLDPKL R KL+ENF QL 
Sbjct: 309 DKQYKFLTQIQQVDIVPTLSALFNIPFPKNNVGVMMPSILELLDPKLFRIKLQENFRQLM 368

Query: 366 ELSKSLTTRNIYNAIDFQNDTIEDIISQMQSVQSELMKSATXXXXXXXXXXXXXXXXXXX 425
            +S +   R +Y + DF+N  I+DIIS+M+ +Q EL  SAT                   
Sbjct: 369 IVSNNKDIRQLYESYDFENTEIKDIISEMKDIQGELTSSATNYNVPLLYLGLGLIFILTL 428

Query: 426 XXXHKAF-----SNYKFNILPVAVSLIIGLSSFASSFIEEEHQIWWWLITGMCAFSLVYN 480
                 +      ++K N+L V +SL+IGLSSFASSF+EEEHQIWWW+ITG+   S +  
Sbjct: 429 TISFWFYFSVLEVDFK-NVLIVIISLLIGLSSFASSFVEEEHQIWWWIITGLITVSAINL 487

Query: 481 SDSKFSNFIVFLCLRLIRGWNNSGQKYYYPFALSSLLKLKYVNYQWYLNTSTILYFMFKG 540
            D K ++ ++F+C+R+IRGWNNSGQKY Y   +S LL  +Y ++QWYLN +TILY M K 
Sbjct: 488 PDQKIAHLVMFVCVRIIRGWNNSGQKYSYDRTISILLNTEYEDFQWYLNIATILYIMLKD 547

Query: 541 XXXXXXXXXXXXLLANLCLMYKVSWAIVNQEHVPDTIKHYVLVLCTHLMSARNVAPLQLF 600
                        L ++C++YKV W I+NQ+HVP+ I    + +C  L    ++  + + 
Sbjct: 548 STDNLISFMFSYNLGSVCILYKVCWTIINQDHVPEPIYKAAIYICRRLSRDYSLQDISVV 607

Query: 601 ESTLIPLARLFFCCVVILLSLTLVIGKLSPTRLGNPVSNXXXXXXXXXXXQTSPENIGLY 660
           E  LIP+AR FF  V+ +  +  + G      + NP+ +           Q+    IGL+
Sbjct: 608 EENLIPIARFFFYSVLAI--VIAIYGSAKLKLIKNPIKDIQKTLTFLLIFQSPSSYIGLF 665

Query: 661 LLFGILETNLTDIIDKHYSGNTQLITTISLVMQYFTFYQFGNTNSIATIDLTNAYNGVSE 720
           +++ IL+++L+ ++   YS N  + +TISLV+QYFTF+QFG TNSIAT DLTNAYNGVSE
Sbjct: 666 MVYDILQSSLSSLLVNQYSSNVMITSTISLVLQYFTFFQFGGTNSIATADLTNAYNGVSE 725

Query: 721 DYNIYFVGWMMSISNYAPAIYWSMFPWIIDDNK----QKWKKFIERKNIILLFNCISGLF 776
           DYNIYFVG++M +SN+APAIYW+MFPW +  N+     KW  F E K  I+ FNCI+G F
Sbjct: 726 DYNIYFVGFLMCVSNFAPAIYWAMFPWKVIYNQIKPNNKWNVFAENKLPIVYFNCIAGCF 785

Query: 777 LLITCTILRYHLFIWSVFSPKLCYYMMWNIFMNVIIGWILETLV 820
           LL++C ILRYHLFIWSVFSPKLCYY  WNIFMN+I+GW+LE  V
Sbjct: 786 LLLSCFILRYHLFIWSVFSPKLCYYATWNIFMNLIVGWVLEIAV 829

>TDEL0D01860 Chr4 (363606..366035) [2430 bp, 809 aa] {ON} Anc_1.317
           YJL062W
          Length = 809

 Score =  800 bits (2065), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 411/818 (50%), Positives = 534/818 (65%), Gaps = 25/818 (3%)

Query: 4   LKLLLFQLIAITIFCVGFFPSKNVLQGSGEFNFEKELQLTTKPVFTKLVFVVIDALRSDF 63
           L LL+ QL+A+++FC GFFP K VL+   +F  E  LQ   KPVF KLV VVIDALRSDF
Sbjct: 6   LALLISQLVAVSLFCAGFFPQKKVLKSEAQFIEEPALQNEAKPVFNKLVLVVIDALRSDF 65

Query: 64  LYEEQNSHFHFVHRVLNSGEAWGFTAFSNPPTVTLPRLKGITTGSTPNFLDAILNVAEDD 123
           L+E+ NS F F+H +LN G AWGFTA+SNPPTVTLPRLKGITTGSTPNFLDAILNVAEDD
Sbjct: 66  LFEKSNSKFSFLHSLLNEGSAWGFTAYSNPPTVTLPRLKGITTGSTPNFLDAILNVAEDD 125

Query: 124 VSSSLKDQDSWLMQFYKHNKNIRFFGDDTWLKLFPLNIFSEYEGTNSFFVSDFEQVDLNV 183
            SS+L DQDSW+ QF+ H K +RFFGDDTWLKLFP   F EY+GTNSFFVSDFEQVD NV
Sbjct: 126 SSSNLNDQDSWVRQFFSHGKKLRFFGDDTWLKLFPKEYFDEYDGTNSFFVSDFEQVDHNV 185

Query: 184 TRHLEKQFKEKEQWDVLILHYLGLDHIGHKGGSQSKFMKGKHEEMDSILEDIYNSIGDTE 243
           TRHL KQ   +++WD LILHYLGLDHIGHKGG  S+FM  K EEMD IL+ IY ++ D  
Sbjct: 186 TRHLPKQLNNQQEWDALILHYLGLDHIGHKGGPNSQFMPAKQEEMDEILKQIYENVDD-- 243

Query: 244 DTLLCVXXXXXXXXXXXXXXXXXXETSAGLTMISKKFKKLAKPKDQINTVLPIKWNENLT 303
           +TL+CV                  ETSA L +ISKK ++ A P +QI   LP++      
Sbjct: 244 ETLICVMGDHGMNDVGNHGGSSAGETSAALALISKKLRRYAPPAEQIGVQLPVQ----NA 299

Query: 304 EEEKDYKFLSFVQQVDFVPTLSALFNLPMPINSVGVLIPELLRLLDPKLTRTKLKENFSQ 363
           + E DY++L+ +QQVD VPTL+ALFN P+P NSVG+LI E L+LLDPKL + KL EN  Q
Sbjct: 300 DGEVDYQYLTRIQQVDIVPTLAALFNFPIPKNSVGILIQETLQLLDPKLAKIKLLENLKQ 359

Query: 364 LTELSKSLTTRNIYNAIDFQNDTIEDIISQMQSVQSELMKSATXXXXXXXXXXXXXXXXX 423
           L  +S      N +  I  + + I+ +   M+ +QS+L +SAT                 
Sbjct: 360 LDSIS------NGHEVIQDEAN-IDQLYDLMKDIQSDLTRSATNYNYDLMGMGLALLVIT 412

Query: 424 XXXXXHKAFSNYKFN---ILPVAVSLIIGLSSFASSFIEEEHQIWWWLITGMCAFSLVYN 480
                    +  +F       + VSL+IGLSSF SSF+EEEHQIWWW+ TG    S VY 
Sbjct: 413 TIITVLVGSNRMEFGHPFFFTMIVSLLIGLSSFGSSFVEEEHQIWWWISTGATLASSVYL 472

Query: 481 SDSKFSNFIVFLCLRLIRGWNNSGQKYYYPFALSSLLKLKYVNYQWYLNTSTILYFMFKG 540
            D K+++F++ +CLR+IR WNNSGQK++    +  +LK +    QWYLN   I+    KG
Sbjct: 473 VDEKYTHFVILVCLRIIRAWNNSGQKHFNENTVFDILK-RNPTEQWYLNFFAIVICGLKG 531

Query: 541 XXXXXXXXXXXXLLANLCLMYKVSWAIVNQEHVPDTIKHYVLVLCTHLMSARNVAPLQLF 600
                       +L  LCL+YKV+WA+VN+E VP  +       C+ +M         +F
Sbjct: 532 SSGDIVTFMCSFVLTALCLVYKVTWALVNRETVPHWLYEVAYKSCSIMMGDTT----DVF 587

Query: 601 ESTLIPLARLFFCCVVILLSLTLVIGKLSPTRLGNPVSNXXXXXXXXXXXQTSPENIGLY 660
           + +LIPLA+LFF C    +++ +V  K+   +  + +S            Q+   NI L+
Sbjct: 588 DKSLIPLAQLFFRCFAGCVAVAVVACKMGGNKNSHAIST---FITLLLIFQSQSPNIPLF 644

Query: 661 LLFGILETNLTDIIDKHYSGNTQLITTISLVMQYFTFYQFGNTNSIATIDLTNAYNGVSE 720
            +F +L+++L  I+ K Y+ +  +I+ +SL++QYFTF+ FG TNSIAT+DL+NAYNGVSE
Sbjct: 645 FVFDVLKSSLNKIVSKRYNSDAYMISAVSLILQYFTFFHFGGTNSIATVDLSNAYNGVSE 704

Query: 721 DYNIYFVGWMMSISNYAPAIYWSMFPW-IIDDNKQKWKKFIERKNIILLFNCISGLFLLI 779
           +YNIY VG+MM +SN+AP+IYWS F W ++    +KW  F + K   L+FNCISG  L+ 
Sbjct: 705 NYNIYAVGFMMCVSNFAPSIYWSTFTWNLLYKTNKKWHNFFQSKLTFLMFNCISGCCLMF 764

Query: 780 TCTILRYHLFIWSVFSPKLCYYMMWNIFMNVIIGWILE 817
            C  LR+HLFIWSVFSPKLCYY  WNIFMN++IGWILE
Sbjct: 765 ACVALRFHLFIWSVFSPKLCYYATWNIFMNLVIGWILE 802

>ZYRO0G20724g Chr7 complement(1705835..1708273) [2439 bp, 812 aa]
           {ON} similar to uniprot|P40367 Saccharomyces cerevisiae
           YJL062W LAS21 Integral plasma membrane protein involved
           in the synthesis of the glycosylphosphatidylinositol
           (GPI) core structure mutations affect cell wall
           integrity
          Length = 812

 Score =  775 bits (2001), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 407/825 (49%), Positives = 536/825 (64%), Gaps = 31/825 (3%)

Query: 4   LKLLLFQLIAITIFCVGFFPSKNVLQGSGEFNFEKELQLTTKPVFTKLVFVVIDALRSDF 63
           + LLL Q +AI IFC GFFP KNVL+G+ +F  E  +Q  +KPVF K V +V+DALRSDF
Sbjct: 6   ITLLLAQFVAIFIFCCGFFPQKNVLKGNADFIIESSIQTQSKPVFDKFVLIVVDALRSDF 65

Query: 64  LYEEQNSHFHFVHRVLNSGEAWGFTAFSNPPTVTLPRLKGITTGSTPNFLDAILNVAEDD 123
           ++EE  S+F FVH ++N GEAWGFTA+SNPPTVTLPRLKGITTGSTPNFLDAILNVAEDD
Sbjct: 66  VFEESISNFKFVHSLINDGEAWGFTAYSNPPTVTLPRLKGITTGSTPNFLDAILNVAEDD 125

Query: 124 VSSSLKDQDSWLMQFYKHNKNIRFFGDDTWLKLFPLNIFSEYEGTNSFFVSDFEQVDLNV 183
            SS+LK+QDSWL QF +  K +RFFGDDTWLKLFPL+ F EYEGTNSFFVSDFEQVDLNV
Sbjct: 126 SSSNLKEQDSWLKQFVRQGKKMRFFGDDTWLKLFPLDFFQEYEGTNSFFVSDFEQVDLNV 185

Query: 184 TRHLEKQFKEKEQWDVLILHYLGLDHIGHKGGSQSKFMKGKHEEMDSILEDIYNSIGDTE 243
           TRHL  Q + ++ WDVLILHYLGLDHIGHKGG++S FM GKH EMDSI+++IY ++   E
Sbjct: 186 TRHLPHQLETQKDWDVLILHYLGLDHIGHKGGARSVFMPGKHAEMDSIVKNIYENV--DE 243

Query: 244 DTLLCVXXXXXXXXXXXXXXXXXXETSAGLTMISKKFKKLAKPKDQINTVLPIKWNENLT 303
           +TL+CV                  ETS+ L MISKK K+   P  Q +  LPI       
Sbjct: 244 NTLVCVMGDHGMNEVGNHGGSSPGETSSALVMISKKLKQFQPPLHQRDVHLPI--TTQFQ 301

Query: 304 EEEKDYKFLSFVQQVDFVPTLSALFNLPMPINSVGVLIPELLRLLDPKLTRTKLKENFSQ 363
           + E +Y +L+ VQQVDFVPTL+ALFN+P+P N+VG++IP+ L+LLD K+   K+K+NF+Q
Sbjct: 302 DGEVNYDYLTKVQQVDFVPTLAALFNIPIPKNNVGIIIPDFLQLLDSKMAAIKVKDNFNQ 361

Query: 364 LTELSKSLTTRNIYNAIDFQNDTIEDIISQMQSVQSELMKSATXXXXXXXXXXXXXXXXX 423
           L  L        +   ++ +N++I +   QM+ +Q  L KSAT                 
Sbjct: 362 LASL--------LGRTLEVKNESINEEFEQMKDLQEVLTKSATNYKYPILAAGFGLLTVL 413

Query: 424 XXXXXHKAFSNY---KFNILPVAVSLIIGLSSFASSFIEEEHQIWWWLITGMCAFSLVYN 480
                    S     K ++L + +SL++G+++F+SSF+EEEHQIWWW+ITG    S +Y 
Sbjct: 414 TAVALWYGISIMQLSKSSLLTIVLSLLLGIATFSSSFVEEEHQIWWWVITGALLLSQLYL 473

Query: 481 SDSKFSNFIVFLCLRLIRGWNNSGQKYYYPFALSSLLKLKYVNYQWYLNTSTILYFMFKG 540
             +   +F+ F+C+RLIRGWNNSGQKY Y   +  LLK      QWYLN  TI      G
Sbjct: 474 RKALGLHFVCFVCVRLIRGWNNSGQKYTYDNTIFELLKAN-PGVQWYLNILTIFTVGLGG 532

Query: 541 XXXXXXXXXXXXLLANLCLMYKVSWAIVNQEHVPDTIKHYVLVLCTHLMSARNVAPLQLF 600
                        L  LC  YK+SWAIVN+E VP  ++      C    +  +  P ++F
Sbjct: 533 SLGDRLSFILSFSLCALCGSYKISWAIVNREDVPFWMQELAFKSCL-FFTKEHTNPEEVF 591

Query: 601 ESTLIPLARLFF----CCVVILLSLTLVIGKLSPTRLGNPVSNXXXXXXXXXXXQTSPEN 656
              L+P+A+ FF     C+V+         K+S +++G   +N           Q+   N
Sbjct: 592 GKALVPMAQFFFKYFIACLVV---------KISASKIGVCKANLFSMLSILLMFQSPTAN 642

Query: 657 IGLYLLFGILETNLTDIIDKHYSGNTQLITTISLVMQYFTFYQFGNTNSIATIDLTNAYN 716
           I L+ +F +L   L+ +   +Y  NT  ++  SL++QYFTFYQFG TNSIA+IDL+NAYN
Sbjct: 643 IPLFFIFEVLRAALSRLFTDYYGSNTYFVSLSSLLLQYFTFYQFGGTNSIASIDLSNAYN 702

Query: 717 GVSEDYNIYFVGWMMSISNYAPAIYWSMFPWII-DDNKQKWKKFIERKNIILLFNCISGL 775
           GV E+YNIY VG+MM +SN+AP IYWS++   I     +KW  + E+K   L+FNC+ G+
Sbjct: 703 GVPENYNIYLVGFMMFVSNFAPTIYWSLYKSTIPRPESRKWILYAEQKIPFLIFNCVVGV 762

Query: 776 FLLITCTILRYHLFIWSVFSPKLCYYMMWNIFMNVIIGWILETLV 820
           FLLI C + R+HLFIWSVFSPKLCY++ WNIFMN+II   LE++V
Sbjct: 763 FLLIACYVFRFHLFIWSVFSPKLCYFVSWNIFMNIIIECGLESIV 807

>KAFR0A01730 Chr1 complement(352169..354634) [2466 bp, 821 aa] {ON}
           Anc_1.317 YJL062W
          Length = 821

 Score =  762 bits (1967), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 398/823 (48%), Positives = 524/823 (63%), Gaps = 22/823 (2%)

Query: 6   LLLFQLIAITIFCVGFFPSKNVLQGSGEFNFEKELQLTTKPVFTKLVFVVIDALRSDFLY 65
           +L+ QL+++ +F +GFFP KNV+ G+  F+  K+LQ  TK  F KLV +VIDALRSDFL+
Sbjct: 8   VLVAQLLSVLLFAIGFFPQKNVMNGNATFSINKKLQEETKQPFKKLVLIVIDALRSDFLF 67

Query: 66  EEQNSHFHFVHRVLNSGEAWGFTAFSNPPTVTLPRLKGITTGSTPNFLDAILNVAEDDVS 125
           +E +S+FHFVH  LNSGEAWG+TA+SNPPTVTLPRLKGITTGSTPNFLDA+LNVAEDD S
Sbjct: 68  DESSSNFHFVHSKLNSGEAWGYTAYSNPPTVTLPRLKGITTGSTPNFLDALLNVAEDDSS 127

Query: 126 SSLKDQDSWLMQFYKHNKNIRFFGDDTWLKLFPLNIFSEYEGTNSFFVSDFEQVDLNVTR 185
           S++KDQDSWL QF+     +RFFGDDTWLKLFPL  F++YEGTNSFFVSDFEQVDLNVTR
Sbjct: 128 SNVKDQDSWLKQFHSKGYRMRFFGDDTWLKLFPLEFFNDYEGTNSFFVSDFEQVDLNVTR 187

Query: 186 HLEKQFKEKEQWDVLILHYLGLDHIGHKGGSQSKFMKGKHEEMDSILEDIYNSIGDTEDT 245
           H+ +Q ++ E WDVLILHYLGLDHIGHKGG+ SKFM  KH EMD I+  +Y+++   EDT
Sbjct: 188 HIPRQLEKTEDWDVLILHYLGLDHIGHKGGANSKFMPAKHREMDQIVGKLYDNL--DEDT 245

Query: 246 LLCVXXXXXXXXXXXXXXXXXXETSAGLTMISKKFKKLAKPKDQINTVLPIKWNENLTEE 305
           LL V                  ETSAGL   SKK  K   P  Q+N  LPI      T  
Sbjct: 246 LLIVMGDHGMNDAGNHGGSSAGETSAGLVFFSKKLSKFKIPIRQLNARLPI------TSN 299

Query: 306 EKDYKFLSFVQQVDFVPTLSALFNLPMPINSVGVLIPELLRLLDPKLTRTKLKENFSQLT 365
             DY++L+ VQQ+D VPTL+AL+N+P+P NSVGV+IP+ L+LLDP +  TKL EN+ QL 
Sbjct: 300 SSDYQYLTQVQQMDLVPTLAALYNVPIPKNSVGVIIPDFLQLLDPNIIDTKLLENYKQLL 359

Query: 366 ELSKSLTTRNIYNAIDFQNDTIEDIISQMQSVQSELMKSATXXXXXXXXXXXXXXXXXXX 425
           ELSK      ++N   F  +   +    M+++Q +L+ + T                   
Sbjct: 360 ELSKVEYDDELFNLNVFDLEKRSECQRIMKTLQEKLIAATTEYDYTMLAIGCFMSLVLTL 419

Query: 426 XXXHKAF---SNYKFNILPVAVSLIIGLSSFASSFIEEEHQIWWWLITGMCAFSLVYNSD 482
                +F   ++ K+    V ++ I+G S F SSF+EEEHQIWWW+ITG C F     + 
Sbjct: 420 VMAIFSFFQMASNKYFFASVLLASILGFSCFGSSFVEEEHQIWWWVITG-CLFISAAKTM 478

Query: 483 SKFSNFIVFLCLRLIRGWNNSGQKYYYPFALSSLLKLKYVNYQWYLNTSTILYFMFKGXX 542
             F + ++ LCLRLIRGWNN+GQK  YP+ +S +L+ +    QW LN  T       G  
Sbjct: 479 HYFEHSVILLCLRLIRGWNNTGQKTVYPYVISKILE-ENSTLQWNLNALTFFVISLNGNQ 537

Query: 543 XXXXXXXXXXLLANLCLMYKVSWAIVNQEHVPDTIKHYVLVLCTHLMSARNVAPLQLFES 602
                      L  LCL YK +WA+VN+E VP  I++ ++  C       N      + S
Sbjct: 538 NSMWGFISSSTLGILCLAYKATWAVVNKEIVPWYIQN-IMDNCASFFQDGNKKD---YSS 593

Query: 603 TLIPLARLFFCCVVILLSLTLVIGKLSPTRLGNPVSNXXXXXXXXXXXQTSPENIGLYLL 662
           TLIP+A  F   V  ++  TL+ GK +       +              +S  NI  +L+
Sbjct: 594 TLIPMASFFLHSVAAIIFFTLLWGKFNKHHPSFSLKCISKYVTILMMFLSSSVNIPQFLI 653

Query: 663 FGILETNLTDIIDKHYSGNTQLITTISLVMQYFTFYQFGNTNSIATIDLTNAYNGVSEDY 722
           F I+ + ++ I+ KHY+ N  L + ISL +Q F F+QFG TNSIATID++NAY+G+SE+Y
Sbjct: 654 FEIMRSFISKILKKHYNSNIYLTSLISLCLQNFAFFQFGGTNSIATIDISNAYHGISENY 713

Query: 723 NIYFVGWMMSISNYAPAIYWSMFPW-----IIDDNKQKWKKFIERKNIILLFNCISGLFL 777
           NIY +G +M +SN+AP+IYW+MF W     I + N  KW  F + K    LFNCI GL L
Sbjct: 714 NIYVIGVLMVLSNFAPSIYWAMFSWDIIYDIKETNFNKWASFTKSKIPTSLFNCIVGLCL 773

Query: 778 LITCTILRYHLFIWSVFSPKLCYYMMWNIFMNVIIGWILETLV 820
           ++ C + RYHLF+WSVFSPKLCY++ WN+FMN I GW+LE L+
Sbjct: 774 MLACVMFRYHLFVWSVFSPKLCYFVGWNLFMNAIFGWVLEVLL 816

>TBLA0F01330 Chr6 complement(333140..335623) [2484 bp, 827 aa] {ON}
           Anc_1.317 YJL062W
          Length = 827

 Score =  739 bits (1908), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 401/828 (48%), Positives = 528/828 (63%), Gaps = 29/828 (3%)

Query: 7   LLFQLIAITIFCVGFFPSKNVLQGSGEFNFEKELQLTTKPVFTKLVFVVIDALRSDFLYE 66
           L  QL A+ IFC+GFFP K+VL GS  F  EK LQ    PVF+KL+ VVIDALRSDF+++
Sbjct: 10  LSLQLAAVFIFCIGFFPQKSVLNGSSTFQIEKSLQQEAPPVFSKLILVVIDALRSDFIFD 69

Query: 67  EQNSHFHFVHRVLNSGEAWGFTAFSNPPTVTLPRLKGITTGSTPNFLDAILNVAEDDVSS 126
              S+F F H +LN+G AWGFTA+SNPPTVTLPRLKG+TTGSTPNFLDAILNVAEDD SS
Sbjct: 70  SNISNFPFTHSLLNNGNAWGFTAYSNPPTVTLPRLKGLTTGSTPNFLDAILNVAEDDNSS 129

Query: 127 SLKDQDSWLMQFYKHNKNIRFFGDDTWLKLFPLNIFSEYEGTNSFFVSDFEQVDLNVTRH 186
           +LKDQDS L QFY +NK IRFFGDDTWLKLFPL+ F E+EGTNSFFVSDF QVD NVTRH
Sbjct: 130 NLKDQDSLLNQFYLNNKKIRFFGDDTWLKLFPLDYFEEHEGTNSFFVSDFTQVDNNVTRH 189

Query: 187 LEKQFKEKEQWDVLILHYLGLDHIGHKGGSQSKFMKGKHEEMDSILEDIYNSIGDTEDTL 246
           + KQ +EK  WDVLILHYLGLDHIGHKGG +SKFM  KHEEMD I+  +Y ++ +  D L
Sbjct: 190 IPKQLQEKNDWDVLILHYLGLDHIGHKGGPRSKFMPTKHEEMDGIIRQLYENLDN--DGL 247

Query: 247 LCVXXXXXXXXXXXXXXXXXXETSAGLTMISKKFKKLAKPKDQINTVLPIKWNENLTEEE 306
           LC+                  ETSA +   S K      P  Q    LPI      +E+E
Sbjct: 248 LCILGDHGMNELGNHGGSSNGETSAAMVFASPKLSNFELPSKQKEIKLPIT---KPSEDE 304

Query: 307 KDYKFLSFVQQVDFVPTLSALFNLPMPINSVGVLIPELLRLL-DPKLTRTKLKENFSQLT 365
             +K+L+ +QQVDFVPT++ LFNLP+P NSVG++I  LL+LL + KL   KLKEN+ QL 
Sbjct: 305 NSFKYLTEIQQVDFVPTIATLFNLPIPRNSVGIIIEPLLKLLRNSKLESIKLKENYKQLL 364

Query: 366 ELSKSLTTRNIYNAI-DFQNDTIEDIISQMQSVQSELMKSATXXXXXXXXXXXXXXXXXX 424
           +L+   +T +  +++ DF+      + ++M S+Q +L +SAT                  
Sbjct: 365 DLAHIHSTMDDISSLEDFE------LFTKMVSIQEDLTRSATNYFYEFLAAGIISSIIGT 418

Query: 425 XXXXHKAFSNYKFNILPVAVSLIIGLSS---FASSFIEEEHQIWWWLITGMCAFSLVYNS 481
                    + KFN + +   +I  L     F SSF+EEEHQIWWW++TG+   SL    
Sbjct: 419 ILYAVLITKDLKFNGIEIISIIISLLIGLSMFGSSFVEEEHQIWWWIVTGLITLSLYLKP 478

Query: 482 DSKFSNFIVFLCLRLIRGWNNSGQKYYYPFALSSLL-KLKYVNYQWYLNTSTILYFMFKG 540
           ++K  +  +F+C+RLIRGWNNSGQKY Y   +S++L +++Y + QWYL  +TI +  F  
Sbjct: 479 NTKLLHLTLFICVRLIRGWNNSGQKYVYESTISNILSRIEYKDMQWYLILATITFVSFND 538

Query: 541 XXXXXXXXXXXXLLANLCLMYKVSWAIVNQEHVPDTIKHYVLVLCTHLM--SARNVAPLQ 598
                        L  L   +KVSW+I N E VP  IK     +   L    ++++    
Sbjct: 539 SMKNLPTFAMSLSLGVLVFSFKVSWSITNGEKVPFVIKDMARTVVKLLFPDESKDI---- 594

Query: 599 LFESTLIPLARLFFCCVVILLSLTLVIGKLSPTR-LGNPVSNXXXXXXXXXXXQTSPENI 657
           +F   L PLA+LFF C +  L + L+I KL   + + N               QT P NI
Sbjct: 595 IFSLALNPLAQLFFHCTLGFLVIKLLIQKLKIDKTVDNIFDELTKVMNLVAIMQTRPSNI 654

Query: 658 GLYLLFGILETNLTDIIDKHYSGNTQLITTISLVMQYFTFYQFGNTNSIATIDLTNAYNG 717
            ++ +F I++  L  II   Y+ N  + +  SLV+Q+FTF+QFG TNSIAT+DL+NAYNG
Sbjct: 655 PMFCVFEIMKMILVKIIKHDYNSNPYVTSIASLVLQHFTFFQFGGTNSIATVDLSNAYNG 714

Query: 718 VSEDYNIYFVGWMMSISNYAPAIYWSMFPWII----DDNK-QKWKKFIERKNIILLFNCI 772
           VSE+YNIY+VG +M+I+N+AP+IYW++F W I    D N   + + F++ K + LLF  I
Sbjct: 715 VSENYNIYYVGLLMTIANFAPSIYWAVFSWDILYSYDTNSILRRQNFMKSKVLPLLFYFI 774

Query: 773 SGLFLLITCTILRYHLFIWSVFSPKLCYYMMWNIFMNVIIGWILETLV 820
            G FL ++C ILRYHLFIWSVFSPKLCYY+ W+IFMN I+GW+ E ++
Sbjct: 775 IGCFLFLSCFILRYHLFIWSVFSPKLCYYVAWSIFMNCIVGWVFEGIL 822

>SAKL0D06974g Chr4 complement(576570..579011) [2442 bp, 813 aa] {ON}
           similar to uniprot|P40367 Saccharomyces cerevisiae
           YJL062W LAS21 Integral plasma membrane protein involved
           in the synthesis of the glycosylphosphatidylinositol
           (GPI) core structure mutations affect cell wall
           integrity
          Length = 813

 Score =  737 bits (1903), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 397/827 (48%), Positives = 516/827 (62%), Gaps = 31/827 (3%)

Query: 3   SLKLLLFQLIAITIFCVGFFPSKNVLQGSGEFNFEKELQLTTKPVFTKLVFVVIDALRSD 62
           S+ LLL Q++AI  F +GFFP K+VLQG   F +  + Q  + PVF KLV VVIDALRSD
Sbjct: 5   SVILLLLQIVAIFTFSIGFFPQKSVLQGDASFLYLPQQQSRSDPVFRKLVLVVIDALRSD 64

Query: 63  FLYEEQNSHFHFVHRVLNSGEAWGFTAFSNPPTVTLPRLKGITTGSTPNFLDAILNVAED 122
           FL++E NS F+FVH++LN G AWG+TA+SNPPTVTLPRLKGITTGSTPNFLDAILNVAED
Sbjct: 65  FLFQESNSKFNFVHQLLNDGAAWGYTAYSNPPTVTLPRLKGITTGSTPNFLDAILNVAED 124

Query: 123 DVSSSLKDQDSWLMQFYKHNKNIRFFGDDTWLKLFPLNIFSEYEGTNSFFVSDFEQVDLN 182
           D+SSSL DQDSWL QF+ +NK I+FFGDDTWLKLFPL  F EYEGTNSFFVSDFEQVDLN
Sbjct: 125 DLSSSLNDQDSWLRQFHNNNKRIKFFGDDTWLKLFPLEFFQEYEGTNSFFVSDFEQVDLN 184

Query: 183 VTRHLEKQFKEKEQWDVLILHYLGLDHIGHKGGSQSKFMKGKHEEMDSILEDIYNSIGDT 242
           VTRHL  QF  K++WDVLILHYLGLDHIGHKGGS S+FM GK EEMD++++ IY S+   
Sbjct: 185 VTRHLPHQFSHKDEWDVLILHYLGLDHIGHKGGSSSRFMPGKQEEMDNVIKQIYESMD-- 242

Query: 243 EDTLLCVXXXXXXXXXXXXXXXXXXETSAGLTMISKKFKKLAKPKDQINTVLPIKWNENL 302
            DTLLCV                  ETSA LT IS K K+   P  Q N  LP+K     
Sbjct: 243 RDTLLCVMGDHGMNDLGNHGGSSNGETSAALTFISPKLKQFQPPVTQRNAHLPLK----- 297

Query: 303 TEEEKDYKFLSFVQQVDFVPTLSALFNLPMPINSVGVLIPELLRLLDPKLTRTKLKENFS 362
            E  ++YK+L  VQQ+D VPTL++LFNLP+P NS+G++I + L+L   +L   K+ +NF 
Sbjct: 298 -EHSENYKYLDEVQQIDLVPTLASLFNLPIPKNSLGIIITDFLQLFPGELAEIKITDNFH 356

Query: 363 QLTELSKSLTTRNIYNAIDFQNDTIEDIISQMQSVQSELMKSATXXXXXXXXXXXXXXXX 422
           QL          NI          I++ + +M+ +QS L K+ T                
Sbjct: 357 QLM---------NIIGETPSDTKDIQNSVEKMKRIQSTLAKATTNYNYQLISIGYIILLL 407

Query: 423 XXXXXXHKAFSNYKFN---ILPVAVSLIIGLSSFASSFIEEEHQIWWWLITGMCAFSLVY 479
                     S  K N    L + VS  +G+S+F SSF+EEE Q+WWW+ TG+   S + 
Sbjct: 408 VTVATTGFTLSLVKLNYDSALLLGVSFTLGISTFGSSFVEEEQQLWWWISTGILLLSAIL 467

Query: 480 NSDSKFSNFIVFLCLRLIRGWNNSGQKYYYPFALSSLLKLKYVNYQWYLNTSTILYFMFK 539
                 ++ +VF CLRLIRGWNNSGQK+ Y   L  LLK+ + ++ W LN  TI    F 
Sbjct: 468 VPQEIINHLLVFTCLRLIRGWNNSGQKFIYDCTLYELLKV-HTSWNWALNALTIFVTSFT 526

Query: 540 GXXXXX--XXXXXXXLLANLCLMYKVSWAIVNQEHVPDTIKHYVLVLCTHLMSARNVAPL 597
                          LLA LCL+YK +W++VN E +   +K  +   C  L+   +    
Sbjct: 527 CTLGERGPLSFVSSFLLATLCLVYKGTWSVVNGEQISQWLKAVIRKSCILLLD--DTDNR 584

Query: 598 QLFESTLIPLARLFFCCVVILLSLTLVIGKLSPTRLGNPVSNXXXXXXXXXXXQTSPENI 657
            ++  +L+P+ARLFF   + L+   + + KL   R      +           QTS  NI
Sbjct: 585 DMYTDSLVPMARLFFQITLTLILFRIALNKLM-DRKTKYFKDIHSIVSMILILQTSSANI 643

Query: 658 GLYLLFGILETNLTDIIDKHYSGNTQLITTISLVMQYFTFYQFGNTNSIATIDLTNAYNG 717
             +L+F IL+  L  ++   Y+ +  L+  ISL++Q  TF+QFG TNSIAT++LTNAYNG
Sbjct: 644 PQFLVFWILQDRLKYLLTA-YTPSDCLVMVISLILQNLTFFQFGGTNSIATVNLTNAYNG 702

Query: 718 VSEDYNIYFVGWMMSISNYAPAIYWSM--FPWIIDD--NKQKWKKFIERKNIILLFNCIS 773
           +S DYNI+ VG +M I N+AP+IYWSM   P + ++  N  KW+ F   +   L+F  I 
Sbjct: 703 ISGDYNIHVVGLLMCIGNFAPSIYWSMATLPTLFENKKNTDKWEIFFATRLPALMFYSII 762

Query: 774 GLFLLITCTILRYHLFIWSVFSPKLCYYMMWNIFMNVIIGWILETLV 820
           G F++ +C ILRYHLFIWSVFSPKLCYY+ WN+FMN ++ W  E L+
Sbjct: 763 GCFIMGSCVILRYHLFIWSVFSPKLCYYVTWNVFMNFMVSWCAEGLL 809

>NCAS0A09220 Chr1 complement(1823213..1825708) [2496 bp, 831 aa]
           {ON} Anc_1.317 YJL062W
          Length = 831

 Score =  729 bits (1881), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 400/827 (48%), Positives = 528/827 (63%), Gaps = 41/827 (4%)

Query: 18  CVGFFPSKNVLQGSGEFNFEKELQLTTKPVFTKLVFVVIDALRSDFLYEEQNSHFHFVHR 77
            +GFFP KNVL+G  +F++  E Q  TKPVF KLV VVIDALRSDFL++E NSHFHF+H 
Sbjct: 21  AIGFFPQKNVLKGLADFHYNSEQQRETKPVFQKLVLVVIDALRSDFLFDETNSHFHFIHS 80

Query: 78  VLNSGEAWGFTAFSNPPTVTLPRLKGITTGSTPNFLDAILNVAEDDVSSSLKDQDSWLMQ 137
            LN G AWGFTA+SNPPTVTLPRLKGITTGSTPNFLDAILNVAEDDVS++L DQDS L Q
Sbjct: 81  QLNEGTAWGFTAYSNPPTVTLPRLKGITTGSTPNFLDAILNVAEDDVSTTLADQDSLLAQ 140

Query: 138 FYKHNKNIRFFGDDTWLKLFPLNIFSEYEGTNSFFVSDFEQVDLNVTRHLEKQFKEKEQW 197
           F+  NK I FFGDDTWLKLFP + F+E EGTNSFFVSDFE VD NV+RHL KQ K    W
Sbjct: 141 FHLQNKKINFFGDDTWLKLFPRDWFNEVEGTNSFFVSDFEVVDTNVSRHLTKQLKHNHDW 200

Query: 198 DVLILHYLGLDHIGHKGGSQSKFMKGKHEEMDSILEDIYNSIGDTEDTLLCVXXXXXXXX 257
           DVLI+HYLGLDHIGHK G+ SKFM  KH EMD+I+  +Y +I D  DTLL V        
Sbjct: 201 DVLIMHYLGLDHIGHKDGASSKFMPEKHIEMDNIVRQVYENIDD--DTLLVVMGDHGMNE 258

Query: 258 XXXXXXXXXXETSAGLTMISKKFKKLAKPKDQINTVLPIKWNENLTEEEKDYKFLSFVQQ 317
                     ETSAGL  +S K KK   P  Q +  LPIK      + +++++FL+ VQQ
Sbjct: 259 VGNHGGSSAGETSAGLVFLSNKLKKGELPLKQRHLNLPIK-----RQTDENFQFLTSVQQ 313

Query: 318 VDFVPTLSALFNLPMPINSVGVLIPELLRLLDPKLTRTKLKENFSQLTELSKSLTTRNI- 376
           +D VPTL+ LFN+P+P N+VG++IPE L+ L   +   KL EN+ QL +LSK     NI 
Sbjct: 314 IDLVPTLATLFNIPIPKNNVGIVIPEFLQFLRKDMINIKLMENYHQLLQLSKGQDLPNIP 373

Query: 377 YNAIDFQNDTIEDIISQMQSVQSELMKSATXXXXXXXXXXXXXXXXXXXXXXHKAFSNYK 436
           ++ +D +N     I+++M+ +Q EL K+AT                           N K
Sbjct: 374 FDHMDSKN-----IMNKMKEIQDELTKNATNYNYSYLGRGYLLLIFTTVTVFIVFILNQK 428

Query: 437 -----FNILPVAVSLIIGLSSFASSFIEEEHQIWWWLITGMCAFSLVY------NSDSKF 485
                  I+ + +SL++GLSSF SSF+EEEHQIWWW+ITG   FS +       +  + F
Sbjct: 429 SLYCATTIITIVISLLVGLSSFGSSFVEEEHQIWWWIITGSIMFSCIETLISNPSKSTVF 488

Query: 486 SNFIVFLCLRLIRGWNNSGQKYYYPFALSSLLKLKYVNYQWYLNTSTILYFMFKGXXXXX 545
           ++F++ +C R+IRGWNNSGQK+ Y F L+++LK  Y N  WYL  +TI Y   K      
Sbjct: 489 NHFLIAVCARIIRGWNNSGQKHVYEFILTNILKNHY-NTLWYLICTTIYYIGLKNTIRTD 547

Query: 546 XXXXXX-XLLANLCLMYKVSWAIVNQEHVPDTIKHYVLVL-CTHLMSARNVAPLQLFEST 603
                    +  LC +YK+ WAIVN E VP+    YV+    + ++     +P   F+  
Sbjct: 548 FLSFLGPFFMTTLCFVYKLDWAIVNNESVPEWF--YVITKEASDILLKVGHSPKDAFKEA 605

Query: 604 LIPLARLFFCCVVILLSLTLVIGKLSPTR--LGNPVSNXXXXXXXXXXXQTSPENIGLYL 661
           L+PLA LF+   V L+S+ ++       R    + +SN           Q++  NI  +L
Sbjct: 606 LLPLATLFYQTFVALVSIRIIFLVFFSRRKTFFDDISN---YISLLLIFQSTATNIPQFL 662

Query: 662 LFGILETNLTDIIDKHYSGN-TQLITTISLVMQYFTFYQFGNTNSIATIDLTNAYNGVSE 720
           +F  L+ ++T ++  ++  N    +  ISL++Q FTF+QFG TNSIATID++NAY+G+SE
Sbjct: 663 VFEFLKKSITKVLQNYHQENKNNYLPLISLILQSFTFFQFGGTNSIATIDISNAYHGISE 722

Query: 721 DYNIYFVGWMMSISNYAPAIYW--SMFPWI---IDDNKQKWKKFIERKNIILLFNCISGL 775
           +YNIY VG  M+ISN+AP+IYW  SM+P +   I ++  KW  + + K  +L+FNCI G 
Sbjct: 723 NYNIYLVGIFMTISNFAPSIYWIISMWPILYAEIPESSSKWNIYFKNKLPLLVFNCIVGC 782

Query: 776 FLLITCTILRYHLFIWSVFSPKLCYYMMWNIFMNVIIGWILE-TLVT 821
            LL  C ILRYHLFIWSVFSPKLCY++ WN+FMN ++GW++E TLV 
Sbjct: 783 CLLAACYILRYHLFIWSVFSPKLCYFLGWNVFMNFVVGWLVEGTLVA 829

>NDAI0G05740 Chr7 (1421943..1424516) [2574 bp, 857 aa] {ON}
           Anc_1.317 YJL062W
          Length = 857

 Score =  717 bits (1852), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 403/848 (47%), Positives = 531/848 (62%), Gaps = 57/848 (6%)

Query: 17  FCVGFFPSKNVLQGSGEFNFEKELQLTTKPVFTKLVFVVIDALRSDFLYEEQNSHFHFVH 76
           F  GFFP K V++G  +F     LQ  T+P F KLV +VIDALRSDFL++ Q SHFHFVH
Sbjct: 19  FATGFFPQKTVIKGDSQFQINATLQSQTRPTFNKLVLIVIDALRSDFLFDSQKSHFHFVH 78

Query: 77  RVLNSGEAWGFTAFSNPPTVTLPRLKGITTGSTPNFLDAILNVAEDDVSSSLKDQDSWLM 136
             LN G AWGFTA+SNPPTVTLPRLKGITTGSTPNFLDAILNVAEDD+SS+L+DQDS + 
Sbjct: 79  SQLNKGTAWGFTAYSNPPTVTLPRLKGITTGSTPNFLDAILNVAEDDISSTLEDQDSLIK 138

Query: 137 QFYKHNKNIRFFGDDTWLKLFPLNIFSEYEGTNSFFVSDFEQVDLNVTRHLEKQFKEKEQ 196
           QFY   KN++FFGDDTWLKLFP + FSE+EGTNSFFVSDFE VD NVTRHL +Q    + 
Sbjct: 139 QFYMQGKNLKFFGDDTWLKLFPHHWFSEFEGTNSFFVSDFEIVDKNVTRHLPEQLAANDA 198

Query: 197 WDVLILHYLGLDHIGHKGGSQSKFMKGKHEEMDSILEDIYNSIGDT----EDTLLCVXXX 252
            DVLILHYLGLDHIGHK G+ SKFMK KH EMD I++ IY S   +    ++TL+ V   
Sbjct: 199 -DVLILHYLGLDHIGHKDGASSKFMKHKHLEMDEIIKMIYESTQYSNEYDDNTLMVVMGD 257

Query: 253 XXXXXXXXXXXXXXXETSAGLTMISKKFKKLAKPKDQINTVLPIKWNENLTEEEKDYKFL 312
                          ETSAG+  +S+K  K + P++Q+N  +P+  N N  E + ++++L
Sbjct: 258 HGMNEVGNHGGSSAGETSAGMVFLSEKLAKYSTPQEQMNFEVPLLPNLN-EEGQNNFQYL 316

Query: 313 SFVQQVDFVPTLSALFNLPMPINSVGVLIPELLRLLDPKLTRTKLKENFSQLTELSKSLT 372
           + +QQVD VPTL+ LF LP+P NSVGV+IPE L++LDP++  TK+KEN++QL +LSK   
Sbjct: 317 NSIQQVDLVPTLATLFGLPIPKNSVGVIIPEFLQMLDPQIISTKIKENYNQLLQLSKKSA 376

Query: 373 TRNIYNAIDFQNDTIEDII-SQMQSVQSELMKSATXXXXXXXXXXXXXXXXXXXXXXHKA 431
               YN  D   D  ++I+ ++M+++Q+EL K+AT                         
Sbjct: 377 NEYEYN-FDSDLDVNQEILQNEMKNIQNELTKTATNYNYNLLIIGYSILVISTLFTSLLI 435

Query: 432 FSNYK----FNILPVAV-SLIIGLSSFASSFIEEEHQIWWWLITGMCAFSLV--YNSDSK 484
           + +Y     F ++P+ V S+++G+S+F+SSF+EEEHQIWWW+ TG    SLV      + 
Sbjct: 436 WKDYSKKNIFQLIPITVISIMLGVSTFSSSFVEEEHQIWWWITTGFITVSLVSTLTLQNG 495

Query: 485 FS-------NFIVFLCLRLIRGWNNSGQKYYYPFALSSLLKLKYVNYQWYLNTSTILYFM 537
           FS       + I+F C R++RGW+NSGQKY Y   LS++LK  + N QWYLN  TIL   
Sbjct: 496 FSPLKTILYHLIIFGCARILRGWSNSGQKYIYDHVLSNVLK-SHTNIQWYLNLLTILIIG 554

Query: 538 F-KGXXXXXXXXXXXXLLANLCLMYKVSWAIVNQEHVPDTIKHYVLVLCTHLMSARNVAP 596
           F K              L+ LC +YKV+WAIVN E+VPD         C+ L+       
Sbjct: 555 FQKDSTSNFFKFTITFFLSVLCFIYKVNWAIVNNENVPDWFYASTYEACSILIGPTATT- 613

Query: 597 LQLFESTLIPLARLFFCCVVI-----LLSLTLVIGKLSPTRLGNPVSNXXXXXXXXXXXQ 651
              F+ +LIP+A LF   +V      ++   + IGK +   L  P  +           +
Sbjct: 614 ---FQDSLIPMANLFLKAIVTTIIGRIIYSKIFIGKNNKDSLLIP--DIVKYIKLLLIFE 668

Query: 652 TSPENIGLYLLFGIL------------ETNLTDIIDKHYSGNTQLITTISLVMQYFTFYQ 699
           TS   I  +L+F I+            +T+  DI +   S    LI  ISL++Q FTF+Q
Sbjct: 669 TSSTKISQFLIFEIINHIWPKLLNLVKDTSDNDIAN---SIELSLIPLISLILQNFTFFQ 725

Query: 700 FGNTNSIATIDLTNAYNGVSEDYNIYFVGWMMSISNYAPAIYWSMFPW-------IIDDN 752
           FG TNSIATID++NAY+G+SE+YNIY VG  M+ISN+AP+IYW++  W        I + 
Sbjct: 726 FGGTNSIATIDISNAYHGISENYNIYQVGLFMTISNFAPSIYWTIITWPTLYNSTSITNK 785

Query: 753 KQKWKKFIERKNIILLFNCISGLFLLITCTILRYHLFIWSVFSPKLCYYMMWNIFMNVII 812
             KW  F   K  IL FNCI G  LL +C ILRYHLFIWSVFSPKLCY++ WN+FMN I+
Sbjct: 786 NSKWIIFASNKLPILFFNCIVGCCLLASCYILRYHLFIWSVFSPKLCYFLGWNLFMNSIV 845

Query: 813 GWILETLV 820
           G+I+E L+
Sbjct: 846 GYIVEGLI 853

>Kwal_14.2587 s14 complement(824261..826687) [2427 bp, 808 aa] {ON}
           YJL062W (LAS21) - putative membrane protein, a member of
           the major facilitator super family [contig 224] FULL
          Length = 808

 Score =  716 bits (1847), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 397/826 (48%), Positives = 519/826 (62%), Gaps = 39/826 (4%)

Query: 4   LKLLLFQLIAITIFCVGFFPSKNVLQGSGEFNFEKELQLTTKPVFTKLVFVVIDALRSDF 63
           L L++ QL+AI  F  GFFP K+VL+G  EFNF+ + Q    P F KLV +VIDALRSDF
Sbjct: 6   LILVVAQLVAILTFSAGFFPQKSVLKGDAEFNFQPDEQRQISPKFNKLVLIVIDALRSDF 65

Query: 64  LYEEQNSHFHFVHRVLNSGEAWGFTAFSNPPTVTLPRLKGITTGSTPNFLDAILNVAEDD 123
           ++++  S+F FVH +LN G+AWG+TA+SNPPTVTLPRLKGITTGSTPNFLDAILNVAEDD
Sbjct: 66  VFQKDMSNFEFVHGLLNRGQAWGYTAYSNPPTVTLPRLKGITTGSTPNFLDAILNVAEDD 125

Query: 124 VSSSLKDQDSWLMQFYKHNKNIRFFGDDTWLKLFPLNIFSEYEGTNSFFVSDFEQVDLNV 183
            SS+LK+QDSWL QF+ +NK I+FFGDDTWLKLFP   F E +GTNSFFVSDFE+VD NV
Sbjct: 126 SSSNLKEQDSWLRQFHINNKRIKFFGDDTWLKLFPQEFFDETDGTNSFFVSDFEEVDFNV 185

Query: 184 TRHLEKQFKEKEQWDVLILHYLGLDHIGHKGGSQSKFMKGKHEEMDSILEDIYNSIGDTE 243
           TRHL KQ   ++ WDVLILH+LGLDHIGHKGG+ S FM  K  EMD ++E +YNS+G  E
Sbjct: 186 TRHLPKQLATQDSWDVLILHFLGLDHIGHKGGAFSHFMAPKQREMDEVIEQVYNSVG--E 243

Query: 244 DTLLCVXXXXXXXXXXXXXXXXXXETSAGLTMISKKFKKLAKPKDQINTVLPIKWNENLT 303
           DTL+CV                  ETSAGL  IS+  +   KP  Q +   PIK      
Sbjct: 244 DTLICVMGDHGMNDLGNHGGSSAGETSAGLIFISRLLEGYEKPLAQNHETFPIK------ 297

Query: 304 EEEKDYKFLSFVQQVDFVPTLSALFNLPMPINSVGVLIPELLRLLDPKLTRTKLKENFSQ 363
            +  DY ++S V Q+D VP++S+LFN P+P NS+GV++P++LRLL PK  + KL +N+ Q
Sbjct: 298 TKNDDYSYVSKVNQIDLVPSISSLFNFPIPKNSIGVVMPDVLRLLSPKDAQLKLMDNYLQ 357

Query: 364 LTELSKSLTTRNIYNAIDFQNDTIEDIISQ-MQSVQSELMKSATXXX--XXXXXXXXXXX 420
           LT +S  L            N + +D+I Q M+ +Q +L K+AT                
Sbjct: 358 LTTISGDLMA----------NSSDQDVIYQHMRDIQGDLAKNATKYNYFMLGFGFSLLFI 407

Query: 421 XXXXXXXXHKAFSNYKFNILPVAVSLIIGLSSFASSFIEEEHQIWWWLITGMCAFSLVYN 480
                    K   +    +L + VSL++ LS+F SSF+EEEHQ+WWWL   +   S    
Sbjct: 408 TAIATFLLLKPTISKPALVLLIGVSLLLSLSTFGSSFVEEEHQLWWWLAIALTGASYTQA 467

Query: 481 SDSKFSNFIVFLCLRLIRGWNNSGQKYYYPFALSSLLKLKYVNYQWYLNTSTILYFMFKG 540
                 + I+ LCLRLIRGWNNSGQKY Y   L  +LK KY   QW L T TI    F+ 
Sbjct: 468 PSEIKEHLIILLCLRLIRGWNNSGQKYTYEHTLLEILKQKY-QLQWLLITLTIFVTQFRA 526

Query: 541 XXXXXXXXXXXXLLANLCLMYKVSWAIVNQEHVPDTIKHYVLVLCTHLMSARNVAPLQLF 600
                       L++ LCL+YK +W+IVN E VP  ++  V++    +M+  N +   L 
Sbjct: 527 KNKGLVSFQCSFLVSTLCLIYKATWSIVNGEKVPSWLQR-VVMKSFSIMNGENNSQADLK 585

Query: 601 ESTLIPLARLFFCCVVILLSLTLVIGKLSPTRLGNPVSNXXXXXXXXXXXQTSPENIGLY 660
           ES L+P+ARLFF  ++ +  L +V+ K +P R    + N           QTSP NI  +
Sbjct: 586 ES-LVPMARLFFKTILAVTLLEIVLHKWNPDR-KRFLHNIQAYCTAFLILQTSPANIPQF 643

Query: 661 LLFGILETNLTDIIDKHYSGNTQLITTISLVMQYFTFYQFGNTNSIATIDLTNAYNGVSE 720
           L++ IL   L  +  +    +  ++    +V+Q   F+QFGNTNSIAT++LTNAYNG+SE
Sbjct: 644 LVYLILSEKLESVWRRR-EWSPSILMLAGIVLQNLAFFQFGNTNSIATVNLTNAYNGISE 702

Query: 721 DYNIYFVGWMMSISNYAPAIYWSM--------FPWIIDDNKQKWKKFIERKNIILLFNCI 772
           +YNIY VG++M +SN+AP+IYWS+        FP      K KWK F+  +    LF CI
Sbjct: 703 NYNIYVVGFLMCVSNFAPSIYWSLNCLKILYSFP-----VKDKWKIFLASRMPSFLFYCI 757

Query: 773 SGLFLLITCTILRYHLFIWSVFSPKLCYYMMWNIFMNVIIGWILET 818
            G FLL +C ILRYHLFIWSVFSPKLCYY+ WNIFMN +IGW++E 
Sbjct: 758 FGCFLLGSCVILRYHLFIWSVFSPKLCYYVSWNIFMNAVIGWLVEA 803

>KLTH0H10736g Chr8 complement(924558..926990) [2433 bp, 810 aa] {ON}
           similar to uniprot|P40367 Saccharomyces cerevisiae
           YJL062W LAS21 Integral plasma membrane protein involved
           in the synthesis of the glycosylphosphatidylinositol
           (GPI) core structure mutations affect cell wall
           integrity
          Length = 810

 Score =  703 bits (1815), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 384/850 (45%), Positives = 509/850 (59%), Gaps = 91/850 (10%)

Query: 10  QLIAITIFCVGFFPSKNVLQGSGEFNFEKELQLTTKPVFTKLVFVVIDALRSDFLYEEQN 69
           +++AI  F  GFFP K+VLQG  +FN++ E      P F K+V V++DALRSDF++++  
Sbjct: 12  EIVAILTFSAGFFPQKSVLQGDAQFNYKPEAHRRMAPKFEKMVLVIVDALRSDFVFQKDM 71

Query: 70  SHFHFVHRVLNSGEAWGFTAFSNPPTVTLPRLKGITTGSTPNFLDAILNVAEDDVSSSLK 129
           S F F+H++LN G AWG+TA+SNPPTVTLPRLKGITTGSTPNFLDAILNVAEDDVSS+LK
Sbjct: 72  SEFGFLHKLLNKGHAWGYTAYSNPPTVTLPRLKGITTGSTPNFLDAILNVAEDDVSSNLK 131

Query: 130 DQDSWLMQFYKHNKNIRFFGDDTWLKLFPLNIFSEYEGTNSFFVSDFEQVDLNVTRHLEK 189
           +QDSWL QF  H K I+FFGDDTWLKLFP   F E +GTNSFFVSDFE+VDLNVTRHL +
Sbjct: 132 EQDSWLRQFRMHQKKIKFFGDDTWLKLFPSEFFDETDGTNSFFVSDFEEVDLNVTRHLPQ 191

Query: 190 QFKEKEQWDVLILHYLGLDHIGHKGGSQSKFMKGKHEEMDSILEDIYNSIGDTEDTLLCV 249
           Q + ++ WDVLILHYLGLDHIGHKGG+ S FM  KH EMD+++E IYN++G  EDTL+CV
Sbjct: 192 QLQSQDSWDVLILHYLGLDHIGHKGGAFSSFMPPKHREMDAVIEQIYNAVG--EDTLICV 249

Query: 250 XXXXXXXXXXXXXXXXXXETSAGLTMISKKFKKLAKPKDQINTVLPIKWNENLTEEEKDY 309
                             ETSA L  ISK  +K  KP  Q    +P+           +Y
Sbjct: 250 MGDHGMNDLGNHGGSSAGETSAALVFISKLLEKYEKPLAQQGQDIPV------ASSSPEY 303

Query: 310 KFLSFVQQVDFVPTLSALFNLPMPINSVGVLIPELLRLLDPKLTRTKLKENFSQLTELSK 369
            +L+ V Q+DFVPT++ LFNLP+P NS+GVLIP+ L+LL P   +TK+ +N+ QL  +S 
Sbjct: 304 NYLTKVNQIDFVPTIATLFNLPVPKNSIGVLIPDFLKLLSPADAKTKVIDNYQQLLSISG 363

Query: 370 SLTTRNIYNAIDFQNDTIEDIISQMQSVQSELMKSATXXXXXXXXXXXXXXXXXXXXXXH 429
             +T+ + +         + II +M+ VQS+L K+AT                       
Sbjct: 364 G-STKKLGDP--------DAIIEEMREVQSDLAKTAT----------------------- 391

Query: 430 KAFSNYKFNILPV---------AVSLIIGLSSFASS---------------------FIE 459
               NY + +L +         +V+L    +SF S+                     FIE
Sbjct: 392 ----NYNYLLLGIGFLTLLVVSSVALFFSWTSFPSTFGLFLLLGTSLLLSLSTFGSSFIE 447

Query: 460 EEHQIWWWLITGMCAFSLVYNSDSKFSNFIVFLCLRLIRGWNNSGQKYYYPFALSSLLKL 519
           EEHQIWWW    +   S +        +  V   LRLIRGWNNSGQK+ Y + L  LLK 
Sbjct: 448 EEHQIWWWTSIALVGLSYISAPRELGDHLTVLAVLRLIRGWNNSGQKFVYEYTLYELLKQ 507

Query: 520 KYVNYQWYLNTSTILYFMFKGXXXXXXXXXXXXLLANLCLMYKVSWAIVNQEHVPDTIKH 579
            Y   +W L T+TI    F+G            L++ LCL+YK +W+IVN E VP  ++H
Sbjct: 508 HY-QVEWLLITTTIFVVQFQGRAKGFSAFQYSFLMSVLCLVYKATWSIVNNEQVPAWLQH 566

Query: 580 YVLVLCTHLMS-ARNVAPLQL-FESTLIPLARLFFCCVVILLSLTLVIGKLSPT--RLGN 635
               +C    S  + V+  Q+ F   L+P+ARLFF     ++++ ++  +  P   RL  
Sbjct: 567 ----ICLRSYSIMKGVSKDQIDFSDALVPMARLFFQVTAAVIAVEVIRHQFKPNGPRL-- 620

Query: 636 PVSNXXXXXXXXXXXQTSPENIGLYLLFGILETNLTDIIDKHYSGNTQLITTISLVMQYF 695
            +             QTS  NI  +L F IL   L  +  +    +  ++ T++LV+Q+ 
Sbjct: 621 -LEEIHAHISTLLILQTSSANIPQFLAFHILSRKLNSLWSRR-QWSFPVLMTVNLVLQHL 678

Query: 696 TFYQFGNTNSIATIDLTNAYNGVSEDYNIYFVGWMMSISNYAPAIYWSMFPWII---DDN 752
           +F+QFGNTNSIAT+ LTNAYNGVSE+YNIY VG +M +SN+AP+IYWS+    I      
Sbjct: 679 SFFQFGNTNSIATVSLTNAYNGVSENYNIYVVGALMCVSNFAPSIYWSLSCLKILYSKST 738

Query: 753 KQKWKKFIERKNIILLFNCISGLFLLITCTILRYHLFIWSVFSPKLCYYMMWNIFMNVII 812
           + KW+ F   +    L+ C+ G FLL +C ILRYHLFIWSVFSPKLCYY+ WN+FMN II
Sbjct: 739 QSKWETFFTSRLPSFLYYCLFGCFLLGSCVILRYHLFIWSVFSPKLCYYVSWNLFMNAII 798

Query: 813 GWILE-TLVT 821
            W  E TLV 
Sbjct: 799 AWFFEGTLVA 808

>KNAG0C05830 Chr3 (1132645..1135137) [2493 bp, 830 aa] {ON}
           Anc_1.317 YJL062W
          Length = 830

 Score =  704 bits (1816), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 388/830 (46%), Positives = 520/830 (62%), Gaps = 40/830 (4%)

Query: 7   LLFQLIAITIFCVGFFPSKNVLQGSGEFNFEKELQLTT---KPVFTKLVFVVIDALRSDF 63
           L+ QLIAI IFC+GFFP K VL+G  EFN E   +L +   +PVF K + VV+DALRSDF
Sbjct: 9   LILQLIAIFIFCLGFFPQKKVLKGQAEFNPENLDRLGSNREEPVFNKFILVVVDALRSDF 68

Query: 64  LYEEQNSHFHFVHRVLNSGEAWGFTAFSNPPTVTLPRLKGITTGSTPNFLDAILNVAEDD 123
           +++  NSHF FVH  LNSGEAWGFTAFS+PPTVTLPRLKGITTGSTPNFLDA+LNVAEDD
Sbjct: 69  IFDSHNSHFDFVHSKLNSGEAWGFTAFSSPPTVTLPRLKGITTGSTPNFLDALLNVAEDD 128

Query: 124 VSSSLKDQDSWLMQFYKH-NKNIRFFGDDTWLKLF-PLN-IFSEYEGTNSFFVSDFEQVD 180
            +S++K+QDSW+ QF  + N++IRFFGDDTWLKLF P N  F E+EGTNSFFVSDF QVD
Sbjct: 129 QTSTIKEQDSWINQFLTNGNQSIRFFGDDTWLKLFAPANETFQEWEGTNSFFVSDFTQVD 188

Query: 181 LNVTRHLEKQFKEKEQWDVLILHYLGLDHIGHKGGSQSKFMKGKHEEMDSILEDIYNSIG 240
           LNVTRH+  Q +EK+QWD LILHYLGLDHIGHKGG+ S FM  KH+EMD++L+D+Y ++ 
Sbjct: 189 LNVTRHIPTQLQEKDQWDTLILHYLGLDHIGHKGGAYSHFMPEKHKEMDNVLKDLYENV- 247

Query: 241 DTEDTLLCVXXXXXXXXXXXXXXXXXXETSAGLTMISKKFKKLAKPKDQINTVLPIKWNE 300
              DTL+ V                  ET AGL  +S+K  +  KP  Q  T   I  N 
Sbjct: 248 -DPDTLIVVMGDHGMNDVGNHGGSSPGETHAGLVFLSEKLSRFPKPHSQYET---IPLNT 303

Query: 301 NLTEE-EKDYKFLSFVQQVDFVPTLSALFNLPMPINSVGVLIPELLRLLDPKLTRTKLKE 359
            +T + +K +++L+ VQQVD VPTL+ LFN+P+P NSVG+LI + + LLD  L   K+ E
Sbjct: 304 PVTADGDKTFEYLTQVQQVDIVPTLATLFNVPIPKNSVGILIKDFIPLLDKHLREAKVGE 363

Query: 360 NFSQLTELSKSLTTRNIYNAIDFQNDTIEDIISQMQSVQSELMKSATXXXXXXXXXXXXX 419
           N+ QL  LS S+ T N+         T++++  +M++VQ  L ++AT             
Sbjct: 364 NYQQLFTLSNSMETVNV-------GLTVDEMYEKMRAVQENLTRNATDYNYRALVPGYVI 416

Query: 420 XXXXXXXXXHKAFSNYKFNILPVA---VSLIIGLSSFASSFIEEEHQIWWWLITGMCAFS 476
                      A    + +   VA   +S + G+S F SSF+EEEHQ+WWW+ITG   F+
Sbjct: 417 LVCVTAYCLILAVQRMRLSGAFVALLGISFLTGISMFGSSFVEEEHQLWWWVITGSILFT 476

Query: 477 LVYNSDS---KFSNFIVFLCLRLIRGWNNSGQKYYYPFALSSLLKLKYVNYQWYLNTSTI 533
           L +   S     S   + L +RLIRGWNN+GQK  Y + + ++L   +   +W LN    
Sbjct: 477 LAFRQSSWHTTSSCITLSLAVRLIRGWNNTGQKTTYTYVIGNILA-AHPTIKWNLNVLAF 535

Query: 534 LYFMFKGXXXXXXXXXXXXLLANLCLMYKVSWAIVNQEHVPDTIKHYVLVLCTHLMSARN 593
           L  + +             +L  + L YK++WA+VN+E+VP     ++ ++   L+    
Sbjct: 536 LA-VCQSNTESLMSFCGHIVLIVVALAYKINWALVNKENVPVYAFQFLQII-GRLIKVNV 593

Query: 594 VAPLQLFESTLIPLARLFFCCVVILLSLTLVIGKLSPTRLGNP---VSNXXXXXXXXXXX 650
              ++  E  LIPLAR+F+  V   LS T+V   L+  RL  P   + +           
Sbjct: 594 GEDIENLEEALIPLARVFYRLV---LSFTVVKIVLAKIRLQPPHSLIKDISKNFVVLLMF 650

Query: 651 QTSPENIGLYLLFGILETNLTDIIDKHYSGNTQLITTISLVMQYFTFYQFGNTNSIATID 710
            +S  NI  +L+F I++  +T II   Y  +  +   +SL++Q FTF+QFG TNSIATID
Sbjct: 651 LSSTSNIPQFLIFEIMKVCITQIIKDEYGSDISITAIVSLILQNFTFFQFGRTNSIATID 710

Query: 711 LTNAYNGVSEDYNIYFVGWMMSISNYAPAIYWSMFPWII------DDNKQKWKKFIERKN 764
           L+NAY+G+SE+YNIY VGW+M ISN+APA+YW+++PW I         K +W +F + K 
Sbjct: 711 LSNAYHGISENYNIYAVGWLMVISNFAPALYWAIYPWNITYVTPTGICKARWLRFAKGKL 770

Query: 765 IILLFNCISGLFLLITCTILRYHLFIWSVFSPKLCYYMMWNIFMNVIIGW 814
            I LFN + G  LL  C  LRYHLFIWSVFSPKLCYY+ WN+FM  IIGW
Sbjct: 771 PITLFNGLVGCCLLAACVALRYHLFIWSVFSPKLCYYVFWNLFMASIIGW 820

>Ecym_6288 Chr6 (540338..542758) [2421 bp, 806 aa] {ON} similar to
           Ashbya gossypii AEL166C
          Length = 806

 Score =  689 bits (1777), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 377/818 (46%), Positives = 506/818 (61%), Gaps = 44/818 (5%)

Query: 3   SLKLLLFQLIAITIFCVGFFPSKNVLQGSGEFNFEKELQLTTKPVFTKLVFVVIDALRSD 62
           ++ LL+ QL+AI  F +GFFP K+VL G  EF +  E     +P F K+V +VIDALRSD
Sbjct: 5   AISLLICQLVAILTFAIGFFPQKSVLTGDSEFLYMPEEHKPMEPQFEKMVVMVIDALRSD 64

Query: 63  FLYEEQNSHFHFVHRVLNSGEAWGFTAFSNPPTVTLPRLKGITTGSTPNFLDAILNVAED 122
           FL++   S FHFVH ++N GEAWG+TA+SNPPTVTLPRLKGITTGS PNFLDAILNVAED
Sbjct: 65  FLFQANVSGFHFVHDLINKGEAWGYTAYSNPPTVTLPRLKGITTGSMPNFLDAILNVAED 124

Query: 123 DVSSSLKDQDSWLMQFYKHNKNIRFFGDDTWLKLFPLNIFSEYEGTNSFFVSDFEQVDLN 182
           D SS+LKDQDSWL Q +KH K I F+GDDTWLKLFP + F   +GTNSFFVSDFE+VD N
Sbjct: 125 DTSSNLKDQDSWLSQLHKHGKRIHFYGDDTWLKLFPSHFFQRSDGTNSFFVSDFEEVDRN 184

Query: 183 VTRHLEKQFKEKEQWDVLILHYLGLDHIGHKGGSQSKFMKGKHEEMDSILEDIYNSIGDT 242
           VTRHL      +E WD+LILHYLGLDHIGHKGGS S+FM  KH EMD++++DIY+++   
Sbjct: 185 VTRHLPYDLSYQE-WDILILHYLGLDHIGHKGGSASQFMFPKHIEMDAVIKDIYDAVD-- 241

Query: 243 EDTLLCVXXXXXXXXXXXXXXXXXXETSAGLTMISKKFKKLAKPKDQINTVLPIKWNENL 302
           E TL+CV                  ETSA +  ISKK      P+ Q    +P      L
Sbjct: 242 ERTLVCVLGDHGMNDMGNHGGSSAGETSAAMVFISKKLANYKAPEAQRGVQVP------L 295

Query: 303 TEEEKDYKFLSFVQQVDFVPTLSALFNLPMPINSVGVLIPELLRLLDPKLTRTKLKENFS 362
              + DY++L+ +QQVD VPTL +LFN P+P NSVG++I + L LL       K+K+NF 
Sbjct: 296 INSDGDYQYLTRIQQVDIVPTLVSLFNFPIPQNSVGIIIKDFLPLLG-TFAEIKVKDNFR 354

Query: 363 QLTELSKSLTTRNIYNAIDFQNDTIEDIISQMQSVQSELMKSAT---XXXXXXXXXXXXX 419
           QL +L+         N  +F   +I+ ++ QM+  Q +L  +AT                
Sbjct: 355 QLMKLAN--------NTPEFAGASIDMLLEQMKITQDDLATAATNYNYIFLIIGLSILCF 406

Query: 420 XXXXXXXXXHKAFSNYKFNILPVAVSLIIGLSSFASSFIEEEHQIWWWLITGMCAFSLVY 479
                    ++ F   K   L VA+SL +GLS F+SSF+EEEHQIWWW++T     S V 
Sbjct: 407 ITIIISCEFYRTFKQTKILSLTVAISLSLGLSMFSSSFVEEEHQIWWWILTAAVGISWVM 466

Query: 480 NSDSKFSNFIVFLCLRLIRGWNNSGQKYYYPFALSSLLKLKYVNYQWYLNTSTILYFMFK 539
           N    + +F+V +C RLIRGWNNSGQKY Y   +  +L+ +Y N +W +N +T+    F+
Sbjct: 467 NPSLTWDHFLVSVCARLIRGWNNSGQKYIYENTIYQILE-RYPNTKWLINAATMFLVAFE 525

Query: 540 GXXXXXXXXXXXXLLANLCLMYKVSWAIVNQEHVPDTIKHYVLVLCTHLMSARNVAPLQL 599
                        +   LCL YK  W +VN+  VP+ ++ +V + C+ L     + P  +
Sbjct: 526 TVEFNLMTFVSSFVTVTLCLAYKGCWTLVNEGLVPNWLQAFVNMTCSFL-----IGPDNM 580

Query: 600 FESTLIPLARLFFCCVVILLSLTLVIG----KLSPTRLGN--PVSNXXXXXXXXXXXQTS 653
            +  L+PLARL  C   IL S+   +     K SP  L +  P+ N           QTS
Sbjct: 581 LKEALVPLARL--CFQSILASIVFRVCYNRFKSSPKTLQSIIPLIN------TILVLQTS 632

Query: 654 PENIGLYLLFGILETNLTDIIDKHYSGN-TQLITTISLVMQYFTFYQFGNTNSIATIDLT 712
           P NI L+LLF +++  +  I+    S + +Q+   +SL+MQ FTF+QFG TNSIATI+LT
Sbjct: 633 PSNIPLFLLFTVMKIAINRILTNLSSNDLSQISCILSLIMQNFTFFQFGGTNSIATINLT 692

Query: 713 NAYNGVSEDYNIYFVGWMMSISNYAPAIYWSM-FPWIIDDNKQKWKKFIERKNIILLFNC 771
           N+YNGVS+ YNIY VG++  ISN+AP IYWS+    +  +  +K    +ER  I+  ++ 
Sbjct: 693 NSYNGVSQSYNIYVVGFLTFISNFAPVIYWSLNLIEVYQEPNKKHTYLVERLPILFHYS- 751

Query: 772 ISGLFLLITCTILRYHLFIWSVFSPKLCYYMMWNIFMN 809
           ++G+FLLI+C  LRYHLFIWSVFSPKLCYY+ W+I +N
Sbjct: 752 VTGVFLLISCLALRYHLFIWSVFSPKLCYYIAWSILIN 789

>AEL166C Chr5 complement(322853..325273) [2421 bp, 806 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YJL062W
           (LAS21)
          Length = 806

 Score =  681 bits (1758), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 364/824 (44%), Positives = 493/824 (59%), Gaps = 29/824 (3%)

Query: 4   LKLLLFQLIAITIFCVGFFPSKNVLQGSGEFNFEKELQLTTKPVFTKLVFVVIDALRSDF 63
           + LL  QL+A+ IF  GFFP K VL+G  +F +  E Q   +P F KLV VVIDALR+DF
Sbjct: 6   VGLLFCQLLAVLIFAAGFFPQKKVLKGDAQFQYMAETQRALEPAFDKLVLVVIDALRADF 65

Query: 64  LYEEQNSHFHFVHRVLNSGEAWGFTAFSNPPTVTLPRLKGITTGSTPNFLDAILNVAEDD 123
           L+++  SHF FVH +LN GEAWGFTA+SNPPTVTLPRLKGITTGS PNFLDAILNVAEDD
Sbjct: 66  LFQQNVSHFDFVHELLNRGEAWGFTAYSNPPTVTLPRLKGITTGSAPNFLDAILNVAEDD 125

Query: 124 VSSSLKDQDSWLMQFYKHNKNIRFFGDDTWLKLFPLNIFSEYEGTNSFFVSDFEQVDLNV 183
            SS+LKDQDSW+ QF KH K I FFGDDTWLKLFP   F +++GTNSFFVSDFE+VD NV
Sbjct: 126 SSSNLKDQDSWISQFAKHGKKIHFFGDDTWLKLFPEEFFQKHDGTNSFFVSDFEEVDTNV 185

Query: 184 TRHLEKQFKEKEQWDVLILHYLGLDHIGHKGGSQSKFMKGKHEEMDSILEDIYNSIGDTE 243
           TRHL  + + K+ WDVLILHYLGLDHIGHKGG+ S+FM  KH EMD+++  IY+ + +  
Sbjct: 186 TRHLPHELQHKD-WDVLILHYLGLDHIGHKGGAASQFMPPKHREMDAVIRQIYDQVDNR- 243

Query: 244 DTLLCVXXXXXXXXXXXXXXXXXXETSAGLTMISKKFKKLAKPKDQINTVLPIKWNENLT 303
            TLLCV                  ETSAG+  ISK      +P  Q     P+   E   
Sbjct: 244 -TLLCVMGDHGMNDLGNHGGSSAGETSAGMVFISKMLSSYPRPAAQDGVSSPVTAAE--- 299

Query: 304 EEEKDYKFLSFVQQVDFVPTLSALFNLPMPINSVGVLIPELLRLLDPKLTRTKLKENFSQ 363
               DY+F + +QQVDFVPT+++LFN+P+P NS+GV + E   LL    T TK+ EN+ Q
Sbjct: 300 ----DYQFFTRIQQVDFVPTIASLFNIPIPKNSLGVFVREFSSLLGQHAT-TKIIENYHQ 354

Query: 364 LTELSKSLTTRNIYNAIDFQNDTIEDIISQMQSVQSELMKSATXXXXXXXXXXXXXXXXX 423
           L +L+   T           ND I+ ++++M+ VQ+ L ++AT                 
Sbjct: 355 LMQLAAKKTAAR-------GNDDIDSMLAEMKDVQATLARTATNYNYAMLFLGVGMLSIV 407

Query: 424 XXXXXHKAFSNYKFN---ILPVAVSLIIGLSSFASSFIEEEHQIWWWLITGMCAFSLVYN 480
                +   S+ + N   +L +AV+ ++G S F SSF+EEEHQIWWW+I  +  +S    
Sbjct: 408 TAATAYCYISSARLNEASVLMIAVTALLGSSVFGSSFVEEEHQIWWWIIIAVVGYSWATR 467

Query: 481 SDSKFSNFIVFLCLRLIRGWNNSGQKYYYPFALSSLLKLKYVNYQWYLNTSTILYFMFKG 540
                S+ +  +C RL+RGWNNSGQK+ Y F ++ LLK  + + +W L  +T+      G
Sbjct: 468 PSCTPSHLVFLVCARLLRGWNNSGQKFMYDFTVAELLK-SHPSIKWLLVCATLAVVALDG 526

Query: 541 XXXXXXXXXXXXLLANLCLMYKVSWAIVNQEHVPDTIKHYVLVLCTHLMSARNVAPLQLF 600
                       L   L  +YK  WA VN E  P   +  V   C+ L +     P    
Sbjct: 527 FTERPLLSIFNLLAGLLWFVYKTCWANVNGEVSPTYAQTLVTKACSLLFAGGT--PWDD- 583

Query: 601 ESTLIPLARLFFCCVVILLSLTLVIGKLSPTRLGNPVSNXXXXXXXXXXXQTSPENIGLY 660
           +  L+PLARLFF     ++ + +    +   R    +S            QT+ +NI L+
Sbjct: 584 KQLLVPLARLFFKVTAAIVCMRIAYNVVFAKR--KFLSELFPLFTIVLIMQTASQNIPLF 641

Query: 661 LLFGILETNLTDIIDKHY-SGNTQLITTISLVMQYFTFYQFGNTNSIATIDLTNAYNGVS 719
           L+F I+ ++L +I+   Y     ++   +SL++Q  +F+QFG TNSIATIDLTN+YNG+S
Sbjct: 642 LVFTIMRSSLRNILRVGYPQQRCEMFFVLSLILQNLSFFQFGGTNSIATIDLTNSYNGIS 701

Query: 720 EDYNIYFVGWMMSISNYAPAIYWSMFPWIIDDNKQKWKKFIERKNIILLFNCISGLFLLI 779
           E+YNIY VG +M I N APAIYWS+   ++D      K + ++K   + F  ++ L LL+
Sbjct: 702 ENYNIYVVGLLMCIGNMAPAIYWSLAA-VVDHQLYSKKSYAQQKLSSMFFYSVNSLLLLV 760

Query: 780 TCTILRYHLFIWSVFSPKLCYYMMWNIFMNVIIGWILETLVTYV 823
            C  +RYHLFIWSVFSPKLCY + WNI ++ +   +LE  +  V
Sbjct: 761 ACICMRYHLFIWSVFSPKLCYLLGWNILIHFLTETVLEPFLLMV 804

>CAGL0J05236g Chr10 complement(504544..507072) [2529 bp, 842 aa]
           {ON} similar to uniprot|P40367 Saccharomyces cerevisiae
           YJL062w LAS21
          Length = 842

 Score =  674 bits (1740), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 386/845 (45%), Positives = 503/845 (59%), Gaps = 40/845 (4%)

Query: 6   LLLFQLIAITIFCVGFFPSKNVLQGSGEFNFEKELQLTTKPVFTKLVFVVIDALRSDFLY 65
           L++   IA+ IF  GFFP K VL G    +          PVF KLV VV+DA+RSDFL+
Sbjct: 5   LVVAHAIAVLIFGCGFFPQKKVLDGHAALDGTH----ARDPVFDKLVVVVVDAMRSDFLF 60

Query: 66  EEQNSHFHFVHRVLNSGEAWGFTAFSNPPTVTLPRLKGITTGSTPNFLDAILNVAEDDVS 125
           +   S FHF+H  L  G AWGFTA SNPPTVTLPRLKGITTGSTPNFLDAILNVAEDD S
Sbjct: 61  DASISKFHFIHEKLADGSAWGFTAHSNPPTVTLPRLKGITTGSTPNFLDAILNVAEDDTS 120

Query: 126 SSLKDQDSWLMQFYKH-NKNIRFFGDDTWLKLFP--------LNIFSEYEGTNSFFVSDF 176
           SSL  QDSWL QF  +  K IRFFGDDTWLKLFP          +F EYEGTNSFFVSDF
Sbjct: 121 SSLLAQDSWLWQFRNNAGKRIRFFGDDTWLKLFPPVEANEDSQTMFDEYEGTNSFFVSDF 180

Query: 177 EQVDLNVTRHLEKQFKEKEQWDVLILHYLGLDHIGHKGGSQSKFMKGKHEEMDSILEDIY 236
            QVDLNVTRH+++Q +E  +WDVLILHYLGLDHIGHK G  S+FM  KHEEMDSI+  +Y
Sbjct: 181 TQVDLNVTRHIDRQLRETSEWDVLILHYLGLDHIGHKDGPYSRFMGPKHEEMDSIIRKLY 240

Query: 237 NSIGDTEDTLLCVXXXXXXXXXXXXXXXXXXETSAGLTMISKKFKKLAKPKDQINTV-LP 295
           + + D + TLL +                  ETSAG+  +S K       K+Q +    P
Sbjct: 241 DEL-DMQSTLLVLMGDHGMNDLGNHGGSSAGETSAGMVFLSDKLAAYKPSKEQSSAKEFP 299

Query: 296 IKWNENLTEEEKDYKFLSFVQQVDFVPTLSALFNLPMPINSVGVLIPELLRLL-DPKLTR 354
           +K       EEK + +L  +QQ+D VPT+S+LFN+ +P N+VGV+IPE L+L  D  L +
Sbjct: 300 MKIPSLNAGEEKTFHYLKKIQQIDVVPTISSLFNVAIPKNNVGVIIPEFLQLFKDVSLQK 359

Query: 355 TKLKENFSQLTELSKSLTTRNIYNAIDFQNDTIEDIISQMQSVQSELMKSATXXXXXXXX 414
             +KEN++QL+ L+K  T        + +N  IED+I  M+ VQ  L K+AT        
Sbjct: 360 AIVKENWNQLSGLTKGKTQI----MEETKNFVIEDVIKNMKDVQENLAKTATDYNYPLLF 415

Query: 415 XXXXXXXXXXXXXXHKAFSNYKFNI---LPVAVSLIIGLSSFASSFIEEEHQIWWWLITG 471
                         ++   +   NI   + +A++ ++G+S F SSFIEEEHQ WWW+ITG
Sbjct: 416 IGCFLSIVITGTIYYRYARHVAININTSILIAIAALMGISVFGSSFIEEEHQFWWWIITG 475

Query: 472 MCAFSLV-YNSDSKFSNFIVFLCLRLIRGWNNSGQKYYYPFALSSLLKLKYVNYQWYLN- 529
           +   S+V  N  S  S+ IV  CLRLIRGWNNSGQKY Y   +++LLK   ++  W+LN 
Sbjct: 476 LVLLSMVNLNFSSWKSHIIVLFCLRLIRGWNNSGQKYTYDNVIANLLK-GNIDALWWLNL 534

Query: 530 -TSTILYFMFKGXXXXXXXXX--------XXXLLANLCLMYKVSWAIVNQEHVPDTIKHY 580
            T T++    K                     LL+ +  +YKV+W+IVN E VPD    +
Sbjct: 535 ITVTVVGLNLKSLRFGNHTVSLLGFSDLLSMGLLSMITFLYKVNWSIVNGERVPDLFYKW 594

Query: 581 VLVLCTHLMSARNVAPLQ-LFESTLIPLARLFFCCVVILLSLTLVIGK-LSPTRLGNPVS 638
           VL   + ++    +   + L  + LIPLAR+FF     +L   L+I K    + +   ++
Sbjct: 595 VLETASLIVEDATLYREEDLIHTALIPLARIFFKLFFAVLVSRLMIQKFFQVSDISKSLA 654

Query: 639 NXXXXXXXXXXXQTSPENIGLYLLFGILETNLTDIIDKHYSGNTQLITTISLVMQYFTFY 698
                       QT   NIGL+L F I+      II + Y  +  L     +++Q+FTF+
Sbjct: 655 VVSRYVTIFLVFQTPSHNIGLFLFFEIINEITVHIIRERYQSDYLLAVIFGIILQFFTFF 714

Query: 699 QFGNTNSIATIDLTNAYNGVSEDYNIYFVGWMMSISNYAPAIYWSMFPWII---DDNKQK 755
           Q G TNSIAT+DL+NAYNGVSE+YNIY VG MM ISN+AP IYWS + W I   + N  +
Sbjct: 715 QSGGTNSIATVDLSNAYNGVSENYNIYVVGLMMCISNFAPTIYWSFYNWRITYANANSSR 774

Query: 756 WKKFIERKNIILLFNCISGLFLLITCTILRYHLFIWSVFSPKLCYYMMWNIFMNVIIGWI 815
           W+  +  K   ++     G  LL+ C ILRYHLFIWSVFSPKLCYYM+W IF+ +I+ WI
Sbjct: 775 WQTLVAAKYPFIIIQSTIGCCLLLACIILRYHLFIWSVFSPKLCYYMVWTIFVGIIVHWI 834

Query: 816 LETLV 820
            E L+
Sbjct: 835 PEILL 839

>KLLA0F01705g Chr6 complement(159469..161832) [2364 bp, 787 aa] {ON}
           similar to uniprot|P40367 Saccharomyces cerevisiae
           YJL062W LAS21 Integral plasma membrane protein involved
           in the synthesis of the glycosylphosphatidylinositol
           (GPI) core structure mutations affect cell wall
           integrity
          Length = 787

 Score =  656 bits (1693), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 376/823 (45%), Positives = 491/823 (59%), Gaps = 56/823 (6%)

Query: 6   LLLFQLIAITIFCVGFFPSKNVLQGSGEFNFEKELQLTTKPVFTKLVFVVIDALRSDFLY 65
           L   QL+A+ +FC GFFP K VL+   +F    E+QL +KPVF KLV VVIDALRSDFL+
Sbjct: 9   LATLQLVAVFLFCGGFFPQKVVLKNDSKFIVNPEVQLASKPVFKKLVLVVIDALRSDFLF 68

Query: 66  EEQNSHFHFVHRVLNSGEAWGFTAFSNPPTVTLPRLKGITTGSTPNFLDAILNVAEDDVS 125
           ++ +S F F+H +LNSGEAWG+TA+SNPPTVTLPRLKGITTGS PNFLDAILNVAEDD S
Sbjct: 69  QKDSSDFEFLHGLLNSGEAWGYTAYSNPPTVTLPRLKGITTGSAPNFLDAILNVAEDDTS 128

Query: 126 SSLKDQDSWLMQFYKHNKNIRFFGDDTWLKLFPLNIFSEYEGTNSFFVSDFEQVDLNVTR 185
           S+LK+QDS L QF+ H+  + FFGDDTWLKLFPL  FSEY+GTNSFFVSDFE+VD NVTR
Sbjct: 129 SNLKEQDSLLKQFHTHHYKMNFFGDDTWLKLFPLEFFSEYDGTNSFFVSDFEEVDFNVTR 188

Query: 186 HLEKQFKEKEQWDVLILHYLGLDHIGHKGGSQSKFMKGKHEEMDSILEDIYNSIGDTEDT 245
           H+  Q + ++ WDVLILHYLGLDHIGHKGGS+S FM  KH EMDS+++ IY  I    DT
Sbjct: 189 HVPYQMEHQKNWDVLILHYLGLDHIGHKGGSKSHFMPSKHREMDSVIKQIYEKIDG--DT 246

Query: 246 LLCVXXXXXXXXXXXXXXXXXXETSAGLTMISKKFKKLAKPKDQINTVLPIKWNENLTEE 305
           L+ V                  ETSA L  +SK+ KK      Q ++ +P++      + 
Sbjct: 247 LMVVLGDHGMNDLGNHGGSSSGETSAALAFLSKRLKKYQSSDIQQSSNVPVE------DA 300

Query: 306 EKDYKFLSFVQQVDFVPTLSALFNLPMPINSVGVLIPELLRLLDPKLTRTKLKENFSQLT 365
             DYK+L  V+Q+D VPTLS LFNLP+P NS+GV+I ELL+LL  KL   K+++N+ QLT
Sbjct: 301 HPDYKYLKEVEQIDIVPTLSMLFNLPIPKNSMGVIIDELLQLLPSKLAAIKVQDNYLQLT 360

Query: 366 ELSKSLTTRNIYNAIDFQNDTIEDIISQMQSVQSELMKSATXXXXXXXXXXXXXXXXXXX 425
           +L         Y A   +  +   ++ +M+ +QS L  +AT                   
Sbjct: 361 KLKPG------YEA-QLEKKSAGTLLEEMREIQSSLAMAATNYNYTFLTYGTTLMIIGTL 413

Query: 426 XXXHKAFSNYKFNILPVAVSLIIGLSSFASSFIEEEHQIWWWLITGMCAFSLVYNSDSKF 485
                 F   +  I  V  S+++G+S FASSFIEEEHQIWWW+   +     + N     
Sbjct: 414 IVTVWNFQLSQEYIEHVGTSVLLGISMFASSFIEEEHQIWWWITISVLLLMQISNG---- 469

Query: 486 SNFIVFLCLRLIRGWNNSGQKYYYPFALSSLLKLKYVNYQWYLNTSTILYFMF-----KG 540
              +V   LRLIRGWNNSGQKY Y   L +LLK  + +  W+LN  T L   F     K 
Sbjct: 470 KKLVVLSGLRLIRGWNNSGQKYIYDNVLHTLLK-SHTSVLWWLNVVTFLSVGFPFLRNKD 528

Query: 541 XXXXXXXXXXXXLLANLCLMYKVSWAIVNQEHVPDTIKHYVLVLCTHLMSARNVAPLQLF 600
                        LA   + YK+ +AIVN + VP  +  + L  C   ++  N     + 
Sbjct: 529 ESEKMVSLLSVSFLALSSITYKICFAIVNGDKVPSGLYTFALRSCAMYLANENATESDI- 587

Query: 601 ESTLIPLARLFF--CCVVILLSLTLVIGKLSPTRLGNPVSNXXXXXXXXXXXQTSPENIG 658
              L+P+AR+FF  C V I++   L+  K +  +  N ++            QTS  NI 
Sbjct: 588 SQCLVPIARIFFQICGVSIII---LLFMKYALNKSTNMLNKLLSVIKFVLLLQTSSANIP 644

Query: 659 LYLLFGILETNLTDIIDKHYSGNTQLITTISLVMQYFTFYQFGNTNSIATIDLTNAYNGV 718
           L+L+F IL +   DI               SL +Q  TF+QFG TNSIAT++LTNAYNGV
Sbjct: 645 LFLIFEILTSVTPDI-----------TPIFSLCLQNLTFFQFGGTNSIATVNLTNAYNGV 693

Query: 719 SEDYNIYFVGWMMSISNYAPAIYW--SMFPWIIDDNKQKWKKFIERKNIILLFNCISGLF 776
           S +YNIY VG +M +SNYAP+IYW  S+ P       Q +K    +K + L    I+G  
Sbjct: 694 SSNYNIYVVGVLMFLSNYAPSIYWALSLIP-------QSYK----QKTLRLQHYYITGTC 742

Query: 777 LLITCTILRYHLFIWSVFSPKLCYYMMWNIFMNVIIGWILETL 819
           L+I C  LRYHLFIWSVFSPKLCYY  W+++ NV++ + +  L
Sbjct: 743 LMIACIALRYHLFIWSVFSPKLCYYAAWSLY-NVVMDFAITLL 784

>Skud_10.159 Chr10 complement(299147..301642) [2496 bp, 831 aa] {ON}
           YJL062W (REAL)
          Length = 831

 Score =  644 bits (1660), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 365/843 (43%), Positives = 503/843 (59%), Gaps = 53/843 (6%)

Query: 10  QLIAITIFCVGFFPSKNVLQGSGEFNFEKELQLTTKPVFTKLVFVVIDALRSDFLYEEQN 69
           QL AI +F   FFP K VL G  + + +++  L     F KLVFV+IDALRSDFL++ Q 
Sbjct: 13  QLFAILLFIFAFFPRKIVLTGISQQDPDEDRDLQHNRPFQKLVFVIIDALRSDFLFDAQI 72

Query: 70  SHFHFVHRVLNSGEAWGFTAFSNPPTVTLPRLKGITTGSTPNFLDAILNVAEDDVSSSLK 129
           SHF+ VH+ LN+GEAWG+T+F+NPPTVTLPRLK ITTGSTP+F+D +LNVA+D  S+ L 
Sbjct: 73  SHFNNVHQWLNTGEAWGYTSFANPPTVTLPRLKSITTGSTPSFIDLLLNVAQDIDSNDLS 132

Query: 130 DQDSWLMQFYKHNKNIRFFGDDTWLKLFPLNIFSEYEGTNSFFVSDFEQVDLNVTRHLEK 189
           + DSWL QF +HN  IRF GDDTWLKLFP   F   + T+SFFVSDF QVD NVTR+L+K
Sbjct: 133 EHDSWLQQFIQHNNTIRFMGDDTWLKLFPHEWFDFADPTHSFFVSDFTQVDNNVTRNLQK 192

Query: 190 Q-FKEKEQWDVLILHYLGLDHIGHKGGSQSKFMKGKHEEMDSILEDIYNSIGDTE---DT 245
           + F+E  QWDV ILHYLGLDHIGH+ G  SKFM  KH+EMDSIL+ IY+ + + E   DT
Sbjct: 193 KLFQEWAQWDVAILHYLGLDHIGHRDGPHSKFMGTKHQEMDSILKSIYDQVLEHENDDDT 252

Query: 246 LLCVXXXXXXXXXXXXXXXXXXETSAGLTMISKKFKKLAKPKDQINTVLPIKWNENLTEE 305
           L+CV                  ETSAGL  +S K  + AKP+ Q   +LPI         
Sbjct: 253 LICVLGDHGMNELGNHGGSSAGETSAGLLFLSPKLSRFAKPEPQETHILPIN-----GTP 307

Query: 306 EKDYKFLSFVQQVDFVPTLSALFNLPMPINSVGVLIPELLRLLDPKLTRTKLKENFSQLT 365
           + D+++L  VQQ+D VPT++ALF +P+P+NSVG++IP+ L+LL  KL    +KENF  L 
Sbjct: 308 DHDFQYLESVQQIDIVPTIAALFGMPIPMNSVGIIIPDFLQLLPNKL--ASMKENFMHLW 365

Query: 366 ELSKSLTTRNIYNAIDFQNDTIEDIISQMQSVQSELMKSATXXXXXXXXXXXXXXXXXXX 425
            LS        ++ +   + TI DI ++M  +Q  L +SAT                   
Sbjct: 366 RLSDH------HDDVALDDFTINDIYTKMHDIQETLTRSATNYNYPLLAVAFVSFLFTTI 419

Query: 426 XXXH--KAFSNYKFNILPVA------VSLIIGLSSFASSFIEEEHQIWWWLITGMCAFSL 477
              +  + +S   F  L ++      VS+I+G+S+FASSFIEEEHQ+WWW++T      L
Sbjct: 420 VAVYQLQRYSGPSFCHLHISSLSVILVSVILGVSTFASSFIEEEHQLWWWIVTASSVVPL 479

Query: 478 VYNSDSKF---SNFIVFLCLRLIRGWNNSGQKYYYPFALSSLLKLKYVNYQWYLNTSTIL 534
                + F     FI+  C+RLI+ WNNSGQK+ Y   +S+LL  +   ++WYLN+ST L
Sbjct: 480 FLYPSNAFVFARWFIMIACVRLIKFWNNSGQKFIYSNVMSNLLN-QNPFWKWYLNSSTFL 538

Query: 535 YFMFKGXXXXXXXXXXXXLLANLCLMYKVSWAIV--NQEHVPDTIKHYVLVLCTHLMSAR 592
             +               +L  LC  YK+SW IV  NQ  +P  ++         L++  
Sbjct: 539 ALIIPSARSQLLHFIVTTILVGLCFTYKISWEIVNGNQAEIPPFMQ--------GLLTKM 590

Query: 593 NVAPLQLFESTLIPLARLFFCCVVILLSLTLVIGKLSPTRLGNPVSNXXXXXXXXXXXQT 652
           +  P    E+ L+ LAR+FF    I++   L + KL        + +           QT
Sbjct: 591 DFLPT---ENNLLLLARVFFQAWSIVVISRLALTKLKVLDKRYLIEDMKLYITVLLIFQT 647

Query: 653 SPENIGLYLLFGILET-------NLTDIIDKHYSGNTQLITTISLVMQYFTFYQFGNTNS 705
           S +NIG +++F IL++       +L   +         L + +SL++Q FTF+QFG TNS
Sbjct: 648 SSQNIGQFIIFQILQSQIYYFFQHLPTSLSLTSPSEVYLSSLVSLILQNFTFFQFGGTNS 707

Query: 706 IATIDLTNAYNGVSEDYNIYFVGWMMSISNYAPAIYWSMFPWIID----DNKQKWKKFIE 761
           I+TIDL NAY+GVS DYNIY VG +MS++N+APAIYWSM PW I+     ++ K + FI 
Sbjct: 708 ISTIDLGNAYHGVSSDYNIYVVGILMSVANFAPAIYWSMLPWSINYGSASSQNKLQTFIM 767

Query: 762 RKNIILLFNCISGLFLLITCTILRYHLFIWSVFSPKLCYYMMWNIFMNVIIGWILETLVT 821
            K     ++CI G  L+  C  LR+HLFIWSVFSPKLCY++ WN+ M ++ GW+ E  + 
Sbjct: 768 SKMPAFTYHCIFGACLMTACIFLRFHLFIWSVFSPKLCYFLGWNLVMGLLNGWLPELAIL 827

Query: 822 YVM 824
           + +
Sbjct: 828 FAL 830

>Smik_10.178 Chr10 (309109..311604) [2496 bp, 831 aa] {ON} YJL062W
           (REAL)
          Length = 831

 Score =  641 bits (1654), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 373/845 (44%), Positives = 500/845 (59%), Gaps = 57/845 (6%)

Query: 10  QLIAITIFCVGFFPSKNVLQGSGEFNFEKELQLTTKPVFTKLVFVVIDALRSDFLYEEQN 69
           QL+AI +F   FFP K VL G  + + +++  L     F KLVFV+IDALRSDFL++   
Sbjct: 13  QLLAIVLFIFAFFPRKIVLTGISQQDADQDRDLQHNRPFQKLVFVIIDALRSDFLFDSHI 72

Query: 70  SHFHFVHRVLNSGEAWGFTAFSNPPTVTLPRLKGITTGSTPNFLDAILNVAEDDVSSSLK 129
           SHF+ VH  LN+GEAWG+T+F+NPPTVTLPRLK ITTGSTP+F+D +LNVA+D  S+ L 
Sbjct: 73  SHFNNVHEWLNTGEAWGYTSFANPPTVTLPRLKSITTGSTPSFIDLLLNVAQDVDSNDLS 132

Query: 130 DQDSWLMQFYKHNKNIRFFGDDTWLKLFPLNIFSEYEGTNSFFVSDFEQVDLNVTRHLE- 188
           + DSWL QF +HN  IRF GDDTWLKLFP   F   + T+SFFVSDF QVD NVTR+L  
Sbjct: 133 EHDSWLQQFIQHNNTIRFMGDDTWLKLFPQEWFDFTDPTHSFFVSDFTQVDNNVTRNLPG 192

Query: 189 KQFKEKEQWDVLILHYLGLDHIGHKGGSQSKFMKGKHEEMDSILEDIYNSI---GDTEDT 245
           K F+E  QWDV ILHYLGLDHIGHK G  SKFM  KH+EMDSIL+ IY+ +      EDT
Sbjct: 193 KIFQEWAQWDVAILHYLGLDHIGHKDGPHSKFMGTKHQEMDSILKSIYDQVLVHEHEEDT 252

Query: 246 LLCVXXXXXXXXXXXXXXXXXXETSAGLTMISKKFKKLAKPKDQINTVLPIKWNENLTEE 305
           L+CV                  ETSAGL  +S K  K  KP+ QIN  LPI         
Sbjct: 253 LICVLGDHGMNELGNHGGSSAGETSAGLLFLSPKLSKFVKPESQINRTLPIN-----AAP 307

Query: 306 EKDYKFLSFVQQVDFVPTLSALFNLPMPINSVGVLIPELLRLLDPKLTRTKLKENFSQLT 365
           ++D+++L  VQQ+D VPT++ALF +P+P+NSVG++IP+ L+LL  KL    +KENF  L 
Sbjct: 308 DRDFQYLETVQQIDIVPTIAALFGMPIPMNSVGIIIPDFLQLLPNKL--ASIKENFMHLW 365

Query: 366 ELSKSLTTRNIYNAIDFQND--TIEDIISQMQSVQSELMKSATXXXXXXXXXXXXXXXXX 423
           +LS        +N  DF  D  TI+ I ++M S+Q  L KSAT                 
Sbjct: 366 KLSD-------HNG-DFTLDDLTIDGIYTKMYSIQETLTKSATNYNYPLLALAFISFLII 417

Query: 424 XXXXXHKAFSN-----YKFNILPVAV---SLIIGLSSFASSFIEEEHQIWWWLITGMCAF 475
                ++   N     ++    P++V   S+I+G+S+FASSFIEEEHQ+WWW++T     
Sbjct: 418 TIIAIYQLQRNSGSSLWQPRTSPLSVLLISVILGISTFASSFIEEEHQLWWWIVTAFSVV 477

Query: 476 SL-VYNSDSKFSN--FIVFLCLRLIRGWNNSGQKYYYPFALSSLLKLKYVNYQWYLNTST 532
            L VYN +       FI+ +C+RLI+ WNNSGQK+ Y   +S+LL    + ++W+LN  T
Sbjct: 478 PLFVYNLNVFVVARWFIMMVCVRLIKFWNNSGQKFIYSNVMSNLLNQNPI-WKWWLNLFT 536

Query: 533 ILYFMFKGXXXXXXXXXXXXLLANLCLMYKVSWAIV--NQEHVPDTIKHYVLVLCTHLMS 590
           +L  +               +L  LC  YK+SW IV  NQ  +P        +    L++
Sbjct: 537 LLALIIASSRFQVLHFIVTTILVGLCFTYKISWEIVNGNQAEIP--------IFMHDLLA 588

Query: 591 ARNVAPLQLFESTLIPLARLFFCCVVILLSLTLVIGKLSPTRLGNPVSNXXXXXXXXXXX 650
             +  P    ES LI LAR+FF    I++   LV+ KL        + +           
Sbjct: 589 KIDFVPT---ESNLILLARVFFQAWAIVVVSRLVLTKLKVLNKNYLIEDIKVYITILLIL 645

Query: 651 QTSPENIGLYLLFGILETNLTDIIDK-------HYSGNTQLITTISLVMQYFTFYQFGNT 703
           QTS +NIG +++F IL++ +               S    L   +SL++Q FTF+QFG T
Sbjct: 646 QTSSQNIGQFIIFQILQSQIYYFFKSLPAPFLLTPSSKVYLSNLVSLILQNFTFFQFGGT 705

Query: 704 NSIATIDLTNAYNGVSEDYNIYFVGWMMSISNYAPAIYWSMFPWIID----DNKQKWKKF 759
           NSI+TIDL NAY+GVS DYN+  VG +MSI+N+AP+IYWSM PW ++     ++ K + F
Sbjct: 706 NSISTIDLGNAYHGVSSDYNMCTVGMLMSIANFAPSIYWSMLPWSMNYDSTSSQVKIQTF 765

Query: 760 IERKNIILLFNCISGLFLLITCTILRYHLFIWSVFSPKLCYYMMWNIFMNVIIGWILETL 819
           I  K     ++CI G  L+  C  LR+HLFIWSVFSPKLCY++ WN  M  + GWI E  
Sbjct: 766 IRSKLPAFTYHCIFGTCLMTACIFLRFHLFIWSVFSPKLCYFLGWNFVMGFLNGWITELT 825

Query: 820 VTYVM 824
           V + +
Sbjct: 826 VLFAL 830

>YJL062W Chr10 (317284..319776) [2493 bp, 830 aa] {ON}
           LAS21Integral plasma membrane protein involved in the
           synthesis of the glycosylphosphatidylinositol (GPI) core
           structure; mutations affect cell wall integrity
          Length = 830

 Score =  634 bits (1635), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 370/835 (44%), Positives = 502/835 (60%), Gaps = 52/835 (6%)

Query: 10  QLIAITIFCVGFFPSKNVLQGSGEFNFEKELQLTTKPVFTKLVFVVIDALRSDFLYEEQN 69
           QL+AI +F   FFP K VL G  + + +++  L     F KLVFV+IDALRSDFL++ Q 
Sbjct: 13  QLLAILLFIFAFFPRKIVLTGISKQDPDQDRDLQRDRPFQKLVFVIIDALRSDFLFDSQI 72

Query: 70  SHFHFVHRVLNSGEAWGFTAFSNPPTVTLPRLKGITTGSTPNFLDAILNVAEDDVSSSLK 129
           SHF+ VH+ LN+GEAWG+T+F+NPPTVTLPRLK ITTGSTP+F+D +LNVA+D  S+ L 
Sbjct: 73  SHFNNVHQWLNTGEAWGYTSFANPPTVTLPRLKSITTGSTPSFIDLLLNVAQDIDSNDLS 132

Query: 130 DQDSWLMQFYKHNKNIRFFGDDTWLKLFPLNIFSEYEGTNSFFVSDFEQVDLNVTRHLE- 188
           + DSWL QF +HN  IRF GDDTWLKLFP   F   + T+SFFVSDF QVD NVTR+L  
Sbjct: 133 EHDSWLQQFIQHNNTIRFMGDDTWLKLFPQQWFDFADPTHSFFVSDFTQVDNNVTRNLPG 192

Query: 189 KQFKEKEQWDVLILHYLGLDHIGHKGGSQSKFMKGKHEEMDSILEDIYNSI---GDTEDT 245
           K F+E  QWDV ILHYLGLDHIGHK G  SKFM  KH+EMDSIL+ IY+ +    D +DT
Sbjct: 193 KLFQEWAQWDVAILHYLGLDHIGHKDGPHSKFMAAKHQEMDSILKSIYDEVLEHEDDDDT 252

Query: 246 LLCVXXXXXXXXXXXXXXXXXXETSAGLTMISKKFKKLAKPKDQINTVLPIKWNENLTEE 305
           L+CV                  ETSAGL  +S K  + A+P+ Q+N  LPI         
Sbjct: 253 LICVLGDHGMNELGNHGGSSAGETSAGLLFLSPKLAQFARPESQVNYTLPIN-----ASP 307

Query: 306 EKDYKFLSFVQQVDFVPTLSALFNLPMPINSVGVLIPELLRLLDPKLTRTKLKENFSQLT 365
           + ++++L  VQQ+D VPT++ALF +P+P+NSVG++IP+ L+LL  KL    +KENF  L 
Sbjct: 308 DWNFQYLETVQQIDIVPTIAALFGMPIPMNSVGIIIPDFLQLLPNKL--ASMKENFMHLW 365

Query: 366 ELSKSLTTRNIYNAIDFQNDTIEDIISQMQSVQSELMKSATXXXXXXXXXXXXXXXXXXX 425
           +LS        +  +   + T EDI ++M ++Q  L KSAT                   
Sbjct: 366 KLSDH------HGEVALDDFTAEDIYTKMYTIQETLTKSATNYNYPLLTLAFVGFLIITI 419

Query: 426 XXXHK--AFSNYKF------NILPVAVSLIIGLSSFASSFIEEEHQIWWWLITGMCAFSL 477
              +    +S   F      ++  + VS+I+G+S+FASSFIEEEHQ+WWW++T   A  L
Sbjct: 420 IAIYVLLRYSGPDFWQLRVSSLSVLLVSIILGVSTFASSFIEEEHQLWWWIVTAFSAVPL 479

Query: 478 -VY--NSDSKFSNFIVFLCLRLIRGWNNSGQKYYYPFALSSLLKLKYVNYQWYLNTSTIL 534
            VY  N       FI+  C+R I+ WNNSGQK+ Y   +S+LL  +  +++W LN  T L
Sbjct: 480 FVYRLNVLIIVRWFIMMACVRSIKFWNNSGQKFIYSNVMSNLLN-QNPSWKWCLNMLTFL 538

Query: 535 YFMFKGXXXXXXXXXXXXLLANLCLMYKVSWAIV--NQEHVPDTIKHYVLVLCTHLMSAR 592
             +               +L  LC  YK+SW IV  NQ  +P        +    L++  
Sbjct: 539 VLIMASAGFQVLHFIVTTILVGLCFTYKISWEIVNGNQAEIP--------LFMHDLLAKI 590

Query: 593 NVAPLQLFESTLIPLARLFFCCVVILLSLTLVIGKLSPTRLGNPVSNXXXXXXXXXXXQT 652
           + AP    ES LI LAR+FF    I++   LV+ KL        + +           QT
Sbjct: 591 DFAPT---ESNLIVLARVFFQAWAIVVISRLVLTKLKVLNKNYLIKDMKVYITILLMFQT 647

Query: 653 SPENIGLYLLFGILETNL----TDIIDKHYSGNTQLITT--ISLVMQYFTFYQFGNTNSI 706
           S +NIG +L+F ILE+ +     +I     +  +++  +  +SL++Q FTF+QFG TNSI
Sbjct: 648 SSQNIGQFLVFQILESQIFYFFQNIPTASLTSTSKIYFSNLVSLILQNFTFFQFGGTNSI 707

Query: 707 ATIDLTNAYNGVSEDYNIYFVGWMMSISNYAPAIYWSMFPWIID----DNKQKWKKFIER 762
           +TIDL NAY+GVS DYNIY VG +MS++N+APAIYWSM PW I+      + K + FI  
Sbjct: 708 STIDLGNAYHGVSSDYNIYVVGILMSVANFAPAIYWSMLPWSINYASIPAQVKLQTFIRS 767

Query: 763 KNIILLFNCISGLFLLITCTILRYHLFIWSVFSPKLCYYMMWNIFMNVIIGWILE 817
           K     ++CI G  L+  C +LR+HLFIWSVFSPKLCY++ WN  M ++ GW+ E
Sbjct: 768 KLPAFTYHCIFGTCLMTACVVLRFHLFIWSVFSPKLCYFLGWNFVMGLLNGWLPE 822

>Suva_6.138 Chr6 complement(231325..233817) [2493 bp, 830 aa] {ON}
           YJL062W (REAL)
          Length = 830

 Score =  627 bits (1618), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 370/838 (44%), Positives = 497/838 (59%), Gaps = 52/838 (6%)

Query: 10  QLIAITIFCVGFFPSKNVLQGSGEF--NFEKELQLTTKPVFTKLVFVVIDALRSDFLYEE 67
           QL AI +F   FFP K VL G  +   + +++  L  +  F KLVFVVIDALRSDFL++ 
Sbjct: 13  QLFAILLFIFAFFPRKIVLPGISQQAPDQDQDRDLQHERPFQKLVFVVIDALRSDFLFDS 72

Query: 68  QNSHFHFVHRVLNSGEAWGFTAFSNPPTVTLPRLKGITTGSTPNFLDAILNVAEDDVSSS 127
           + SHF+ VH+ LN+GEAWG+T+F+NPPTVTLPRLK ITTGSTP+F+D +LNVA+D  S+ 
Sbjct: 73  RISHFNNVHQWLNTGEAWGYTSFANPPTVTLPRLKSITTGSTPSFIDLLLNVAQDVDSND 132

Query: 128 LKDQDSWLMQFYKHNKNIRFFGDDTWLKLFPLNIFSEYEGTNSFFVSDFEQVDLNVTRHL 187
           L + DSWL QF +HN  IRF GDDTWLKLFP   F   + T+SFFVSDF QVD NVTR+L
Sbjct: 133 LSEHDSWLQQFIQHNNTIRFMGDDTWLKLFPHEWFDFTDPTHSFFVSDFTQVDNNVTRNL 192

Query: 188 E-KQFKEKEQWDVLILHYLGLDHIGHKGGSQSKFMKGKHEEMDSILEDIYNSIGDTE--- 243
           + K F+E  QWDV ILHYLGLDHIGHK G  SKFM  KH+EMDSIL+ IY+ + + E   
Sbjct: 193 QGKLFQEWAQWDVAILHYLGLDHIGHKDGPHSKFMSTKHQEMDSILKTIYDQVLEHESDD 252

Query: 244 DTLLCVXXXXXXXXXXXXXXXXXXETSAGLTMISKKFKKLAKPKDQINTVLPIKWNENLT 303
           DTL+CV                  ETSAGL  +S K  +  KP  Q    LPI  N  L 
Sbjct: 253 DTLICVLGDHGMNELGNHGGSSAGETSAGLLFLSPKLSQFVKPASQAENALPI--NGTL- 309

Query: 304 EEEKDYKFLSFVQQVDFVPTLSALFNLPMPINSVGVLIPELLRLLDPKLTRTKLKENFSQ 363
             ++D+++L  VQQ+D VPT++ALF +P+P+NSVG++IP+ L+LL  K+    +KENF  
Sbjct: 310 --DRDFQYLDSVQQIDIVPTIAALFGMPIPMNSVGIIIPDFLQLLPNKV--ASMKENFMH 365

Query: 364 LTELSKSLTTRNIYNAIDFQNDTIEDIISQMQSVQSELMKSATXXXXXXXXXXXXXXXXX 423
           L  LS       + + +D     I DI S+M  +Q  L KSAT                 
Sbjct: 366 LWRLSDH-QEEVVLDDLD-----IGDIYSKMHDIQETLTKSATNYNYPLLSLAFASFLII 419

Query: 424 XXXXXH--KAFSNYKFNILPV------AVSLIIGLSSFASSFIEEEHQIWWWLITGMCA- 474
                +  +  S   F  L         VS+I+G+S+FASSFIEEEHQ+WWW++T   A 
Sbjct: 420 TIIATYQLQRHSGPTFCKLRTSSLSVLLVSVILGVSTFASSFIEEEHQLWWWIVTAFAAV 479

Query: 475 --FSLVYNSDSKFSNFIVFLCLRLIRGWNNSGQKYYYPFALSSLLKLKYVNYQWYLNTST 532
             F+   N+      FI+  C+RLI+ WNNSGQK+ Y   +SS+L  +   ++W LN+ T
Sbjct: 480 PLFAYQLNASVIARWFIMLACVRLIKFWNNSGQKFIYTNVMSSILN-RNPFWKWSLNSLT 538

Query: 533 ILYFMFKGXXXXXXXXXXXXLLANLCLMYKVSWAIVN--QEHVPDTIKHYVLVLCTHLMS 590
            L  +               +L  LC  YK+SW IVN  Q  +P        +    L++
Sbjct: 539 FLILLMASVRSQLLHCIMSTILVGLCFTYKISWEIVNGDQAEIP--------LFLQDLLT 590

Query: 591 ARNVAPLQLFESTLIPLARLFFCCVVILLSLTLVIGKLSPTRLGNPVSNXXXXXXXXXXX 650
             +  P    ES LI LAR+FF    I++   LV+ KL        + +           
Sbjct: 591 KIDFIP---NESNLITLARVFFQAWAIVVISRLVLTKLKVLDQKYLIRDMKLYITILLIL 647

Query: 651 QTSPENIGLYLLFGILETNLTDIIDKHYSGNTQ----LITTISLVMQYFTFYQFGNTNSI 706
           QTS +NIGL+++F IL++ +        S ++     L   +SLV+Q F+F+QFG TNSI
Sbjct: 648 QTSSQNIGLFIVFQILQSQICYFFQNFPSSSSTTKVYLSNLVSLVLQNFSFFQFGGTNSI 707

Query: 707 ATIDLTNAYNGVSEDYNIYFVGWMMSISNYAPAIYWSMFPWIID----DNKQKWKKFIER 762
           +TIDL NAY+G+S DYNI  VG +MSI+N+APAIYWSM PW I+     ++ K + F++ 
Sbjct: 708 STIDLGNAYHGISSDYNISVVGLLMSIANFAPAIYWSMLPWSINYEPASSQNKLQTFVKS 767

Query: 763 KNIILLFNCISGLFLLITCTILRYHLFIWSVFSPKLCYYMMWNIFMNVIIGWILETLV 820
           K     ++CI G  L+  C  LR+HLFIWSVFSPKLCY++ WN+ M  + GW+ E  V
Sbjct: 768 KLPAFTYHCIFGTCLMTACIFLRFHLFIWSVFSPKLCYFLGWNLVMGFLNGWLPELAV 825

>Ecym_5559 Chr5 (1131115..1134159) [3045 bp, 1014 aa] {ON} similar
           to Ashbya gossypii AGR126C
          Length = 1014

 Score =  161 bits (408), Expect = 4e-40,   Method: Compositional matrix adjust.
 Identities = 128/363 (35%), Positives = 176/363 (48%), Gaps = 49/363 (13%)

Query: 1   MLSLKLLLFQLIAITIFCVGFFPSKNVLQGSGEFNFEKELQLTTKPVFTKLVFVVIDALR 60
           +L   L + Q IAI  F  GF  S+ VL     F+  K+    +   F K V +++DALR
Sbjct: 45  LLLFSLAVLQAIAIAFFTRGFLLSRTVLDNVASFDETKD----SYGKFDKAVILIVDALR 100

Query: 61  SDFL------YEEQNSHFHFVHRVLNSGEAWGFTAF----SNPPTVTLPRLKGITTGSTP 110
            DF+       E  N ++H   +VL   E W  +      ++PPT TL RLKG+TTGS P
Sbjct: 101 FDFVIPVDTAAEGYNDNYHNNLKVLY--EYWDNSVLLKFIADPPTTTLQRLKGLTTGSLP 158

Query: 111 NFLDAILNVAEDDVSSSLKDQDSWLMQFYKHNKNIRFFGDDTWLKLF-PL--NIFSEYEG 167
            F+DA  N   D +      +D+ + Q Y HNK+I F GDDTW  LF P   N+   YE 
Sbjct: 159 TFIDAGSNFNGDVIV-----EDNLIKQLYLHNKSIYFVGDDTWDALFHPYLSNMSVPYES 213

Query: 168 TNSFFVSDFEQVDLNVTRHLEKQFKEKE----QWDVLILHYLGLDHIGHKGGSQSKFMKG 223
            N   V D + VD  V  + E+   +K+    +WDVLI H LG+DH+GHK G     M  
Sbjct: 214 LN---VWDLDTVDNGVISYFEEHLLDKDPLDREWDVLIGHMLGIDHVGHKYGPNHFTMSE 270

Query: 224 KHEEMDSILEDIYNSIGDTEDTLLCVXXXXXXXXXXXXXXXXXXETSAGLTMISKKFK-- 281
           K +++D  +  +  SI   EDTLL V                  E  + L + SK+    
Sbjct: 271 KQQQVDKFIRKVIASI--DEDTLLVVMGDHGMDHTGNHGGDSNDELESTLWLHSKRKNAW 328

Query: 282 KLAKPKDQINTVLPIKWNENLTEEEKDYKFLSFVQQVDFVPTLSALFNLPMPINSVGVLI 341
           KL  P DQ NT    +  EN  +          V Q+D VPTLS L   P+P N++G  +
Sbjct: 329 KLKSP-DQYNTS---RLGENYRQ----------VNQIDLVPTLSLLLGTPIPFNNLGWPV 374

Query: 342 PEL 344
            E+
Sbjct: 375 DEI 377

>KNAG0J02820 Chr10 (539098..542151) [3054 bp, 1017 aa] {ON} Anc_4.28
           YLL031C
          Length = 1017

 Score =  161 bits (407), Expect = 6e-40,   Method: Compositional matrix adjust.
 Identities = 122/397 (30%), Positives = 189/397 (47%), Gaps = 37/397 (9%)

Query: 10  QLIAITIFCVGFFPSKNVLQGSGEFNFEKELQLTTKPVFTKLVFVVIDALRSDFLY---- 65
           Q IAI  F  GF  S++VL    +   + +L L + P F + V +++DALR DF+     
Sbjct: 46  QFIAIAFFSRGFLLSRHVLDNISKA--DSQLTLQSSPKFDRAVVLIVDALRFDFVIPIEK 103

Query: 66  EEQNSHFH-----FVHRVLNSGEAWG---FTAFSNPPTVTLPRLKGITTGSTPNFLDAIL 117
           E+ NS++H        + +++ E+         ++PPT TL RLKG+TTGS P F+DA  
Sbjct: 104 EKANSNYHNNINIMYDKFMDNSESCSSLLLKFMADPPTTTLQRLKGLTTGSLPTFIDAGS 163

Query: 118 NVAEDDVSSSLKDQDSWLMQFYKHNKNIRFFGDDTWLKLFPLNIFSEYEGTNSFFVSDFE 177
           N   D +     ++D+ + Q Y H+KN+ F GDDTW  LF   + +      S  V D +
Sbjct: 164 NFNGDTI-----EEDNLIKQLYLHDKNVLFVGDDTWDALFNPFLSNNSAPFESLNVWDLD 218

Query: 178 QVDLNVTRHLEKQFKEKEQWDVLILHYLGLDHIGHKGGSQSKFMKGKHEEMDSILEDIYN 237
            VD  V          KE WDVL+ H LG+DH+GHK G     MK K  +++  +  +  
Sbjct: 219 TVDNGVISFFNDHIHSKE-WDVLVGHMLGVDHVGHKYGPDHFTMKEKQTQVNEFIHYVMQ 277

Query: 238 SIGDTEDTLLCVXXXXXXXXXXXXXXXXXXETSAGLTMISKKFKKLAKPKDQINTVLPIK 297
           S+ D  DTLL V                  E  + L + SK   K     D   ++    
Sbjct: 278 SLDD--DTLLVVMGDHGMDRTGNHGGDSIDELESTLFLYSKTPGKFGAMTDGNQSIY--- 332

Query: 298 WNENLTEEEKDYKFLSFVQQVDFVPTLSALFNLPMPINSVGVLIPELLRLLDPKLTRTKL 357
              N+++    Y+    V Q+D V TLS +   P+P N++G  I E+     P+  +   
Sbjct: 333 ---NISDYGSSYR---SVNQIDLVSTLSLMLGTPIPFNNLGWPIEEMFN--TPEEGKRMT 384

Query: 358 KENFSQLTELSKSLTTRNIYNAIDFQNDTIEDIISQM 394
           +    QL E  K   T N+   +D ++D +E I+ ++
Sbjct: 385 QITMDQLLEYKK---TMNLQFPLD-RHDRMESILDEI 417

>NDAI0H00320 Chr8 complement(57504..60608) [3105 bp, 1034 aa] {ON}
           Anc_4.28
          Length = 1034

 Score =  160 bits (404), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 131/424 (30%), Positives = 196/424 (46%), Gaps = 54/424 (12%)

Query: 4   LKLLLFQLIAITIFCVGFFPSKNVLQGSGEFNFEKELQLTTKPVFT---------KLVFV 54
           + L + Q IAI  F  GF  ++NVL+     N    + L + P+F          K V V
Sbjct: 40  ISLAILQFIAIAFFIKGFLLTRNVLENVSTLNDYTSI-LESNPIFNNPSDIAKFDKTVIV 98

Query: 55  VIDALRSDFLYEEQNS---------------HFHFVHRVLNSGEAWGFTAFSNPPTVTLP 99
           VIDALR DF+     S               + HF +   ++  +      ++PPT TL 
Sbjct: 99  VIDALRFDFVIPVDESNPNYNPNYHNNFKVMYDHF-NETSSADSSLLLKFIADPPTTTLQ 157

Query: 100 RLKGITTGSTPNFLDAILNVAEDDVSSSLKDQDSWLMQFYKHNKNIRFFGDDTWLKLFPL 159
           RLKG+TTGS P F+DA       +   S+ ++D+ + Q Y +NK + F GDDTW  LF  
Sbjct: 158 RLKGLTTGSLPTFIDA-----GSNFDGSVIEEDNLIKQMYLNNKTVYFVGDDTWDSLFHP 212

Query: 160 NIFSEYEGTNSFFVSDFEQVDLNVTRHLEKQF-------KEKEQWDVLILHYLGLDHIGH 212
            + S+ +   S  V D + VD  V  + EK+        KE+++WDVLI H LG+DH+GH
Sbjct: 213 FLSSKSQPFESLNVWDLDTVDNGVISYFEKELISKKNNQKEEKEWDVLIGHMLGMDHVGH 272

Query: 213 KGGSQSKFMKGKHEEMDSILEDIYNSIGDTEDTLLCVXXXXXXXXXXXXXXXXXXETSAG 272
           K G     MK K  +++  +  + +S+   EDTLL V                  E  + 
Sbjct: 273 KYGPSHFSMKDKQLQLNEFVTKVIDSLD--EDTLLVVMGDHGMDHTGNHGGDSQDELEST 330

Query: 273 LTMISKKFKKLAKPKDQINTVLPIKWNENLTEEEKDYKFLSFVQQVDFVPTLSALFNLPM 332
           L + SKK +      D   T+       N+ +  K Y+    V Q+D VPTLS L  LP+
Sbjct: 331 LFLFSKKQQMWNLDPDNQETLY------NVNKLGKHYR---QVNQIDLVPTLSLLTGLPI 381

Query: 333 PINSVGVLIPELLRLLDPKLTRTKLKENFSQLTELSKSLTTRNIYNAIDFQNDTIEDIIS 392
           P N++G  I E+ +  D     TK     + L +L +   T  I      +   +E++  
Sbjct: 382 PFNNLGWPIKEIAKNFDEDRFYTK-----AILNQLERYTHTIGIEPPTQEKKRLLEELWQ 436

Query: 393 QMQS 396
           Q Q+
Sbjct: 437 QAQN 440

>KLLA0C17534g Chr3 (1540967..1543984) [3018 bp, 1005 aa] {ON}
           similar to uniprot|Q07830 Saccharomyces cerevisiae
           YLL031C,
          Length = 1005

 Score =  158 bits (400), Expect = 4e-39,   Method: Compositional matrix adjust.
 Identities = 126/393 (32%), Positives = 191/393 (48%), Gaps = 44/393 (11%)

Query: 1   MLSLKLLLFQLIAITIFCVGFFPSKNVLQGSGEFNFEKELQLTTKPVFTKLVFVVIDALR 60
           +L   L + Q I+I  F  GF  ++ VL    E     + QL  +  + K+V +++DALR
Sbjct: 45  LLLASLAVLQFISIAFFAKGFLLTRTVLDNVAEL----DPQLPFEAKYDKMVLLIVDALR 100

Query: 61  SDFL------YEEQNSHFHFVHRVL-----NSGEAWGFTAFSNPPTVTLPRLKGITTGST 109
            DF+      + + N ++H   +VL     NS ++      ++PPT TL RLKG+TTGS 
Sbjct: 101 FDFVIPVDENHAKYNPNYHNNLKVLYETAHNSTDSVLLKFLADPPTTTLQRLKGLTTGSL 160

Query: 110 PNFLDAILNVAEDDVSSSLKDQDSWLMQFYKHNKNIRFFGDDTWLKLFPLNIFSEYEGTN 169
           P F+DA  N   D +     D+D+ + Q Y HNK I F GDDTW  LF   +  E     
Sbjct: 161 PTFIDAGSNFNGDVI-----DEDNLIKQLYLHNKKIFFAGDDTWDALFNPYLAPESVPYE 215

Query: 170 SFFVSDFEQVDLNVTRHLEKQF---KEKEQWDVLILHYLGLDHIGHKGGSQSKFMKGKHE 226
           S  V D + VD  V  +LE+ +   +++ ++D+LI H LG+DH+GHK G     MK K  
Sbjct: 216 SLNVWDLDTVDNGVISYLEEYYFNEEKRSEYDILIGHMLGVDHVGHKYGPNHFTMKEKQL 275

Query: 227 EMDSILEDIYNSIGDTEDTLLCVXXXXXXXXXXXXXXXXXXETSAGLTMISKKFKKLAKP 286
           ++D +L  I ++  D  +TL  V                  E  + L + +K     +K 
Sbjct: 276 QVDELLRKIISTADD--NTLYVVMGDHGMDHTGNHGGDSQDELESVLWLYAKN-ANWSKD 332

Query: 287 KDQINTVLPIKWNENLTEEEKDYKFLSFVQQVDFVPTLSALFNLPMPINSVGVLIPELLR 346
            D  NT          T+    YK ++   Q+D VPTLS L  +P+P N++G  + E+  
Sbjct: 333 YDSYNT----------TDLGTSYKQMN---QIDLVPTLSLLLGIPIPFNNLGWPLDEIAN 379

Query: 347 LLDPKLTRTKLKENFSQLTELSKSLTTRNIYNA 379
             DP+     L  N  +  +L K L+  NI  A
Sbjct: 380 --DPE--ELTLYHNICR-NQLEKYLSVSNIIGA 407

>ZYRO0B01034g Chr2 (87543..90572) [3030 bp, 1009 aa] {ON} similar to
           uniprot|Q07830 Saccharomyces cerevisiae YLL031C
          Length = 1009

 Score =  154 bits (389), Expect = 8e-38,   Method: Compositional matrix adjust.
 Identities = 118/360 (32%), Positives = 172/360 (47%), Gaps = 40/360 (11%)

Query: 1   MLSLKLLLFQLIAITIFCVGFFPSKNVLQGSGEFNFEKELQLTTKPVFTKLVFVVIDALR 60
           +L   L   Q IAI  F  GF  ++ VL       F  +        F K V +VIDALR
Sbjct: 37  ILLASLAALQFIAIAFFTRGFLLTRQVLDNVSS-PFPNQYG-----KFDKAVVLVIDALR 90

Query: 61  SDFL------YEEQNSHFHFVHRVL-----NSGEAWGFTAFSNPPTVTLPRLKGITTGST 109
            DF+      + + N ++H   + L       G +  F   ++PPT TL RLKG+TTGS 
Sbjct: 91  FDFVIPVDESHPQHNPNYHNNIKALWNDESLKGSSLLFKFIADPPTTTLQRLKGLTTGSL 150

Query: 110 PNFLDAILNVAEDDVSSSLKDQDSWLMQFYKHNKNIRFFGDDTWLKLFPLNIFSEYEGTN 169
           P F+DA       +   S+ ++D+ + Q Y   KN+ F GDDTW  LF   + ++ E   
Sbjct: 151 PTFIDA-----GSNFDGSVIEEDNLIKQLYLAQKNVYFAGDDTWSALFHPFLSAQSEPYP 205

Query: 170 SFFVSDFEQVDLNVTRHLEKQFKEKEQ-----WDVLILHYLGLDHIGHKGGSQSKFMKGK 224
           S  V D + VD  V  + E+   E  Q     WDVL+ H LG+DH+GHK G     M+ K
Sbjct: 206 SLNVWDLDTVDNGVMSYFERHLLEGGQTRHRDWDVLVGHMLGVDHVGHKYGPNHFTMREK 265

Query: 225 HEEMDSILEDIYNSIGDTEDTLLCVXXXXXXXXXXXXXXXXXXETSAGLTMISKKFKKLA 284
             ++D  +  I  +I   +DTLL V                  E  + L + SK+   + 
Sbjct: 266 QLQVDEFIRKIIAAID--KDTLLIVMGDHGMDHTGNHGGDSIDELESTLFLYSKR-PDMW 322

Query: 285 KPKDQINTVLPIKWNENLTEEEKDYKFLSFVQQVDFVPTLSALFNLPMPINSVGVLIPEL 344
           +P +  N         ++++  K+YK    V Q+D VPTLS L NLP+P NS+G  + E+
Sbjct: 323 QPNEDPNVY-------DVSDLGKNYK---QVNQIDLVPTLSLLLNLPIPFNSLGWPLEEI 372

>KLTH0E06094g Chr5 complement(550258..553308) [3051 bp, 1016 aa]
           {ON} similar to uniprot|Q07830 Saccharomyces cerevisiae
           YLL031C
          Length = 1016

 Score =  152 bits (385), Expect = 3e-37,   Method: Compositional matrix adjust.
 Identities = 125/422 (29%), Positives = 198/422 (46%), Gaps = 48/422 (11%)

Query: 5   KLLLFQLIAITIFCVGFFPSKNVLQGSGEFNFEKELQLTTKPVFTKLVFVVIDALRSDFL 64
            L + Q+IAI  F  GF  ++ VL+       + E +      F+K V +VIDALR DF 
Sbjct: 47  SLAVLQIIAIAFFARGFLLTRTVLENVAT-GADHEAR------FSKCVILVIDALRFDFS 99

Query: 65  YEEQ------NSHFH----FVHRVLNSGEAWGFTAF-----SNPPTVTLPRLKGITTGST 109
                     NS+FH     +H   N+  +   ++      ++PPT TL RLKG+TTGS 
Sbjct: 100 IPVDPADNAFNSYFHNNLDVLHTSFNNATSETHSSLLLKFIADPPTTTLQRLKGLTTGSL 159

Query: 110 PNFLDAILNVAEDDVSSSLKDQDSWLMQFYKHNKNIRFFGDDTWLKLFPLNIFSEYEGTN 169
           P F+DA       + + ++ ++D+ + Q + +N+++ F GDDTW  LF   +    +   
Sbjct: 160 PTFIDA-----GSNFNGAVIEEDNLIKQMFLNNQSVLFAGDDTWDNLFNPFLSPASQPFE 214

Query: 170 SFFVSDFEQVDLNVTRHLEKQF----KEKEQWDVLILHYLGLDHIGHKGGSQSKFMKGKH 225
           S  V D + VD  V R  E       ++ E+WDVLI H LG+DH+GHK G     MK K 
Sbjct: 215 SLNVWDLDTVDNGVIRFFEDNLFAKSEKSEEWDVLIGHMLGIDHVGHKYGPNHFTMKEKQ 274

Query: 226 EEMDSILEDIYNSIGDTEDTLLCVXXXXXXXXXXXXXXXXXXETSAGLTMISKKFKKLAK 285
            + +  ++ I  SI D  DTLL V                  E  A L + SK+    + 
Sbjct: 275 LQANEFIKRICESIDD--DTLLVVMGDHGMDHTGNHGGDSKSELEAALWLHSKRPNMWSH 332

Query: 286 PKDQINTVLPIKWNENLTEEEKDYKFLSFVQQVDFVPTLSALFNLPMPINSVGVLIPELL 345
             +Q   +  +   EN  +          V Q+D VPTLS L  LP+P N++G  I E+ 
Sbjct: 333 LPEQFYDISAL--GENYRQ----------VNQIDLVPTLSLLLGLPIPFNNLGWPIQEVA 380

Query: 346 RLLDPKLTRTKLK-ENFSQLTELSKSLTTRNIYNAI-DFQNDTIEDIISQMQSVQSELMK 403
              +   + +K+  +      ++S+ +T       + +  N+++EDI+ Q    Q   ++
Sbjct: 381 ATQEQLRSYSKIALDQIKAYKDISRVITAAEKNERLNELLNESLEDIL-QASEYQKIFLE 439

Query: 404 SA 405
           S 
Sbjct: 440 SC 441

>YLL031C Chr12 complement(77152..80205) [3054 bp, 1017 aa] {ON}
           GPI13ER membrane localized phosphoryltransferase that
           adds phosphoethanolamine onto the third mannose residue
           of the glycosylphosphatidylinositol (GPI) anchor
           precursor; similar to human PIG-O protein
          Length = 1017

 Score =  152 bits (383), Expect = 5e-37,   Method: Compositional matrix adjust.
 Identities = 110/358 (30%), Positives = 169/358 (47%), Gaps = 48/358 (13%)

Query: 8   LFQLIAITIFCVGFFPSKNVLQGSGEFNFEKELQLTTKPVFTKLVFVVIDALRSDFLYEE 67
           + Q I+I  F  GF  S++VL      N   +L     P F K V +VIDALR DF    
Sbjct: 44  ILQFISIAFFTRGFLLSRHVLDNISSQNETSKL----PPRFNKAVILVIDALRFDFAIPV 99

Query: 68  QNSH----FHFVHRVLNSGEAWG---------FTAFSNPPTVTLPRLKGITTGSTPNFLD 114
             SH     ++ + +L+  +++              ++PPT TL RLKG+TTGS P F+D
Sbjct: 100 NESHSNYNLNYHNNILSLYDSFASDKDASSLLLKFIADPPTTTLQRLKGLTTGSLPTFID 159

Query: 115 AILNVAEDDVSSSLKDQDSWLMQFYKHNKNIRFFGDDTWLKLFPLNIFSEYEGTNSFFVS 174
           A       +   ++ ++D++L Q +  NK ++F GDDTW+ LF   + ++     S  V 
Sbjct: 160 A-----GSNFDGTVIEEDNFLKQLHLANKTVKFAGDDTWMALFHPFLSNDSFPLESLNVW 214

Query: 175 DFEQVDLNVTRHLEKQFKEKEQWDVLILHYLGLDHIGHKGGSQSKFMKGKHEEMDSILED 234
           D + VD  V  +     ++ ++WDV+I H LG+DH+GHK G     M+ K  ++D  ++ 
Sbjct: 215 DLDTVDNGVMDYFHDHLQQDKEWDVMIGHMLGIDHVGHKYGPDHFTMREKQIQVDQFIDW 274

Query: 235 IYNSIGDTEDTLLCVXXXXXXXXXXXXXXXXXXETSAGLTMISKKFKKLAKPKDQINTVL 294
           I  SI D  DTLL +                  E  + L + SKK               
Sbjct: 275 ILKSIDD--DTLLVILGDHGMDHTGNHGGDSIDELESTLFLYSKK--------------- 317

Query: 295 PIKW------NENLTEEEKDYKFLSFVQQVDFVPTLSALFNLPMPINSVGVLIPELLR 346
           P  W      N N+     DY+    V+Q+D V +L+ L   P+P N++G  I E+ R
Sbjct: 318 PDMWRLKETSNYNIDNLGHDYR---SVRQIDLVSSLALLMGQPIPFNNLGWPIDEIAR 372

>Kwal_55.20667 s55 complement(511335..513140) [1806 bp, 602 aa]
           {OFF} YLL031C (GPI13) - phosphoryltransferase that adds
           phosphoethanolamine to the third mannose residue of the
           GPI anchor precursor [contig 141] PARTIAL
          Length = 602

 Score =  149 bits (376), Expect = 6e-37,   Method: Compositional matrix adjust.
 Identities = 118/357 (33%), Positives = 167/357 (46%), Gaps = 46/357 (12%)

Query: 6   LLLFQLIAITIFCVGFFPSKNVLQGSGEFNFEKELQLTTKPVFTKLVFVVIDALRSDF-- 63
           + + Q+IAI  F  GF  ++ VL+               +P F K V +VIDALR DF  
Sbjct: 52  IAVLQIIAIAFFARGFLLTRTVLENVAT-------HADYEPKFDKCVILVIDALRFDFSI 104

Query: 64  -LYEEQNSHFHFVHRVLNSGEAWGFTA----------FSNPPTVTLPRLKGITTGSTPNF 112
            +  ++N +  + H  L+   + GF             S+PPT TL RLKG+TTGS P F
Sbjct: 105 PIDPQENGYNPYYHNNLDVFHS-GFRDQNHSSLLLKFISDPPTTTLQRLKGLTTGSLPTF 163

Query: 113 LDAILNVAEDDVSSSLKDQDSWLMQFYKHNKNIRFFGDDTWLKLFPLNIFSEYEGTNSFF 172
           +DA  N      + ++ ++D+ + Q Y +NK I F GDDTW  LF   +    +   S  
Sbjct: 164 IDAGSNF-----NGAIIEEDNLIKQMYLNNKTILFAGDDTWDNLFGTFLSPSSKPYESLN 218

Query: 173 VSDFEQVDLNVTRHLEKQF----KEKEQWDVLILHYLGLDHIGHKGGSQSKFMKGKHEEM 228
           V D + VD  V  + E+      K++  WDVLI H LG+DH+GHK G     MK K  + 
Sbjct: 219 VWDLDTVDNGVIDYFEEHLLSPAKDEAHWDVLIGHMLGIDHVGHKYGPNHFTMKEKQLQA 278

Query: 229 DSILEDIYNSIGDTEDTLLCVXXXXXXXXXXXXXXXXXXETSAGLTMISKKFKKLAK-PK 287
           +  ++ I   + D  DTLL V                  E  A L M S K       P+
Sbjct: 279 NEFIKRICEKLDD--DTLLVVMGDHGMDHTGNHGGDSRSELEATLWMYSTKPDMWNHLPQ 336

Query: 288 DQINTVLPIKWNENLTEEEKDYKFLSFVQQVDFVPTLSALFNLPMPINSVGVLIPEL 344
           D  NT +       L E  ++      V Q+D V TLS L  LP+P N++G  I E+
Sbjct: 337 DAYNTSV-------LGENHRE------VNQIDLVSTLSLLLGLPIPFNNLGWPIQEV 380

>Kwal_YGOB_55.20664 s55 complement(510269..511291,511293..513140)
           [2871 bp, 956 aa] {ON} ANNOTATED BY YGOB -
          Length = 956

 Score =  150 bits (380), Expect = 1e-36,   Method: Compositional matrix adjust.
 Identities = 118/357 (33%), Positives = 167/357 (46%), Gaps = 44/357 (12%)

Query: 5   KLLLFQLIAITIFCVGFFPSKNVLQGSGEFNFEKELQLTTKPVFTKLVFVVIDALRSDF- 63
            + + Q+IAI  F  GF  ++ VL+               +P F K V +VIDALR DF 
Sbjct: 51  SIAVLQIIAIAFFARGFLLTRTVLENVAT-------HADYEPKFDKCVILVIDALRFDFS 103

Query: 64  --LYEEQNSHFHFVHR---VLNSG------EAWGFTAFSNPPTVTLPRLKGITTGSTPNF 112
             +  ++N +  + H    V +SG       +      S+PPT TL RLKG+TTGS P F
Sbjct: 104 IPIDPQENGYNPYYHNNLDVFHSGFRDQNHSSLLLKFISDPPTTTLQRLKGLTTGSLPTF 163

Query: 113 LDAILNVAEDDVSSSLKDQDSWLMQFYKHNKNIRFFGDDTWLKLFPLNIFSEYEGTNSFF 172
           +DA  N      + ++ ++D+ + Q Y +NK I F GDDTW  LF   +    +   S  
Sbjct: 164 IDAGSNF-----NGAIIEEDNLIKQMYLNNKTILFAGDDTWDNLFGTFLSPSSKPYESLN 218

Query: 173 VSDFEQVDLNVTRHLEKQF----KEKEQWDVLILHYLGLDHIGHKGGSQSKFMKGKHEEM 228
           V D + VD  V  + E+      K++  WDVLI H LG+DH+GHK G     MK K  + 
Sbjct: 219 VWDLDTVDNGVIDYFEEHLLSPAKDEAHWDVLIGHMLGIDHVGHKYGPNHFTMKEKQLQA 278

Query: 229 DSILEDIYNSIGDTEDTLLCVXXXXXXXXXXXXXXXXXXETSAGLTMISKKFKKLAK-PK 287
           +  ++ I   + D  DTLL V                  E  A L M S K       P+
Sbjct: 279 NEFIKRICEKLDD--DTLLVVMGDHGMDHTGNHGGDSRSELEATLWMYSTKPDMWNHLPQ 336

Query: 288 DQINTVLPIKWNENLTEEEKDYKFLSFVQQVDFVPTLSALFNLPMPINSVGVLIPEL 344
           D  NT +       L E  ++      V Q+D V TLS L  LP+P N++G  I E+
Sbjct: 337 DAYNTSV-------LGENHRE------VNQIDLVSTLSLLLGLPIPFNNLGWPIQEV 380

>Smik_12.25 Chr12 complement(61505..64558) [3054 bp, 1017 aa] {ON}
           YLL031C (REAL)
          Length = 1017

 Score =  147 bits (372), Expect = 9e-36,   Method: Compositional matrix adjust.
 Identities = 115/354 (32%), Positives = 174/354 (49%), Gaps = 40/354 (11%)

Query: 8   LFQLIAITIFCVGFFPSKNVLQGSGEFNFEKELQLTTKPVFTKLVFVVIDALRSDFLYE- 66
           + Q I+I  F  GF  S++VL      N   +L     P F K V +VIDALR DF    
Sbjct: 44  ILQFISIAFFTRGFLLSRHVLDNISSRNETSDL----PPRFNKAVVLVIDALRFDFAIPV 99

Query: 67  -----EQNSHFH---------FVHRVLNSGEAWGFTAFSNPPTVTLPRLKGITTGSTPNF 112
                + N ++H         F +   +S     F A  +PPT TL RLKG+TTGS P F
Sbjct: 100 NESDPDHNPNYHNNILSLYDSFTNDKNSSSLLLKFIA--DPPTTTLQRLKGLTTGSLPTF 157

Query: 113 LDAILNVAEDDVSSSLKDQDSWLMQFYKHNKNIRFFGDDTWLKLFPLNIFSEYEGTNSFF 172
           +DA       +   ++ ++D+ L QF+  NK ++F GDDTW  LF   + ++     S  
Sbjct: 158 IDA-----GSNFDGTIIEEDNLLKQFFLANKTVKFAGDDTWTALFYPFLSNDSFPLESLN 212

Query: 173 VSDFEQVDLNVTRHLEKQFKEKEQWDVLILHYLGLDHIGHKGGSQSKFMKGKHEEMDSIL 232
           V D + VD  V  +     ++ ++WDV+I H LG+DH+GHK G     M+ K  ++D  +
Sbjct: 213 VWDLDTVDNGVMDYFHDHLQQDKEWDVMIGHMLGIDHVGHKYGPDHFTMREKQIQVDRFI 272

Query: 233 EDIYNSIGDTEDTLLCVXXXXXXXXXXXXXXXXXXETSAGLTMISKKFKKLAKPKDQINT 292
           + I NSI D  DTLL +                  E  + L + SKK  ++ + KD    
Sbjct: 273 DWILNSIDD--DTLLVILGDHGMDHTGNHGGDSIDELESTLFLYSKK-PEMWRLKD---- 325

Query: 293 VLPIKWNENLTEEEKDYKFLSFVQQVDFVPTLSALFNLPMPINSVGVLIPELLR 346
                +N N ++   +Y+    V+Q+D V +LS L + P+P N++G  I E+ R
Sbjct: 326 ----AFNYNTSDSGYNYR---SVRQIDLVSSLSLLLDQPIPFNNLGWPIDEIAR 372

>SAKL0H25542g Chr8 (2236849..2239890) [3042 bp, 1013 aa] {ON}
           similar to uniprot|Q07830 Saccharomyces cerevisiae
           YLL031C
          Length = 1013

 Score =  147 bits (370), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 127/407 (31%), Positives = 196/407 (48%), Gaps = 53/407 (13%)

Query: 5   KLLLFQLIAITIFCVGFFPSKNVLQGSGEFNFEKELQLTTKPVFTKLVFVVIDALRSDFL 64
            L L Q IAI  F  GF  +++VL         K+ +  T   F K V +V+DALR DF+
Sbjct: 46  SLALLQFIAIAFFTRGFLLTRHVLDNVAT----KKSEYGT---FDKAVVLVVDALRFDFV 98

Query: 65  Y---EEQ---NSHFHFVHRVL-------NSGEAWGFTAFSNPPTVTLPRLKGITTGSTPN 111
               E Q   N ++H    VL       +   +      ++PPT TL RLKG+TTGS P 
Sbjct: 99  IPVSETQDYYNENYHNNLEVLYEKFKDVSESSSLLLKFIADPPTTTLQRLKGLTTGSLPT 158

Query: 112 FLDAILNVAEDDVSSSLKDQDSWLMQFYKHNKNIRFFGDDTWLKLFPLNIFSEYEGTNSF 171
           F+DA       + +  + ++D+ + Q + ++K + F GDDTW  LF   +  +     S 
Sbjct: 159 FIDA-----GSNFNGEVIEEDNLIKQMFLNDKTVFFAGDDTWNALFSPFLAEQSRPYESL 213

Query: 172 FVSDFEQVDLNV----TRHLEKQFKEKEQWDVLILHYLGLDHIGHKGGSQSKFMKGKHEE 227
            V D + VD  V      HL ++   + +WDVLI H LG+DH+GHK G     M+ K  +
Sbjct: 214 NVWDLDTVDNGVISFFKEHLFEKTPAQREWDVLIGHMLGIDHVGHKYGPNHFTMREKQLQ 273

Query: 228 MDSILEDIYNSIGDTEDTLLCVXXXXXXXXXXXXXXXXXXETSAGLTMISKKFKKLAKPK 287
           +D+ +  I  SI   EDTLL +                  E  + L + SKK        
Sbjct: 274 VDNFIRQIMESID--EDTLLVILGDHGMDHTGNHGGDSRDELESTLWLHSKKHGMWDHYS 331

Query: 288 DQINTVLPIKWNENLTEEEKDYKFLSFVQQVDFVPTLSALFNLPMPINSVGVLIPELLRL 347
           D+           + +E  K+Y+    V Q+D VPTLS L  LP+P N++G  I E+ + 
Sbjct: 332 DE---------TYDTSELGKNYR---QVNQIDLVPTLSLLLGLPIPFNNLGWPIREIAK- 378

Query: 348 LDPKLTRTKLKENFSQLTELSKSLTTRNIYNAIDF--QNDTIEDIIS 392
                T+ +L E ++QLT L +  + +NI   I+   +N+ +E +++
Sbjct: 379 -----TKDEL-ELYTQLT-LEQLQSYKNISGVINTAEKNEKLESLLA 418

>CAGL0G04015g Chr7 (379330..382389) [3060 bp, 1019 aa] {ON} highly
           similar to uniprot|Q07830 Saccharomyces cerevisiae
           YLL031c GPI13
          Length = 1019

 Score =  145 bits (367), Expect = 4e-35,   Method: Compositional matrix adjust.
 Identities = 111/364 (30%), Positives = 162/364 (44%), Gaps = 48/364 (13%)

Query: 5   KLLLFQLIAITIFCVGFFPSKNVLQGSGEFNFEKELQLTTKPVFTKLVFVVIDALRSDFL 64
            L   Q +AI  F  GF  S+ VL      +   +  L     F K+V +V+DALR DF+
Sbjct: 41  ALAFLQFVAIAFFAKGFLLSRTVLD---NVSTTSDNPLAVDKKFDKMVLLVVDALRFDFV 97

Query: 65  YEEQNSH------FHFVHRVL----------------NSGEAWGFTAFSNPPTVTLPRLK 102
                SH      FH    VL                NSG +      ++PPT TL RLK
Sbjct: 98  VPVSTSHPNYNENFHNNLDVLYNTWLSTRHGGRGGYSNSGSSILLKFIADPPTTTLQRLK 157

Query: 103 GITTGSTPNFLDAILNVAEDDVSSSLKDQDSWLMQFYKHNKNIRFFGDDTWLKLFPLNIF 162
           G+TTGS P F+DA       +   S+ ++D+ + Q +  NK++ F GDDTW  LF   + 
Sbjct: 158 GLTTGSLPTFIDA-----GSNFDGSVIEEDNLIKQLFLANKSVSFVGDDTWDALFHPFLA 212

Query: 163 SEYEGTNSFFVSDFEQVDLNVTRHLEKQFKEK---EQWDVLILHYLGLDHIGHKGGSQSK 219
           +  E   S  V D + VD  V  + +    +K     WD+L+ H LG+DH+GHK G    
Sbjct: 213 NNSEPYPSLNVWDLDTVDNGVISYFKSHLLDKSADRNWDILVGHMLGVDHVGHKYGPNHF 272

Query: 220 FMKGKHEEMDSILEDIYNSIGDTEDTLLCVXXXXXXXXXXXXXXXXXXETSAGLTMISKK 279
            M+ K  +++  +++I  SI +  DTLL V                  E  + L   +K+
Sbjct: 273 TMREKQNQVNRFIQEIIESIDN--DTLLVVMGDHGMDHTGNHGGDSQDELESTLFFYTKR 330

Query: 280 FKKLAKPKDQINTVLPIKWNENLTEEEKDYKFLSFVQQVDFVPTLSALFNLPMPINSVGV 339
                      +        ENL +          V Q+D VPTLS L ++P+P N++G 
Sbjct: 331 QNTWKNQNGNYDI-------ENLAQNYHS------VNQIDLVPTLSLLLDIPVPFNNLGW 377

Query: 340 LIPE 343
            I E
Sbjct: 378 PISE 381

 Score = 32.0 bits (71), Expect = 9.3,   Method: Compositional matrix adjust.
 Identities = 14/55 (25%), Positives = 27/55 (49%)

Query: 758 KFIERKNIILLFNCISGLFLLITCTILRYHLFIWSVFSPKLCYYMMWNIFMNVII 812
           + +    ++L +N +  L   I  T  R HL +W +F P+  +  +  I M ++I
Sbjct: 943 RIVSNCGVLLTYNTVLCLSSFIWVTHFRRHLMVWKIFCPRFIFACLSLIVMQLVI 997

>Kpol_478.1 s478 complement(442..3471) [3030 bp, 1009 aa] {ON}
           complement(442..3471) [3030 nt, 1010 aa]
          Length = 1009

 Score =  145 bits (367), Expect = 5e-35,   Method: Compositional matrix adjust.
 Identities = 135/421 (32%), Positives = 194/421 (46%), Gaps = 63/421 (14%)

Query: 8   LFQLIAITIFCVGFFPSKNVLQGSGEFNFEKELQLTTKPVFTKLVFVVIDALRSDFL--- 64
           + Q I+I  FC GF  ++NVL      N     Q  TK  F K V ++IDALR DF+   
Sbjct: 34  ILQFISIAFFCKGFLLTRNVLDNVNNLNPSDLNQDYTKK-FDKAVILIIDALRFDFVIPV 92

Query: 65  -----YEEQNSHF-------HFVHRVLNSGEAWGFTAF-SNPPTVTLPRLKGITTGSTPN 111
                   QN H         F+ +  N   +     F ++PPT TL RLKG+TTGS P 
Sbjct: 93  NSTDPLHNQNYHNNIITLYDQFISQNNNKDHSSILLKFIADPPTTTLQRLKGLTTGSLPT 152

Query: 112 FLDAILNVAEDDVSSSLKDQDSWLMQFYKHNKNIRFFGDDTWLKLFPLNIFSEYEGTNSF 171
           F+DA  N        S+ ++D+ + Q Y  N+ I F GDDTW  LF   + +  +   S 
Sbjct: 153 FIDAGTNF-----DGSVIEEDNLIKQLYLKNEEIYFVGDDTWDSLFNPFLSNHSKPFESL 207

Query: 172 FVSDFEQVDLNV----TRHLEKQFKEKEQWDVLILHYLGLDHIGHKGGSQSKFMKGKHEE 227
            V D + VD  V      HL  Q    ++WD+LI H LG+DH+GHK G     M+ K  +
Sbjct: 208 NVWDLDTVDNGVISYFNDHLINQKTNDKKWDILIGHMLGVDHVGHKYGPNHFTMREKQLQ 267

Query: 228 MDSILEDIYNSIGDTEDTLLCVXXXXXXXXXXXXXXXXXXETSAGLTMISKKFK--KLAK 285
           +++ + DI  SI D  DTLL +                  E  + L M SKK    +L  
Sbjct: 268 VNNFINDIIESIDD--DTLLVIMGDHGMDHTGNHGGDSKDELESTLFMYSKKTDVWELGD 325

Query: 286 PKDQINTVLPIKWNENLTEEEKDYKFLSFVQQVDFVPTLSALFNLPMPINSVGVLIPELL 345
           P            N N+     +Y+    V Q+D VPTLS L ++P+P N++G  I E+ 
Sbjct: 326 PN-----------NYNIENSGDNYR---SVNQIDLVPTLSLLLDVPIPFNNLGWPINEIS 371

Query: 346 -----RLLDPKLTRTKLKENFSQLTELSKSLTTRNIY-------------NAIDFQNDTI 387
                R +  +LT  +LK N+ +++ L  + T +  +              A  FQND +
Sbjct: 372 KNQNERNIFEQLTLKQLK-NYQEVSGLVVNNTEKYFHLEQLYQDSLIDSSKATIFQNDLL 430

Query: 388 E 388
           E
Sbjct: 431 E 431

>KAFR0I01410 Chr9 (294241..297291) [3051 bp, 1016 aa] {ON} Anc_4.28
           YLL031C
          Length = 1016

 Score =  143 bits (361), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 112/363 (30%), Positives = 175/363 (48%), Gaps = 37/363 (10%)

Query: 8   LFQLIAITIFCVGFFPSKNVLQGSGEFNFEKELQLTTKPVFTKLVFVVIDALRSDFLY-- 65
           L Q IAI  F  GF  S+ VL      N            F K V +++DALR DF+   
Sbjct: 44  LLQFIAIAFFTKGFLLSRQVLD-----NITPLDSNVIDAKFDKAVILIVDALRFDFVIPV 98

Query: 66  ---EEQNSHFH----FVHRVLNSGEAWGFTAF----SNPPTVTLPRLKGITTGSTPNFLD 114
              E  N+++H     ++    +G + G +      ++PPT TL RLKG+TTGS P F+D
Sbjct: 99  DSTEHLNNNYHNNIDILYDTFKNGNSHGSSILLKFLADPPTTTLQRLKGLTTGSLPTFID 158

Query: 115 AILNVAEDDVSSSLKDQDSWLMQFYKH-NKNIRFFGDDTWLKLFPLNIFSEYEGTNSFFV 173
           A       + + ++  +D+ + Q  ++ N+ I F GDDTW  LF   + +      S  V
Sbjct: 159 A-----GSNFNGNVIFEDNLIRQLSENLNREILFVGDDTWDALFHPFLSNNSLPYESLNV 213

Query: 174 SDFEQVDLNVTRHLEKQFKEKEQWDVLILHYLGLDHIGHKGGSQSKFMKGKHEEMDSILE 233
            D + VD  V    ++  K+ + WDVLI H LG+DH+GHK G     M+ K  ++++ ++
Sbjct: 214 WDLDTVDNGVIDFFDENLKKNDDWDVLIGHMLGVDHVGHKYGPNHFTMREKQLQVNTFIK 273

Query: 234 DIYNSIGDTEDTLLCVXXXXXXXXXXXXXXXXXXETSAGLTMISKKFKKLAKPKDQINTV 293
            I +SI +  +TLL V                  E  + L + +KK K + +  D     
Sbjct: 274 KIIDSIDN--NTLLVVMGDHGMDHTGNHGGDSIDELESTLFLYTKK-KNIFRKHDDFTPY 330

Query: 294 LPIKWNENLTEEEKDYKFLSFVQQVDFVPTLSALFNLPMPINSVGVLIPELLRLLDPKLT 353
                  N+T+  K+Y+    V Q+D V TLS L  +P+P N++G  I E+    + K+ 
Sbjct: 331 -------NITDLGKNYR---AVNQIDLVSTLSYLLGIPIPFNNLGWPIEEIFHSKNDKIK 380

Query: 354 RTK 356
            TK
Sbjct: 381 MTK 383

 Score = 32.3 bits (72), Expect = 5.8,   Method: Compositional matrix adjust.
 Identities = 15/55 (27%), Positives = 28/55 (50%)

Query: 758 KFIERKNIILLFNCISGLFLLITCTILRYHLFIWSVFSPKLCYYMMWNIFMNVII 812
           + +    I+L++N I  L   I  T  R HL +W +F P+  +  +  I + V++
Sbjct: 940 RIVSNCGILLIYNTILCLSSFIWVTHFRRHLMVWKIFCPRFIFASLCLIVVQVVV 994

>Suva_10.41 Chr10 complement(81579..84632) [3054 bp, 1017 aa] {ON}
           YLL031C (REAL)
          Length = 1017

 Score =  143 bits (361), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 111/353 (31%), Positives = 174/353 (49%), Gaps = 38/353 (10%)

Query: 8   LFQLIAITIFCVGFFPSKNVLQGSGEFNFEKELQLTT-KPVFTKLVFVVIDALRSDFLY- 65
           + Q I+I  F  GF  S++VL      N   + + TT  P F K V +VIDALR DF+  
Sbjct: 44  ILQFISIAFFTRGFLLSRHVLD-----NISTQNETTTLHPRFNKTVVLVIDALRFDFVIP 98

Query: 66  ---EEQNSHFHFVHRVLNSGEAWG---------FTAFSNPPTVTLPRLKGITTGSTPNFL 113
                 N + ++ + +L+  +++              ++PPT TL RLKG+TTGS P F+
Sbjct: 99  VDESGSNHNLNYHNNILSLYDSFANDKDASSLLLKFIADPPTTTLQRLKGLTTGSLPTFI 158

Query: 114 DAILNVAEDDVSSSLKDQDSWLMQFYKHNKNIRFFGDDTWLKLFPLNIFSEYEGTNSFFV 173
           DA       +   ++ ++D+ L Q +  NK ++F GDDTW+ LF   + ++     S  V
Sbjct: 159 DA-----GSNFDGTVIEEDNLLKQLHLANKTVKFAGDDTWMALFHPFLSNDSFPLESLNV 213

Query: 174 SDFEQVDLNVTRHLEKQFKEKEQWDVLILHYLGLDHIGHKGGSQSKFMKGKHEEMDSILE 233
            D + VD  V  +     ++ ++WDV+I H LG+DH+GHK G     M+ K  ++D  + 
Sbjct: 214 WDLDSVDKGVMDYFHDHLQQDQEWDVMIGHMLGIDHVGHKYGPDHFTMREKQVQVDEFIN 273

Query: 234 DIYNSIGDTEDTLLCVXXXXXXXXXXXXXXXXXXETSAGLTMISKKFKKLAKPKDQINTV 293
            I  SI   E+TLL +                  E  + L + SKK   L K KD     
Sbjct: 274 WILKSID--ENTLLVILGDHGMDHTGNHGGDSIDELESTLFLYSKK-PNLWKLKDSS--- 327

Query: 294 LPIKWNENLTEEEKDYKFLSFVQQVDFVPTLSALFNLPMPINSVGVLIPELLR 346
                N +++   +DY+    V+Q+D V +LS L   P+P N++G  I E+ R
Sbjct: 328 -----NYDISALGRDYR---SVRQIDLVSSLSLLLGQPIPFNNLGWPIDEIAR 372

>TDEL0F01690 Chr6 (313714..316731) [3018 bp, 1005 aa] {ON} Anc_4.28
           YLL031C
          Length = 1005

 Score =  143 bits (361), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 115/360 (31%), Positives = 160/360 (44%), Gaps = 44/360 (12%)

Query: 1   MLSLKLLLFQLIAITIFCVGFFPSKNVLQGSGEFNFEKELQLTTKPVFTKLVFVVIDALR 60
           +L   L L Q IAI  F  GF  ++ VL        +  ++      F K V +++DALR
Sbjct: 37  ILLASLALLQFIAIAFFTRGFLLTRQVLD-------DVAIKTAEYGKFDKAVVLIVDALR 89

Query: 61  SDFLYEEQNSH------FHFVHRVL------NSGEAWGFTAFSNPPTVTLPRLKGITTGS 108
            DF+      H      FH    VL      + G +      ++ PTVTL RLKG+TTGS
Sbjct: 90  FDFVIPVDQDHQGYSGNFHNNIDVLYESMFADQGSSLLLKFIADAPTVTLQRLKGLTTGS 149

Query: 109 TPNFLDAILNVAEDDVSSSLKDQDSWLMQFYKHNKNIRFFGDDTWLKLFPLNIFSEYEGT 168
            P F+DA       +   S+ ++D+ + Q Y+  K I F GDDTW  LF   +    +  
Sbjct: 150 LPTFIDA-----GSNFDGSVIEEDNLIKQMYEQGKQIYFAGDDTWESLFSPFLSPRSKYY 204

Query: 169 NSFFVSDFEQVDLNVTRHLEKQFKE--KEQWDVLILHYLGLDHIGHKGGSQSKFMKGKHE 226
            SF V D + VD  V  +  +   E     WDVLI H LG+DH+GHK G     M+ K  
Sbjct: 205 ESFNVWDLDTVDNGVISYFNEHLLETANRDWDVLIGHMLGVDHVGHKYGPNHFTMREKQL 264

Query: 227 EMDSILEDIYNSIGDTEDTLLCVXXXXXXXXXXXXXXXXXXETSAGLTMISKK--FKKLA 284
           +++  L  I  +I D  DTLL +                  E  + L + SK+     L 
Sbjct: 265 QVNDFLIKIKETIDD--DTLLVIMGDHGMDHTGNHGGDSKDELESTLFLYSKRPNMWGLN 322

Query: 285 KPKDQINTVLPIKWNENLTEEEKDYKFLSFVQQVDFVPTLSALFNLPMPINSVGVLIPEL 344
            P     T L   + E              V Q+D VPTLS L  LP+P N++G  I E+
Sbjct: 323 DPSQYNTTDLGAYYRE--------------VNQIDLVPTLSILMGLPIPFNNLGWPIEEI 368

>Skud_12.36 Chr12 complement(68300..71350) [3051 bp, 1016 aa] {ON}
           YLL031C (REAL)
          Length = 1016

 Score =  142 bits (359), Expect = 4e-34,   Method: Compositional matrix adjust.
 Identities = 110/354 (31%), Positives = 171/354 (48%), Gaps = 37/354 (10%)

Query: 6   LLLFQLIAITIFCVGFFPSKNVLQGSGEFNFEKELQLTTKPVFTKLVFVVIDALRSDFLY 65
           + + Q I+I  F  GF  S++VL      N     + +  P F K V +V+DALR DF+ 
Sbjct: 42  IAVLQFISIAFFTRGFLLSRHVLDNISALN-----ETSIPPRFNKAVVLVVDALRFDFVI 96

Query: 66  ----EEQNSHFHFVHRVLNSGEAWG---------FTAFSNPPTVTLPRLKGITTGSTPNF 112
                  N + ++ + +L+  +++              ++PPT TL RLKG+TTGS P F
Sbjct: 97  PVNESSSNHNLNYHNNILSLYDSFANDEDASSLLLKFIADPPTTTLQRLKGLTTGSLPTF 156

Query: 113 LDAILNVAEDDVSSSLKDQDSWLMQFYKHNKNIRFFGDDTWLKLFPLNIFSEYEGTNSFF 172
           +DA       +   ++ ++D+ L Q +  NK ++F GDDTW+ LF   + ++     S  
Sbjct: 157 IDA-----GSNFDGTVIEEDNLLKQLHLVNKTVKFAGDDTWMALFHPFLSNDSFPLESLN 211

Query: 173 VSDFEQVDLNVTRHLEKQFKEKEQWDVLILHYLGLDHIGHKGGSQSKFMKGKHEEMDSIL 232
           V D + VD  V  +     ++ ++WDV+I H LG+DH+GHK G     MK K  ++D  +
Sbjct: 212 VWDLDTVDNGVMDYFHDHLQQDKEWDVMIGHMLGIDHVGHKYGPNHFTMKEKQFQVDQFI 271

Query: 233 EDIYNSIGDTEDTLLCVXXXXXXXXXXXXXXXXXXETSAGLTMISKKFKKLAKPKDQINT 292
             I  SI D  DTLL +                  E  + L + SKK   +   KD    
Sbjct: 272 AWILKSIDD--DTLLVILGDHGMDHTGNHGGDSIDELESTLFLYSKK-PNMWNFKDAS-- 326

Query: 293 VLPIKWNENLTEEEKDYKFLSFVQQVDFVPTLSALFNLPMPINSVGVLIPELLR 346
                 N N+T    DY+    V+Q+D V +LS L   P+P N++G  I E+ R
Sbjct: 327 ------NYNITNLGCDYR---SVRQIDLVSSLSLLLGQPIPFNNLGWPIDEIAR 371

>TPHA0F00310 Chr6 complement(59665..62745) [3081 bp, 1026 aa] {ON}
           Anc_4.28 YLL031C
          Length = 1026

 Score =  139 bits (350), Expect = 5e-33,   Method: Compositional matrix adjust.
 Identities = 116/367 (31%), Positives = 171/367 (46%), Gaps = 52/367 (14%)

Query: 10  QLIAITIFCVGFFPSKNVLQGSGEFNFEKELQLTT------KPVFTKLVFVVIDALRSDF 63
           Q IAI  F  GF  S+NVL    E         ++      +  F K V +VIDALR DF
Sbjct: 37  QFIAIAFFTKGFLLSRNVLDDINELKPSMYAANSSNNGFVHQQKFEKTVILVIDALRFDF 96

Query: 64  LY------EEQNSHFH-------------FVHRVLNSGEAWGFTAFSNPPTVTLPRLKGI 104
           +          NS+ H              V +  N+     F A  +PPT TL RLKG+
Sbjct: 97  VIPVNTNNSAYNSNHHNKITTLYDQFCKESVGKKQNNSLLLKFLA--DPPTTTLQRLKGL 154

Query: 105 TTGSTPNFLDAILNVAEDDVSSSLKDQDSWLMQFYKHNKNIRFFGDDTWLKLFPLNIFSE 164
           TTGS P F+DA       +   ++ ++D+ + Q Y +NK + F GDDTW  LF   + + 
Sbjct: 155 TTGSLPTFIDA-----GSNFDGTVIEEDNLIKQMYLNNKEVFFVGDDTWDALFSPFLSNH 209

Query: 165 YEGTNSFFVSDFEQVDLNVTRHL-------EKQFKEKEQWDVLILHYLGLDHIGHKGGSQ 217
                S  V D + VD  V  +        E+  K+  QW+VLI H LG+DH+GHK G  
Sbjct: 210 SIPYESLNVWDLDTVDNGVISYFNDNLIRSEEYKKKNSQWNVLIGHMLGVDHVGHKYGPN 269

Query: 218 SKFMKGKHEEMDSILEDIYNSIGDTEDTLLCVXXXXXXXXXXXXXXXXXXETSAGLTMIS 277
              MK K  ++++ + DI N I D  DTLL +                  E  + L + S
Sbjct: 270 HFTMKEKQLQVNNFINDIINVIDD--DTLLVIMGDHGMDHTGNHGGDSIDELESTLFLYS 327

Query: 278 KKFKKLAKPKDQINTVLPIKWNENLTEEEKDYKFLSFVQQVDFVPTLSALFNLPMPINSV 337
           K+ + + K +D  +         N+ +   +YK    + Q+D VPTL+ L ++P+P N++
Sbjct: 328 KR-QNVWKLEDDHSVY-------NIDDLGSNYK---SINQIDLVPTLALLLDIPIPFNNL 376

Query: 338 GVLIPEL 344
           G  I E+
Sbjct: 377 GWPIKEI 383

>NCAS0C05800 Chr3 (1193195..1196230) [3036 bp, 1011 aa] {ON}
           Anc_4.28
          Length = 1011

 Score =  137 bits (345), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 110/356 (30%), Positives = 164/356 (46%), Gaps = 37/356 (10%)

Query: 5   KLLLFQLIAITIFCVGFFPSKNVLQGSGEFNFEKELQLTTKPVFTKLVFVVIDALRSDFL 64
            L   Q IAI  F  GF  ++NVL         + ++   K  F K V +V+DALR DF+
Sbjct: 41  SLAALQFIAIAFFLKGFLLTRNVLDNVATLADYQSIENYGK--FNKSVILVVDALRFDFV 98

Query: 65  YE------EQNSHFHFVHRVL-------NSGEAWGFTAFSNPPTVTLPRLKGITTGSTPN 111
                   + N ++H   +VL       +S  +      ++PPT TL RLKG+TTGS P 
Sbjct: 99  IPVNQSNPDYNDYYHNNLKVLYEKFEDQSSSSSLLLKFMADPPTTTLQRLKGLTTGSLPT 158

Query: 112 FLDAILNVAEDDVSSSLKDQDSWLMQFYKHNKNIRFFGDDTWLKLFPLNIFSEYEGTNSF 171
           F+DA       +   S+ ++D+ + Q + ++K + F GDDTW  LF   +    +   S 
Sbjct: 159 FIDA-----GSNFDGSVIEEDNIIKQMFLNDKQVLFVGDDTWDALFNPFLSPMSQPFESL 213

Query: 172 FVSDFEQVDLNVTRHLEKQFKEK---EQWDVLILHYLGLDHIGHKGGSQSKFMKGKHEEM 228
            V D + VD  V         E    + W+VLI H LG+DH+GHK G     MK K  ++
Sbjct: 214 NVWDLDTVDNGVISFFNDHLLENTNDQSWNVLIGHMLGMDHVGHKFGPNHFTMKQKQLQI 273

Query: 229 DSILEDIYNSIGDTEDTLLCVXXXXXXXXXXXXXXXXXXETSAGLTMISKKFKKLAKPKD 288
           D  + +I +SI D  DTLL +                  E  + L + SK+         
Sbjct: 274 DKFIREIMDSIDD--DTLLVIMGDHGMDHTGNHGGDSKDELESTLFLYSKR--------- 322

Query: 289 QINTVLPIKWNENLTEEEKDYKFLSFVQQVDFVPTLSALFNLPMPINSVGVLIPEL 344
             N    ++   N     +  ++ S V Q+D V TLS L  LP+P N++G  I E+
Sbjct: 323 --NNAWNLQDTSNYDTRNQGDRYRS-VNQIDLVSTLSFLLGLPIPFNNLGWPINEI 375

 Score = 33.1 bits (74), Expect = 4.0,   Method: Compositional matrix adjust.
 Identities = 15/58 (25%), Positives = 29/58 (50%)

Query: 758 KFIERKNIILLFNCISGLFLLITCTILRYHLFIWSVFSPKLCYYMMWNIFMNVIIGWI 815
           + +    +++L+N I  L   I  T  R HL +W +F P+  +  M  I   +I+ ++
Sbjct: 935 RIVSNCGVLILYNSILCLSSFIWVTHFRRHLMVWKIFCPRFLFACMSLIVTQIIVTFV 992

>AGR126C Chr7 complement(989235..992276) [3042 bp, 1013 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YLL031C
           (GPI13)
          Length = 1013

 Score =  133 bits (335), Expect = 3e-31,   Method: Compositional matrix adjust.
 Identities = 131/393 (33%), Positives = 177/393 (45%), Gaps = 54/393 (13%)

Query: 5   KLLLFQLIAITIFCVGFFPSKNVLQGSGEFNFEKELQLTTKPVFTKLVFVVIDALRSDFL 64
            L   Q IAI  F  GF  S+ VL      +     + T    F +LV +V+DALR DF+
Sbjct: 49  ALAALQFIAIAFFTRGFLLSRKVLD-----DVANRDESTAPAKFDRLVLLVVDALRFDFV 103

Query: 65  ------YEEQNSHFHFVHRVLNSGEAWG----FTAFSNPPTVTLPRLKGITTGSTPNFLD 114
                  E  NSH+H   R L   E W         ++PPT TL RLKG+TTGS P F+D
Sbjct: 104 IPVDVAAEGYNSHYHNHLRALY--ERWDESILLKFLADPPTTTLQRLKGLTTGSLPTFID 161

Query: 115 AILNVAEDDVSSSLKDQDSWLMQFYKHNKNIRFFGDDTWLKLF-PL--NIFSEYEGTNSF 171
           A       + +  + D+   + Q    NK I F GDDTW  LF P   N+   YE  N  
Sbjct: 162 A-----GSNFNGIVIDEGYIIKQMCLINKTIYFAGDDTWDALFHPYLSNVSMPYESLN-- 214

Query: 172 FVSDFEQVDLNVTR----HLEKQFKEKEQWDVLILHYLGLDHIGHKGGSQSKFMKGKHEE 227
            V D + VD  V      HL     EK++WDVL+ H LG+DH+GHK G     M  K  +
Sbjct: 215 -VWDLDTVDNGVISFFEDHLLNNPTEKKEWDVLVGHMLGIDHVGHKYGPSHFSMAEKQSQ 273

Query: 228 MDSILEDIYNSIGDTEDTLLCVXXXXXXXXXXXXXXXXXXETSAGLTMISKKFKKLAKPK 287
           +D  +  I +++   EDTLL V                  E  + L + +K+     +  
Sbjct: 274 VDGFIRQIIDAV--DEDTLLVVMGDHGMDHTGNHGGDSPAELESTLWLYTKRPGTWRRQA 331

Query: 288 DQINTVLPIKWNENLTEEEKDYKFLSFVQQVDFVPTLSALFNLPMPINSVGVLIPELLRL 347
                  P  +N   TE  + Y+    V Q+D VP+LS L  LP+P N++G  I EL   
Sbjct: 332 -------PAAYNT--TELGRYYR---AVNQIDLVPSLSLLLGLPIPFNNLGWPIEELAH- 378

Query: 348 LDPKLTRTKLKENFSQLTELSKSLTTRNIYNAI 380
            D    R   ++   QL       T RN  N+I
Sbjct: 379 -DDDEWRLFTRQTLMQLE------TYRNTSNSI 404

>TBLA0A08500 Chr1 complement(2089018..2092215) [3198 bp, 1065 aa]
           {ON} Anc_4.28 YLL031C
          Length = 1065

 Score =  132 bits (333), Expect = 5e-31,   Method: Compositional matrix adjust.
 Identities = 113/360 (31%), Positives = 173/360 (48%), Gaps = 39/360 (10%)

Query: 8   LFQLIAITIFCVGFFPSKNVLQGSGEFNFEKELQLTTKPVFTKLVFVVIDALRSDFLYE- 66
           + Q I+I  F  GF  ++NVL      N    + L  KP F K V +++DALR +F+   
Sbjct: 63  ILQFISIAFFSRGFLLTRNVLDNISTDNNPNSI-LNDKPQFDKTVILIVDALRFNFVIPV 121

Query: 67  -----EQNSHFHFVHRVL-----NSGEAWG--FTAFSNPPTVTLPRLKGITTGSTPNFLD 114
                + N ++H    VL     NS ++        ++PPT T+ RLKG+TTG+ P F+D
Sbjct: 122 DVDSMDYNPNYHNNIDVLYDTFKNSQDSSSVLLKFIADPPTTTMQRLKGLTTGTLPTFID 181

Query: 115 AILNVAEDDVSSSLKDQDSWLMQFY--KHNKNIRFFGDDTWLKLFPLNIFSEYEGT-NSF 171
           A       +   S+  +D+ + Q Y  K   +I F GDDTW  LF   +  ++    +S 
Sbjct: 182 A-----GSNFDGSVILEDNLIKQLYLNKFWNDIYFVGDDTWDALFKPYLNQQFSRPFDSL 236

Query: 172 FVSDFEQVDLNVTRH-----LEKQFKEKEQWDVLILHYLGLDHIGHKGGSQSKFMKGKHE 226
            V D + VD  V  +     +++  K++  +  LI H LG+DH+GHK G     MK K  
Sbjct: 237 NVWDLDTVDNGVISYFHEYLIDQSSKDQMTYKTLIGHMLGVDHVGHKYGPNHFTMKEKQL 296

Query: 227 EMDSILEDIYNSIGDTEDTLLCVXXXXXXXXXXXXXXXXXXETSAGLTMISKKFKKLAKP 286
           +++  L++I NSI D  +TLL V                  E  + L M +KK       
Sbjct: 297 QINQFLKEIINSIDD--NTLLVVMGDHGMDHTGNHGGDSVDELESTLFMYAKKKNSFTLD 354

Query: 287 KDQINTVLPIKWNENLTEEEKDYKFLSFVQQVDFVPTLSALFNLPMPINSVGVLIPELLR 346
           KD        + + N++   + YK    V Q+D VPTLS L +L +P NS+G  I E+ +
Sbjct: 355 KDY-------ETSYNISNFGESYK---QVNQIDLVPTLSLLLDLQIPFNSLGWPIDEIAQ 404

>TPHA0K02180 Chr11 (466234..469320) [3087 bp, 1028 aa] {ON} Anc_4.28
           YLL031C
          Length = 1028

 Score =  127 bits (320), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 104/373 (27%), Positives = 161/373 (43%), Gaps = 64/373 (17%)

Query: 6   LLLFQLIAITIFCVGFF----PSKNVLQGSGEFNFEKELQLTTKPVFTKLVFVVIDALRS 61
           + L Q+I+I  F  GF     P ++  Q S E++  K+        F K V +++DALR 
Sbjct: 49  IALLQVISIAFFTKGFSFCRSPIRHTAQYSPEYSEVKK--------FDKAVVLLVDALRF 100

Query: 62  DFLY----------EEQNSHFHFVHRVLNSGE----------------AWGFTAFSNPPT 95
           DF+           E  +++   +  +LN  +                +  F   + PPT
Sbjct: 101 DFVVPINELDPIYNENYHNNIDIISELLNQNDNSTKNESKKDRVQKSSSLLFKFLAEPPT 160

Query: 96  VTLPRLKGITTGSTPNFLDAILNVAEDDVSSSLKDQDSWLMQFYKHNKNIRFFGDDTWLK 155
            T  RLKGITTG  P+FLD I+ + +  V     + DS + Q +  NK I F GDDTW +
Sbjct: 161 TTFHRLKGITTGLLPSFLDGIMKLNDRVV-----EDDSIIKQLFLRNKTIYFSGDDTWSR 215

Query: 156 LFPLNIFSEYEGTNSFFVSDFEQVDLNV----TRHLEKQFKEKEQWDVLILHYLGLDHIG 211
           +F   +  +     S+ + D   VD  V      HL  +     +WD+LI H +G+DH  
Sbjct: 216 MFEPYLSPKSVPLESYNIWDLNTVDDGVFKFFNEHLTSKNTSNREWDILIGHIVGIDHAA 275

Query: 212 HKGGSQSKFMKGKHEEMDSILEDIYNSIGDTEDTLLCVXXXXXXXXXXXXXXXXXXETSA 271
            K G     +K K  +++  ++ I  S+ D   TLL V                  E  +
Sbjct: 276 TKYGPNHITVKQKQIQINEFIKQIVKSLDD--QTLLIVMGDHGMDITGNHGGKSSGELES 333

Query: 272 GLTMISKKFKKLAKPKDQINTVLPIKWNENLTEEEKDYKFLSFVQQVDFVPTLSALFNLP 331
            L + SKK                  W +  +  E +  F   + Q+D VPT S LF +P
Sbjct: 334 SLFLYSKKSS---------------VWKQEHSLHENNNDFYKKINQIDIVPTFSLLFGIP 378

Query: 332 MPINSVGVLIPEL 344
           +P N++G  I E+
Sbjct: 379 IPYNNLGWPINEI 391

>TBLA0E01480 Chr5 complement(337267..340389) [3123 bp, 1040 aa] {ON}
           Anc_4.28 YLL031C
          Length = 1040

 Score = 52.4 bits (124), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 84/351 (23%), Positives = 140/351 (39%), Gaps = 78/351 (22%)

Query: 93  PPTVTLPRLKGITTGSTPNFLDAILNVAEDDVSSSLKDQDSWLMQFYKHNKNIRFFGDDT 152
           PPT TL R+K IT GS P+F+D  +         S+ ++D+ L Q Y +N++I F GD  
Sbjct: 151 PPTDTLQRVKCITGGSVPSFIDTGITFY-----GSMIEEDNILKQMYLNNRSIYFTGDKF 205

Query: 153 WLKLFPLNIFSEYEGTNSF--FVSDFEQVDLNVTRHLEKQFKEKEQ-------------- 196
           W  L+    F  ++  N+    +  F+++  +      +  +  ++              
Sbjct: 206 WNSLYS-KYFQNFKLANNIDDIIDYFQKITTSTNHSYGESNRSSDKPISLDTNLLQNISS 264

Query: 197 ---------------WDVLILHYLGLDHIGHKGGSQSKFMKGKHEEMDSILEDIYNSIGD 241
                          WD+LI H +            +   K    +++S L D  NSI +
Sbjct: 265 IPTISNATVTTPSKDWDILIGHIM----------EDTMNEKVTQLKVNSFLNDTINSIDN 314

Query: 242 TEDTLLCVXXXXXXXXXXXXXXXXXXETSAGLTMISKKFKKLAKPKDQINTVLPIKWNEN 301
             DTLL V                      GL M +KKFK     ++ +          N
Sbjct: 315 --DTLLLVLGDYSTANNHML--------DTGLFMYTKKFKNFWNLQNHLG-------EYN 357

Query: 302 LTEEEKDYKFLSFVQQVDFVPTLSALFNLPMPINSVGVLIPELLRLLDPKLTRTKL---K 358
           +    ++Y+    + Q D VP+LS L  LP+P N++G  I E++  ++  L   +     
Sbjct: 358 VDNFGENYR---VIDQFDVVPSLSLLLGLPIPFNNLGWPIDEIISPINSNLNDVRTLWYN 414

Query: 359 ENFSQL------TELSKSLTTRNIYNAIDFQNDTIEDIISQMQSVQSELMK 403
              SQL      T +SKS +   I   +  +   IE+ I   +  Q  L+K
Sbjct: 415 STLSQLKHYKDKTTISKSRSKNAILQKLWLK--AIENPIENGEIYQKSLLK 463

>Kpol_1044.18 s1044 complement(37667..40735) [3069 bp, 1022 aa] {ON}
           complement(37667..40735) [3069 nt, 1023 aa]
          Length = 1022

 Score = 40.4 bits (93), Expect = 0.020,   Method: Compositional matrix adjust.
 Identities = 81/373 (21%), Positives = 157/373 (42%), Gaps = 62/373 (16%)

Query: 6   LLLFQLIAITIFCVGFFPSKNVLQGSGEFNFEKELQ--LTTKPVFTKLVFVVIDALRSDF 63
           L L Q I+I  F  G   + + L  S + N    +       P F+K + +V+D+L  D 
Sbjct: 42  LALLQFISIAFFTKGLLFTNHYLDTSYKTNSRNNVDNIPDIDPQFSKAIVLVLDSLSLDS 101

Query: 64  L-YEEQNSHFHFVHRV--------------LNSGEAWGFTAFSNPPTVTLPRLKGITTGS 108
           + + E +++ +F H++              L S  +  +T  +   T    +L+ + +G+
Sbjct: 102 IAFSELSANDNFNHQLSSLTSPDDEISSQKLFSYVSKEYTFEAESSTHHTSKLQDLFSGT 161

Query: 109 TPNFLDAILNVAEDDVSSSLKDQDSWLMQFYKHNKNIRFFGDDTWLKLFPLNIFSEYEGT 168
             +    + N      ++ L  +D++L +   + KN+ F  +  W  +    IFS  +  
Sbjct: 162 VTDLAKCVKNF-----TNCLLFEDNFLHKLNLNYKNVYFANEHYWDSID--GIFSSNQRL 214

Query: 169 NSFFVSDFE----QVDLN------VTRHLEKQFKEKEQWDVLILHYLGLDHIGHKGGSQS 218
            +   ++ E     +D N      +   +  +  + E+W+VLI H  GL        +  
Sbjct: 215 PATLANNAEIDTYTIDPNKDTINFLYETVIDKSNDIEKWEVLIGHLYGLKPHDENLETND 274

Query: 219 KFMKGKHEEMDSILEDIYNSIGDTEDTLLCVXXXXXXXXXXXXXXXXXXETSAGLTMISK 278
             +     E+D ++ D+  S+ +  DTLL V                    S      +K
Sbjct: 275 PSILRNQIEIDKLITDLKKSMDN--DTLLMV-------------------VSGNSKFSTK 313

Query: 279 KFKKLAKPKDQINTVLPIKWNENLTEEE-----KDYKFLSF--VQQVDFVPTLSALFNLP 331
              K  K    + + +P  WN ++ +       KD   L +  + +VD +P++S L +LP
Sbjct: 314 DVIKNNKNILYLYSNVPNLWNYSVADNSNLIIGKDNSTLKYSNIDKVDIIPSISLLLDLP 373

Query: 332 MPINSVGVLIPEL 344
           +P++S+G+ IPEL
Sbjct: 374 LPVDSLGLFIPEL 386

>NDAI0A00980 Chr1 complement(201468..204245) [2778 bp, 925 aa] {ON}
           Anc_1.184 YKL165C
          Length = 925

 Score = 39.7 bits (91), Expect = 0.037,   Method: Compositional matrix adjust.
 Identities = 86/420 (20%), Positives = 148/420 (35%), Gaps = 83/420 (19%)

Query: 43  TTKPVFTKLVFVVIDALRSDFLYE------EQNSHF--HFVHRVLNSGEAWGFTAFSNPP 94
           T  P   +L  +V D LR+D  ++         + F   F+  ++ +   +G +    P 
Sbjct: 42  TDTPPAKRLFLIVGDGLRADTTFDLITHPTTGKTEFLAPFIRSLVKTNATYGISHTRMP- 100

Query: 95  TVTLPRLKGITTGSTPNFLDAILNVAED--DVSSSLKDQDSWLMQFYKHNKNIRFFGDDT 152
                      T S P  +  I    ED   V+   K+       F+  + +   FG   
Sbjct: 101 -----------TESRPGHVAMIAGFYEDVSAVTKGWKENPVDFDSFFNQSTHTYSFGSPD 149

Query: 153 WLKLF------PLNIFS-----EYEGTNSFFVSDFEQVDLNVTRHLEKQFKE-------- 193
            L +F      P  + +     EYE     F     ++D  V RHL+  FK         
Sbjct: 150 ILPMFKDGASDPNKVDAWMYGHEYED----FTQSSIELDAYVFRHLDSLFKNSTSNVTLD 205

Query: 194 ---KEQWDVLILHYLGLDHIGHKGGSQSKF----MKGKHEEMDSILEDIYNSIGDTEDTL 246
              +++ +V  LH LG D  GH     S      +K   E++  +++ +++  GD EDT 
Sbjct: 206 HEIRQEGNVFFLHLLGCDTAGHSYRPYSAEYYDNVKYIDEQVSLLVDKVHDFFGD-EDTA 264

Query: 247 LCVXXXXXXXXXXXXXXXXXXETSAGLTMISKKFKKLAKPKDQINTVLPIKWNENLTEEE 306
                                 T   L        K  K +      +PI  N   +   
Sbjct: 265 FIFTADHGMSAFGSHGDGHPNNTRTPLVAWGAGLNKPVKNE------VPIYDNYTESWGL 318

Query: 307 KDYKFLSFVQQVDFVPTLSALFNLPMPINSVG----------------VLIPELLRLLDP 350
            D K  + ++Q D  P +S L     P NSVG                 L      +L+ 
Sbjct: 319 ADIK-RNDIKQADITPLMSYLIGANYPANSVGELPLSYIDSNESQKLKALYNNARSILEQ 377

Query: 351 KLTRTK-------LKENFSQLTELSKSLTTRNIYNAIDFQNDTIEDIISQMQSVQSELMK 403
            L + +       + + + +L++ S     + I++ ID   D   D+ ++  ++  ELMK
Sbjct: 378 YLVKEQEVIESQFIYKEYPKLSDKSHKQYLKEIHHLIDLIADGELDLENEAITLTEELMK 437

>NCAS0B08260 Chr2 (1574633..1577407) [2775 bp, 924 aa] {ON}
           Anc_1.184 YKL165C
          Length = 924

 Score = 37.0 bits (84), Expect = 0.23,   Method: Compositional matrix adjust.
 Identities = 75/331 (22%), Positives = 118/331 (35%), Gaps = 44/331 (13%)

Query: 38  KELQLTTKPVFTKLVFVVIDALRSDFLYEEQNSHFHFVHRVLNSGE---AWGFTAFSNPP 94
           K  + T KP   +L  +V D LR+D  ++         H V    E    +  +   N  
Sbjct: 38  KHFRSTEKPPAKRLFLIVGDGLRADTTFD------MITHPVTGKTEFLAPYIRSLVLNNA 91

Query: 95  TVTLPRLKGITTGSTPNFLDAILNVAED--DVSSSLKDQDSWLMQFYKHNKNIRFFGDDT 152
           T  +   + + T S P  +  I    ED   V+   K+       F+  + +   FG   
Sbjct: 92  TYGISHTR-MPTESRPGHVAMIAGFYEDVSAVTKGWKENPVDFDSFFNQSSHTYSFGSPD 150

Query: 153 WLKLFPLNIFSEYEGTNSFFVSDFE-------QVDLNVTRHLEKQFKE-----------K 194
            L +F       ++     +  ++E       ++D  V RHL+  F             +
Sbjct: 151 ILPMFKEGATDPHKVDAWMYGHEYEDFTQSSIELDAYVFRHLDSLFHNSTLDSTLDHEIR 210

Query: 195 EQWDVLILHYLGLDHIGH--KGGSQSKFMKGKH-EEMDSILEDIYNSIGDTEDTLLCVXX 251
           ++ +V  LH LG D  GH  +  S   +   K+ +E  SIL D  ++    +DT      
Sbjct: 211 QEGNVFFLHLLGCDTAGHSYRPYSAEYYDNVKYIDEQVSILVDKVHTFFGDDDTAFIFTA 270

Query: 252 XXXXXXXXXXXXXXXXETSAGLTMISKKFKKLAKPKDQINTVLPIKWNENLTEEEK--DY 309
                            T   L        K  K +      +PI   +N TE  K  D 
Sbjct: 271 DHGMSAFGSHGDGHPNNTRTPLVAWGAGLNKPVKNE------VPIY--DNYTESWKLADI 322

Query: 310 KFLSFVQQVDFVPTLSALFNLPMPINSVGVL 340
           K  + V+Q D    +S L     P NSVG L
Sbjct: 323 K-RNDVKQADITSLMSYLIGTNYPANSVGEL 352

>Kwal_33.13856 s33 complement(424296..427064) [2769 bp, 922 aa] {ON}
           YKL165C (MCD4) - (putative) involved in cell polarity
           [contig 108] FULL
          Length = 922

 Score = 33.9 bits (76), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 73/334 (21%), Positives = 110/334 (32%), Gaps = 60/334 (17%)

Query: 43  TTKPVFTKLVFVVIDALRSDFLYEEQNSHFHFVHRVLNSGEAWGFTAFS-----NPPTVT 97
           T  P   +L  +V D LR+D  +E+        H V  SGE      F      N  T  
Sbjct: 43  TEVPPAKRLFLIVGDGLRADTTFEK------ITHPV--SGETAHLAPFIRSLVLNNATYG 94

Query: 98  LPRLKGITTGSTPNFLDAILNVAED--DVSSSLKDQDSWLMQFYKHNKNIRFFGDDTWLK 155
           +   + + T S P  +  I    ED   V+   K+       F+  + +   FG    L 
Sbjct: 95  VSHTR-MPTESRPGHVAMIAGFYEDVSAVTKGWKENPVDFDSFFNQSAHTYSFGSPDILP 153

Query: 156 LFPLNIFSEYEGTNSFFVSDFE-------QVDLNVTRHLEKQFKEK-----------EQW 197
           +F       ++     +  +FE       ++D  V RHL+  F              +  
Sbjct: 154 MFKDGATDPHKVDAWMYGHEFEDFTQSSIELDAFVFRHLDNLFNTSTTNETLRQEITQSG 213

Query: 198 DVLILHYLGLDHIGHKGGSQSKF----MKGKHEEMDSILEDIYNSIGDTEDTLLCVXXXX 253
           +V  LH LG D  GH     S      +K   +E+  ++  + +  GD +DT        
Sbjct: 214 NVFFLHLLGCDTAGHSYRPYSAEYYDNVKYIDQELSKLVVKVRDYFGD-DDTAFIFTADH 272

Query: 254 XXXXXXXXXXXXXXETSAGLTMISKKFKKLAKPKDQINTVLPIKWNENLTE-------EE 306
                          T   L        K  K         P+   +N TE       + 
Sbjct: 273 GMSAFGSHGDGHPNNTRTPLVAWGAGLNKPVKN--------PVPIYDNYTEGWDLATIQR 324

Query: 307 KDYKFLSFVQQVDFVPTLSALFNLPMPINSVGVL 340
            D      V+Q D    +S L     P NSVG L
Sbjct: 325 ND------VKQADIASLMSYLIGANYPANSVGEL 352

>Ecym_8094 Chr8 (200835..203615) [2781 bp, 926 aa] {ON} similar to
           Ashbya gossypii AEL113C
          Length = 926

 Score = 33.1 bits (74), Expect = 3.9,   Method: Compositional matrix adjust.
 Identities = 69/327 (21%), Positives = 112/327 (34%), Gaps = 46/327 (14%)

Query: 43  TTKPVFTKLVFVVIDALRSDFLYEEQNSHFHFVHRVLNSGEAWGFTAF-----SNPPTVT 97
           T +P   +L  +V D LR+D  +++            ++GEA     F      N  T  
Sbjct: 43  TEQPPAKRLFLIVGDGLRADTTFDKITYP--------SAGEAEFLAPFIRSLVMNNATYG 94

Query: 98  LPRLKGITTGSTPNFLDAILNVAED--DVSSSLKDQDSWLMQFYKHNKNIRFFGDDTWLK 155
           +   + + T S P  +  I    ED   V+   K+        +  + +   FG    L 
Sbjct: 95  ISHTR-MPTESRPGHVSMIAGFYEDVSAVTKGWKENPVNFDSVFNQSAHTYSFGSPDILP 153

Query: 156 LFPLNIFSEYEGTNSFFVSDFE-------QVDLNVTRHLEKQFKEK-----------EQW 197
           +F        + +   +  +FE       ++D  V RHL++ F+             +  
Sbjct: 154 MFKDGASDPNKVSAWMYGHEFEDFTQSSIELDAYVFRHLDQLFRNSTVNATLNEEIFQDG 213

Query: 198 DVLILHYLGLDHIGHKGGSQSKF----MKGKHEEMDSILEDIYNSIGDTEDTLLCVXXXX 253
           +V  LH LG D  GH     S      +K   +++  +++ + +  GD +DT        
Sbjct: 214 NVFFLHLLGCDTAGHSYRPYSAEYYDNVKYIDKQISLLVDKVRDFFGD-DDTAFLFTADH 272

Query: 254 XXXXXXXXXXXXXXETSAGLTMISKKFKKLAKPKDQINTVLPIKWNENLTEEEKDYKFLS 313
                          T   L        K  + K       PI  N     E  D K  +
Sbjct: 273 GMSAFGSHGDGHPNNTRTPLVAWGAGLNKPVRNKH------PIHDNYTKNWELSDIK-RN 325

Query: 314 FVQQVDFVPTLSALFNLPMPINSVGVL 340
            V Q D    +S L     P NSVG L
Sbjct: 326 DVNQADIASLMSYLIGANYPANSVGEL 352

>KAFR0C01580 Chr3 (323154..323804) [651 bp, 216 aa] {ON} Anc_3.65
           YOL111C
          Length = 216

 Score = 32.0 bits (71), Expect = 5.0,   Method: Composition-based stats.
 Identities = 24/79 (30%), Positives = 41/79 (51%), Gaps = 4/79 (5%)

Query: 300 ENLTEEEKDYKFLSFVQQVDFVPTLSALFNLPMP-INSVGVLIPELLRLLDPKLTRTKLK 358
           E +++ E   KFL+     +  P +S+ +  P+  + ++GV +P L    +PK TRT  +
Sbjct: 4   EGVSQREFVNKFLTLATLNE--PIISSSYQKPLQDVTTLGVALPALKYKYNPKRTRTTQQ 61

Query: 359 ENFSQL-TELSKSLTTRNI 376
               QL T    SLT ++I
Sbjct: 62  AGAEQLETSTPVSLTLKSI 80

>Skud_11.60 Chr11 complement(124115..126874) [2760 bp, 919 aa] {ON}
           YKL165C (REAL)
          Length = 919

 Score = 32.7 bits (73), Expect = 5.4,   Method: Compositional matrix adjust.
 Identities = 44/200 (22%), Positives = 74/200 (37%), Gaps = 40/200 (20%)

Query: 41  QLTTKPVFTKLVFVVIDALRSDFLYEE------QNSHF--HFVHRVLNSGEAWGFTAFSN 92
           Q T  P   +L  +V D LR+D  +++        + F   F+  ++ +   +G +    
Sbjct: 41  QSTPTPPAKRLFLIVGDGLRADTTFDKVTHPVTGKTEFLAPFIRSLVMNNATYGISHTRM 100

Query: 93  PPTVTLPRLKGITTGSTPNFLDAILNVAED--DVSSSLKDQDSWLMQFYKHNKNIRFFGD 150
           P            T S P  +  I    ED   V+   K        F+  + +   FG 
Sbjct: 101 P------------TESRPGHVAMIAGFYEDVSAVTKGWKSNPVDFDSFFNQSAHTYSFGS 148

Query: 151 DTWLKLF------PLNIFS-EYEGTNSFFVSDFEQVDLNVTRHLEKQFKE---------- 193
              L +F      P  + +  Y+ T   F     ++D  V RHL++ F+           
Sbjct: 149 PDILPMFRDGASDPNKVDTWMYDHTFEDFTQSSIELDAYVFRHLDQLFRNSTLNSTLDYE 208

Query: 194 -KEQWDVLILHYLGLDHIGH 212
            ++  +V  LH LG D  GH
Sbjct: 209 IRQDGNVFFLHLLGCDTAGH 228

>TPHA0B03950 Chr2 (931793..933148) [1356 bp, 451 aa] {ON} Anc_1.454
          Length = 451

 Score = 32.3 bits (72), Expect = 5.9,   Method: Compositional matrix adjust.
 Identities = 18/58 (31%), Positives = 28/58 (48%), Gaps = 5/58 (8%)

Query: 70  SHFHFVHRVLNSGEAWGFTAFSNPPTVTLPRLKGITTGSTPNFLDAILNVAEDDVSSS 127
           +H HF+H+       W +  F+N    T+P   G T G     LD + +  EDD+ +S
Sbjct: 392 THIHFIHKTTGDLTRWLYKGFTNRAMTTIP---GTTIGLI--LLDYMRSKLEDDIITS 444

>TPHA0B01610 Chr2 complement(361146..364658) [3513 bp, 1170 aa] {ON}
           
          Length = 1170

 Score = 32.3 bits (72), Expect = 6.1,   Method: Compositional matrix adjust.
 Identities = 19/45 (42%), Positives = 27/45 (60%), Gaps = 3/45 (6%)

Query: 123 DVSSSLKDQDSWLMQFYKHNKNIRFFGDDTWLKLFPLNIFSEYEG 167
           D+  SL D+D  L+   K+ KNI F G+DT   L PL  F+ ++G
Sbjct: 253 DLIESLFDEDETLL---KYKKNISFNGEDTIYSLTPLEEFTLFDG 294

>KNAG0B05820 Chr2 (1144434..1146164) [1731 bp, 576 aa] {ON}
           Anc_4.195 YGR055W
          Length = 576

 Score = 32.3 bits (72), Expect = 6.3,   Method: Compositional matrix adjust.
 Identities = 25/115 (21%), Positives = 48/115 (41%), Gaps = 14/115 (12%)

Query: 717 GVSEDYNIYFVGWMMSISNYAPAIYWSMFPWIIDDNKQKWKKFIERKNIILLFNCISGLF 776
           G + ++ +  V + M+I N+A ++      W     K +W   I+   + + F  ++ L+
Sbjct: 404 GDAYNFIMNLVSYPMNIINFAISVGLLWIYWQRRQGKLEWNPPIKAGVVAITFFALANLY 463

Query: 777 LLITCTILRYH--------------LFIWSVFSPKLCYYMMWNIFMNVIIGWILE 817
           L++   I   H              +  W VF     YY++WN  +    G+ LE
Sbjct: 464 LIVAPYIPPRHGESVYKSMPYWTHCVVTWGVFGVGAVYYLIWNQILPKRGGYTLE 518

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.324    0.139    0.425 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 85,254,593
Number of extensions: 3776192
Number of successful extensions: 14711
Number of sequences better than 10.0: 64
Number of HSP's gapped: 14727
Number of HSP's successfully gapped: 81
Length of query: 824
Length of database: 53,481,399
Length adjustment: 118
Effective length of query: 706
Effective length of database: 39,950,811
Effective search space: 28205272566
Effective search space used: 28205272566
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.6 bits)
S2: 70 (31.6 bits)