Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
TPHA0O014601.319ON72172137020.0
Kpol_1035.241.319ON71772213551e-177
ZYRO0G20680g1.319ON6927169211e-113
YJL061W (NUP82)1.319ON7137218961e-109
KAFR0A017201.319ON7166968771e-106
Smik_10.1791.319ON7137218681e-105
Suva_6.1371.319ON7187248501e-102
TDEL0D018801.319ON6917188361e-101
NDAI0G057501.319ON7347348361e-100
Skud_10.1581.319ON7167058341e-100
NCAS0A092101.319ON7107278321e-100
SAKL0D06930g1.319ON6907228113e-97
TBLA0F013101.319ON7427318041e-95
KNAG0C058401.319ON7477187822e-92
KLTH0H10692g1.319ON6917256102e-68
CAGL0J05214g1.319ON7167205912e-65
Kwal_14.25801.319ON6877315812e-64
Ecym_62901.319ON6716034456e-46
AEL168C1.319ON6737354093e-41
KLLA0F01661g1.319ON6877293962e-39
Suva_6.2451.182ON39479715.5
Smik_13.3976.281ON725161709.6
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= TPHA0O01460
         (721 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

TPHA0O01460 Chr15 complement(293395..295560) [2166 bp, 721 aa] {...  1430   0.0  
Kpol_1035.24 s1035 complement(57897..60050) [2154 bp, 717 aa] {O...   526   e-177
ZYRO0G20680g Chr7 complement(1703031..1705109) [2079 bp, 692 aa]...   359   e-113
YJL061W Chr10 (320016..322157) [2142 bp, 713 aa] {ON}  NUP82Link...   349   e-109
KAFR0A01720 Chr1 complement(349779..351929) [2151 bp, 716 aa] {O...   342   e-106
Smik_10.179 Chr10 (311844..313985) [2142 bp, 713 aa] {ON} YJL061...   338   e-105
Suva_6.137 Chr6 complement(228953..231109) [2157 bp, 718 aa] {ON...   332   e-102
TDEL0D01880 Chr4 (366715..368790) [2076 bp, 691 aa] {ON} Anc_1.3...   326   e-101
NDAI0G05750 Chr7 (1424856..1427060) [2205 bp, 734 aa] {ON} Anc_1...   326   e-100
Skud_10.158 Chr10 complement(296754..298904) [2151 bp, 716 aa] {...   325   e-100
NCAS0A09210 Chr1 complement(1820713..1822845) [2133 bp, 710 aa] ...   325   e-100
SAKL0D06930g Chr4 complement(573700..575772) [2073 bp, 690 aa] {...   317   3e-97
TBLA0F01310 Chr6 complement(329569..331797) [2229 bp, 742 aa] {O...   314   1e-95
KNAG0C05840 Chr3 (1135516..1137759) [2244 bp, 747 aa] {ON} Anc_1...   305   2e-92
KLTH0H10692g Chr8 complement(921787..923862) [2076 bp, 691 aa] {...   239   2e-68
CAGL0J05214g Chr10 complement(501919..504069) [2151 bp, 716 aa] ...   232   2e-65
Kwal_14.2580 s14 complement(821497..823560) [2064 bp, 687 aa] {O...   228   2e-64
Ecym_6290 Chr6 (543547..545562) [2016 bp, 671 aa] {ON} similar t...   176   6e-46
AEL168C Chr5 complement(320121..322142) [2022 bp, 673 aa] {ON} S...   162   3e-41
KLLA0F01661g Chr6 complement(156609..158672) [2064 bp, 687 aa] {...   157   2e-39
Suva_6.245 Chr6 (438131..439315) [1185 bp, 394 aa] {ON} YJL164C ...    32   5.5  
Smik_13.397 Chr13 (631479..633656) [2178 bp, 725 aa] {ON} YMR192...    32   9.6  

>TPHA0O01460 Chr15 complement(293395..295560) [2166 bp, 721 aa] {ON}
           Anc_1.319 YJL061W
          Length = 721

 Score = 1430 bits (3702), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 706/721 (97%), Positives = 706/721 (97%)

Query: 1   MVSPQLHTIFNRFSVGKVSSKRSSITVDNGLKIILYQNNTVRYGFVNDADGNFKSITLEK 60
           MVSPQLHTIFNRFSVGKVSSKRSSITVDNGLKIILYQNNTVRYGFVNDADGNFKSITLEK
Sbjct: 1   MVSPQLHTIFNRFSVGKVSSKRSSITVDNGLKIILYQNNTVRYGFVNDADGNFKSITLEK 60

Query: 61  EMIGDVSIIADQIGNYLCLFNEFEIRVIELPWKLWDAKEDSSFQLDNMVQIRSYDLKSFG 120
           EMIGDVSIIADQIGNYLCLFNEFEIRVIELPWKLWDAKEDSSFQLDNMVQIRSYDLKSFG
Sbjct: 61  EMIGDVSIIADQIGNYLCLFNEFEIRVIELPWKLWDAKEDSSFQLDNMVQIRSYDLKSFG 120

Query: 121 TTIQKILFHPLGLAYPCLVVLLKNSNICSIDIKRILKVEEIPSTCITTFHTKGVMGLXXX 180
           TTIQKILFHPLGLAYPCLVVLLKNSNICSIDIKRILKVEEIPSTCITTFHTKGVMGL   
Sbjct: 121 TTIQKILFHPLGLAYPCLVVLLKNSNICSIDIKRILKVEEIPSTCITTFHTKGVMGLSSC 180

Query: 181 XXXXXXXXXXXXKLSLYALTETDIYLFYPFLIPTISVTKNEIDQLFQKSIILFENLENDS 240
                       KLSLYALTETDIYLFYPFLIPTISVTKNEIDQLFQKSIILFENLENDS
Sbjct: 181 IDDIIDISFSSDKLSLYALTETDIYLFYPFLIPTISVTKNEIDQLFQKSIILFENLENDS 240

Query: 241 SEAVRRNIIKQLQLLSTLSGDIKTQMKQVKNTDETKIYNIDINTEYRSVNAQGSFSIAPF 300
           SEAVRRNIIKQLQLLSTLSGDIKTQMKQVKNTDETKIYNIDINTEYRSVNAQGSFSIAPF
Sbjct: 241 SEAVRRNIIKQLQLLSTLSGDIKTQMKQVKNTDETKIYNIDINTEYRSVNAQGSFSIAPF 300

Query: 301 PEELYKQSAVNLSVIQIGHGNELYVITYDDGTVLILYRDLESSMSWDSNDYTFNNSFILL 360
           PEELYKQSAVNLSVIQIGHGNELYVITYDDGTVLILYRDLESSMSWDSNDYTFNNSFILL
Sbjct: 301 PEELYKQSAVNLSVIQIGHGNELYVITYDDGTVLILYRDLESSMSWDSNDYTFNNSFILL 360

Query: 361 EKLKFNPDETKSILDIPFKNGIFAIAGDQTVNLIDTSCWSDILSQCIKDNDIRNLAGLSI 420
           EKLKFNPDETKSILDIPFKNGIFAIAGDQTVNLIDTSCWSDILSQCIKDNDIRNLAGLSI
Sbjct: 361 EKLKFNPDETKSILDIPFKNGIFAIAGDQTVNLIDTSCWSDILSQCIKDNDIRNLAGLSI 420

Query: 421 ESHKQTINTLEEPNSCILWNEHNKKELLFITETKLISSDILESNNESAEKLPVPAINDIK 480
           ESHKQTINTLEEPNSCILWNEHNKKELLFITETKLISSDILESNNESAEKLPVPAINDIK
Sbjct: 421 ESHKQTINTLEEPNSCILWNEHNKKELLFITETKLISSDILESNNESAEKLPVPAINDIK 480

Query: 481 KIEKLQLKNYSQPIKEINIAVQRYKDSCKVPYSKVIPANIRQKPFANDENEDQLAYITEI 540
           KIEKLQLKNYSQPIKEINIAVQRYKDSCKVPYSKVIPANIRQKPFANDENEDQLAYITEI
Sbjct: 481 KIEKLQLKNYSQPIKEINIAVQRYKDSCKVPYSKVIPANIRQKPFANDENEDQLAYITEI 540

Query: 541 SQEIGSKILQGQTIALMMHTRLREQQDVFAEQLMHTNKELLHNKTIKQTYDIQSTKIKHI 600
           SQEIGSKILQGQTIALMMHTRLREQQDVFAEQLMHTNKELLHNKTIKQTYDIQSTKIKHI
Sbjct: 541 SQEIGSKILQGQTIALMMHTRLREQQDVFAEQLMHTNKELLHNKTIKQTYDIQSTKIKHI 600

Query: 601 TERNTKLNERTSKLIEMMEKIKQSQQYKNMPINDSESKLFKEIKKQVLIFNDAVNRQQEQ 660
           TERNTKLNERTSKLIEMMEKIKQSQQYKNMPINDSESKLFKEIKKQVLIFNDAVNRQQEQ
Sbjct: 601 TERNTKLNERTSKLIEMMEKIKQSQQYKNMPINDSESKLFKEIKKQVLIFNDAVNRQQEQ 660

Query: 661 QEAIKFLQTELNNIIEQPAQSHDAIIDSDEDEWNELCDLLNRDAKIIEDCNAELSSASGL 720
           QEAIKFLQTELNNIIEQPAQSHDAIIDSDEDEWNELCDLLNRDAKIIEDCNAELSSASGL
Sbjct: 661 QEAIKFLQTELNNIIEQPAQSHDAIIDSDEDEWNELCDLLNRDAKIIEDCNAELSSASGL 720

Query: 721 I 721
           I
Sbjct: 721 I 721

>Kpol_1035.24 s1035 complement(57897..60050) [2154 bp, 717 aa] {ON}
           complement(57897..60050) [2154 nt, 718 aa]
          Length = 717

 Score =  526 bits (1355), Expect = e-177,   Method: Compositional matrix adjust.
 Identities = 276/722 (38%), Positives = 459/722 (63%), Gaps = 22/722 (3%)

Query: 2   VSPQLHTIFNRFSVGKVSSKRSSITVDNGLKIILYQNNTVRYGFVNDADGNFKSITLEKE 61
           +S +L+ IF R SV +  +KR   + +NG +IIL+Q++T+R+ F +D D +++S+ L   
Sbjct: 1   MSFELNPIFKRPSVSRELTKRFFFSANNGTRIILFQDSTIRWSFSSDND-HYQSMALRDS 59

Query: 62  MIGDVSIIADQIGNYLCLFNEFEIRVIELPWKLWDAKEDSSFQLDNMVQIRSYDLKSFGT 121
            +     I    G+YLCL+N  +IRVIE+PW L +  E S+  + + +Q R Y+      
Sbjct: 60  DMDVTGAIISDPGDYLCLYNSHQIRVIEIPWGLTNVDEISN-SMASSLQERVYNFNEDKL 118

Query: 122 TIQKILFHPLGLAYPCLVVLLKNSNICSIDIKRILKVEEIPSTCITTFHTKGVMGLXXXX 181
           +++++LFHPL  + P LVVL   S I  +D+K + K  +IP  C        VMG+    
Sbjct: 119 SVKQVLFHPLSKSSPFLVVLFSGSQIAFVDLKNVFKSSDIPIDCFLNLTDSNVMGIDNRV 178

Query: 182 XXXXXXXXXXXKLSLYALTETDIYLFYPFLIPTISVTKNEIDQLFQKSIILFENLENDSS 241
                       LSLY+LT+TD+Y FYP L P  S++KN +D+L  KSI+L+ENL  D+ 
Sbjct: 179 ENIQYVVFADDCLSLYSLTDTDVYCFYPCLPPVASLSKNRVDELINKSIVLYENLGIDAD 238

Query: 242 EAVRRNIIKQLQLLSTLSGDIKTQMKQVKNTDETKIYNIDINTEYRSVNAQGSFSIAPFP 301
           + VR+N+IKQLQL S+L    + ++++ +N +     N++I+ E+R   AQG FSI+P+P
Sbjct: 239 DIVRKNVIKQLQLASSL----RKKIEEFENANGEVEVNVEIDLEFRQTKAQGYFSISPYP 294

Query: 302 EELYKQSAVNLSVIQIGHGNELYVITYDDGTVLILYRDLESSMSWDSNDYTFNNSFILLE 361
           E LY  +   +SV+ IG GNEL+++++D+GTVL++++D ES+MSWD NDY+FNNSF L+E
Sbjct: 295 ESLYTCTGKQISVLPIGEGNELFLVSFDNGTVLVVFKDKESTMSWDVNDYSFNNSFTLVE 354

Query: 362 KLKFNPDETKSILDIPFKNGIFAIAGDQTVNLIDTSCWSDILSQCIKDNDIRNLAGLSIE 421
            +KF P+E  +++ +  + G F ++G+++  L+DT+ WS ++S+CI+DND+R L GL ++
Sbjct: 355 IIKFKPEELSNMVVLQGELGKFVVSGEKSTILVDTTKWSSVISKCIRDNDLRPLVGLEMK 414

Query: 422 SHKQTINTLEEPNSCILWNEHNKKELLFITETKLISSDI----LESNNESAEKLPVPAIN 477
           S    IN+  + NSC +WN    K LL +    ++   +    +E   ESAE++      
Sbjct: 415 STITHINSDMQINSCGIWNSGEAKSLLLVDTNVVVGYQLFKKEVEFKPESAEEIST---- 470

Query: 478 DIKKIEKLQLKNYSQPIKEINIAVQRYKDSCKVPYSKVIPANIRQKPFANDENEDQLAYI 537
              ++E   L  ++ P  E+  A  +++++  VPYSKVIPANI+Q PF ++  E+QL  +
Sbjct: 471 ---ELENFTLDKFTVPENELKAANYKFQEAVSVPYSKVIPANIKQVPFGSNAMEEQLKIL 527

Query: 538 TEISQEIGSKILQGQTIALMMHTRLREQQDVFAEQLMHTNKELLHNKTIKQTYDIQSTKI 597
            +IS+++GSKI+QGQ++ LM++ RL EQQD  +EQL+ TNK L+  K ++  Y  Q +K+
Sbjct: 528 NDISRDVGSKIVQGQSLGLMLYDRLLEQQDKLSEQLIITNKILIRAKKVQGDYPAQLSKL 587

Query: 598 KHITERNTKLNERTSKLIEMMEKIKQSQQYKNMPINDSESKLFKEIKKQVLIFNDAVNRQ 657
               ++   L +   K+   +  I++SQ+ K++P+++ E +LFKE++ Q+L+FN+ V++Q
Sbjct: 588 DEKLKKQEHLEKILLKMESNLNTIQESQKLKSLPLSEKEIQLFKELRSQILLFNNFVHKQ 647

Query: 658 QEQQEAIKFLQTELNNIIE-QPAQSHDAIIDSDEDEWNELCDLLNRDAKIIEDCNAELSS 716
           ++Q++ I+FL+ EL  II+   ++S   ++    +EW EL  +L  DAKII++CN +L+ 
Sbjct: 648 KDQKQNIQFLKKELQKIIDISRSESSKGML----NEWEELRQILADDAKIIKECNEQLTQ 703

Query: 717 AS 718
            S
Sbjct: 704 IS 705

>ZYRO0G20680g Chr7 complement(1703031..1705109) [2079 bp, 692 aa]
           {ON} similar to uniprot|P40368 Saccharomyces cerevisiae
           YJL061W NUP82 Subunit of the nuclear pore complex (NPC)
           forms a subcomplex with Nup159p and Nsp1p interacts with
           Nup116p and is required for proper localization of
           Nup116p in the NPC
          Length = 692

 Score =  359 bits (921), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 225/716 (31%), Positives = 376/716 (52%), Gaps = 38/716 (5%)

Query: 7   HTIFNRFSVGKVSSKRSSITVDNGLKIILYQNNTVRYGFVNDADGNFKSITLEKEMIGDV 66
           H+IF R S    SSKR   T  +G K+++YQ++++R+   N  D  ++ + LE  +    
Sbjct: 6   HSIFKRASG---SSKRFLCTSQDGSKVVIYQDSSIRW--CNAFDSKYEFMLLEPTIEDVE 60

Query: 67  SIIADQIGNYLCLFNEFEIRVIELPWKLWDAKEDSSFQLDNMVQIRSYDLKSFGTTIQKI 126
            ++    G  L L+N  E+R++E+PW       +   +    V  R   L      I+K+
Sbjct: 61  HVVLSPTGTLLLLYNSREVRIVEIPWGYSQVSYEGFQKFRYSVDSRQDPL------IKKV 114

Query: 127 LFHPLGLAYPCLVVLLKNSNICSIDIKRILKVEEIPSTCITTFHTKGVMGLXXXXXXXXX 186
           LFHPL     C+V+L  ++ I  +D  R    ++ P   +   H  G  G+         
Sbjct: 115 LFHPLAYREHCIVILKTDNTIHLLD--RYYPYDKQPKLLVLNQH-DGAFGMEGLVTDIES 171

Query: 187 XXXXXXKLSLYALT---ETDIYLFYPFLIPTISVTKNEIDQLFQKSIILFENLENDSSEA 243
                  L+LYAL+     DIY FYP L  +I +  +++D L  KS++ +ENL  ++ +A
Sbjct: 172 ITFSQDGLTLYALSVAEGCDIYAFYPCLPCSIEIDSHKLDLLMHKSLVQYENLSVETPDA 231

Query: 244 VRRNIIKQLQLLSTLSGDIKTQMKQVKNTDETKIYNIDINTEYRSVNAQGSFSIAPFPEE 303
            +RN IKQ Q +S L        +Q    D+TKI   DI  ++  V  QG F+IAPFP+ 
Sbjct: 232 TKRNTIKQFQFISKL--------RQGLENDQTKI---DIPMDWLRVRGQGPFTIAPFPDR 280

Query: 304 LYKQSAVNLSVIQIGHGNELYVITYDDGTVLILYRDLESSMSWDSNDYTFNNSFILLEKL 363
            Y ++AV L ++ IG  N+L ++++DDGT+++LY+DLE +M WDS  Y++NNS +L+E +
Sbjct: 281 YYDRTAVQLKILPIGANNDLLLMSFDDGTIVVLYQDLELTMCWDSKGYSYNNSLVLVESI 340

Query: 364 KFNPDETKSILDIPFKNGIFAIAGDQTVNLIDTSCWSDILSQCIKDNDIRNLAGLSIESH 423
           +    E   +L     +  F + G   + L+DTS WS ILS CI ++D+  +A L  +S 
Sbjct: 341 RLERGEL--VLKQGTLSQFFVLGGTSDIYLVDTSPWSKILSNCIDNSDLEPIADLQFKSE 398

Query: 424 KQTINTLEEPNSCILWNEHNKKELLFITETKLISSDILESNNESAEKLPVPAINDIKKIE 483
              I  + + +S  +W +  + + +F+++  +       ++  S  K    A  DI + E
Sbjct: 399 ISKIEGVSQIDSYAMWKKDTEPKDVFVSKDTVFVKSTAVNDQPSTVKDEKKANVDIPRYE 458

Query: 484 KLQLKNYSQPIKEINIAVQRYKDSCKVPYSKVIPANIRQKPFANDENEDQLAYITEISQE 543
                  +QP+ EI      ++   K P SK++  + RQ    N+ NE+QL  +T +S+E
Sbjct: 459 VA----LNQPMSEILSLNASFQTEAKKPLSKLVEPSKRQTKLNNESNEEQLEILTTVSKE 514

Query: 544 IGSKILQGQTIALMMHTRLREQQDVFAEQLMHTNKELLHNKTIKQTYDIQSTKIKHITER 603
              KI++ Q +   +H R  EQQ     QL ++++ L     ++     QS++ +   +R
Sbjct: 515 FLQKIVKAQALGFNLHNRCLEQQYELTRQLQYSSEILSKQDKLRSKAQSQSSECESKIQR 574

Query: 604 NTKLNERTSKLIEMMEKIKQSQQYKNMPINDSESKLFKEIKKQVLIFNDAVNRQQEQQEA 663
             KL +R + L E + +I +S +++ M I D E   FKEI+ QVL+FN  V+ Q+ QQ+ 
Sbjct: 575 QDKLLQRFNSLSEKLGRINESPKFREMNITDKEMAWFKEIRNQVLVFNQYVHHQKNQQDQ 634

Query: 664 IKFLQTELNNIIEQPAQSHDAIIDSDEDEWNELCDLLNRDAKIIEDCNAELSSASG 719
           +++LQ EL NI    +     + +  + EW EL  +L  D KII++CN +L+ AS 
Sbjct: 635 LRYLQKELENI----SLEDKDVGEKSKSEWTELLSILESDTKIIKECNNQLAHASS 686

>YJL061W Chr10 (320016..322157) [2142 bp, 713 aa] {ON}  NUP82Linker
           nucleoporin component of the nuclear pore complex (NPC);
           also part of the NPC cytoplasmic filaments; contributes
           to nucleocytoplasmic transport and NPC biogenesis; forms
           stable associations with three FG-nucleoporins (Nsp1p,
           Nup159p, and Nup116p)
          Length = 713

 Score =  349 bits (896), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 232/721 (32%), Positives = 391/721 (54%), Gaps = 47/721 (6%)

Query: 14  SVGKVSSKRSSITVDNGLKIILYQNNTVRYGFVNDADGNFKSITLEKEMIGD--VSIIAD 71
           S+    S R   +  NG +I+  Q+N +R+  V   D  + S+   + ++ D    +I+ 
Sbjct: 16  SLSASQSPRYIFSSQNGTRIVFIQDNIIRWYNVL-TDSLYHSLNFSRHLVLDDTFHVISS 74

Query: 72  QIGNYLCLFNEFEIRVIELPWKLWDAKEDSSFQLDNMVQIRSY--DLKSFG--TTIQKIL 127
             G+ LCLFN+ EI V+E+PW  +   ED S Q  +  QI  Y  D +  G  ++I+K+L
Sbjct: 75  TSGDLLCLFNDNEIFVMEVPWG-YSNVEDVSIQ--DAFQIFHYSIDEEEVGPKSSIKKVL 131

Query: 128 FHPLGLAYPCLVVLLKNSNICSIDIKRILKVEEIPSTCITTFHTKGVMGLXXXXXXXXXX 187
           FHP      C+VVL ++  I   DI   L  +E P   I         GL          
Sbjct: 132 FHPKSYRDSCIVVLKEDDTITMFDI---LNSQEKP---IVLNKPNNSFGLDARVNDITDL 185

Query: 188 XXXXXKLSLYALTET---DIYLFYPFLIPTISVTKNEIDQLFQKSIILFENLENDSSEAV 244
                 L+LY L  T   DI+ FYPFL   + + + +++ +  KS++++E+L++ +   V
Sbjct: 186 EFSKDGLTLYCLNTTEGGDIFAFYPFLPSVLLLNEKDLNLILNKSLVMYESLDSTTDVIV 245

Query: 245 RRNIIKQLQLLSTLSGDIKTQMKQVKNTDETKIYNIDINTEYRSVNAQGSFSIAPFPEEL 304
           +RN+IKQLQ +S L  +  ++  +V           DI  EYR    QG F+I PFP EL
Sbjct: 246 KRNVIKQLQFVSKLHENWNSRFGKV-----------DIQKEYRLAKVQGPFTINPFPGEL 294

Query: 305 YKQSAVNLSVIQIGHG-NELYVITYDDGTVLILYRDLESSMSWDSNDYTFNNSFILLEKL 363
           Y  +A N++ I I +G NE+  +++DDG++++L++DLE SMSWD ++Y +NNS +L+E++
Sbjct: 295 YDYTATNIATILIDNGQNEIVCVSFDDGSLILLFKDLEMSMSWDVDNYVYNNSLVLIERV 354

Query: 364 KFNPDETKSILDIPFKNGIFAIAGDQTVNLIDTSCWSDILSQCIKDNDIRNLAGLSIESH 423
           K    E KS++ +P + G   +  D  +  ++   W+  LS+CI ++D+  LAGL  ES 
Sbjct: 355 KLQR-EIKSLITLPEQLGKLYVISDNIIQQVNFMSWASTLSKCINESDLNPLAGLKFESK 413

Query: 424 KQTINTLEE-PN-SCILWNEHNKKELLFITETKL----ISSDILESNNESAEKLPVPAIN 477
            + I T+E  PN + I WN+ +   L  ++   L    ISSD+   +  +   +     +
Sbjct: 414 LEDIATIERIPNLAYINWNDQSN--LALMSNKTLTFQNISSDMKPQSTAAETSISTEKSD 471

Query: 478 DIKKIEKLQLKNYSQPIKEINIAVQRYKDSCKVPYSKVIPANIRQKPFANDENEDQLAYI 537
            +    K+   +++QPI EI I    ++ +C  P  ++IP+  RQ P  N+ +E+QL   
Sbjct: 472 TVGDGFKM---SFTQPINEILILNDNFQKACISPCERIIPSADRQIPLKNEASENQLEIF 528

Query: 538 TEISQEIGSKILQGQTIALMMHTRLREQQDVFAEQLMHTNKELLHNKTIKQTYDIQSTKI 597
           T+IS+E   +I++ QT+ + +H R+ EQQ     QL  T K +  +  +++ ++ Q+ K 
Sbjct: 529 TDISKEFLQRIVKAQTLGVSIHNRIHEQQFELTRQLQSTCKIISKDDDLRRKFEAQNKKW 588

Query: 598 KHITERNTKLNERTSKLIEMMEKIKQSQQYKNMPINDSESKLFKEIKKQVLIFNDAVNRQ 657
                R ++L ER SKL + + +I +S ++K   I+  E K FKEI+ Q+L FN  V+ Q
Sbjct: 589 DAQLSRQSELMERFSKLSKKLSQIAESNKFKEKKISHGEMKWFKEIRNQILQFNSFVHSQ 648

Query: 658 QEQQEAIKFLQTELNNIIEQPAQSHDAIIDSDEDEWNELCDLLNRDAKIIEDCNAELSSA 717
           +  Q+ + +L++EL  I  +  +    +    ++EW+EL  +L  D+KII++CN EL   
Sbjct: 649 KSLQQDLSYLKSELTRIEAETIK----VDKKSQNEWDELRKMLEIDSKIIKECNEELLQV 704

Query: 718 S 718
           S
Sbjct: 705 S 705

>KAFR0A01720 Chr1 complement(349779..351929) [2151 bp, 716 aa] {ON}
           Anc_1.319 YJL061W
          Length = 716

 Score =  342 bits (877), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 220/696 (31%), Positives = 377/696 (54%), Gaps = 48/696 (6%)

Query: 35  LYQNNTVRYGFVNDADGNFKSITLEKEMIGDVS----IIADQIGNYLCLFNEFEIRVIEL 90
           +Y+ N +R+G V  A   + S+ L   +  D S    +I    G +LCL+++  + +IE+
Sbjct: 48  IYKKNQLRWGSV--ASSQYHSLPL---LFFDDSAYENVIISNSGQFLCLYDKKSLSLIEI 102

Query: 91  PWKLWDAKED--SSFQLDNMVQIRSYDLKSFGTTIQKILFHPLGLAYPCLVVLLKNSNIC 148
           PW    A     SSFQ       R +   +  + I+KILFHP      C+V+L +N  IC
Sbjct: 103 PWGYDGAVTSIKSSFQ-------RVFRDVNKSSDIKKILFHPKAADDGCVVILFENDVIC 155

Query: 149 SIDIKRILKVEEIPSTCITTFHTKGVMGLXXXXXXXXXXXXXXXKLSLYALTETD---IY 205
             D+++        S  +    T   +G+                L+LY L+ TD   IY
Sbjct: 156 LFDLRK--------SEKLFLNKTANKLGIETRVTDIEDMEFSQDGLTLYMLSVTDGGDIY 207

Query: 206 LFYPFLIPTISVTKNEIDQLFQKSIILFENLENDSSEAVRRNIIKQLQLLSTLSGDIKTQ 265
            FYP L P +S+ K+ ++ LF KS IL+++L++  S  VR+N++KQ++ +++L       
Sbjct: 208 AFYPCLPPKLSLKKSVLEDLFNKSRILYDSLDSTVSIEVRKNVLKQIKFIASLRDS---- 263

Query: 266 MKQVKNTDETKIYNIDINTEYRSVNAQGSFSIAPFPEELYKQSAVNLSVIQIGHGNELYV 325
                ++DETK   ++I+ ++R V AQG F++AP+PE+LY+ +A  +  + IG+ NEL+ 
Sbjct: 264 -----SSDETKNSCLEISNDFRQVKAQGPFTVAPYPEKLYEATAKEIYTLDIGNNNELFA 318

Query: 326 ITYDDGTVLILYRDLESSMSWDSNDYTFNNSFILLEKLKFNPDETKSILDIPFKNGIFAI 385
           IT+D+GTV +L +DLE SMSW++++Y +NNSF+L+E ++  P+  K +        +F  
Sbjct: 319 ITFDNGTVTLLLKDLELSMSWNADNYVYNNSFVLIESVEMGPESIKLLKSSSLTGQMFIS 378

Query: 386 AGDQTVNLIDTSCWSDILSQCIKDNDIRNLAGLSIESHKQTINTLEEPNSCILWNEHNKK 445
               +V  IDT+ WS  +S+CI ++D+ +L  +  +S    ++  E  +   +W+   ++
Sbjct: 379 QNHSSVRKIDTTAWSFKVSKCITNSDLTSLIDVDFKSKISDLDIKENVDCYGVWSLRGER 438

Query: 446 ELLFITETKLISSDILESNNESAEKLPVPAINDIKKIEKLQLKNY----SQPIKEINIAV 501
            +LF++ + +IS  + ES++    KL    ++  K IE    K Y    +QPI EI    
Sbjct: 439 GILFVSNSSVISRTLPESDSSFVIKL--DEMSRSKNIEDPVTKKYEVSFTQPISEIMNLN 496

Query: 502 QRYKDSCKVPYSKVIPANIRQKPFANDENEDQLAYITEISQEIGSKILQGQTIALMMHTR 561
             ++  C+ P+ K+I    RQ   +ND NE QLA +TEIS ++ S I++GQ++ L++  R
Sbjct: 497 DSFQRICRHPFKKIISPEERQTVLSNDSNETQLATLTEISNDLVSNIVEGQSLGLVLRNR 556

Query: 562 LREQQDVFAEQLMHTNKELLHNKTIKQTYDIQSTKIKHITERNTKLNERTSKLIEMMEKI 621
           L EQQ    +QL  + + +     +K +YD +  +     ++  +L +R + L   + KI
Sbjct: 557 LYEQQYELTKQLKESIQLIEKQSLLKSSYDDKMVRWNKNLKKQDELIQRFNALNGNLAKI 616

Query: 622 KQSQQYKNMPINDSESKLFKEIKKQVLIFNDAVNRQQEQQEAIKFLQTELNNIIEQPAQS 681
            +S++    PI++ E + FKE++ Q+L FND V+  +  QE I FL+  L+ I  +  Q 
Sbjct: 617 HESKEISKTPISEKEVEWFKEVRNQILKFNDFVHVHRNMQEQINFLRKGLSRIESKVGQR 676

Query: 682 HDAIIDSDEDEWNELCDLLNRDAKIIEDCNAELSSA 717
              +      EW E   +L  D  II++CN EL+ A
Sbjct: 677 SSHLT----SEWAEFKKILETDTNIIKECNEELTKA 708

>Smik_10.179 Chr10 (311844..313985) [2142 bp, 713 aa] {ON} YJL061W
           (REAL)
          Length = 713

 Score =  338 bits (868), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 235/721 (32%), Positives = 386/721 (53%), Gaps = 47/721 (6%)

Query: 14  SVGKVSSKRSSITVDNGLKIILYQNNTVRYGFVNDADGNFKSITLEKEMIGD--VSIIAD 71
           S+    S R   T  NG +I+  Q+N +R+  V   D  + S++L + ++ D    +I+ 
Sbjct: 16  SLSASQSPRYIFTSQNGTRIVFIQDNIIRWYNVL-TDPCYHSLSLSRHLVLDDTFHVISS 74

Query: 72  QIGNYLCLFNEFEIRVIELPWKLWDAKEDSSFQLDNMVQIRSYDLKSFG--TTIQKILFH 129
             G+ LC FN+ EI V+E+PW  +   E+ S Q    V   S D    G  + I+K+LFH
Sbjct: 75  TSGDLLCFFNDQEIFVMEVPWG-YSNVENISIQDAFQVFHYSVDETELGPKSLIKKVLFH 133

Query: 130 PLGLAYPCLVVLLKNSNICSIDIKRILKVEEIPSTCITTFHTKGVMGLXXXXXXXXXXXX 189
           P      C+VVL +N  I   DI   L  +E P   I         GL            
Sbjct: 134 PKSYHDSCIVVLKENDTIIMFDI---LNQQEKP---IILNKPNNSFGLDARLNDITDLVF 187

Query: 190 XXXKLSLYALTET---DIYLFYPFLIPTISVTKNEIDQLFQKSIILFENLENDSSEAVRR 246
               L+LY L  T   DI+ FYPFL   + + +N++  +  KS++++E+L+  +   V+R
Sbjct: 188 SKDGLTLYCLNTTEGGDIFAFYPFLPSALLLNENDLSWILNKSLVMYESLDPTTDVTVKR 247

Query: 247 NIIKQLQLLSTLSGDIKTQMKQVKNTDETKIYNIDINTEYRSVNAQGSFSIAPFPEELYK 306
           NIIKQLQ +S L           +N D +K+  +DI++EYR V  QG F+I PFP ELY 
Sbjct: 248 NIIKQLQFVSKLH----------ENWD-SKLNKVDIDSEYRLVKVQGPFTINPFPNELYD 296

Query: 307 QSAVNLSVIQI-GHGNELYVITYDDGTVLILYRDLESSMSWDSNDYTFNNSFILLEKLKF 365
            +A N++ I I    NE++ I++DDG++++L +DLE SMSWD  +Y +N+S +L+E++K 
Sbjct: 297 YTAKNIATISIDNQQNEIFCISFDDGSLILLLKDLEMSMSWDVGNYVYNDSLVLIERVKM 356

Query: 366 NPDETKSILDIPFKNGIFAIAGDQTVNLIDTSCWSDILSQCIKDNDIRNLAGLSIESHKQ 425
              E +S++ +P + G   +     V  ++++ W+  +S+CI ++D+  L  L  ES  +
Sbjct: 357 QK-EIESLITLPEQMGKLYVFSKNFVYQVNSTSWTSTISKCINESDLNPLGDLKFESKIE 415

Query: 426 TINTLEE-PN-SCILWNE------HNKKELLFITETKLISSDILESNNESAEKLPVPAIN 477
            I T+E  PN + I WN        + KEL F T    +S D    + E+   +      
Sbjct: 416 NIATVEGMPNLAHIYWNNTSNLALASNKELTFQT----VSVDQKMQSTETETDIGTEESG 471

Query: 478 DIKKIEKLQLKNYSQPIKEINIAVQRYKDSCKVPYSKVIPANIRQKPFANDENEDQLAYI 537
             K   +L+   ++QP+ EI    + ++ +C  P  ++IP+  RQ P  N+ +E+QL   
Sbjct: 472 LAKCRYELR---FTQPLSEILTLNENFQRACISPCEQIIPSTDRQIPLKNEASENQLEIF 528

Query: 538 TEISQEIGSKILQGQTIALMMHTRLREQQDVFAEQLMHTNKELLHNKTIKQTYDIQSTKI 597
           T++S+E   KI + Q++ + ++ R+ EQQ     QL  T K +  +  +++ ++ Q+ K 
Sbjct: 529 TDVSKEFLQKIAKAQSLGVSIYNRIHEQQLELTRQLQSTCKIISKDVDLRKKFEAQNKKW 588

Query: 598 KHITERNTKLNERTSKLIEMMEKIKQSQQYKNMPINDSESKLFKEIKKQVLIFNDAVNRQ 657
                R +KL ER SKL E + +I +S ++K   I+++E + FKEI+ Q+L FN  V+ Q
Sbjct: 589 DAQIIRQSKLMERFSKLTENLSEISKSNKFKEKNISNAEMEWFKEIRNQILQFNCYVHSQ 648

Query: 658 QEQQEAIKFLQTELNNIIEQPAQSHDAIIDSDEDEWNELCDLLNRDAKIIEDCNAELSSA 717
           +  Q+ + +L+ EL  I  +  Q    +    + EWNEL  +L  D+KII++CN EL  A
Sbjct: 649 KSLQQDLSYLKRELTRIETETIQ----VDKKSQSEWNELRKMLEIDSKIIKECNEELQHA 704

Query: 718 S 718
           S
Sbjct: 705 S 705

>Suva_6.137 Chr6 complement(228953..231109) [2157 bp, 718 aa] {ON}
           YJL061W (REAL)
          Length = 718

 Score =  332 bits (850), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 224/724 (30%), Positives = 388/724 (53%), Gaps = 48/724 (6%)

Query: 14  SVGKVSSKRSSITVDNGLKIILYQNNTVRYGFVNDADGNFKSITLEKEMIGDVSI--IAD 71
           S+    S R   +  NG ++++ Q++ +R+  +   D ++ S+   + ++ D +   I+ 
Sbjct: 16  SLSANQSPRYIFSSHNGTRLVVIQDDIIRWCSLL-TDPSYHSLNFSRHLVLDDTFHAISS 74

Query: 72  QIGNYLCLFNEFEIRVIELPW---KLWDAKEDSSFQLDNMVQIRSYDLKSFGTTIQKILF 128
             G+ LC +++ EI V+E+PW    L D     +FQ+ +   +   +L S  + I+K+LF
Sbjct: 75  ASGDLLCFYSDQEIFVMEIPWGYLNLGDVSIQDAFQVFHY-SVDELELGS-NSPIKKVLF 132

Query: 129 HPLGLAYPCLVVLLKNSNICSIDIKRILKVEEIPSTCITTFHTKGVMGLXXXXXXXXXXX 188
           HP      C+VVL  +  I   DI   L  +E P   I         GL           
Sbjct: 133 HPKSYNDSCIVVLKNDDTITMFDI---LNQQEAP---IILNKRNSSFGLDARVNDITDFA 186

Query: 189 XXXXKLSLYALTET---DIYLFYPFLIPTISVTKNEIDQLFQKSIILFENLENDSSEAVR 245
                L+LY L  T   DI+ FYPFL   +S+++ ++  +  KS++++E+L   +   V+
Sbjct: 187 FSKDGLTLYCLNTTEGGDIFAFYPFLPSVLSLSEKDLGWILNKSLVMYESLNATTDYKVK 246

Query: 246 RNIIKQLQLLSTLSGDIKTQMKQVKNTDETKIYNIDINTEYRSVNAQGSFSIAPFPEELY 305
           RNI KQLQ +S L  +  +++ +VK           I+ EYR V  QG F+I PFP ELY
Sbjct: 247 RNITKQLQFVSKLHKNWDSKLAKVK-----------IDDEYRLVKMQGPFTINPFPNELY 295

Query: 306 KQSAVNLSVIQI-GHGNELYVITYDDGTVLILYRDLESSMSWDSNDYTFNNSFILLEKLK 364
             +A  ++ I I    NE+  +++DDG+++IL++DLE SMSWD ++Y +NNS IL+E++K
Sbjct: 296 DFTASKITTIPIDNQQNEIVCVSFDDGSLIILFQDLEMSMSWDVDNYVYNNSLILIERIK 355

Query: 365 FNPDETKSILDIPFKNGIFAIAGDQTVNLIDTSCWSDILSQCIKDNDIRNLAGLSIESHK 424
               E KS+  +P + G   +  + +V+ +D + W+ +LS+CI ++D+  LA +   S  
Sbjct: 356 LQQKEMKSLTALPDQLGKLYVTLESSVHQLDCTSWTSVLSKCIDESDLNALADVKFVSKF 415

Query: 425 QTINTLEEPNSCILWNEHNKKELLFITETKLISSDILESNNESAEKLPVPA-----IN-D 478
           + I T+ + ++    N ++K  L  I++ KL   +I  SN++  + L  PA     +N D
Sbjct: 416 EDIATIHQLSNFAYINWNDKSSLALISKEKLTIQNI--SNHKKEQSLNAPAELDTNVNSD 473

Query: 479 IKKIEKLQLK-NYSQPIKEINIAVQRYKDSCKVPYSKVIPANIRQKPFANDENEDQLAYI 537
                K   + +++QPI EI    + ++  C  P  ++IP   RQ P  N+ NE+QL   
Sbjct: 474 KSDTGKRGYEISFTQPINEILSLNESFQKVCLSPCERIIPPADRQLPLKNEANENQLEIF 533

Query: 538 TEISQEIGSKILQGQTIALMMHTRLREQQDVFAEQLMHTNKELLHNKTIKQTYDIQSTKI 597
           T+IS+E   KI++ Q++ + ++ R+ EQQ     QL  T+K +  ++ +++  + Q+ K 
Sbjct: 534 TDISKEFLRKIIKAQSLGVSIYNRIHEQQFELTRQLQSTSKIIAKDEILQKKLEAQTEKW 593

Query: 598 KHITERNTKLNERTSKLIEMMEKIKQSQQYKNMPINDSESKLFKEIKKQVLIFNDAVNRQ 657
              + R  +L  R  KL E + K+ +S ++K   I+  E + FKEI+ Q+L FN  V+ Q
Sbjct: 594 NSQSSRQAELMTRFGKLTENLSKVAESDKFKEQNISHGEMEWFKEIRNQILQFNGFVHSQ 653

Query: 658 QEQQEAIKFLQTELNNIIEQPAQSHDAIIDSD---EDEWNELCDLLNRDAKIIEDCNAEL 714
           +  Q+ + +L+ EL  I           I++D   ++EW+EL  +L  D+KII++CN EL
Sbjct: 654 KSIQQDLSYLKRELIRI-------ESETINADKKSQNEWDELRKMLEVDSKIIKECNEEL 706

Query: 715 SSAS 718
              S
Sbjct: 707 VHVS 710

>TDEL0D01880 Chr4 (366715..368790) [2076 bp, 691 aa] {ON} Anc_1.319
           YJL061W
          Length = 691

 Score =  326 bits (836), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 218/718 (30%), Positives = 370/718 (51%), Gaps = 45/718 (6%)

Query: 7   HTIFNRFSVGKVSSKRSSITVDNGLKIILYQNNTVRYGFVNDADGNFKSITLEKEMIGDV 66
           H IF      +  S R  +T  +G + ++ Q++ +R+   N ++  + S+TLE+      
Sbjct: 6   HPIFRPSLTAQSGSDRFFLTTSDGGRAVVVQDSCIRW--CNVSEPGYHSMTLERAFKDVK 63

Query: 67  SIIADQIGNYLCLFNEFEIRVIELPWKLWDAKE-DSSFQLDNMVQIRSYDLKSFGTTIQK 125
            ++    G +LCL+N+ E+R+IE+PW   +     ++FQL   V        S    I++
Sbjct: 64  HVVMSNSGEFLCLYNDDELRIIEVPWAYTEVSSMANAFQLFRFV--------SDEARIKQ 115

Query: 126 ILFHPLGLAYPCLVVLLKNSNICSIDIKRILKVEEIPSTCITTFH-TKGVMGLXXXXXXX 184
           +LFHPL      +V+L  + +I       I+  ++   +     + + G   L       
Sbjct: 116 VLFHPLAYQQETVVILKDDDSIT------IMNWQDFGDSKPDVLNLSNGTYSLDSSITDV 169

Query: 185 XXXXXXXXKLSLYALT---ETDIYLFYPFLIPTISVTKNEIDQLFQKSIILFENLENDSS 241
                    L+LY L+     DIY FYP L P +   K  +D+L  KS+I ++ L   + 
Sbjct: 170 ECITFSQDGLTLYVLSVSEGADIYAFYPCLAPRMQFDKQGLDRLMYKSLIQYDVLNVGTD 229

Query: 242 EAVRRNIIKQLQLLSTLSGDIKTQMKQVKNTDETKIYNIDINTEYRSVNAQGSFSIAPFP 301
             V+RN IKQL+ +S L           K  +  +I  ++I    R V  QG F+IAPFP
Sbjct: 230 SEVKRNTIKQLKFVSGLH----------KQQNSQRI--LEIPEAQRQVRGQGPFTIAPFP 277

Query: 302 EELYKQSAVNLSVIQIGHGNELYVITYDDGTVLILYRDLESSMSWDSNDYTFNNSFILLE 361
           +++Y  +   ++ + I   NEL +++ DDG + IL +DL+ +M+WDS  Y +NNSF L+E
Sbjct: 278 KQIYSSTGTGIASLPINDQNELLIMSLDDGNIAILLQDLDVTMNWDSARYNYNNSFALVE 337

Query: 362 KLKFNPDETKSILDIPFKNGIFAIAGDQTVNLIDTSCWSDILSQCIKDNDIRNLAGLSIE 421
            +     E + I+    K G F++   + V  IDTS WS +++ C+ ++D+R LA   +E
Sbjct: 338 LITLGSQEIQQIVVGDHKYGQFSVMTPEGVFSIDTSKWSGVMASCLTESDLRPLAETKLE 397

Query: 422 SHKQTINTLEEPNSCILWNEHNKKELLFITETKLISSDILESNNESAEKLPVPAINDIKK 481
           S        + P S   WN    + ++ ++  ++ S  + E  ++  + +        ++
Sbjct: 398 SEVTFTELKDSPKSVAWWNT-TPQSVVKVSNREVKSKQVSEGVSKQDDDI----TGSRQE 452

Query: 482 IEKLQLKNYSQPIKEINIAVQRYK-DSCKVPYSKVIPANIRQKPFANDENEDQLAYITEI 540
            EK    +YSQPI EI    Q+++ +S K P SKVIP   RQKP  N+ +E QL  +TE 
Sbjct: 453 PEKYN-AHYSQPIAEIMQLNQKFQLESSKAP-SKVIPPRERQKPLKNEASEIQLDLLTEA 510

Query: 541 SQEIGSKILQGQTIALMMHTRLREQQDVFAEQLMHTNKELLHNKTIKQTYDIQSTKIKHI 600
           S++  SKI  GQT+ + +H R+ EQQ     QL  + + +   +TI   +  QS++   +
Sbjct: 511 SKDFVSKIAVGQTLGVTLHNRIYEQQLDLTHQLKASGELMEKQQTILTHFHSQSSRSDAV 570

Query: 601 TERNTKLNERTSKLIEMMEKIKQSQQYKNMPINDSESKLFKEIKKQVLIFNDAVNRQQEQ 660
             R++ L  R +K  + + +I+ SQ++K++ I+  E + FKEI+KQVL FN  V+ Q+  
Sbjct: 571 HARHSTLMSRFNKFKDNLGQIQNSQRFKDLEISKEEVEWFKEIRKQVLTFNRDVHNQKRL 630

Query: 661 QEAIKFLQTELNNIIEQPAQSHDAIIDSDEDEWNELCDLLNRDAKIIEDCNAELSSAS 718
           Q+ +  L+ E+N I +     +        DEW+EL  +L  D  I++DCN +L SA+
Sbjct: 631 QDQLIHLKQEMNRIAQVTGDQNSQA----RDEWHELRHMLEEDTIILQDCNNQLKSAA 684

>NDAI0G05750 Chr7 (1424856..1427060) [2205 bp, 734 aa] {ON}
           Anc_1.319 YJL061W
          Length = 734

 Score =  326 bits (836), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 229/734 (31%), Positives = 373/734 (50%), Gaps = 41/734 (5%)

Query: 7   HTIFNRFSVGKVSSKRSSITVDNGLKIILYQNNTVRYGFVNDADGN---FKSITLEKEMI 63
           H IF    +    S+R   T   G +++L Q   +++  V D   +    KSI   K  I
Sbjct: 11  HPIFGTSIITNEDSQRFFFTSHQGTRMVLLQGCILKWCNVIDTTYHSMKVKSIFNNKRKI 70

Query: 64  GDVSIIADQIGNYLCLFNEFEIRVIELPWKLWDAKEDSSFQLDNMVQIRSYDLKSFGTT- 122
            DV +   + G++LC++    I ++E+PW      E    +L +  Q   YD+ S  +  
Sbjct: 71  IDVKL--SESGDFLCIYTTKTIDILEIPW----GYEKIPDELLSKFQPFHYDISSSTSAL 124

Query: 123 -----IQKILFHPLGLAYPCLVVLLKNSNICSIDIKRILKVEEIPSTCITTFHTKGVMGL 177
                I+++LFHP      CLV+L ++S I  ID           +  IT     G +G+
Sbjct: 125 SSPSDIKQVLFHPKSYHETCLVILYEDSIIQLIDTTA-------STETITINQPTGTLGV 177

Query: 178 XXXXXXXXXX-XXXXXKLSLYALTETD---IYLFYPFLIPTISVTKNEIDQLFQKSIILF 233
                            L LYAL+ +D   IY  YP L   + V+K E+D L QKSI+L+
Sbjct: 178 ETRVIDIESICFDKTTGLILYALSISDGGDIYALYPCLPTRLDVSKKEVDLLLQKSIVLY 237

Query: 234 ENLENDSSEAVRRNIIKQLQLLSTLSGDIKTQMKQVKNTDETKIYN------IDINTEYR 287
           ++L+ + S  V+RN+IKQLQ  + L G    Q+K  K+ + T+         +D++ EYR
Sbjct: 238 DSLKENMSNDVKRNVIKQLQFATKLQGQFLEQLKGEKDEERTRHAQKDLKLILDVDLEYR 297

Query: 288 SVNAQGSFSIAPFPEELYKQSAVNLSVIQIGHGNELYVITYDDGTVLILYRDLESSMSWD 347
            VN QG F+I+PFP ELY  +A     ++I   NEL ++T+DDG+V +L+RDLE +MSWD
Sbjct: 298 LVNFQGPFTISPFPNELYSATAKESQCMKINENNELLIMTFDDGSVALLFRDLELTMSWD 357

Query: 348 SNDYTFNNSFILLEKLKFNPDETKSILDIPFKNGIFAIAGDQTVNLIDTSCWSDILSQCI 407
             +Y  +NSF L+E +K  P +   ++      G F +  D  + L+ T+ WSD L++ I
Sbjct: 358 IANYIHDNSFALVELIKLKPTDIGRLIIYQDNFGKFFLLSDDVIMLVHTNSWSDKLAKAI 417

Query: 408 KDNDIRNLAGLSIESHKQTINTLEEPNSCILWNEHNKKELLFITETKLISSDILESNNES 467
            D+++  L+ +  ES     + + + N+C     H K+ ++F++   +   ++ + ++ +
Sbjct: 418 DDSNLNILSEIGFESEITWFDVMGKFNNCTPCKYHGKESIIFVSSDNVFVENLTKKHSMN 477

Query: 468 AEKLPVPAINDIKKIEKLQLKNYSQPIKEINIAVQRYKDSCKVPYSKVIPANIRQKPFAN 527
             K    + ++ +  E      + QPI E+    + ++  C++P+SK+I    RQ   +N
Sbjct: 478 NIKGSSTSNSNEETAESEYKVTFKQPIDELMTLNELFQKQCRMPFSKLIKPEDRQIELSN 537

Query: 528 DENEDQLAYITEISQEIGSKILQGQTIALMMHTRLREQQDVFAEQLMHTNKELLHNKTIK 587
           + NE QL  +T++S+E+ +KI+ GQT+   +H RL+EQQ     QL HT         IK
Sbjct: 538 ESNEIQLEILTDLSKELITKIIDGQTLGFNLHNRLKEQQLELTRQLKHTQIVFEKQDCIK 597

Query: 588 QTYDIQSTKIKHITERNTKLNERTSKLIEMMEKIKQSQQYKNMPINDSESKLFKEIKKQV 647
                   +      R+ KL +R   L E +  I  S    + PI   E + FKEI+ QV
Sbjct: 598 NKNKEILKRWNEQLNRSVKLTDRLQNLNEKLITINDSPNLSSYPITSVELEWFKEIRNQV 657

Query: 648 LIFNDAVNRQQEQQEAIKFLQTELNNIIEQPAQSHDAIIDSDE---DEWNELCDLLNRDA 704
             FN  V+ Q++  E + FL+ EL+ I      S+D     DE    EW EL  +L +D+
Sbjct: 658 HKFNSFVHTQRDANEELSFLKKELDRI------SNDVTSVVDEKSKKEWEELRAILEQDS 711

Query: 705 KIIEDCNAELSSAS 718
           KII++CN EL+  +
Sbjct: 712 KIIKECNIELTKTT 725

>Skud_10.158 Chr10 complement(296754..298904) [2151 bp, 716 aa] {ON}
           YJL061W (REAL)
          Length = 716

 Score =  325 bits (834), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 222/705 (31%), Positives = 384/705 (54%), Gaps = 45/705 (6%)

Query: 29  NGLKIILYQNNTVRYGFVND-ADGNFKSITLEKEMIGD--VSIIADQIGNYLCLFNEFEI 85
           NG +++  Q+N +R+   N   + +++S+   + +I D    +I+   G+ L  FN  EI
Sbjct: 31  NGTRVVFIQDNIIRW--CNSLTESSYQSLDFSRHLILDDTFRVISSASGDLLGFFNVQEI 88

Query: 86  RVIELPWKLWDAKEDSSFQLDNMVQIRSYDLKSF----GTTIQKILFHPLGLAYPCLVVL 141
            V+E+PW  ++  E++S Q  +  Q+  Y +        + I+K+LFHP      C+VVL
Sbjct: 89  FVMEVPWG-YNNIEEASVQ--DAFQLFHYSVGQVENGSRSLIKKVLFHPKSYHDSCIVVL 145

Query: 142 LKNSNICSIDIKRILKVEEIPSTCITTFHTKGVMGLXXXXXXXXXXXXXXXKLSLYALTE 201
            ++  I   DI   L  +  P   I         GL                L+LY L  
Sbjct: 146 KEDDTITMFDI---LNQQHKP---IVLNKRSNSFGLDARVNDITDLAFSRDGLTLYCLNT 199

Query: 202 T---DIYLFYPFLIPTISVTKNEIDQLFQKSIILFENLENDSSEAVRRNIIKQLQLLSTL 258
           T   D++ FYP L P + + + ++  +  KS++++E+L++ +   V+RNIIKQLQL+S L
Sbjct: 200 TEGGDVFAFYPLLPPVLLLGEKDLGWILNKSLVMYESLDSTTDITVKRNIIKQLQLVSKL 259

Query: 259 SGDIKTQMKQVKNTDETKIYNIDINTEYRSVNAQGSFSIAPFPEELYKQSAVNLSVIQIG 318
             ++ +Q+ +V           +I+ EYR V  QG F+I PFP+ELY+ +A N++ I I 
Sbjct: 260 HENLDSQLGKV-----------EIDEEYRLVKMQGPFTINPFPDELYEYTAANITTIPID 308

Query: 319 H-GNELYVITYDDGTVLILYRDLESSMSWDSNDYTFNNSFILLEKLKFNPDETKSILDIP 377
           +  NE+  + +DDG++ +L++DLE SMSWD ++Y  NNS +L+E++K    + KS+  +P
Sbjct: 309 NMQNEIVCVGFDDGSLNLLFQDLEMSMSWDVDNYVHNNSLVLIERIKIQETDIKSLKTLP 368

Query: 378 FKNGIFAIAGDQTVNLIDTSCWSDILSQCIKDNDIRNLAGLSIESHKQTINTLEEPN--S 435
            + G   +  + +V+ +D++ WS ILS+CI+++D+  L  +  ES  + I T+E P+  +
Sbjct: 369 EELGKLYVFSENSVHQLDSTNWSAILSRCIEESDLNALGDVKFESKLENIVTIEHPSNLA 428

Query: 436 CILWNEHNKKELLFITETKLISSDILESNNESAEKLPVPAINDIKKIE--KLQLKNYSQP 493
            I WN+ +   L+     KL   +I  SN++  +     A N   +I+  K    +++QP
Sbjct: 429 YISWNDTSN--LVLTARGKLTFQNI--SNDKELQTTKFDANNKSDRIDAGKHYEMSFTQP 484

Query: 494 IKEINIAVQRYKDSCKVPYSKVIPANIRQKPFANDENEDQLAYITEISQEIGSKILQGQT 553
           I EI    + ++ +C  P  K+IP   RQ P  N+ +E+QL   T IS+E   KI++ Q+
Sbjct: 485 INEILSLNESFQKACISPCEKIIPPAYRQMPLKNEASENQLEIFTGISKEFLQKIIKAQS 544

Query: 554 IALMMHTRLREQQDVFAEQLMHTNKELLHNKTIKQTYDIQSTKIKHITERNTKLNERTSK 613
           +   ++ R++EQQ     QL  T+K +  +  +++    Q+ K      R  KL ER  K
Sbjct: 545 LGFSIYNRIQEQQFELTRQLQATSKIISKDADLQEKLGAQNKKWDAQVSRQVKLMERFKK 604

Query: 614 LIEMMEKIKQSQQYKNMPINDSESKLFKEIKKQVLIFNDAVNRQQEQQEAIKFLQTELNN 673
           L E + +I +S++ +   IN  E K FKEI+ Q+L FN+ V  Q+  Q+ + +++ EL  
Sbjct: 605 LTENLSQIAESKKLREKNINRGEMKWFKEIRNQILQFNNFVRSQKSLQQDLSYMKKELTR 664

Query: 674 IIEQPAQSHDAIIDSDEDEWNELCDLLNRDAKIIEDCNAELSSAS 718
           I  +  ++ +      ++EW+EL  +L  D+KII++CN EL   S
Sbjct: 665 IEAETIKTDEKT----QNEWDELRKMLEEDSKIIKECNEELMHVS 705

>NCAS0A09210 Chr1 complement(1820713..1822845) [2133 bp, 710 aa]
           {ON} Anc_1.319 YJL061W
          Length = 710

 Score =  325 bits (832), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 223/727 (30%), Positives = 375/727 (51%), Gaps = 44/727 (6%)

Query: 7   HTIFNRFSVGKVSSKRSSITVDNGLKIILYQNNTVRYGFVNDADGNFKSITL---EKEMI 63
           H IF      + ++ R   T  +G ++++ Q   +R+  V  +  +F S+T+   + E  
Sbjct: 10  HPIFQGLDCTQDAAPRFLFTSHHGTRMVVLQGGLLRWCSVTAS--SFNSMTIDFFQPEST 67

Query: 64  GDVSIIADQIGNYLCLFNEFEIRVIELPWKLWDAKEDSSFQLDNMVQIRSYDLKS--FGT 121
                I    G ++C++    I VIE+PW         S  + +  Q+ SY+ K     +
Sbjct: 68  APQKAILSNSGEFICVYTNHTIEVIEIPW----GYVTPSPSMVSKFQLFSYNNKDDDGYS 123

Query: 122 TIQKILFHPLGLAYPCLVVLLKNSNICSIDIKRILKVEEIPSTCITTFHTKGVMGLXXXX 181
            I+++LFHP      CLVVL  N  I  +D+ +I K        IT        G+    
Sbjct: 124 PIKQVLFHPEAYKDSCLVVLYDNGTISLMDVTQITKT-------ITLNKRVATFGIDTQI 176

Query: 182 XXXXXXXXXXXKLSLYALT---ETDIYLFYPFLIPTISVTKNEIDQLFQKSIILFENLEN 238
                        +LYAL+     DIY FYP L   + V + +I  L  +S++L+E+L+ 
Sbjct: 177 TDIESICFSKDGWTLYALSISDGGDIYAFYPCLPQQLEVKREKITSLLHESVLLYESLKL 236

Query: 239 DSSEAVRRNIIKQLQLLSTLSGDIKTQMKQVKNTDETKIYNIDINTEYRSVNAQGSFSIA 298
           D+   V+RN+I+Q+Q ++ L+G + T+ ++  N D      I+I  EYR +  QG F+I 
Sbjct: 237 DTDRDVKRNVIRQVQFVNKLNG-LLTENEKNSNED-----FIEIEQEYRLIRGQGPFTID 290

Query: 299 PFPEELYKQSAVNLSVIQIGHGNELYVITYDDGTVLILYRDLESSMSWDSNDYTFNNSFI 358
           P+PE LY  +A+ +S + I   NEL  + +DDG++ +L++DL  +MSWD ++Y  NNSF 
Sbjct: 291 PYPERLYSATALEISTLPINSNNELMCMIFDDGSIALLFKDLPLTMSWDVDNYVHNNSFS 350

Query: 359 LLEKLKFNPDETKSILDIPFKNGIFAIAGDQTVNLIDTSCWSDILSQCIKDNDIRNLAGL 418
           L+E ++    + K I+  P   G F I GD ++ L+ T  WSD+L++ I ++++  L  +
Sbjct: 351 LVELMQLKDTDVKRIVSYPDTYGQFFIFGDSSLFLVHTHIWSDLLAKAIDNSNLNELLEM 410

Query: 419 SIESHKQTINTLEEPNSCILWNEHNKKELLFITE-------TKLISSDILESNNESAEKL 471
           +  S      T      C       +  +LFIT+        ++  S IL +N       
Sbjct: 411 NFTSKLDFFETTNGITKCSPCKWRGRDVILFITKEDVYMHPVEMRKSGILGNNK------ 464

Query: 472 PVPAINDIKKIEKLQLKNYSQPIKEINIAVQRYKDSCKVPYSKVIPANIRQKPFANDENE 531
           PV   N+  K ++ +  ++ QP++E+    + ++  C +  SK+I    RQ    N+ NE
Sbjct: 465 PVLVNNEELKHQEYK-TSFKQPVEELMALNKLFQQQCSMGVSKLIAPEERQVLLNNENNE 523

Query: 532 DQLAYITEISQEIGSKILQGQTIALMMHTRLREQQDVFAEQLMHTNKELLHNKTIKQTYD 591
            QL  ++++S+E+ SKI QGQ +AL +H RL EQQ     QL   +  +     +++  +
Sbjct: 524 VQLELLSDVSKEVISKIGQGQNLALNLHHRLLEQQYELTRQLKIVHTIMSKQSDLRRKSE 583

Query: 592 IQSTKIKHITERNTKLNERTSKLIEMMEKIKQSQQYKNMPINDSESKLFKEIKKQVLIFN 651
            QS +    T R+++L +R   L   + +I  S + K  PIND E + FKEI+ QVL FN
Sbjct: 584 EQSRRWDDQTSRSSQLIKRLQDLDAKILEINNSPKLKEYPINDKELEWFKEIRNQVLKFN 643

Query: 652 DAVNRQQEQQEAIKFLQTELNNIIEQPAQSHDAIIDSDEDEWNELCDLLNRDAKIIEDCN 711
             V+ Q++ QE +  L+ +L  I ++ +Q  D   +  + EW+EL D+L  DA+II++CN
Sbjct: 644 SFVHNQRDAQEELNHLKKDLARISKETSQLRD---EKSDKEWDELRDILKHDAQIIQECN 700

Query: 712 AELSSAS 718
            EL S +
Sbjct: 701 KELLSTT 707

>SAKL0D06930g Chr4 complement(573700..575772) [2073 bp, 690 aa] {ON}
           similar to uniprot|P40368 Saccharomyces cerevisiae
           YJL061W NUP82 Subunit of the nuclear pore complex (NPC)
           forms a subcomplex with Nup159p and Nsp1p interacts with
           Nup116p and is required for proper localization of
           Nup116p in the NPC
          Length = 690

 Score =  317 bits (811), Expect = 3e-97,   Method: Compositional matrix adjust.
 Identities = 215/722 (29%), Positives = 387/722 (53%), Gaps = 44/722 (6%)

Query: 2   VSPQLHTIFNRFSVGKVSSKRSSITVDNGLKIILYQNNTVRYGFVNDADGNFKSITLEKE 61
           +S + H IF   SVGK S  +  +T  +G ++++ Q +T+R    +  +  ++ I     
Sbjct: 1   MSAEDHPIFQNISVGKESYPKKLLTTQDGCRVVVIQGDTIR--LCSSGNSQYQIIECGIN 58

Query: 62  MIGDVSIIADQIGNYLCLFNEFEIRVIELPWKLWDAKEDSSFQLDNMVQIRSYDLKSFGT 121
            +   ++  +  G  LC +NE E++VI LP     +          +++  +Y++ +  +
Sbjct: 59  TVAGAAL--NNSGTLLCAYNETELQVIVLPSPFVSSH-------GGILKPHTYNI-TVKS 108

Query: 122 TIQKILFHPLGLAYPCLVVLLKNSNICSIDIKRILKVEEIPSTCITTFHTKGVMGLXXXX 181
            I+++ +HP G      VVL K+  I   ++    +  + P+  + T   +  +G+    
Sbjct: 109 PIKQVQWHPRGKLDSVPVVLHKDDTIAMYELYN--EDFQQPTAVLNTMQNQ--LGVTSHI 164

Query: 182 XXXXXXXXXXXKLSLYALTET---DIYLFYPFLIPTISVTKNEIDQLFQKSIILFENLEN 238
                       L+LY L  +   D+Y  YPFL   + + +  ++  F KS I +ENL +
Sbjct: 165 TDIESMCFSKDGLALYLLNSSEGGDVYALYPFLPSVLVIPEQHLEMCFYKSCINYENLSS 224

Query: 239 DSSEAVRRNIIKQLQLLSTLSGDIKTQ-MKQVKNTDETKIYNIDINTEYRSVNAQGSFSI 297
           D S  V+RN+IKQLQ +S L    K++ + + +N D   ++NI     YR+   QG F+I
Sbjct: 225 DDSPTVKRNVIKQLQFVSRLHKQYKSETVDKARNGD--LVFNI--QESYRNAKIQGPFTI 280

Query: 298 APFPEELYKQSAVNLSVIQIGHGNELYVITYDDGTVLILYRDLESSMSWDSNDYTFNNSF 357
            PF E+LY  +A  ++ + I   NEL ++ +D+GT+L  ++DL+ SM W+  D + NNS 
Sbjct: 281 NPFAEKLYSATATQITTMPIDEFNELILVYFDNGTILQCFQDLDLSMCWEEIDSSSNNSL 340

Query: 358 ILLEKLKFNPDETKSILDIPFKNGIFAIAGDQTVNLIDTSCWSDILSQCIKDNDIRNLAG 417
           ++LE L     +   I   P K   FA+ G ++  ++D+S W+  LS+CI  +++  L+ 
Sbjct: 341 VVLESLDILSGQI--ICLTPHK---FAVLGPKSF-VVDSSEWTKALSECINFSNLEVLSQ 394

Query: 418 LSIESHKQTINTLEEPNSCILWNEHNKKELLFITETKLISSDILESN-NESAEKLPVPAI 476
           ++I+S    +N         LW  + +K+L+F+++  + S  + E N  + A    V  +
Sbjct: 395 INIKSTITPVNGAF--TQAGLWESNGEKQLIFMSDKSVKSITLPEPNKTKDAVSKTVQPV 452

Query: 477 NDIKKIEKLQLKNYSQPIKEINIAVQRYKDSCKVPYSKVIPANIRQKPFANDENEDQLAY 536
            ++K  E +    +SQPI EI +  ++++  C      VIP ++   P  ND NEDQLA 
Sbjct: 453 TEVK-YEPV----FSQPIGEILLLNKKFQSECSRATQTVIPPHLMDLPLQNDSNEDQLAL 507

Query: 537 ITEISQEIGSKILQGQTIALMMHTRLREQQDVFAEQLMHTNKELLHNKTIKQTYDIQSTK 596
           +T+IS+E+ SKI+QGQT+ L++H RL EQ+     QL  +++ L   K +++ Y  Q+++
Sbjct: 508 LTDISKEVFSKIIQGQTLGLLIHNRLFEQRYELTRQLERSSEILHKAKCLQERYPDQNSR 567

Query: 597 IKHITERNTKLNERTSKLIEMMEKIKQSQQYKNMPINDSESKLFKEIKKQVLIFNDAVNR 656
            +H++++   ++ R  KL   + +I  S + K++ I+  E + FKEIK QV +FN  V +
Sbjct: 568 WEHVSKKQENIDSRFEKLQSRLNEISSSGKLKDLAISQREMEWFKEIKSQVSLFNKFVMQ 627

Query: 657 QQEQQEAIKFLQTELNNIIEQPAQSHDAIIDSDEDEWNELCDLLNRDAKIIEDCNAELSS 716
           QQ+ +E ++F+Q+EL    E+     D        +W EL +LL+ D++II++CN  L  
Sbjct: 628 QQDVKEQLEFVQSELKTAGERRVSKEDVF------DWAELQELLSVDSEIIKECNEGLVE 681

Query: 717 AS 718
           A+
Sbjct: 682 AA 683

>TBLA0F01310 Chr6 complement(329569..331797) [2229 bp, 742 aa] {ON}
           Anc_1.319 YJL061W
          Length = 742

 Score =  314 bits (804), Expect = 1e-95,   Method: Compositional matrix adjust.
 Identities = 231/731 (31%), Positives = 382/731 (52%), Gaps = 49/731 (6%)

Query: 4   PQLHTIFNR---FSVGKVSSKRSSITVDNGLKIILYQNNTVRYGFVNDADGNFKSITLEK 60
           P  H IF R    S  + +S R   T +   ++++ Q+ ++R+ +      N+ S T+  
Sbjct: 15  PTSHPIFKRNYLSSSFQETSPRFFFTTNRDNRVVVVQDGSIRWCYT--FSQNYHSYTIAS 72

Query: 61  EMIGDVSIIADQIGNYLCLFNEFEIRVIELPWKLWDAKEDSSFQLDNMVQIRSYDLKSFG 120
                   +    G+++C +++ +I ++E+PW   ++   SS    + +Q   Y  K + 
Sbjct: 73  RNFDIKDSLISNSGSFVCYYSDTDISIMEIPWSHSNSVNASS---SHCIQKYRYSFKKYS 129

Query: 121 TTIQKILFHPLGLAYPCLVVLLKNSNICSIDIKRILKVEEIPSTCITTFHTKGVMGLXXX 180
            T++++LFHPL     CLVVLL +  I  ID  +   +  + S  I    +K + GL   
Sbjct: 130 LTVKQVLFHPLATLESCLVVLLSDDTIVFIDFSKSFDL--LSSDYILNKKSKSI-GLSSQ 186

Query: 181 XXXXXXXXXXXXKLSLYALTE---TDIYLFYPFLIPTISVTKNEIDQLFQKSIILFENLE 237
                        L+LYAL+    TD+Y FYP L P+   +  +++ L  KS++ +E L 
Sbjct: 187 ISDIQSLTFSQDGLTLYALSSSAATDVYAFYPCLPPSAQFSLEQLENLVNKSVVQYEELR 246

Query: 238 NDSSEAVRRNIIKQLQLLSTLSGDIKTQMKQVKNTDETKIYNIDINTEYRSVNAQGSFSI 297
            D   A++ NIIKQL+  S L    K  +++  +TD +K +  D+  EYR +  QG F+I
Sbjct: 247 EDDPTALKINIIKQLKFTSDLYKKGKRALEE--DTD-SKTWKYDVPLEYRLIRPQGPFTI 303

Query: 298 APFPEELYKQSAVNLSVIQIGHGNELYVITYDDGTVLILYRDLESSMSWDSNDYTFNNSF 357
           +PFP+ LY  S  ++  + I   NEL V+++ DG+V+ L++DLE +MSWD +++  NNS 
Sbjct: 304 SPFPDSLYYSSPTHIVSVPIDTTNELLVLSFSDGSVVSLFQDLELTMSWDQDNFNENNSL 363

Query: 358 ILLEKLKFNPDETKSILDIPFKNGIFAIAGDQTVNLIDTSCWSDILSQCIKDNDIRNLAG 417
           +LLE +K      + +     + G F I G      + TS WS  L+ CIK +DIR+L+ 
Sbjct: 364 VLLELIKTKEQNIRKLTTYAHQYGTFYILGSVKNFEVLTSHWSSTLAICIKSSDIRDLSN 423

Query: 418 LSIESH-KQTINTLEEPNSCILWNEHNKKELLFITET---------KLISSD----ILES 463
           L I+S  K   N   E  S   W       LLFI ++         KL+ SD    +L S
Sbjct: 424 LLIKSVIKPFDNAAYELTSGGWWCSPTISSLLFINKSTVIELNEKPKLLLSDDTTHLLTS 483

Query: 464 NNESAEKLPVPAINDIKKIEKLQLKNYSQPIKEINIAVQRYKDSCKVPYSKVIPANIRQK 523
             E A+K  +P + D  KI K++L      I ++N     +K+      +  IP+  R  
Sbjct: 484 --ELAQKY-IPPLED--KIFKIELP-MGILISDLNNMNTVFKEESNKQLTIPIPSQERNV 537

Query: 524 PFANDENEDQLAYITEISQEIGSKILQGQTIALMMHTRLREQQDVFAEQLMHTNKELLHN 583
              N  NE+QL  +T+IS+ IG KI  GQ++   ++ ++ +QQ++   QL  T + L   
Sbjct: 538 TLFNKTNENQLETLTKISKVIGIKISMGQSLGFGIYNKILDQQNIVELQLRQTQRLLEKE 597

Query: 584 KTIKQTYDIQSTKIKHITERNTKLNERTSKLIEMMEKIKQSQ---QYKNMPINDSESKLF 640
           K +   Y+ Q+ K++  TER  KL    S+L+ M EK+K++       N+ I+  E + F
Sbjct: 598 KILNTKYNEQADKLRAFTERQEKL---MSRLLIMNEKLKKADLDTNLLNISISKKELEFF 654

Query: 641 KEIKKQVLIFNDAVNRQQEQQEAIKFLQTELNNIIEQPAQSHDAIID-SDEDEWNELCDL 699
           KEI+KQVL+FN+ V++Q++Q + + F++ EL  I     +  +AI+D +D  +W+ L D+
Sbjct: 655 KEIRKQVLLFNEFVHKQKDQHDTLLFIKKELIRI-----KGENAIVDENDFKQWDRLRDM 709

Query: 700 LNRDAKIIEDC 710
           L+ DA  IE C
Sbjct: 710 LHDDATTIETC 720

>KNAG0C05840 Chr3 (1135516..1137759) [2244 bp, 747 aa] {ON}
           Anc_1.319 YJL061W
          Length = 747

 Score =  305 bits (782), Expect = 2e-92,   Method: Compositional matrix adjust.
 Identities = 202/718 (28%), Positives = 353/718 (49%), Gaps = 61/718 (8%)

Query: 20  SKRSSITVDNGLKIILYQ--NNTVRYGFVNDADGNFKSITLEKEMIGDVSIIADQIGNYL 77
           S R   T D G K +     N  +R+G V++ + N   + +       V++I    G +L
Sbjct: 37  SSRYVFTTDKGTKYVYLDKTNGLLRWGSVSEDEYNSMPLKISNFADKSVNVILSDSGEFL 96

Query: 78  CLFNEFEIRVIELPWKLWDAKEDSSFQLDNMVQIRSYDLKSFGTTIQKILFHPLGLAYPC 137
           C++++  + VIE+PW+  + +E S     +  +IR     SF   I+K+LFHP  +   C
Sbjct: 97  CVYSKDCVTVIEVPWRYRNPEEMSYVFQTSFKEIRK---DSF---IKKVLFHPRAIKKTC 150

Query: 138 LVVLLKNSNICSIDIKRILKVE-EIPSTCITTFHTKGVMGLXXXXXXXXXXXXXXXKLSL 196
           +V+L ++  I   D++   K+   +PS         G +G+                L+L
Sbjct: 151 MVILFEDDTIYLFDVEDNNKIALNVPS---------GNIGIEDRITSIADIEFSQDGLTL 201

Query: 197 YALTE---TDIYLFYPFLIPTISVTKNEIDQLFQKSIILFENLENDSSEAVRRNIIKQLQ 253
           Y L+     D+Y  YP L P +++++ E+  L  +S++L+++L   +  AV++ +IKQ++
Sbjct: 202 YVLSAEDCGDVYAIYPCLPPILAMSQKELKSLMNRSVLLYDSLTETTPSAVKKGVIKQVE 261

Query: 254 LLSTLSGDIKTQMKQVKNTDETKIYNIDINTEYRSVNAQGSFSIAPFPEELYKQSAVNLS 313
            +S L  +I    +++ N        ++I+T YR    QG F+IAPFPE+LY  +A  + 
Sbjct: 262 FISQLQ-NISHGKEEISNV-------LEIDTIYRLAKPQGPFTIAPFPEKLYSATATEIC 313

Query: 314 VIQIGHGNELYVITYDDGTVLILYRDLESSMSWDSNDYTFNNSFILLEKLKFNPDETKSI 373
            + IG GNE+  I YD+GT L L++DLE SM+WD     +NNS +L+E+     +   SI
Sbjct: 314 PLNIGGGNEILCIAYDNGTALFLFKDLELSMAWDVGGIYYNNSLVLMEEFDLQTESAVSI 373

Query: 374 LD-------IPFK----------------NGIFAIAGDQTVNLIDTSCWSDILSQCIKDN 410
           L        I FK                +G   +     +  +DT  WS ++S CI  +
Sbjct: 374 LKSFKMDGLILFKVSDSVQHIDVSKSFIQDGDLLVQQSSMIRCVDTKAWSSVVSDCIDRH 433

Query: 411 DIRNLAGLSIESHKQTINTL-EEPNSCILWNEHNKKELLFITETKLISSDILESNNESAE 469
           DI  L  +S +S   T      +  SC  WN    + + +IT   +   ++     +   
Sbjct: 434 DINALITVSFKSKGHTWAIAGSDITSCGAWNHGGTEGVTWITNKSVTCKEL----KKQVS 489

Query: 470 KLPVPAINDIKKIEKLQLKNYSQPIKEINIAVQRYKDSCKVPYSKVIPANIRQKPFANDE 529
             P  + +  KK +      +S PI E+N     Y+D+C++ +  +I    RQKP  N  
Sbjct: 490 WKPEQSTSSEKKKQAFPKPEFSVPISELNALNINYQDTCRIGFHDIISPLDRQKPLLNPS 549

Query: 530 NEDQLAYITEISQEIGSKILQGQTIALMMHTRLREQQDVFAEQLMHTNKELLHNKTIKQT 589
           NE QL  +T +S  + + + +GQ + + ++ RL EQQ    +QL  +NK L+    I + 
Sbjct: 550 NEKQLQVMTSLSNYLLATVGKGQGLGMTLYNRLLEQQLELTKQLQCSNKILMKQPAIAKK 609

Query: 590 YDIQSTKIKHITERNTKLNERTSKLIEMMEKIKQSQQYKNMPINDSESKLFKEIKKQVLI 649
            + Q +       +  KL ER S L + +  I ++++  ++ I D ES  FKE+KK+ L 
Sbjct: 610 LEEQKSVWNEKLAKQNKLKERFSSLQQKLAAIDKTKKSTDLVITDEESVWFKEVKKEALT 669

Query: 650 FNDAVNRQQEQQEAIKFLQTELNNIIEQPAQSHDAIIDSDEDEWNELCDLLNRDAKII 707
           FND V +Q+  Q+ ++FL+ EL+  +    +    +  +   EW+ L ++L  D+ ++
Sbjct: 670 FNDLVYKQESVQDDLRFLKRELSTFVSDSQR----LPGTANTEWHSLQEMLKHDSLLL 723

>KLTH0H10692g Chr8 complement(921787..923862) [2076 bp, 691 aa] {ON}
           similar to uniprot|P40368 Saccharomyces cerevisiae
           YJL061W NUP82 Subunit of the nuclear pore complex (NPC)
           forms a subcomplex with Nup159p and Nsp1p interacts with
           Nup116p and is required for proper localization of
           Nup116p in the NPC
          Length = 691

 Score =  239 bits (610), Expect = 2e-68,   Method: Compositional matrix adjust.
 Identities = 194/725 (26%), Positives = 346/725 (47%), Gaps = 59/725 (8%)

Query: 4   PQLHTIFNRFSVGKVSSKRSSITVDNGLKIILYQNNTVRYGFVNDADGNFKSITLEKEMI 63
           P+ H IF   S+G+  S+R  +   +  + IL + N++++  ++  +  +    +E   I
Sbjct: 3   PEAHPIFQARSLGESRSERLCLHTKDLSRTILLEGNSLKWCLMDAPNYEY----MELNAI 58

Query: 64  GD-VSIIADQIGNYLCLFNEFEIRVIELPWKLWDAKEDSSFQLDNMVQIRSYDLKSFGTT 122
            +  S + +  G  LCL N  EI+V+ L W              +  +  SY +K     
Sbjct: 59  SNYTSAVLNDSGTLLCLNNVDEIQVLALSW--------------DQTRPESYRIK-VPAG 103

Query: 123 IQKILFHPLGLAYPCLVVLLKNSNICSIDIKRILKVEEIPSTCITTFHTKGVMGLXXXXX 182
           ++++L+HP G    CL VL K   I   ++  + +    P+T +     +  MG      
Sbjct: 104 VKQVLWHPRGRLDSCLTVLNKRDEILLYEL--LSEDFSAPTTVLNASTNELGMGSSVKDI 161

Query: 183 XXXXXXXXXXKLSLYALTE-TDIYLFYPFLIPTISVTKNEIDQLFQKSIILFENLENDSS 241
                      L L +++E  D++  YP +   +S+T+  +   F K+++ ++ L    S
Sbjct: 162 ESVCFSADGLTLYLMSVSEGADVFSIYPCMPSELSITRKALKYNFNKALLQYQELSEGDS 221

Query: 242 EAVRRNIIKQLQLLSTLSGDIKTQMKQVKNTDETK---IYNIDINTEYRSVNAQGSFSIA 298
             ++    +QL  +S+L         Q  + D+++   +    I   YR+  AQG F+I+
Sbjct: 222 PELKLKATRQLHFMSSL-------YNQPHDADDSQTNLLQTFHIRKAYRNARAQGPFTIS 274

Query: 299 PFPEELYKQSAVNLSVIQI-GHGNELYVITYDDGTVLILYRDLESSMSWDSNDYTFNNSF 357
           PFPE+LY  +A  +  I +     EL +IT+DD T+L  + DL   MSW+ +  +  NS 
Sbjct: 275 PFPEKLYLATAKQIKAIALEDETTELLLITFDDDTILECFPDLTPVMSWEDSGSSEKNSL 334

Query: 358 ILLEKLKFNPDETKSILDIPFKNGIFAIAGDQTVNLIDTSCWSDILSQCIKDNDIRNLAG 417
           I +  LK  P     I         F +   +   +++ S  +  + + + D D   L+ 
Sbjct: 335 ISVGSLKL-PGSISLIY-----GSCFVLISAEKAAVVNLSRLTRSIERSLDDCDATELSE 388

Query: 418 LSI-ESHKQTINTLEEPNSCILWNEHNKKELLFITETKLISSDILESNNESAEKLPVPAI 476
             + E   +   T +   S  LW E   ++++ ++E ++ S DI          +  PA 
Sbjct: 389 EDLTEEITEKKGTFQ---SAGLWPESGMQKIVLLSEKEITSIDI--------SSMQTPAS 437

Query: 477 NDIKKIEKLQL---KNYSQPIKEINIAVQRYKDSCKVPYSKVIPANIRQKPFANDENEDQ 533
           +  +KIEK +    + YSQP+ E+    Q+ +   K P S VIPA +RQK   N +NEDQ
Sbjct: 438 STTEKIEKSETNRQRPYSQPLSEVQTLNQKVQSLLKSPLSTVIPAALRQKTLNNTDNEDQ 497

Query: 534 LAYITEISQEIGSKILQGQTIALMMHTRLREQQDVFAEQLMHTNKELLHNKTIKQTYDIQ 593
           L+ +T+IS+E+ S++   QT+ L +H RL  QQD  A+ L   ++     + +      Q
Sbjct: 498 LSLLTDISKEVLSRVTLAQTLGLSLHLRLLGQQDELAQHLRDVSELRTKKERVSAHLASQ 557

Query: 594 STKIKHITERNTKLNERTSKLIEMMEKIKQSQQYKNMPINDSESKLFKEIKKQVLIFNDA 653
             + + I E+N  +  R   L   M +I +S Q ++ PI  +E + FKE++ QV+ FN  
Sbjct: 558 KPRWEAIQEKNKSIALRFESLHRNMTQISKSSQLQSQPIAKAEMEWFKELRNQVVRFNRL 617

Query: 654 VNRQQEQQEAIKFLQTELNNI----IEQPAQSHDAIIDSDEDEWNELCDLLNRDAKIIED 709
           V+ QQ+  EA+  L+  L  +     E  ++S  +   +    W+EL  +L +D++II++
Sbjct: 618 VHEQQDLAEALSSLKLSLEYVRVDSAEAASRSKKSAESAGGVPWDELQAMLAKDSRIIKE 677

Query: 710 CNAEL 714
           C AEL
Sbjct: 678 CQAEL 682

>CAGL0J05214g Chr10 complement(501919..504069) [2151 bp, 716 aa]
           {ON} similar to uniprot|P40368 Saccharomyces cerevisiae
           YJL061w NUP82 nuclear pore protein
          Length = 716

 Score =  232 bits (591), Expect = 2e-65,   Method: Compositional matrix adjust.
 Identities = 194/720 (26%), Positives = 338/720 (46%), Gaps = 50/720 (6%)

Query: 19  SSKRSSITVDNGLKII-LYQNNTVRYGFVNDADGNFKSITLEKEMIGDV-SIIADQIGNY 76
           +++R   +  +G KI+ +     +R+   +     +KS+  + +  G V   ++    +Y
Sbjct: 17  AAQRFLFSSSDGTKIVSIADRGHLRW--CHSTSTTYKSLDFDLQFEGKVEGAVSSTTADY 74

Query: 77  LCLFNEFEIRVIELPWKLWDAKEDSSFQLDNMVQIRSYDLKSFGTTIQKILFHPLGLAYP 136
           +C++N  E+ V+E+PW ++  +E+    L ++  I S+       +I+++LFHP      
Sbjct: 75  VCIYNRDELHVLEVPW-MYSGEENG---LKHLCHIYSHKFDE-NHSIKQVLFHPKSYLDS 129

Query: 137 CLVVLLKNSNICSIDIKRILKVEEIPSTCITTFHTKGVMGLXXXXXXXXXXXXXXXKLSL 196
            ++VL  + +I  I+              I        +GL                LSL
Sbjct: 130 TILVLTNDDSIFMINTDD----NRSDKNMINLNSKNSALGLYDRINDIQKIIFSQDGLSL 185

Query: 197 YALTE---TDIYLFYPFLIPTISVTKNEIDQLFQKSIILFENLENDSSEAVRRNIIKQLQ 253
             L+     DI+  YP L     ++ +E+D LF KS++L+ N+  +++   +RNI+KQL 
Sbjct: 186 LILSAEEGCDIFTIYPCLPRRWDISLHEVDTLFAKSLLLYNNMNVNTTPQEKRNIVKQLN 245

Query: 254 LLSTLSGDIKTQMKQVKNTDETKIYNIDINTEYRSVNAQGSFSIAPFPEELYKQSAVNLS 313
            +  + G    Q    +N  +  I    +   Y +   QG FS+ P+P ELY   A +++
Sbjct: 246 FMEKIRG----QKTAFRNDKKPLI----LEDAYLNAQPQGPFSMTPYPNELYDFMATDIN 297

Query: 314 VIQIGHGNELYVITYDDGTVLILYRDLESSMSWDSNDYTFNNSFILLEKLKFNPDETKSI 373
           +IQI     L  I + +GTVL+   DLE  MSWD + +  +NS  LLE++K    +    
Sbjct: 298 IIQITQNISLLAIAFSNGTVLLFLSDLEPIMSWDISRFPGSNSLALLEQIKLEITDNAKF 357

Query: 374 LDIPFKNGIFAIAGDQTVNLIDTSC-WSDILSQCIKDNDIRNLAGLSIESHKQTINTLEE 432
           L IP   G F +  +   N    +C WS IL+Q I D+DI+ LA L ++S+ + +  L  
Sbjct: 358 LSIPGTYGKFVVTDNVKSNFFVNTCDWSTILAQIIDDSDIKLLANLKVKSNIENLQQLAT 417

Query: 433 P-NSCILWNEHNKKELLFITETKLISSDIL-------------ESNNESAEKLPVPAI-N 477
              S I W   N      I++ K+   D+L             +SN++   KL +P + N
Sbjct: 418 TFKSIIYWKNENISCNYIISDKKIEELDMLDGISSTTKHKLIDQSNSQVESKLDLPELKN 477

Query: 478 DIKKIEKLQLKNYSQPIKEINIAVQRYKDSCKVPYSKVIPANIRQKPFANDENEDQLAYI 537
            + +++      +++P+ EI    Q Y  + +      IP  IR  P  N  NE+QL  +
Sbjct: 478 GLYEVK------FARPLTEIQHYEQIYYKNLQNQNFTKIPLEIRSAPLKNSSNENQLESL 531

Query: 538 TEISQEIGSKILQGQTIALMMHTRLREQQDVFAEQLMHTNKELLHNKTIKQTYDIQSTKI 597
           T+IS+     I   QT+  +   R+ +  + F+ Q+  T +        +Q  ++Q+TKI
Sbjct: 532 TKISESYMKMISMAQTLGYIYRKRMIDSIEEFSRQIETTYQINKFWDNFEQIREVQNTKI 591

Query: 598 KHITERNTKLNERTSKLIEMMEKIKQSQQYKNMPINDSESKLFKEIKKQVLIFNDAVNRQ 657
             + E+  KL ER S L + +E  K+     N  I+ +ES+ F EIK+ V+ FN  V + 
Sbjct: 592 DKVKEKQQKLMERLSSLYDKVEGQKEMGSMNNSNISAAESEWFAEIKRSVIEFNSYVRKA 651

Query: 658 QEQQEAIKFLQTELNNIIEQPAQSHDAIIDSDEDEWNELCDLLNRDAKIIEDCNAELSSA 717
               + ++F++ +   I  Q       I   +  EWN+L  LL  D KII +   +  +A
Sbjct: 652 STNHQELEFIKEQQAQIANQKPD----ISSENGKEWNDLQQLLRTDLKIISEFEKKCDTA 707

>Kwal_14.2580 s14 complement(821497..823560) [2064 bp, 687 aa] {ON}
           YJL061W (NUP82) - 82-kDa protein, with putative
           coiled-coil domain, has carboxy-terminal domain,
           containing heptad repeats, that binds Nsp1p; nucleoporin
           [contig 224] FULL
          Length = 687

 Score =  228 bits (581), Expect = 2e-64,   Method: Compositional matrix adjust.
 Identities = 196/731 (26%), Positives = 345/731 (47%), Gaps = 67/731 (9%)

Query: 4   PQLHTIFNRFSVGKVSSKRSSITVDNGLKIILYQNNTVRYGFVNDADGNFKSITLEKE-M 62
           P+ H IF+  +     S+R    +    K  + Q NT+R+     + G  +   LE E  
Sbjct: 3   PESHPIFDTKTNSSGKSRRFVFNIGIASKYGVLQGNTLRWC----SAGGHEYQYLEFEPR 58

Query: 63  IGDVSIIADQIGNYLCLFNEFEIRVIELPWKLWDAKEDSSFQLDNMVQIRSYDLKSFGTT 122
           I   S++ ++ G+ LCL+N  +++++ + W   ++K D+              L S    
Sbjct: 59  IDYTSVVINESGSLLCLYNSKQVQILAVSWD--ESKSDTI-------------LISPPAG 103

Query: 123 IQKILFHPLGLAYPCLVVLLKNSNICSIDIKRILKVEEIPSTCITTFHTKGVMGLXXXXX 182
           I++ L+HP G    CL VL     IC   +  +L  +    T I    TK  +G+     
Sbjct: 104 IKQALWHPRGRLGSCLAVLTTQDEIC---LYELLTEDYTEPTTILNTCTKE-LGMGSVVK 159

Query: 183 XXXXXXXXXXKLSLYALTET---DIYLFYPFLIPTISVTKNEIDQLFQKSIILFENLEND 239
                      L+LY L+ +   DIY  YP L   + ++   +  +F K+++ +++L ++
Sbjct: 160 DITSMSFSSDGLTLYLLSTSEGADIYSIYPCLPSEMEISGALLKSVFNKALLQYQDLNDN 219

Query: 240 SSEAVRRNIIKQLQLLSTLSGDIKTQMKQVKNT-DETKIYNIDINTEYRSVNAQGSFSIA 298
            S  +RR + KQLQ +S L         Q KN   +T+ + + I+  +RS  AQG F+I 
Sbjct: 220 DSPDLRRKVTKQLQFVSKL---------QKKNDYKDTESHVVTISKAHRSPRAQGPFTIN 270

Query: 299 PFPEELYKQSAVNLSVIQI-GHGNELYVITYDDGTVLILYRDLESSMSWDSNDYTFNNSF 357
           PFP+ LY  +   + VI++ G   EL +I++DDGT+L  + D E  MSW+   +  NNS 
Sbjct: 271 PFPDNLYLATGRQVEVIKLQGCAAELLLISFDDGTILECFPDREPVMSWEDEGFCENNSL 330

Query: 358 ILLEKLKFNPDETKSILDIPFKNG-IFAIAGDQTVNLIDTSCWSDILSQCIKDNDIRNL- 415
           I+L  +    +       I   NG  F +     V  +     + ++   + D DI    
Sbjct: 331 IVLGSVNIGGE-------IALVNGYTFVVLSSAKVTFVSLRKLAQVIESSLNDCDISYFD 383

Query: 416 -AGLSIESHKQTINTLEEPNSCILWNEHNKKELLFITETKLISSDILESNNESAEKLPVP 474
            A LS    ++ +       S I+     K  +  ++ET     DI  S       L  P
Sbjct: 384 EADLS----EEVVEKNGRFCSAIICASSEKSCVALLSETTTSHIDIPFS-------LDAP 432

Query: 475 AIN---DIKKIEKLQLKNYSQPIKEINIAVQRYKDSCKVPYSKVIPANIRQKPFANDENE 531
            +       K +  Q + Y QP+ E+    ++ +   K P    +  ++RQ    N+ NE
Sbjct: 433 KMRTALGTAKTDVEQYRPYGQPLNEVLALNEKVQALLKKPLQTGVSPSLRQAKLNNESNE 492

Query: 532 DQLAYITEISQEIGSKILQGQTIALMMHTRLREQQDVFAEQLMHTNK-ELLHNKTIKQTY 590
           DQL+ +T IS+E+ ++I   QT+AL ++ RL  QQ    + L   +K E L +K +++  
Sbjct: 493 DQLSLLTSISKEVMTRIASAQTLALSLYLRLSCQQGELTQHLETVSKVEELQSKVLRRLK 552

Query: 591 DIQSTKIKHITERNTKLNERTSKLIEMMEKIKQSQQYKNMPINDSESKLFKEIKKQVLIF 650
           D QS++ +    +N  ++ R  ++   ++++  S ++++ PI++ E + FKEI+ QV+ F
Sbjct: 553 D-QSSRWEAAQAKNKSISSRLEQISSKLKQVSSSGKFQSQPISNHELEWFKEIRDQVIRF 611

Query: 651 NDAVNRQQEQQEAIKFLQTELN--NIIEQPAQSHDAIIDS-DEDEWNELCDLLNRDAKII 707
           N  V+ QQ     +  L+ EL   ++  +  +S  +  D+ DE  W+EL  LL +D +II
Sbjct: 612 NRLVHEQQSLGNTLSNLKCELEYVHVESKEGKSGSSSADNKDEVPWDELRALLAKDLRII 671

Query: 708 EDCNAELSSAS 718
            +C   L   +
Sbjct: 672 GECQDSLQGVA 682

>Ecym_6290 Chr6 (543547..545562) [2016 bp, 671 aa] {ON} similar to
           Ashbya gossypii AEL168C
          Length = 671

 Score =  176 bits (445), Expect = 6e-46,   Method: Compositional matrix adjust.
 Identities = 156/603 (25%), Positives = 298/603 (49%), Gaps = 44/603 (7%)

Query: 123 IQKILFHPLGLAYPCLVVLLKNSNICSIDIKRILKVEEIPSTCITTFHTKGVMGLXXXXX 182
           I+++L+HPL     CLVVL K +   +I++  + K   +  T +        +G+     
Sbjct: 97  IKQVLWHPLAYLDSCLVVLTKEN---TIELYELAKANFMYPTVVLN-EKLPQLGISSHVS 152

Query: 183 XXXXXXXXXXKLSLYALT---ETDIYLFYPFLIPTISVTKNEIDQLFQKSIILFENLEND 239
                      L+LY L+     D+Y  +P L   + + ++  +  + K+  L+E+++ D
Sbjct: 153 EICSMAFSPDGLTLYLLSLEEGGDVYALHPLLPSRLRIKRSFWESQWYKATALYESIDKD 212

Query: 240 SSEAVRRNIIKQLQLLSTLSGDIKTQMKQVKNTDETKIYNIDINTEYRSVNAQGSFSIAP 299
           +    +  +I+    +S +   I           +++ ++++I    R V  +G FSI  
Sbjct: 213 TPNEKKIAMIEHFDFVSKIYKMID---------KDSEFFDVNIPEHKRMVTPRGPFSIYG 263

Query: 300 FPEELYKQSAVNLSVIQIG-HGNELYVITYDDGTVLILYRDLESSMSWDSNDYTFNN--S 356
           FPEELY  +A  L  + +   G  + ++++DDGT+L L+ D+E  MSW     + NN  S
Sbjct: 264 FPEELYNTTATKLITLPVNDEGAYVLILSFDDGTILSLFPDIELLMSWSR---SLNNACS 320

Query: 357 FILLEKLKFNPDETKSILDIPFKNGIFAIAGDQTVNLIDTSCWSDILSQCIKDNDIRNLA 416
           F+L+EK +   +    I  I  ++G+ AI      +++    +   L +CIK+ DI  + 
Sbjct: 321 FVLIEKFRAGGE----IFAI--ESGV-AILEKNNAHIVRFP-YLKALGECIKEGDIAPMV 372

Query: 417 GLSIESHKQTINTLEEPNSCILWNEHNKKELLFITETKLISSDILESNNESAEKLPV-PA 475
            + + S    +      ++ + WNE + K +LFI  + + S  I +    S+ K  V PA
Sbjct: 373 DVKLTSDITPLAG--SYHTVVTWNEPSTKGILFIGNSVIRS--IPDDVGLSSFKPRVDPA 428

Query: 476 INDIKKIEKLQLKNYSQPIKEINIAVQRYKDSCKVPYSKVIPANIRQKPFANDENEDQLA 535
           I+   K   +   +  + + + N A+Q    + + P   ++P   +  P  ++ NE QLA
Sbjct: 429 ISQNGKY-TVCFPSTMEELLKTNKALQH---TLRQPLP-LVPLEQKNVPLNSEFNEHQLA 483

Query: 536 YITEISQEIGSKILQGQTIALMMHTRLREQQDVFAEQLMHTNKELLHNKTIKQTYDIQST 595
            +T+IS E+  +I+  Q++  +M+ R   QQ     QL   +K    + T+KQ     + 
Sbjct: 484 TLTKISTEVMDRIILAQSLGYLMYNRAATQQFELCRQLETVSKLNDRSVTLKQNTKSLTC 543

Query: 596 KIKHITERNTKLNERTSKLIEMMEKIKQSQQYKNMPINDSESKLFKEIKKQVLIFNDAVN 655
           ++  +++++  L  R  KL + ++K+ +S ++  +P++  E   F+E+K  VL FN+ V 
Sbjct: 544 RLDSVSKKDIALRSRLEKLQQSLDKVNESPKFNELPLSMKERAWFRELKNDVLAFNEYVL 603

Query: 656 RQQEQQEAIKFLQTELNNIIEQPAQSHDAIIDSDEDEWNELCDLLNRDAKIIEDCNAELS 715
           +  +  E + FL+ EL  +IE    +H  I + +   + +L DLL  D+K+I DCN +L 
Sbjct: 604 QNSKLCEELNFLKKEL-ELIE---SNHGNIPNEELFNFEKLQDLLTLDSKMIGDCNDQLL 659

Query: 716 SAS 718
           +A+
Sbjct: 660 AAA 662

>AEL168C Chr5 complement(320121..322142) [2022 bp, 673 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YJL061W
           (NUP82)
          Length = 673

 Score =  162 bits (409), Expect = 3e-41,   Method: Compositional matrix adjust.
 Identities = 169/735 (22%), Positives = 318/735 (43%), Gaps = 89/735 (12%)

Query: 2   VSPQLHTIFNRFSVGKVSSKRSSITVDNGLKIILYQNNTVRYGFVNDADGNFKSITLEKE 61
           ++ +LH IFN  ++G  S +  + T  +G KI+ Y N  +R G   +    +KS     E
Sbjct: 1   MTGELHPIFNADALG-ASHRLHAHTHGDGTKIVGYYNKHLRLGRFTEQ--TYKS--WHAE 55

Query: 62  MIGDVSIIADQIGNYLCLFNEFEIRVIELPWKLWDAKEDSSFQLDNMVQIRSYDLKSFGT 121
           +    S I +  G+ L  + +  I V++        +E     L            +   
Sbjct: 56  VDAKASSILNGSGSLLAFYGDHIIEVVD--------REGKKITL------------TVNG 95

Query: 122 TIQKILFHPLGLAYPCLVVLLKNSNICSIDIKRILKVEEIPSTCITTFHTKGVMGLXXXX 181
            I+++L+HPL     CLVVL     I   ++       E P+  +    ++  +G+    
Sbjct: 96  GIKQVLWHPLAYLDSCLVVLTGQETIEIYELNE--PRYEKPTLVLNEPTSQ--LGISSRV 151

Query: 182 XXXXXXXXXXXKLSLYALTET---DIYLFYPFLIPTISVTKNEIDQLFQKSIILFENLEN 238
                       LSLY  + +   D+++  P L   I   + +  + + K+  L+  L  
Sbjct: 152 IDITNIAFAPDGLSLYLFSTSEGGDVHVICPLLPSRIKADRAKWARQWNKATALYSTLTK 211

Query: 239 DSSEAVRRNIIKQLQLLSTLSGDIKTQMKQVKNTDETKIYNIDINTEYRSVNAQGSFSIA 298
           D+ +  +   I+ L+ ++ L   I+      KN  + ++    I    R   +QG ++I 
Sbjct: 212 DTPDDAKVATIEYLEFVTQLLQAIE------KNGSDGELV---IPEHRRRTISQGPYNIH 262

Query: 299 PFPEELYKQSAVNLSVIQIGHGN-ELYVITYDDGTVLILYRDLESSMSWDSNDYTFNNSF 357
            FPE+LY      L+V+ +G     L ++++DD T ++L+   E  MSW  +     N++
Sbjct: 263 GFPEKLYSAVGTKLTVVPLGESEAHLLLLSFDDSTNILLFPSTEVLMSWTKD---LKNAY 319

Query: 358 ILLEKLKFNPDETKSILDIPFKNGIFAIAGDQTVNLIDTSCWSDI-----LSQCIKDNDI 412
            L+   +F    T            FA      V  ID++   +I     L  CI+D ++
Sbjct: 320 TLMLVEEFTATGTA-----------FATCDGVAVLGIDSAQRVEIPYLQALEDCIRDCNL 368

Query: 413 RNLAGLS-------IESHKQTINTLEEPN--SCILWNEHNKKELLFITETKLISSDILES 463
             L  ++       I     ++     P     IL  +H+ K    +  T+   SD    
Sbjct: 369 AALQDINFTSSICKIPGKFHSVARFNAPGNKGIILVGDHHAK---IVPSTEAAKSDTETE 425

Query: 464 NNESAEKLPVPAINDIKKIEKLQLKNYSQPIKEINIAVQRYKDSCKVPYSKVIPANIRQK 523
            +    K P   +            N  + I   N  +QR K    +P   ++P  ++  
Sbjct: 426 LDSQPGKEPTYTVC---------FPNSLEEILNTNKELQRRKHQ-PLP---LVPPALKNI 472

Query: 524 PFANDENEDQLAYITEISQEIGSKILQGQTIALMMHTRLREQQDVFAEQLMHTNKELLHN 583
           P  +D NE  LA +T IS+E+  +I+  Q+  L+MH RL  QQ     Q+         +
Sbjct: 473 PLNSDLNEQHLATLTNISKEVMDRIILSQSAGLLMHNRLSLQQYELHRQVETVADICSRH 532

Query: 584 KTIKQTYDIQSTKIKHITERNTKLNERTSKLIEMMEKIKQSQQYKNMPINDSESKLFKEI 643
             ++ + +  S+++  + +R+ +L +R   L   + +I  S ++ ++P++  E+  F+E+
Sbjct: 533 SVLRDSSEAMSSRLTSVLKRDRRLKQRLCMLQSTLNRINSSHKFSDLPLSKKEADWFREL 592

Query: 644 KKQVLIFNDAVNRQQEQQEAIKFLQTELNNIIEQPAQSHDAIIDSDEDEWNELCDLLNRD 703
           K Q + FND V +  + ++ + FL+ EL ++ E   + HD   + +  ++  L +LL  D
Sbjct: 593 KNQAISFNDYVLQSAQLRDELAFLKNELESLPEH--RQHDR-QEEEPFDFRRLQELLKLD 649

Query: 704 AKIIEDCNAELSSAS 718
           +KII +C   LS+A+
Sbjct: 650 SKIITECTDNLSAAA 664

>KLLA0F01661g Chr6 complement(156609..158672) [2064 bp, 687 aa] {ON}
           weakly similar to uniprot|P40368 Saccharomyces
           cerevisiae YJL061W NUP82 Subunit of the nuclear pore
           complex (NPC) forms a subcomplex with Nup159p and Nsp1p
           interacts with Nup116p and is required for proper
           localization of Nup116p in the NPC
          Length = 687

 Score =  157 bits (396), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 182/729 (24%), Positives = 323/729 (44%), Gaps = 107/729 (14%)

Query: 25  ITVDNGLKIILYQNNTVRYGFVNDADGNFKSITLEKEMIGDVSIIADQIGNYLCLFNEFE 84
           +  +N   I L+Q+N +R    +D +  ++S  +E   + +  +I+   G  +      E
Sbjct: 24  LVCNNSNTIYLWQDNILRVQ--SDHETQYRSYNVELPFVPEQMVISPS-GGLVAFHANSE 80

Query: 85  IRVIELPWKLWDAKEDSSFQLDNMVQIRSYDLKSFGTTIQKILFHPLGLAYPCLVVLLKN 144
           + V+E+               +   ++R +   S G  I+K+L+HPL       V+L  +
Sbjct: 81  LYVMEV---------------NEQSRLRKHFNTSLG--IKKLLWHPLATYGLSFVILHDD 123

Query: 145 SNICSIDIKRILKVEEIPSTCITTFHTKG-VMGLXXXXXXXXXXXXXXXKLSLYALTE-- 201
           S I      RI  +E++    IT F+ K    GL                L+LY L+   
Sbjct: 124 STI------RIYDLEDLEPESITVFNRKSRSFGLSDHVESVCDIAFDPTGLTLYLLSSFN 177

Query: 202 -TDIYLFYPFLIPTISVTKNEI-------------DQLFQKSIILFENLENDSSEAVRRN 247
             DIY  +P L    S+  N+              D +  KS+ L+ +L+          
Sbjct: 178 YCDIYAIHPCLPKNFSLRSNDTSNVTSRTKNGSLADYMLHKSLSLYNSLD---------- 227

Query: 248 IIKQLQLLSTLSGDIKTQ--------MKQVKNTDETKIYNIDINT----EYRSVNAQGSF 295
             KQL+L+S    D+++         +KQ++  D  K  N  I+T      R+   QG F
Sbjct: 228 --KQLKLISGSDPDVESDYLTLKHDLLKQIQFFDNYK-KNDGIDTFTSKAIRNSVPQGPF 284

Query: 296 SIAPFPEELYKQSAVNLSVIQIGHGNELYVITYDDGTVLILYRDLESSMSWD-SNDYTFN 354
            I  FP  L  +    L++I +G    L  + + DGT ++L+ D E  MSW   ++ TFN
Sbjct: 285 IIKKFPTALNAKEVTGLTIIPVGERLGLLNLQFIDGTNVVLFSDSEIVMSWSLRSNTTFN 344

Query: 355 NSFILLEKLKFNPDETKSILDIPFKNGIFAIAGDQTVNLIDTSCWSDILSQCIKDNDIRN 414
           N  ++     FN      +L+      +F   GD +  +++   W + L+QCI+ +D   
Sbjct: 345 NLSVIT---MFNAKGQCQLLNSSEPKLVFT--GDSSTTIMEMP-WLEPLAQCIRLHDFSI 398

Query: 415 LAGLSIESHKQTIN-----TLEEPNSCILWNEHNKKELLFITETKLISSDILESNNESAE 469
           +  +  E+  +T++      L   +  IL+N ++ K              ++ESN++S  
Sbjct: 399 IDDVKFENKIRTVSGTFLGVLSTLSGDILYNGNSFK--------------VIESNDKSTT 444

Query: 470 KLPVPAINDIKKIEKLQLKNYSQPIKEINIAVQRYKDSCKVPYSKVIPANIRQKPFANDE 529
           + P+   +++K   K  L       KE+++ + +YK      +   IP ++   P  N+ 
Sbjct: 445 QKPINRTDEVKYTYKPSLPTSG---KELDMLLTKYKTEAN-GFISGIPDSLAPLPLKNNS 500

Query: 530 NEDQLAYITEISQEIGSKILQGQTIALMMHTRLREQQDVFAEQLMHTNK-ELLHNKTIKQ 588
           NE QL  ++E+ +E   ++  GQ I   M  +  E+      QL  TN+ E+L NK    
Sbjct: 501 NERQLEVVSELYKETMKRVKLGQMILFRMFNKSNEEVAELHRQLRKTNEIEMLRNKLNGN 560

Query: 589 TYDIQSTKIKHITERNTKLNERTSKLIEMMEKIKQSQQYKNMPINDSESKLFKEIKKQVL 648
             D+Q  +     E++  L +R  KL E    I+ +++ +   I+++E   FK IK QVL
Sbjct: 561 LGDLQE-RYSRYEEKSKTLEKRLDKLKETFSSIENNEKLRTSSISEAELVWFKSIKNQVL 619

Query: 649 IFNDAVNRQQEQQEAIKFLQTELNNIIEQPAQSHDAIIDSDEDEWNELCDLLNRDAKIIE 708
            FN+ V+   + +E ++FL T+L +      +  D      E E++ L  +L  D K+I 
Sbjct: 620 KFNNYVHLTNKLREELEFLDTQLRST----TKGDDFF---SELEFSSLQQMLLNDKKVIN 672

Query: 709 DCNAELSSA 717
            C  ELS++
Sbjct: 673 SCMNELSAS 681

>Suva_6.245 Chr6 (438131..439315) [1185 bp, 394 aa] {ON} YJL164C
           (REAL)
          Length = 394

 Score = 32.0 bits (71), Expect = 5.5,   Method: Compositional matrix adjust.
 Identities = 25/79 (31%), Positives = 42/79 (53%), Gaps = 7/79 (8%)

Query: 512 YSKVIPANIRQKPFANDENEDQLAYI--TEISQEIGSKILQGQTIALMMHTRLREQQDVF 569
           Y K++ A +R  PF ND+ +D L+ +   ++SQ +G+  LQ  T  +  H   +E   V 
Sbjct: 288 YEKILNAELRFPPFFNDDVKDLLSRLITRDLSQRLGN--LQNGTEDVKNHPWFKE---VV 342

Query: 570 AEQLMHTNKELLHNKTIKQ 588
            E+L+  N E  +   I+Q
Sbjct: 343 WEKLLSRNIETPYEPPIQQ 361

>Smik_13.397 Chr13 (631479..633656) [2178 bp, 725 aa] {ON} YMR192W
           (REAL)
          Length = 725

 Score = 31.6 bits (70), Expect = 9.6,   Method: Compositional matrix adjust.
 Identities = 46/161 (28%), Positives = 65/161 (40%), Gaps = 26/161 (16%)

Query: 375 DIPFKNGIFAIAGDQTVNL---------IDTSCWSDILSQCIKD----NDIRNLAGLSIE 421
           DI  KNG+  I GD+  NL           +SC S+   Q +KD    ND+ N    SI+
Sbjct: 39  DIALKNGMSTIEGDEQANLDKEEAVLTNTSSSCHSN---QSMKDAASINDLSNTHEASIQ 95

Query: 422 SHKQTINTLEEPNSCILWNEHNKKELLFITETKLISSDILESNNESAEK-LPVPAINDIK 480
           +  +    L +  S  L  E +K E       K I+S  L S  ++ E  +PVP      
Sbjct: 96  TGGEAEALLSKDLSQQLETEESKVE----EALKRITSPPLPSRVDNVENCMPVPLKASSP 151

Query: 481 KIEKLQLKN----YSQPIKEINIAVQRYKDSCKVPYSKVIP 517
            +   + KN    + QP       V       K P+  VIP
Sbjct: 152 PVPP-RYKNGKASFDQPQLPPRQMVNAETLHLKTPHGNVIP 191

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.316    0.133    0.372 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 77,978,085
Number of extensions: 3620497
Number of successful extensions: 17485
Number of sequences better than 10.0: 449
Number of HSP's gapped: 18293
Number of HSP's successfully gapped: 531
Length of query: 721
Length of database: 53,481,399
Length adjustment: 117
Effective length of query: 604
Effective length of database: 40,065,477
Effective search space: 24199548108
Effective search space used: 24199548108
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 69 (31.2 bits)