Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
TPHA0O014701.318ON1001004452e-58
TDEL0D018701.318ON1001002603e-30
Kpol_1035.251.318ON1061022527e-29
SAKL0D06952g1.318ON1071072404e-27
Kwal_14.25861.318ON106992301e-25
ZYRO0G20702g1.318ON1401002304e-25
KLLA0F01683g1.318ON98802256e-25
CAGL0I09372g1.318ON1031012171e-23
KLTH0H10714g1.318ON106902153e-23
Ecym_62891.318ON103972127e-23
AEL167C1.318ON101942065e-22
NDAI0B047701.318ON1131132075e-22
KNAG0C017701.318ON1011011962e-20
NCAS0B074401.318ON110791772e-17
YBR268W (MRPL37)1.318ON105971762e-17
Suva_4.5291.318ON105971752e-17
TBLA0F013201.318ON111771753e-17
Smik_2.4111.318ON105971727e-17
KAFR0C042101.318ON101991665e-16
Skud_2.4001.318ON105971632e-15
Suva_4.4288.583ON31234622.5
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= TPHA0O01470
         (100 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

TPHA0O01470 Chr15 complement(295860..296162) [303 bp, 100 aa] {O...   176   2e-58
TDEL0D01870 Chr4 (366206..366508) [303 bp, 100 aa] {ON} Anc_1.31...   104   3e-30
Kpol_1035.25 s1035 complement(60631..60951) [321 bp, 106 aa] {ON...   101   7e-29
SAKL0D06952g Chr4 complement(576023..576346) [324 bp, 107 aa] {O...    97   4e-27
Kwal_14.2586 s14 complement(823777..824097) [321 bp, 106 aa] {ON...    93   1e-25
ZYRO0G20702g Chr7 complement(1705327..1705749) [423 bp, 140 aa] ...    93   4e-25
KLLA0F01683g Chr6 complement(158967..159263) [297 bp, 98 aa] {ON...    91   6e-25
CAGL0I09372g Chr9 (901576..901887) [312 bp, 103 aa] {ON} similar...    88   1e-23
KLTH0H10714g Chr8 complement(924077..924397) [321 bp, 106 aa] {O...    87   3e-23
Ecym_6289 Chr6 (542978..543289) [312 bp, 103 aa] {ON} similar to...    86   7e-23
AEL167C Chr5 complement(322363..322668) [306 bp, 101 aa] {ON} Sy...    84   5e-22
NDAI0B04770 Chr2 complement(1176179..1176520) [342 bp, 113 aa] {...    84   5e-22
KNAG0C01770 Chr3 (349006..349311) [306 bp, 101 aa] {ON} Anc_1.31...    80   2e-20
NCAS0B07440 Chr2 complement(1405363..1405695) [333 bp, 110 aa] {...    73   2e-17
YBR268W Chr2 (741299..741616) [318 bp, 105 aa] {ON}  MRPL37Mitoc...    72   2e-17
Suva_4.529 Chr4 (912965..913282) [318 bp, 105 aa] {ON} YBR268W (...    72   2e-17
TBLA0F01320 Chr6 complement(332337..332672) [336 bp, 111 aa] {ON...    72   3e-17
Smik_2.411 Chr2 (727356..727673) [318 bp, 105 aa] {ON} YBR268W (...    71   7e-17
KAFR0C04210 Chr3 (839148..839453) [306 bp, 101 aa] {ON} Anc_1.31...    69   5e-16
Skud_2.400 Chr2 (710286..710603) [318 bp, 105 aa] {ON} YBR268W (...    67   2e-15
Suva_4.428 Chr4 (753224..754162) [939 bp, 312 aa] {ON} YBR176W (...    28   2.5  

>TPHA0O01470 Chr15 complement(295860..296162) [303 bp, 100 aa] {ON}
           Anc_1.318 YBR268W
          Length = 100

 Score =  176 bits (445), Expect = 2e-58,   Method: Compositional matrix adjust.
 Identities = 87/100 (87%), Positives = 87/100 (87%)

Query: 1   MISVFAKRFFSRGSILLQESQANVLKSSCKAGTPLQINVLKTGKDPIALEDSEYPPWLWT 60
           MISVFAKRFFSRGSILLQESQANVLKSSCKAGTPLQINVLKTGKDPIALEDSEYPPWLWT
Sbjct: 1   MISVFAKRFFSRGSILLQESQANVLKSSCKAGTPLQINVLKTGKDPIALEDSEYPPWLWT 60

Query: 61  VLDKGAQAARLENDPXXXXXXXXXXXXXANIKQNNFLKQI 100
           VLDKGAQAARLENDP             ANIKQNNFLKQI
Sbjct: 61  VLDKGAQAARLENDPLKLRRKELRRKNRANIKQNNFLKQI 100

>TDEL0D01870 Chr4 (366206..366508) [303 bp, 100 aa] {ON} Anc_1.318
           YBR268W
          Length = 100

 Score =  104 bits (260), Expect = 3e-30,   Method: Compositional matrix adjust.
 Identities = 50/100 (50%), Positives = 62/100 (62%)

Query: 1   MISVFAKRFFSRGSILLQESQANVLKSSCKAGTPLQINVLKTGKDPIALEDSEYPPWLWT 60
           M     KR FS   + LQE+ + ++KSSC AGT L +NV K+GKDP+ALEDSEYP WLW 
Sbjct: 1   MFRFVPKRLFSNCRVFLQETPSTIVKSSCPAGTVLSVNVKKSGKDPVALEDSEYPAWLWE 60

Query: 61  VLDKGAQAARLENDPXXXXXXXXXXXXXANIKQNNFLKQI 100
           VLD  A+A +L  DP               IKQNNFL+Q+
Sbjct: 61  VLDPEARARKLAEDPMKLRKKQIRKANRMQIKQNNFLQQL 100

>Kpol_1035.25 s1035 complement(60631..60951) [321 bp, 106 aa] {ON}
           complement(60631..60951) [321 nt, 107 aa]
          Length = 106

 Score =  101 bits (252), Expect = 7e-29,   Method: Compositional matrix adjust.
 Identities = 52/102 (50%), Positives = 63/102 (61%), Gaps = 5/102 (4%)

Query: 4   VFAKRFFSRGSILLQES-----QANVLKSSCKAGTPLQINVLKTGKDPIALEDSEYPPWL 58
           +F KR  S   +L QE+     Q+  ++SSC AG+ L +N+ K GKDP+ALED+EYP WL
Sbjct: 5   IFQKRLLSSSRLLWQETVKTSGQSLKIQSSCPAGSVLTLNIKKAGKDPVALEDAEYPTWL 64

Query: 59  WTVLDKGAQAARLENDPXXXXXXXXXXXXXANIKQNNFLKQI 100
           WTVLDK AQA  L  DP              NIKQNNFLKQI
Sbjct: 65  WTVLDKEAQAEALSKDPLALRKKKLRQANRKNIKQNNFLKQI 106

>SAKL0D06952g Chr4 complement(576023..576346) [324 bp, 107 aa] {ON}
           similar to uniprot|P36532 Saccharomyces cerevisiae
           YBR268W MRPL37 Mitochondrial ribosomal protein of the
           large subunit
          Length = 107

 Score = 97.1 bits (240), Expect = 4e-27,   Method: Compositional matrix adjust.
 Identities = 50/107 (46%), Positives = 64/107 (59%), Gaps = 7/107 (6%)

Query: 1   MISVF---AKRFFSRGSILLQESQANV----LKSSCKAGTPLQINVLKTGKDPIALEDSE 53
           M+S F   ++RF S   I LQ+  A      +KSSC AGTPL + + K+GK+ +ALED E
Sbjct: 1   MLSSFHLASRRFLSTTRITLQQQAATATVSKVKSSCPAGTPLNLQIKKSGKETVALEDHE 60

Query: 54  YPPWLWTVLDKGAQAARLENDPXXXXXXXXXXXXXANIKQNNFLKQI 100
           YP WLWTVLD+ AQ+A+L  DP               IKQNNFL +I
Sbjct: 61  YPEWLWTVLDEKAQSAKLAQDPAKLKKKQLRKMNREKIKQNNFLTKI 107

>Kwal_14.2586 s14 complement(823777..824097) [321 bp, 106 aa] {ON}
           YBR268W (MRPL37) - Probable mitochondrial protein L37
           [contig 224] FULL
          Length = 106

 Score = 93.2 bits (230), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 47/99 (47%), Positives = 61/99 (61%), Gaps = 2/99 (2%)

Query: 4   VFAKRFFSRGSILLQESQANV--LKSSCKAGTPLQINVLKTGKDPIALEDSEYPPWLWTV 61
           +  K+ FS  S LLQ  + +V  +KSSC AGTPL + + K+GK+P+ALED EYP WLW+V
Sbjct: 8   LVVKKPFSTFSALLQSQKGSVSGIKSSCIAGTPLNLQIKKSGKEPVALEDHEYPEWLWSV 67

Query: 62  LDKGAQAARLENDPXXXXXXXXXXXXXANIKQNNFLKQI 100
           LD  AQ  +L+ DP               IKQNNFL +I
Sbjct: 68  LDDKAQLKKLQEDPLKLRKKQLRSANRQKIKQNNFLSEI 106

>ZYRO0G20702g Chr7 complement(1705327..1705749) [423 bp, 140 aa]
           {ON} similar to uniprot|P36532 Saccharomyces cerevisiae
           YBR268W MRPL37 Mitochondrial ribosomal protein of the
           large subunit
          Length = 140

 Score = 93.2 bits (230), Expect = 4e-25,   Method: Compositional matrix adjust.
 Identities = 47/100 (47%), Positives = 60/100 (60%), Gaps = 5/100 (5%)

Query: 1   MISVFAKRFFSRGSILLQESQANVLKSSCKAGTPLQINVLKTGKDPIALEDSEYPPWLWT 60
           ++ +F +RF S   +L Q      +KSSC AGT + +N  K+GKDP+ALED+EYP WLW 
Sbjct: 46  LLRLFPRRFVSTSPVLGQ-----AVKSSCPAGTIINVNTKKSGKDPVALEDNEYPDWLWE 100

Query: 61  VLDKGAQAARLENDPXXXXXXXXXXXXXANIKQNNFLKQI 100
           VLD  AQ  +L+ DP               IKQNNFLKQI
Sbjct: 101 VLDPEAQMKKLQADPMKLRKKQLRKDNREKIKQNNFLKQI 140

>KLLA0F01683g Chr6 complement(158967..159263) [297 bp, 98 aa] {ON}
           similar to uniprot|P36532 Saccharomyces cerevisiae
           YBR268W MRPL37 Mitochondrial ribosomal protein of the
           large subunit
          Length = 98

 Score = 91.3 bits (225), Expect = 6e-25,   Method: Compositional matrix adjust.
 Identities = 44/80 (55%), Positives = 52/80 (65%)

Query: 21  QANVLKSSCKAGTPLQINVLKTGKDPIALEDSEYPPWLWTVLDKGAQAARLENDPXXXXX 80
           QA  + SSC AGTPL + + K+GK+P+ALEDSEYP WLWTVLD   QA +L  DP     
Sbjct: 19  QAAKIVSSCPAGTPLNLQIKKSGKEPVALEDSEYPEWLWTVLDANVQAEKLAADPIKLRK 78

Query: 81  XXXXXXXXANIKQNNFLKQI 100
                   ANIKQNNFL +I
Sbjct: 79  KQLRIANRANIKQNNFLAKI 98

>CAGL0I09372g Chr9 (901576..901887) [312 bp, 103 aa] {ON} similar to
           uniprot|P36532 Saccharomyces cerevisiae YBR268w MRPL37
          Length = 103

 Score = 88.2 bits (217), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 48/101 (47%), Positives = 57/101 (56%), Gaps = 6/101 (5%)

Query: 4   VFAKRFFSRGSILLQESQANVLKSSCKAGTPLQINVLKTGKDPIALEDSEYPPWLWTVLD 63
           +F KR  S   +L  E  A  +KSSC AGTPL +NV KTGKDP+ALEDSEYP WLWTVLD
Sbjct: 5   LFTKRLLSSSVVLRNE--AKQIKSSCLAGTPLSLNVKKTGKDPVALEDSEYPEWLWTVLD 62

Query: 64  K----GAQAARLENDPXXXXXXXXXXXXXANIKQNNFLKQI 100
           +     A  A +  +                IKQ NFL Q+
Sbjct: 63  QTNTAAAAKAPVSEESLKARKKQIRQSNREKIKQRNFLNQL 103

>KLTH0H10714g Chr8 complement(924077..924397) [321 bp, 106 aa] {ON}
           similar to uniprot|P36532 Saccharomyces cerevisiae
           YBR268W MRPL37 Mitochondrial ribosomal protein of the
           large subunit
          Length = 106

 Score = 87.4 bits (215), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 42/90 (46%), Positives = 55/90 (61%)

Query: 11  SRGSILLQESQANVLKSSCKAGTPLQINVLKTGKDPIALEDSEYPPWLWTVLDKGAQAAR 70
           SR +   Q++  + + SSC AGTPL + + K+GK+P+ALED EYP WLWTVLD  AQ  +
Sbjct: 17  SRATFQGQKASPSGVVSSCPAGTPLNLQIKKSGKEPVALEDHEYPEWLWTVLDSRAQLKK 76

Query: 71  LENDPXXXXXXXXXXXXXANIKQNNFLKQI 100
           L+ DP               IKQNNFL +I
Sbjct: 77  LQEDPLKLRKKQLRSANRNKIKQNNFLSEI 106

>Ecym_6289 Chr6 (542978..543289) [312 bp, 103 aa] {ON} similar to
           Ashbya gossypii AEL167C
          Length = 103

 Score = 86.3 bits (212), Expect = 7e-23,   Method: Compositional matrix adjust.
 Identities = 42/97 (43%), Positives = 55/97 (56%)

Query: 4   VFAKRFFSRGSILLQESQANVLKSSCKAGTPLQINVLKTGKDPIALEDSEYPPWLWTVLD 63
           +  KR  S    L ++  +  + SSC AGTPL + + KTGK+P+AL +SEYP WLW VLD
Sbjct: 7   IINKRLISTTLRLAEQKGSKAIISSCPAGTPLNLQIKKTGKEPVALHESEYPEWLWGVLD 66

Query: 64  KGAQAARLENDPXXXXXXXXXXXXXANIKQNNFLKQI 100
              +AA+L  DP               IKQNNFL +I
Sbjct: 67  PQVEAAKLNEDPFAARKKQLRKMNREKIKQNNFLSRI 103

>AEL167C Chr5 complement(322363..322668) [306 bp, 101 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YBR268W
           (MRPL37)
          Length = 101

 Score = 84.0 bits (206), Expect = 5e-22,   Method: Compositional matrix adjust.
 Identities = 44/94 (46%), Positives = 56/94 (59%), Gaps = 1/94 (1%)

Query: 7   KRFFSRGSILLQESQANVLKSSCKAGTPLQINVLKTGKDPIALEDSEYPPWLWTVLDKGA 66
           +R FS  S  + + QA    SSC AGTPL + + K GK+P+ALEDS+YP WLW VLD  A
Sbjct: 9   RRLFS-VSCRVYDQQAQKAVSSCPAGTPLNLLIKKGGKEPLALEDSDYPEWLWKVLDPEA 67

Query: 67  QAARLENDPXXXXXXXXXXXXXANIKQNNFLKQI 100
           QAA+L  DP              +IKQ NFL ++
Sbjct: 68  QAAKLAEDPIKARKKALRRMNREHIKQQNFLAKM 101

>NDAI0B04770 Chr2 complement(1176179..1176520) [342 bp, 113 aa] {ON}
           Anc_1.318 YBR268W
          Length = 113

 Score = 84.3 bits (207), Expect = 5e-22,   Method: Compositional matrix adjust.
 Identities = 47/113 (41%), Positives = 60/113 (53%), Gaps = 13/113 (11%)

Query: 1   MISVFAKRFFS------RGSILLQESQANVLKSSCKAGTPLQINVLKTGKDPIALEDSEY 54
           M+ +F KR FS         + +  + A+ +KSSC AGTPL +N+ KTGK+PIALED EY
Sbjct: 1   MLRLFVKRSFSTSIKVLNAEVKVASTIASEIKSSCLAGTPLNLNIKKTGKEPIALEDKEY 60

Query: 55  PPWLWTVLDKGAQAARLEN-------DPXXXXXXXXXXXXXANIKQNNFLKQI 100
           P WLWTVLD      R ++       +                IKQNNFL QI
Sbjct: 61  PEWLWTVLDTKTANGRAKSGKGTSVEESLLARKRQLRVETRKKIKQNNFLSQI 113

>KNAG0C01770 Chr3 (349006..349311) [306 bp, 101 aa] {ON} Anc_1.318
           YBR268W
          Length = 101

 Score = 80.1 bits (196), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 38/101 (37%), Positives = 54/101 (53%), Gaps = 1/101 (0%)

Query: 1   MISVFAKRFFSRGSILLQESQANVLKSSCKAGTPLQINVLKTGKDPIALEDSEYPPWLWT 60
           M     +R +  G +L Q +Q   +KSSC AGTPL++++ K G+DP+A+ D EYP WLW 
Sbjct: 1   MWRFVQRRMWHGGRVLGQTAQGPAVKSSCLAGTPLKLDIRKDGRDPVAMRDEEYPEWLWH 60

Query: 61  VLDKGAQA-ARLENDPXXXXXXXXXXXXXANIKQNNFLKQI 100
           VL+      A    DP               IKQ+N+L Q+
Sbjct: 61  VLEPATGGDASARADPLAARRKELRRKHRNEIKQSNYLSQL 101

>NCAS0B07440 Chr2 complement(1405363..1405695) [333 bp, 110 aa] {ON}
           Anc_1.318 YBR268W
          Length = 110

 Score = 72.8 bits (177), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 39/79 (49%), Positives = 48/79 (60%), Gaps = 3/79 (3%)

Query: 25  LKSSCKAGTPLQINVLKTGKDPIALEDSEYPPWLWTVLDKGA--QAARL-ENDPXXXXXX 81
           +KSSC AGT L +N+ K GKDPIALED+EYP WLW VL+  A  +A+ L E +       
Sbjct: 31  IKSSCLAGTSLNLNIKKNGKDPIALEDNEYPAWLWKVLESKAPKEASDLSEQEVLAMRKK 90

Query: 82  XXXXXXXANIKQNNFLKQI 100
                    IKQNNFL Q+
Sbjct: 91  QLRKENRKKIKQNNFLSQL 109

>YBR268W Chr2 (741299..741616) [318 bp, 105 aa] {ON}
           MRPL37Mitochondrial ribosomal protein of the large
           subunit
          Length = 105

 Score = 72.4 bits (176), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 41/97 (42%), Positives = 49/97 (50%), Gaps = 4/97 (4%)

Query: 8   RFFSRGSILLQESQANVLKSSCKAGTPLQINVLKTGKDPIALEDSEYPPWLWTVLDKGAQ 67
           R  S   IL  +     + SSC AGT L +N+ K+GKD +ALED EYP WLW+VLD    
Sbjct: 9   RLISTSRILYNKPTVKSVVSSCPAGTSLNLNIWKSGKDAVALEDKEYPNWLWSVLDSDHV 68

Query: 68  AARLENDPX-XXXXXXXXXXXXAN---IKQNNFLKQI 100
                 DP              AN   IKQNNFL Q+
Sbjct: 69  VEHAAEDPEGQALLKRRKNIRKANRQRIKQNNFLSQL 105

>Suva_4.529 Chr4 (912965..913282) [318 bp, 105 aa] {ON} YBR268W
           (REAL)
          Length = 105

 Score = 72.0 bits (175), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 40/97 (41%), Positives = 49/97 (50%), Gaps = 4/97 (4%)

Query: 8   RFFSRGSILLQESQANVLKSSCKAGTPLQINVLKTGKDPIALEDSEYPPWLWTVLDKGAQ 67
           R+ S   +   +    V+ SSC AGT L +N+ K+GKD  ALED EYP WLW+VLD    
Sbjct: 9   RWLSTSRVFYNKQAVKVVASSCPAGTSLNLNIWKSGKDAQALEDREYPSWLWSVLDAKQA 68

Query: 68  AARLENDPX-XXXXXXXXXXXXAN---IKQNNFLKQI 100
                 DP              AN   IKQNNFL Q+
Sbjct: 69  VDHAAKDPEGEALSQRKKNIRKANRQQIKQNNFLSQL 105

>TBLA0F01320 Chr6 complement(332337..332672) [336 bp, 111 aa] {ON}
           Anc_1.318 YBR268W
          Length = 111

 Score = 72.0 bits (175), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 35/77 (45%), Positives = 44/77 (57%)

Query: 24  VLKSSCKAGTPLQINVLKTGKDPIALEDSEYPPWLWTVLDKGAQAARLENDPXXXXXXXX 83
            +KSSC AGT L++NV K GKDP+ALED +YPPWLW++L           +         
Sbjct: 34  AIKSSCPAGTELRLNVYKDGKDPVALEDEKYPPWLWSILTPSNNKNPSPMEAIAQRKKVL 93

Query: 84  XXXXXANIKQNNFLKQI 100
                  IKQNNFLKQ+
Sbjct: 94  RKNNRDRIKQNNFLKQL 110

>Smik_2.411 Chr2 (727356..727673) [318 bp, 105 aa] {ON} YBR268W
           (REAL)
          Length = 105

 Score = 70.9 bits (172), Expect = 7e-17,   Method: Compositional matrix adjust.
 Identities = 39/97 (40%), Positives = 49/97 (50%), Gaps = 4/97 (4%)

Query: 8   RFFSRGSILLQESQANVLKSSCKAGTPLQINVLKTGKDPIALEDSEYPPWLWTVLDKGAQ 67
           RF S   +L  +     + SSC AGT L +N+ K+GKD +ALED EYP WLW +L+    
Sbjct: 9   RFISTSRVLFNKPAVKSVVSSCPAGTSLNLNIWKSGKDAVALEDKEYPNWLWGILNNEQT 68

Query: 68  AARLENDPX-XXXXXXXXXXXXAN---IKQNNFLKQI 100
                 DP              AN   IKQNNFL Q+
Sbjct: 69  VEHTTKDPEGEALLKRRKNIRKANRQRIKQNNFLSQL 105

>KAFR0C04210 Chr3 (839148..839453) [306 bp, 101 aa] {ON} Anc_1.318
           YBR268W
          Length = 101

 Score = 68.6 bits (166), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 38/99 (38%), Positives = 55/99 (55%), Gaps = 4/99 (4%)

Query: 5   FAKRFFSRGSILLQESQANVLKSSCKAGTPLQINVLKTGKDPIALEDSEYPPWLWTVLDK 64
            ++RFFS    +LQ ++  +L SSC  GTPL++ V K  K P+AL+D EYP WLW+VL++
Sbjct: 4   LSRRFFSHSRSVLQSTKC-LLVSSCPEGTPLKLGVRKGQKPPLALKDEEYPGWLWSVLNE 62

Query: 65  GAQAARLENDPXXXXXXXXXXXXXAN---IKQNNFLKQI 100
            +   + E  P              N   IKQ NFL ++
Sbjct: 63  ESANTQKELSPIQELELRRKQLRKLNRDKIKQKNFLSEL 101

>Skud_2.400 Chr2 (710286..710603) [318 bp, 105 aa] {ON} YBR268W
           (REAL)
          Length = 105

 Score = 67.4 bits (163), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 35/97 (36%), Positives = 48/97 (49%), Gaps = 4/97 (4%)

Query: 8   RFFSRGSILLQESQANVLKSSCKAGTPLQINVLKTGKDPIALEDSEYPPWLWTVLDKGAQ 67
           R+ S   +L  +     + SSC AGT L +N+ K+GKD +ALE+ EYP WLW+VLD    
Sbjct: 9   RWISTSRVLYNKQAVKTVVSSCPAGTSLNLNIWKSGKDALALEEKEYPSWLWSVLDNKQD 68

Query: 68  AARL----ENDPXXXXXXXXXXXXXANIKQNNFLKQI 100
                   E +                IKQ+NFL Q+
Sbjct: 69  VEHAGQDQEGEALLKRRKNIRKANRQRIKQSNFLSQL 105

>Suva_4.428 Chr4 (753224..754162) [939 bp, 312 aa] {ON} YBR176W
          (REAL)
          Length = 312

 Score = 28.5 bits (62), Expect = 2.5,   Method: Composition-based stats.
 Identities = 12/34 (35%), Positives = 21/34 (61%)

Query: 4  VFAKRFFSRGSILLQESQANVLKSSCKAGTPLQI 37
          VF+KRF+S   I+ +++    ++    AGTPL +
Sbjct: 10 VFSKRFYSSTKIVPKQNTIQDVRDKYNAGTPLSM 43

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.316    0.132    0.386 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 8,738,127
Number of extensions: 280344
Number of successful extensions: 514
Number of sequences better than 10.0: 22
Number of HSP's gapped: 507
Number of HSP's successfully gapped: 22
Length of query: 100
Length of database: 53,481,399
Length adjustment: 71
Effective length of query: 29
Effective length of database: 45,340,113
Effective search space: 1314863277
Effective search space used: 1314863277
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 59 (27.3 bits)