Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
TPHA0O013103.454ON43843822090.0
Kpol_1035.93.454ON42738212051e-163
TDEL0F033903.454ON42438511961e-162
SAKL0B06116g3.454ON43137911661e-157
Suva_7.3953.454ON45138711671e-157
Smik_6.2003.454ON44538711631e-157
ZYRO0C06270g3.454ON43038511601e-156
Skud_7.4153.454ON45239011551e-155
YGR110W (CLD1)3.454ON44538711281e-151
KAFR0I019703.454ON41137711241e-151
KLTH0E13948g3.454ON43837811051e-148
Kwal_27.123173.454ON43537711001e-147
ABL019W3.454ON43138010991e-147
Ecym_24653.454ON43838110991e-147
NCAS0E008603.454ON44038110831e-145
NDAI0G010903.454ON45638010811e-144
KNAG0B009503.454ON41837410711e-143
CAGL0L04686g3.454ON45140510311e-137
KLLA0B12914g3.454ON4263749201e-120
TBLA0F034603.454ON4413969021e-117
KLTH0C01254gna 1ON4344104031e-43
Kwal_14.985na 1ON4354143793e-40
SAKL0G19074gna 1ON4324173312e-33
Ecym_5577singletonON4334143312e-33
Suva_10.1838.284ON3943561811e-13
Skud_12.1678.284ON3943471801e-13
Skud_4.3868.284ON4463421783e-13
TDEL0F041008.284ON4343581774e-13
YLR099C (ICT1)8.284ON3943341747e-13
Smik_12.1588.284ON3943341667e-12
KAFR0B053808.284ON4114031659e-12
Suva_2.2888.284ON4353371613e-11
Smik_4.3718.284ON4353401604e-11
Kpol_543.498.284ON4293431561e-10
KNAG0H031208.284ON4343531552e-10
Kwal_56.237028.284ON4163311552e-10
ZYRO0D06666g8.284ON3803971472e-09
SAKL0H16500g8.284ON4193581472e-09
NCAS0B051208.284ON3963801462e-09
YDR125C (ECM18)8.284ON4533331427e-09
NDAI0J012108.284ON4163731418e-09
KLTH0G13178g8.284ON4153331373e-08
CAGL0B01969g8.284ON4233281363e-08
TPHA0A016908.284ON4053721355e-08
KAFR0B028308.284ON3913731346e-08
KLLA0F19624g8.284ON4093471311e-07
AGR062C8.284ON3843761312e-07
KNAG0G021408.284ON4083431293e-07
Ecym_42858.284ON4053701284e-07
CAGL0M11462g8.284ON3863621241e-06
NCAS0B037108.284ON4303241152e-05
NDAI0J01200singletonON4273451142e-05
TPHA0L016008.524ON372172960.003
TBLA0H014008.284ON421142960.003
KNAG0A037708.524ON356118890.017
CAGL0J08547g5.693ON379140850.057
KNAG0E032408.37ON37054830.10
NCAS0B022608.524ON363121800.28
Kpol_1030.465.358ON369101751.0
Kpol_2000.611.87ON286116731.6
TDEL0D00200singletonON56763732.0
SAKL0H10450g8.524ON392118704.1
CAGL0C00297g1.170ON71697695.8
NDAI0E001208.880ON749154696.8
TPHA0L016608.539ON54774696.8
Kpol_1000.244.373ON158053697.5
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= TPHA0O01310
         (438 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

TPHA0O01310 Chr15 complement(258745..260061) [1317 bp, 438 aa] {...   855   0.0  
Kpol_1035.9 s1035 complement(19721..21004) [1284 bp, 427 aa] {ON...   468   e-163
TDEL0F03390 Chr6 (624579..625853) [1275 bp, 424 aa] {ON} Anc_3.4...   465   e-162
SAKL0B06116g Chr2 complement(519929..521224) [1296 bp, 431 aa] {...   453   e-157
Suva_7.395 Chr7 (684763..686118) [1356 bp, 451 aa] {ON} YGR110W ...   454   e-157
Smik_6.200 Chr6 (329969..331306) [1338 bp, 445 aa] {ON} YGR110W ...   452   e-157
ZYRO0C06270g Chr3 (475283..476575) [1293 bp, 430 aa] {ON} simila...   451   e-156
Skud_7.415 Chr7 (692655..694013) [1359 bp, 452 aa] {ON} YGR110W ...   449   e-155
YGR110W Chr7 (713709..715046) [1338 bp, 445 aa] {ON}  CLD1Mitoch...   439   e-151
KAFR0I01970 Chr9 (401907..403142) [1236 bp, 411 aa] {ON}              437   e-151
KLTH0E13948g Chr5 complement(1231122..1232438) [1317 bp, 438 aa]...   430   e-148
Kwal_27.12317 s27 complement(1173365..1174672) [1308 bp, 435 aa]...   428   e-147
ABL019W Chr2 (361560..362855) [1296 bp, 431 aa] {ON} Non-synteni...   427   e-147
Ecym_2465 Chr2 complement(908173..909489) [1317 bp, 438 aa] {ON}...   427   e-147
NCAS0E00860 Chr5 (157521..158843) [1323 bp, 440 aa] {ON} Anc_3.454    421   e-145
NDAI0G01090 Chr7 (230932..232302) [1371 bp, 456 aa] {ON} Anc_3.454    421   e-144
KNAG0B00950 Chr2 (173167..174423) [1257 bp, 418 aa] {ON} Anc_3.4...   417   e-143
CAGL0L04686g Chr12 (539203..540558) [1356 bp, 451 aa] {ON} simil...   401   e-137
KLLA0B12914g Chr2 (1126975..1128255) [1281 bp, 426 aa] {ON} simi...   358   e-120
TBLA0F03460 Chr6 (853280..854605) [1326 bp, 441 aa] {ON}              352   e-117
KLTH0C01254g Chr3 complement(113435..114739) [1305 bp, 434 aa] {...   159   1e-43
Kwal_14.985 s14 complement(142781..144088) [1308 bp, 435 aa] {ON...   150   3e-40
SAKL0G19074g Chr7 (1646858..1648156) [1299 bp, 432 aa] {ON} cons...   132   2e-33
Ecym_5577 Chr5 (1185997..1187298) [1302 bp, 433 aa] {ON} similar...   132   2e-33
Suva_10.183 Chr10 complement(344549..345733) [1185 bp, 394 aa] {...    74   1e-13
Skud_12.167 Chr12 complement(322870..324054) [1185 bp, 394 aa] {...    74   1e-13
Skud_4.386 Chr4 complement(673125..674465) [1341 bp, 446 aa] {ON...    73   3e-13
TDEL0F04100 Chr6 complement(756762..758066) [1305 bp, 434 aa] {O...    73   4e-13
YLR099C Chr12 complement(339744..340928) [1185 bp, 394 aa] {ON} ...    72   7e-13
Smik_12.158 Chr12 complement(319660..320844) [1185 bp, 394 aa] {...    69   7e-12
KAFR0B05380 Chr2 (1107049..1108284) [1236 bp, 411 aa] {ON} Anc_8...    68   9e-12
Suva_2.288 Chr2 complement(496577..497884) [1308 bp, 435 aa] {ON...    67   3e-11
Smik_4.371 Chr4 complement(662692..663999) [1308 bp, 435 aa] {ON...    66   4e-11
Kpol_543.49 s543 complement(108945..110234) [1290 bp, 429 aa] {O...    65   1e-10
KNAG0H03120 Chr8 (586146..587450) [1305 bp, 434 aa] {ON} Anc_8.2...    64   2e-10
Kwal_56.23702 s56 complement(668862..670112) [1251 bp, 416 aa] {...    64   2e-10
ZYRO0D06666g Chr4 (576172..577314) [1143 bp, 380 aa] {ON} simila...    61   2e-09
SAKL0H16500g Chr8 (1450828..1452087) [1260 bp, 419 aa] {ON} simi...    61   2e-09
NCAS0B05120 Chr2 complement(953798..954988) [1191 bp, 396 aa] {O...    61   2e-09
YDR125C Chr4 complement(701397..702758) [1362 bp, 453 aa] {ON}  ...    59   7e-09
NDAI0J01210 Chr10 (282384..283634) [1251 bp, 416 aa] {ON} Anc_8....    59   8e-09
KLTH0G13178g Chr7 (1131579..1132826) [1248 bp, 415 aa] {ON} simi...    57   3e-08
CAGL0B01969g Chr2 complement(181406..182677) [1272 bp, 423 aa] {...    57   3e-08
TPHA0A01690 Chr1 (344521..345738) [1218 bp, 405 aa] {ON} Anc_8.2...    57   5e-08
KAFR0B02830 Chr2 complement(578530..579705) [1176 bp, 391 aa] {O...    56   6e-08
KLLA0F19624g Chr6 complement(1817206..1818435) [1230 bp, 409 aa]...    55   1e-07
AGR062C Chr7 complement(833212..834366) [1155 bp, 384 aa] {ON} S...    55   2e-07
KNAG0G02140 Chr7 complement(484440..485666) [1227 bp, 408 aa] {O...    54   3e-07
Ecym_4285 Chr4 (612053..613270) [1218 bp, 405 aa] {ON} similar t...    54   4e-07
CAGL0M11462g Chr13 complement(1129244..1130404) [1161 bp, 386 aa...    52   1e-06
NCAS0B03710 Chr2 (664097..665389) [1293 bp, 430 aa] {ON} Anc_8.284     49   2e-05
NDAI0J01200 Chr10 (280820..282103) [1284 bp, 427 aa] {ON}              49   2e-05
TPHA0L01600 Chr12 (338450..339568) [1119 bp, 372 aa] {ON} Anc_8....    42   0.003
TBLA0H01400 Chr8 (312727..313992) [1266 bp, 421 aa] {ON} Anc_8.2...    42   0.003
KNAG0A03770 Chr1 complement(494021..495091) [1071 bp, 356 aa] {O...    39   0.017
CAGL0J08547g Chr10 (846742..847881) [1140 bp, 379 aa] {ON} simil...    37   0.057
KNAG0E03240 Chr5 (650902..652014) [1113 bp, 370 aa] {ON} Anc_8.3...    37   0.10 
NCAS0B02260 Chr2 complement(374788..375879) [1092 bp, 363 aa] {O...    35   0.28 
Kpol_1030.46 s1030 (103691..104797) [1107 bp, 369 aa] {ON} (1036...    33   1.0  
Kpol_2000.61 s2000 (123249..123272,123369..124205) [861 bp, 286 ...    33   1.6  
TDEL0D00200 Chr4 (32432..34135) [1704 bp, 567 aa] {ON}                 33   2.0  
SAKL0H10450g Chr8 complement(897598..898776) [1179 bp, 392 aa] {...    32   4.1  
CAGL0C00297g Chr3 (29470..31620) [2151 bp, 716 aa] {ON} similar ...    31   5.8  
NDAI0E00120 Chr5 (1990..4239) [2250 bp, 749 aa] {ON}                   31   6.8  
TPHA0L01660 Chr12 complement(348715..350358) [1644 bp, 547 aa] {...    31   6.8  
Kpol_1000.24 s1000 complement(56352..59846,59848..61095) [4743 b...    31   7.5  

>TPHA0O01310 Chr15 complement(258745..260061) [1317 bp, 438 aa] {ON}
           
          Length = 438

 Score =  855 bits (2209), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 416/438 (94%), Positives = 416/438 (94%)

Query: 1   MHRYLKELLDNLRTIKLREKVIDFSGSNLNLIEKPSRLXXXXXXXXXXXXXXXXXXXXXX 60
           MHRYLKELLDNLRTIKLREKVIDFSGSNLNLIEKPSRL                      
Sbjct: 1   MHRYLKELLDNLRTIKLREKVIDFSGSNLNLIEKPSRLTSPSIPNAAAAPTASTAPTALS 60

Query: 61  LFELIKQFPRLFPRSFMKSFQDYKQFHSDVENFQVRLLETLPYFPDPSNGIYSKITNTIV 120
           LFELIKQFPRLFPRSFMKSFQDYKQFHSDVENFQVRLLETLPYFPDPSNGIYSKITNTIV
Sbjct: 61  LFELIKQFPRLFPRSFMKSFQDYKQFHSDVENFQVRLLETLPYFPDPSNGIYSKITNTIV 120

Query: 121 DDEGSSINEFVVYPSNISVPSEKLKHLIFVHGYGAGLGFFLKNLENIKLLNDEWCVHAID 180
           DDEGSSINEFVVYPSNISVPSEKLKHLIFVHGYGAGLGFFLKNLENIKLLNDEWCVHAID
Sbjct: 121 DDEGSSINEFVVYPSNISVPSEKLKHLIFVHGYGAGLGFFLKNLENIKLLNDEWCVHAID 180

Query: 181 LPGYGFSTRAKFPFQVGKHRHDQVNEWFHSRIRNWMHQRNLLQHSQNNFLIAHSLGAYLM 240
           LPGYGFSTRAKFPFQVGKHRHDQVNEWFHSRIRNWMHQRNLLQHSQNNFLIAHSLGAYLM
Sbjct: 181 LPGYGFSTRAKFPFQVGKHRHDQVNEWFHSRIRNWMHQRNLLQHSQNNFLIAHSLGAYLM 240

Query: 241 ALYVDKHPNDLQKILMCSPAGIGDSMNLKKKTPAWWFEKLWERNISPFTLVRSSSYIGSK 300
           ALYVDKHPNDLQKILMCSPAGIGDSMNLKKKTPAWWFEKLWERNISPFTLVRSSSYIGSK
Sbjct: 241 ALYVDKHPNDLQKILMCSPAGIGDSMNLKKKTPAWWFEKLWERNISPFTLVRSSSYIGSK 300

Query: 301 LTSGWTYRRFSSLLSQNNLKQFEALHKYTYSIFNQRGSGEYLLNFALKCGGGPRYPLEKT 360
           LTSGWTYRRFSSLLSQNNLKQFEALHKYTYSIFNQRGSGEYLLNFALKCGGGPRYPLEKT
Sbjct: 301 LTSGWTYRRFSSLLSQNNLKQFEALHKYTYSIFNQRGSGEYLLNFALKCGGGPRYPLEKT 360

Query: 361 LFMNNDKGISKSSTEWIWAYGDNDWMDKNGGIRVSEILTKQLKKRSEVYIVPRAGHHLYF 420
           LFMNNDKGISKSSTEWIWAYGDNDWMDKNGGIRVSEILTKQLKKRSEVYIVPRAGHHLYF
Sbjct: 361 LFMNNDKGISKSSTEWIWAYGDNDWMDKNGGIRVSEILTKQLKKRSEVYIVPRAGHHLYF 420

Query: 421 DNHQFFNDLILKEMECMK 438
           DNHQFFNDLILKEMECMK
Sbjct: 421 DNHQFFNDLILKEMECMK 438

>Kpol_1035.9 s1035 complement(19721..21004) [1284 bp, 427 aa] {ON}
           complement(19721..21004) [1284 nt, 428 aa]
          Length = 427

 Score =  468 bits (1205), Expect = e-163,   Method: Compositional matrix adjust.
 Identities = 216/382 (56%), Positives = 279/382 (73%), Gaps = 6/382 (1%)

Query: 61  LFELIKQFPRLFPRSFMKSFQDYKQFHSDVENFQVRLLETLPYFPDPSNGIYSKITNTIV 120
           L+E+I + P LFPR+  +S  DY  FH D++ FQ  LL TLPY+P  ++G  +++  T V
Sbjct: 47  LYEIILKLPNLFPRTLKESLNDYHDFHKDIDKFQTELLSTLPYYPMANDGKKAELITTKV 106

Query: 121 DDEGSSINEFVVYPSNISVPSEKLKHLIFVHGYGAGLGFFLKNLENIKLLNDEWCVHAID 180
           DDEG+ INEF + P         LKHLIF+HGYGAGLGFFLKN E++ LL+++WC+HAID
Sbjct: 107 DDEGNYINEFCISPIGAEADQRDLKHLIFIHGYGAGLGFFLKNFEHLPLLDNKWCIHAID 166

Query: 181 LPGYGFSTRAKFPFQVGKHRHDQVNEWFHSRIRNWMHQRNLLQHSQNNFLIAHSLGAYLM 240
           LPGYG+S R +FPF+  +H    V +WFH RIR W   R+LL   +NN ++AHSLGAYLM
Sbjct: 167 LPGYGYSKRCEFPFKYPEHDISDVQDWFHKRIRTWFKARSLLTTPENNMIMAHSLGAYLM 226

Query: 241 ALYVDKHPNDLQKILMCSPAGIGDSMNLKK----KTPAWWFEKLWERNISPFTLVRSSSY 296
           ALY+DK PND +KI+MCSPAGI  S   ++    KTP WWF KLW++N+SPFTLVR++ Y
Sbjct: 227 ALYIDKFPNDFKKIVMCSPAGICQSSTSEEIGNIKTP-WWFNKLWDQNVSPFTLVRNTYY 285

Query: 297 IGSKLTSGWTYRRFSSLLSQNNLKQFEALHKYTYSIFNQRGSGEYLLNFALKCGGGPRYP 356
           +GSKLTSGW+YRRF  L    +L QFE LH+Y YSIFNQ+GSGEY+L FALKCGG PR P
Sbjct: 286 LGSKLTSGWSYRRFKQLKQSGHLMQFEKLHRYAYSIFNQKGSGEYILGFALKCGGDPRIP 345

Query: 357 LEKTLFMN-NDKGISKSSTEWIWAYGDNDWMDKNGGIRVSEILTKQLKKRSEVYIVPRAG 415
           LE  LF +   +GI KS  EW+W YG+ DWMD  GG RV++ L  +  K+S   +VP +G
Sbjct: 346 LEDNLFKSPKTEGIPKSDCEWLWVYGEKDWMDIGGGKRVTDELVTRFGKKSSTTVVPDSG 405

Query: 416 HHLYFDNHQFFNDLILKEMECM 437
           HHLYFDN++FFN+L++KEM+ M
Sbjct: 406 HHLYFDNYKFFNELLVKEMKNM 427

>TDEL0F03390 Chr6 (624579..625853) [1275 bp, 424 aa] {ON} Anc_3.454
           YGR110W
          Length = 424

 Score =  465 bits (1196), Expect = e-162,   Method: Compositional matrix adjust.
 Identities = 228/385 (59%), Positives = 283/385 (73%), Gaps = 10/385 (2%)

Query: 61  LFELIKQFPRLFPRSFMKSFQDYKQF--HSDVENFQVRLLETLPYFPDPSNGIYSKITNT 118
           L E+I + P LFPRSF  S +DY+    H+D E FQ  LL TLP++ +      S++  T
Sbjct: 42  LREIIVKLPSLFPRSFGDSVRDYRDLCRHTD-EKFQRDLLATLPFYGEGDLHRRSEVIRT 100

Query: 119 IVDDEGSSINEFVVYPSNISVPSEKLKHLIFVHGYGAGLGFFLKNLENIKLLNDEWCVHA 178
            VDDEG+ INEF + P N SVP ++LKHL+F+HGYGAGLGFFLKN ENI LLN+EWC+HA
Sbjct: 101 KVDDEGNYINEFYIMPKNASVPRDRLKHLVFIHGYGAGLGFFLKNFENIPLLNNEWCIHA 160

Query: 179 IDLPGYGFSTRAKFPFQVGKHRHDQVNEWFHSRIRNWMHQRNLLQHSQNNFLIAHSLGAY 238
           IDLPGYGFS+R KFPFQ  K     V+EWFH R+  W  +RNLL++ +NN ++AHSLGAY
Sbjct: 161 IDLPGYGFSSRCKFPFQYPKDTVTDVHEWFHKRLNRWFAERNLLRNPENNIVMAHSLGAY 220

Query: 239 LMALYVDKHPNDLQKILMCSPAGIGDSMNLKK---KTPAWWFEKLWERNISPFTLVRSSS 295
           LMALY  K+ +  +K++MCSPAGI +S   K    + P WW+ KLW+RNISPF+LVR SS
Sbjct: 221 LMALYASKNSSHFKKLVMCSPAGICESTTTKAIGNRKPPWWYSKLWDRNISPFSLVRVSS 280

Query: 296 YIGSKLTSGWTYRRFSSLL---SQNNLKQFEALHKYTYSIFNQRGSGEYLLNFALKCGGG 352
            +GSKLTSGW+Y+RF  LL   S+ + +QFEALHKY YSIFN+ G GEYLL+FAL+CGG 
Sbjct: 281 RLGSKLTSGWSYKRFGKLLRSKSRKSEQQFEALHKYCYSIFNKPGCGEYLLSFALRCGGD 340

Query: 353 PRYPLEKTLFMNNDKGISKSSTEWIWAYGDNDWMDKNGGIRVSEILTKQLKKRSEVYIVP 412
           PR PLE  LF  ND GI   + EW+W YG+ DWMD NGG RVSE L K  +K SEV IVP
Sbjct: 341 PRIPLEDMLFKTNDSGIMNGNLEWLWLYGERDWMDFNGGKRVSEHLKKSGQK-SEVCIVP 399

Query: 413 RAGHHLYFDNHQFFNDLILKEMECM 437
            AGHHLYFDN+ +FN LI++EM+ M
Sbjct: 400 NAGHHLYFDNYDYFNSLIIREMKSM 424

>SAKL0B06116g Chr2 complement(519929..521224) [1296 bp, 431 aa] {ON}
           similar to uniprot|P53264 Saccharomyces cerevisiae
           YGR110W Hypothetical ORF
          Length = 431

 Score =  453 bits (1166), Expect = e-157,   Method: Compositional matrix adjust.
 Identities = 221/379 (58%), Positives = 276/379 (72%), Gaps = 7/379 (1%)

Query: 61  LFELIKQFPRLFPRSFMKSFQDYKQFHSDVENFQVRLLETLPYFPDPSNGIYSKITNTIV 120
           L ++  Q P LFP SF  S +DY  F  + E+FQ +LL TLP++P P+NG  S+I  T V
Sbjct: 56  LIQIATQLPNLFPLSFEASIRDYSMFQENAESFQSQLLSTLPFYPSPANGRSSEILKTPV 115

Query: 121 DDEGSSINEFVVYPSNISVPSEKLKHLIFVHGYGAGLGFFLKNLENIKLLNDEWCVHAID 180
           DDEG+ INEF + P N S  S  +KHLIFVHGYGAGLGFFLKN ENI LLN+ WC+HAID
Sbjct: 116 DDEGNYINEFTIKPMNPSS-SSSMKHLIFVHGYGAGLGFFLKNFENIPLLNNNWCIHAID 174

Query: 181 LPGYGFSTRAKFPFQVGKHRHDQVNEWFHSRIRNWMHQRNLLQHSQNNFLIAHSLGAYLM 240
           LPGYGFS+R KFPF   +H    V +WFH RI+ W+H+R LL + +NN L+AHSLGAY+ 
Sbjct: 175 LPGYGFSSRPKFPFNYPEHNPIMVEDWFHQRIKGWLHKRGLLANPKNNLLVAHSLGAYIS 234

Query: 241 ALYVDKHPNDLQKILMCSPAGIGDSMNLKKKTPAWWFEKLWERNISPFTLVRSSSYIGSK 300
           ALY +K PN   K++MCSPAGI  S  L +  P  WF KLW+RNISPF+LVR+S ++GSK
Sbjct: 235 ALYANKFPNHFSKLIMCSPAGICPSPKLGQAPPQ-WFVKLWDRNISPFSLVRNSFHLGSK 293

Query: 301 LTSGWTYRRFSSLL--SQNNLKQFEALHKYTYSIFNQRGSGEYLLNFALKCGGGPRYPLE 358
           LTSGWTYRRF   L   Q   +Q +A+HKYTY+IFN+ GSGEYLL+FALKCGG PR PLE
Sbjct: 294 LTSGWTYRRFRQFLREGQRGYEQHKAMHKYTYAIFNKPGSGEYLLSFALKCGGDPRLPLE 353

Query: 359 KTLFMNNDKGISKSSTEWIWAYGDNDWMDKNGGIRVSEILTKQLKKRSEVYIVPRAGHHL 418
           K LF N      K++ +W+W YGD DWMD  GG R SE L K++  +S+V +VP AGHHL
Sbjct: 354 KRLFDNTSS--FKANCDWLWLYGDEDWMDLRGGQRASEFL-KKIGMKSDVKVVPSAGHHL 410

Query: 419 YFDNHQFFNDLILKEMECM 437
           Y DN++ FN++++KEME M
Sbjct: 411 YLDNYKHFNNVVIKEMEKM 429

>Suva_7.395 Chr7 (684763..686118) [1356 bp, 451 aa] {ON} YGR110W
           (REAL)
          Length = 451

 Score =  454 bits (1167), Expect = e-157,   Method: Compositional matrix adjust.
 Identities = 215/387 (55%), Positives = 282/387 (72%), Gaps = 12/387 (3%)

Query: 61  LFELIKQFPRLFPRSFMKSFQDYKQFHSDVENFQVRLLETLPYFPDPSNGIYSKITNTIV 120
           L E+I + P LFPR    S +D++ F  + ++FQ  LL TLP++P+PS    SK+  TIV
Sbjct: 63  LREIIYKVPGLFPRPLEDSVKDFRDFIKNEDSFQTELLATLPFYPNPSTTKKSKLIKTIV 122

Query: 121 DDEGSSINEFVVYPSNISVPSEKLKHLIFVHGYGAGLGFFLKNLENIKLLNDEWCVHAID 180
           DD+G+ INEF +YP   SVP   LKHL+F+HGYGAGLGFF+KN E+I LLN+EWCVHAID
Sbjct: 123 DDDGNYINEFCIYPQVPSVPEADLKHLVFIHGYGAGLGFFIKNFEDIPLLNNEWCVHAID 182

Query: 181 LPGYGFSTRAKFPFQVGKHRHDQVNEWFHSRIRNWMHQRNLLQHSQNNFLIAHSLGAYLM 240
           LPGYGFS+R KFPF+  +     V +WFH RI  W  +RNLL   + N ++AHSLG+YLM
Sbjct: 183 LPGYGFSSRPKFPFKYPRDDIHSVQDWFHERIHTWFEKRNLLNKPEKNIVMAHSLGSYLM 242

Query: 241 ALYVDKHPN--DLQKILMCSPAGI-------GDSMNLKKKTPAWWFEKLWERNISPFTLV 291
           ALY+ K+      +K+++CSPAG+       G+S   K K P WW+ KLW++NISPFTLV
Sbjct: 243 ALYLQKYEGSPSFKKLILCSPAGVSHRDFDSGNSDVEKWKPPPWWYVKLWDKNISPFTLV 302

Query: 292 RSSSYIGSKLTSGWTYRRFSSLLS--QNNLKQFEALHKYTYSIFNQRGSGEYLLNFALKC 349
           R+S   GSK+TSGW+YRRF  +L+   +  K+FEALH+Y YSIFN+RGSGEYLL+FALKC
Sbjct: 303 RNSRQFGSKITSGWSYRRFKHILNGDPDQSKRFEALHRYAYSIFNKRGSGEYLLSFALKC 362

Query: 350 GGGPRYPLEKTLFMNNDKGISKSST-EWIWAYGDNDWMDKNGGIRVSEILTKQLKKRSEV 408
           GG PR PLE+ LF   +  + K++  EW+W YGD+DWMD NGG+RVS++L  +LK++S V
Sbjct: 363 GGEPRLPLEEQLFNGKNANVLKNAKYEWVWLYGDDDWMDVNGGLRVSKLLNDKLKQKSSV 422

Query: 409 YIVPRAGHHLYFDNHQFFNDLILKEME 435
             VP AGHHLY DNH+FFN +I+ EM+
Sbjct: 423 ITVPNAGHHLYLDNHKFFNTIIMNEMQ 449

>Smik_6.200 Chr6 (329969..331306) [1338 bp, 445 aa] {ON} YGR110W
           (REAL)
          Length = 445

 Score =  452 bits (1163), Expect = e-157,   Method: Compositional matrix adjust.
 Identities = 221/387 (57%), Positives = 285/387 (73%), Gaps = 14/387 (3%)

Query: 61  LFELIKQFPRLFPRSFMKSFQDYKQFHSDVENFQVRLLETLPYFPDPSNGIYSKITNTIV 120
           L E+I + P LFPR    S +D++ F    + FQ  LL+TLP++P+PS    S++  T+V
Sbjct: 57  LREIIYKVPGLFPRPVGDSVKDFRDFIKSEDVFQTELLKTLPFYPNPSKLKKSRVIRTVV 116

Query: 121 DDEGSSINEFVVYPSNISVPSEKLKHLIFVHGYGAGLGFFLKNLENIKLLNDEWCVHAID 180
           DD+G+ INEF + P N SVP  +LKHLIF+HGYGAGLGFF+KN E+I LLN+EWCVHAID
Sbjct: 117 DDDGNYINEFCIRPINPSVPETELKHLIFIHGYGAGLGFFIKNFEDIPLLNNEWCVHAID 176

Query: 181 LPGYGFSTRAKFPFQVGKHRHDQVNEWFHSRIRNWMHQRNLLQHSQNNFLIAHSLGAYLM 240
           LPGYGFS+R KFPF+  +     V +WFH R+  W ++RNLL     N ++AHSLG+YLM
Sbjct: 177 LPGYGFSSRPKFPFEYPRDNLHDVQDWFHKRLHTWFNKRNLLNKPDKNVVMAHSLGSYLM 236

Query: 241 ALYVDKHPN--DLQKILMCSPAGIG--DSMNL-----KKKTPAWWFEKLWERNISPFTLV 291
           ALYV K+      +K+++CSPAG+   DS N      K K P WW+ KLW+RNISPFTLV
Sbjct: 237 ALYVQKYKERPSFKKLILCSPAGVSHRDSNNTTSEAEKWKPPPWWYVKLWDRNISPFTLV 296

Query: 292 RSSSYIGSKLTSGWTYRRFSSLLSQNNLKQ---FEALHKYTYSIFNQRGSGEYLLNFALK 348
           R+S   GSK+TSGW+YRRF  +L+  +LKQ   FEALH+Y YSIFN+RGSGEYLL+FALK
Sbjct: 297 RNSRQFGSKITSGWSYRRFKHILN-GDLKQSSRFEALHRYAYSIFNKRGSGEYLLSFALK 355

Query: 349 CGGGPRYPLEKTLFMNNDKGISKSST-EWIWAYGDNDWMDKNGGIRVSEILTKQLKKRSE 407
           CGG PR PLE+ LF + +  I +SS  EW+W YGD+DWMD NGGIRVS+ L ++L+++S 
Sbjct: 356 CGGEPRLPLEEQLFNDRNLNILRSSNYEWLWLYGDDDWMDVNGGIRVSKFLNEKLRQKSN 415

Query: 408 VYIVPRAGHHLYFDNHQFFNDLILKEM 434
           V IVP AGHHLY DN +FFND+++KEM
Sbjct: 416 VIIVPHAGHHLYLDNSKFFNDILVKEM 442

>ZYRO0C06270g Chr3 (475283..476575) [1293 bp, 430 aa] {ON} similar
           to uniprot|P53264 Saccharomyces cerevisiae YGR110W
           Hypothetical ORF
          Length = 430

 Score =  451 bits (1160), Expect = e-156,   Method: Compositional matrix adjust.
 Identities = 213/385 (55%), Positives = 274/385 (71%), Gaps = 8/385 (2%)

Query: 61  LFELIKQFPRLFPRSFMKSFQDYKQFHSDVENFQVRLLETLPYFPDPSNGIYSKITNTIV 120
           L ++I + P+LFPRS   S +DYK F       Q  LL TLP++P  +    +++  T V
Sbjct: 46  LHKIIMRLPKLFPRSVDASTRDYKDFCYHTGQLQEELLRTLPFYPYCAESKKAEVVKTTV 105

Query: 121 DDEGSSINEFVVYPSNISVPSEKLKHLIFVHGYGAGLGFFLKNLENIKLLNDEWCVHAID 180
           DD+G+ INEF + P   SVPS K+KHLI +HGYGAGLGFFLKNLE I LL++ W +HAID
Sbjct: 106 DDQGNYINEFCITPVKPSVPSHKMKHLICIHGYGAGLGFFLKNLEGIPLLDNSWVIHAID 165

Query: 181 LPGYGFSTRAKFPFQVGKHRHDQVNEWFHSRIRNWMHQRNLLQHSQNNFLIAHSLGAYLM 240
           LPGYGFS+R KFPF+  K    QV+ WFH RI  W  +R LL +SQNN ++AHSLGAYLM
Sbjct: 166 LPGYGFSSRPKFPFKYPKDSLSQVHSWFHDRIHTWFKKRGLLVNSQNNLVMAHSLGAYLM 225

Query: 241 ALYVDKHPNDLQKILMCSPAGIGDSM---NLKKKTPAWWFEKLWERNISPFTLVRSSSYI 297
           ALY  K+    +K++MCSPAG+  S    N+   TP WW+ KLW+ NISPF LVR+++ +
Sbjct: 226 ALYTTKYTTHFKKLVMCSPAGVCKSTTAKNIGNTTPPWWYTKLWDLNISPFCLVRNAAAL 285

Query: 298 GSKLTSGWTYRRFSSLLSQN---NLK--QFEALHKYTYSIFNQRGSGEYLLNFALKCGGG 352
           GS +TSGW+YRRF+ LL  N   NL   QFEALH+Y Y+IFN+RGSGEYLL+FAL CGG 
Sbjct: 286 GSMVTSGWSYRRFNKLLQSNSNTNLDRLQFEALHRYAYAIFNRRGSGEYLLSFALSCGGD 345

Query: 353 PRYPLEKTLFMNNDKGISKSSTEWIWAYGDNDWMDKNGGIRVSEILTKQLKKRSEVYIVP 412
           PR PLE T+F +   GI +S+ EWIW YG+ DWMD NGG RVS  +  Q  ++S+V++ P
Sbjct: 346 PRLPLEDTIFKDKTSGIFRSNCEWIWIYGERDWMDVNGGERVSRFIENQGGRKSQVHVAP 405

Query: 413 RAGHHLYFDNHQFFNDLILKEMECM 437
            +GHHLYFDNH+FFN  I+K+M+ M
Sbjct: 406 NSGHHLYFDNHKFFNSFIVKQMKDM 430

>Skud_7.415 Chr7 (692655..694013) [1359 bp, 452 aa] {ON} YGR110W
           (REAL)
          Length = 452

 Score =  449 bits (1155), Expect = e-155,   Method: Compositional matrix adjust.
 Identities = 211/390 (54%), Positives = 287/390 (73%), Gaps = 12/390 (3%)

Query: 61  LFELIKQFPRLFPRSFMKSFQDYKQFHSDVENFQVRLLETLPYFPDPSNGIYSKITNTIV 120
           L E+I + P LFPR    S +D++ F  + + FQ  LLETLP++P+PS    SK+  T+V
Sbjct: 63  LREIIYKVPGLFPRPLEDSVKDFRDFTKNEDVFQTELLETLPFYPNPSKYKKSKLIKTVV 122

Query: 121 DDEGSSINEFVVYPSNISVPSEKLKHLIFVHGYGAGLGFFLKNLENIKLLNDEWCVHAID 180
           DD+G+ INEF +YP   SVP  +LKHL+F+HGYGAGLGFF+KNLE+I LL++EWC+HAID
Sbjct: 123 DDDGNYINEFCIYPQKPSVPETELKHLVFIHGYGAGLGFFIKNLEDIPLLDNEWCIHAID 182

Query: 181 LPGYGFSTRAKFPFQVGKHRHDQVNEWFHSRIRNWMHQRNLLQHSQNNFLIAHSLGAYLM 240
           LPGYGFS+R KFPF+  K     V +WFH RI  W ++RNLL     N ++AHSLG+YLM
Sbjct: 183 LPGYGFSSRPKFPFEYPKDNLHTVQDWFHERIHTWFNKRNLLHKPDKNIVVAHSLGSYLM 242

Query: 241 ALYVDKHPN--DLQKILMCSPAGIGD-------SMNLKKKTPAWWFEKLWERNISPFTLV 291
           ALY+ K+      +K+++CSPAG+ +       +   K K P WW+ KLW+RNISPFTLV
Sbjct: 243 ALYLQKYKESPSFKKLVLCSPAGVSNRDFDNTTAEVGKWKPPPWWYVKLWDRNISPFTLV 302

Query: 292 RSSSYIGSKLTSGWTYRRFSSLLSQN--NLKQFEALHKYTYSIFNQRGSGEYLLNFALKC 349
           R++  +GSK+TSGW+YRRF  +L+ +    ++FEALH+Y YSIFN+RGSGEYLL+FAL+C
Sbjct: 303 RNARQLGSKITSGWSYRRFKHILNGDPGQSRRFEALHRYAYSIFNKRGSGEYLLSFALRC 362

Query: 350 GGGPRYPLEKTLF-MNNDKGISKSSTEWIWAYGDNDWMDKNGGIRVSEILTKQLKKRSEV 408
           GG PR PLE+ LF   N K +  S+ EW+W YG++DWMD +GG+RVS+ L ++L ++S V
Sbjct: 363 GGEPRLPLEEQLFNGENSKVLKNSNYEWVWLYGNDDWMDVDGGLRVSKYLNEKLGQKSNV 422

Query: 409 YIVPRAGHHLYFDNHQFFNDLILKEMECMK 438
           +IVP AGHHLY DN+ FFN +++KEM+ +K
Sbjct: 423 FIVPHAGHHLYLDNYTFFNKILVKEMQNVK 452

>YGR110W Chr7 (713709..715046) [1338 bp, 445 aa] {ON}
           CLD1Mitochondrial cardiolipin-specific phospholipase;
           functions upstream of Taz1p to generate
           monolyso-cardiolipin; transcription increases upon
           genotoxic stress; involved in restricting Ty1
           transposition; has homology to mammalian CGI-58
          Length = 445

 Score =  439 bits (1128), Expect = e-151,   Method: Compositional matrix adjust.
 Identities = 207/387 (53%), Positives = 277/387 (71%), Gaps = 12/387 (3%)

Query: 61  LFELIKQFPRLFPRSFMKSFQDYKQFHSDVENFQVRLLETLPYFPDPSNGIYSKITNTIV 120
           L E+I + P LFPR    S +D++ F  + + FQ  LL+TLP++P PS    +++  T+V
Sbjct: 57  LREIIYRVPSLFPRPLEDSVKDFRDFIKNEDAFQTELLKTLPFYPTPSESKTARLIRTVV 116

Query: 121 DDEGSSINEFVVYPSNISVPSEKLKHLIFVHGYGAGLGFFLKNLENIKLLNDEWCVHAID 180
           DDEG+ INEF + P   SVP   LKHL+F+HGYGAGLGFF+KN E+I LL++EWC+HAID
Sbjct: 117 DDEGNYINEFCIRPRKTSVPEADLKHLVFIHGYGAGLGFFIKNFEDIPLLDNEWCIHAID 176

Query: 181 LPGYGFSTRAKFPFQVGKHRHDQVNEWFHSRIRNWMHQRNLLQHSQNNFLIAHSLGAYLM 240
           LPGYGFS+R KFPF+  +     V +WFH RI  W  +RNLL   + N ++AHSLG+YLM
Sbjct: 177 LPGYGFSSRPKFPFEYPRDNIHSVQDWFHERIHTWFSKRNLLNRPEKNIVMAHSLGSYLM 236

Query: 241 ALYVDKHPN--DLQKILMCSPAGIG-------DSMNLKKKTPAWWFEKLWERNISPFTLV 291
           ALY+ K+      +K+++CSPAG+         S   K K P WW+ KLW+RNISPFTLV
Sbjct: 237 ALYLQKYKESPSFKKLILCSPAGVSYRDFNNTASEVEKWKPPPWWYVKLWDRNISPFTLV 296

Query: 292 RSSSYIGSKLTSGWTYRRFSSLLSQN--NLKQFEALHKYTYSIFNQRGSGEYLLNFALKC 349
           R+   +GSK+TSGW+YRRF  +L+ +    K+FEALH+Y Y+IFN+RGSGEYLL+FALKC
Sbjct: 297 RNFRQLGSKITSGWSYRRFKHILNGDPEQSKRFEALHRYAYAIFNKRGSGEYLLSFALKC 356

Query: 350 GGGPRYPLEKTLFMNNDKGISK-SSTEWIWAYGDNDWMDKNGGIRVSEILTKQLKKRSEV 408
           GG PR  LE+ LF      I K S+ +W+W YGD+DWMD NGG+RVS  L ++LK++S V
Sbjct: 357 GGEPRLSLEQQLFDGKKSDILKNSNCDWLWLYGDDDWMDVNGGLRVSRFLKEKLKQKSNV 416

Query: 409 YIVPRAGHHLYFDNHQFFNDLILKEME 435
            IVP +GHHLY DN++FFN+++ KEM+
Sbjct: 417 IIVPHSGHHLYLDNYKFFNNILTKEMQ 443

>KAFR0I01970 Chr9 (401907..403142) [1236 bp, 411 aa] {ON} 
          Length = 411

 Score =  437 bits (1124), Expect = e-151,   Method: Compositional matrix adjust.
 Identities = 208/377 (55%), Positives = 269/377 (71%), Gaps = 8/377 (2%)

Query: 61  LFELIKQFPRLFPRSFMKSFQDYKQFHSDVENFQVRLLETLPYFPDPSNGIYSKITNTIV 120
           L ++I Q PRLFPRS  +SF+DY+ +    E  Q  LL TLP++P+ S    ++I  T+V
Sbjct: 39  LVKIIAQLPRLFPRSIDESFKDYRVYKEGPERMQEDLLSTLPFYPNVSKDKVARIIKTVV 98

Query: 121 DDEGSSINEFVVYPSNISVPSEKLKHLIFVHGYGAGLGFFLKNLENIKLLNDEWCVHAID 180
           D+EG+ INEF + P N +V S+KLKHLIF+HGYGAG GFFLKNLE+I LL++ WC+HAID
Sbjct: 99  DEEGNYINEFCITPKN-TVNSQKLKHLIFIHGYGAGFGFFLKNLESIPLLDNNWCIHAID 157

Query: 181 LPGYGFSTRAKFPFQVGKHRHDQVNEWFHSRIRNWMHQRNLLQHSQNNFLIAHSLGAYLM 240
           LPG+GFS+R  FPF+       +V  WFH RIR W+ +R LL + +NN ++AHSLGAYLM
Sbjct: 158 LPGFGFSSRKNFPFKYPTSNTSEVTAWFHERIRRWLEERTLLDNPKNNVIVAHSLGAYLM 217

Query: 241 ALYVDKHPNDLQKILMCSPAGIGDSMNLKKKT--PAWWFEKLWERNISPFTLVRSSSYIG 298
           ALY   +P  L+K++MCSPAG+  S N  K    P WW+ KLW+ N+SPFTLVR S ++G
Sbjct: 218 ALYTQVYPAHLRKLIMCSPAGVSKSQNNSKAVLQPPWWYAKLWDMNLSPFTLVRLSKHLG 277

Query: 299 SKLTSGWTYRRFSSLLSQNNLKQFEALHKYTYSIFNQRGSGEYLLNFALKCGGGPRYPLE 358
           SKLTSGW+YRRF  +    N  QFE LH+Y+Y+IFNQ GSGEYLL F L+CGG PR  LE
Sbjct: 278 SKLTSGWSYRRFKLI---ENRMQFEMLHRYSYAIFNQPGSGEYLLGFILECGGNPRCSLE 334

Query: 359 KTLFMNNDKGISKSSTEWIWAYGDNDWMDKNGGIRVSEILTKQLKKRSEVYIVPRAGHHL 418
            TLF NN    SK   EW W YG+NDWMD  GG RV  +L ++  + S+ Y+VP AGHHL
Sbjct: 335 DTLFSNNFNVSSK--VEWAWIYGENDWMDIEGGRRVHNLLLEKFNRDSKFYMVPNAGHHL 392

Query: 419 YFDNHQFFNDLILKEME 435
           Y DN ++FN++I++ ME
Sbjct: 393 YLDNIRYFNNIIVQHME 409

>KLTH0E13948g Chr5 complement(1231122..1232438) [1317 bp, 438 aa]
           {ON} similar to uniprot|P53264 Saccharomyces cerevisiae
           YGR110W Hypothetical ORF
          Length = 438

 Score =  430 bits (1105), Expect = e-148,   Method: Compositional matrix adjust.
 Identities = 205/378 (54%), Positives = 268/378 (70%), Gaps = 5/378 (1%)

Query: 61  LFELIKQFPRLFPRSFMKSFQDYKQFHSDVENFQVRLLETLPYFPDPSNGIYSKITNTIV 120
           L EL+   PRLFPRS  +S +DY  F  D    Q +LL TLP+FP   +   +++  T V
Sbjct: 59  LRELVINLPRLFPRSMKESVRDYFAFRKDAGTLQHQLLSTLPFFPVAGDDKVAEVVQTPV 118

Query: 121 DDEGSSINEFVVYPSNISVPSEKLKHLIFVHGYGAGLGFFLKNLENIKLLNDEWCVHAID 180
           D++ + INEF V P+ +  PS  L+HLI VHGYGAGLGFFLKNLE + L+++ W +HAID
Sbjct: 119 DEQANYINEFCVRPA-MPHPSGTLRHLIIVHGYGAGLGFFLKNLEKLNLIDNRWVIHAID 177

Query: 181 LPGYGFSTRAKFPFQVGKHRHDQVNEWFHSRIRNWMHQRNLLQHSQNNFLIAHSLGAYLM 240
           LPGYGFS+R KFP++       QV  WFH+R + W+ +R LLQH + N L+AHS+GAYL 
Sbjct: 178 LPGYGFSSRPKFPYKYKSDPAAQVEHWFHARFKTWLEKRGLLQHPEQNMLVAHSMGAYLA 237

Query: 241 ALYVDKHPNDLQKILMCSPAGIGDS-MNLKKKTPAWWFEKLWERNISPFTLVRSSSYIGS 299
           ALY +K+PN  +K++MCSPAGI ++  N +++ P WWF KLW+RNISPF+LVR+S  +GS
Sbjct: 238 ALYANKYPNHFKKLVMCSPAGICNTPSNKQRRLPPWWFAKLWDRNISPFSLVRNSRLLGS 297

Query: 300 KLTSGWTYRRFSSLLSQN--NLKQFEALHKYTYSIFNQRGSGEYLLNFALKCGGGPRYPL 357
           KLTSGW+YRRF  LLS+     +QFEA+HKY Y+IFN  GSGEYLL+FALKCGG PR  L
Sbjct: 298 KLTSGWSYRRFGQLLSEGYRGAQQFEAIHKYAYAIFNSPGSGEYLLSFALKCGGDPRDAL 357

Query: 358 EKTLFMNNDKGISKSSTEWIWAYGDNDWMDKNGGIRVSEILTKQLKKRSEVYIVPRAGHH 417
           E+ LF N      K+  EW+W YGD DWMD  GG RVS  L   + K+S+V +V  +GHH
Sbjct: 358 ERRLFHNKMNQF-KAKCEWLWLYGDQDWMDVGGGRRVSHFLNTAMGKKSKVEVVHDSGHH 416

Query: 418 LYFDNHQFFNDLILKEME 435
           LYFDN++ FN ++ KEM+
Sbjct: 417 LYFDNYEQFNRILEKEMK 434

>Kwal_27.12317 s27 complement(1173365..1174672) [1308 bp, 435 aa]
           {ON} YGR110W - Hypothetical ORF [contig 20] FULL
          Length = 435

 Score =  428 bits (1100), Expect = e-147,   Method: Compositional matrix adjust.
 Identities = 200/377 (53%), Positives = 267/377 (70%), Gaps = 5/377 (1%)

Query: 61  LFELIKQFPRLFPRSFMKSFQDYKQFHSDVENFQVRLLETLPYFPDPSNGIYSKITNTIV 120
           L E+I + P LFPRS  +S +D+K F  +    Q  LL TLP+FP   +   ++I  T V
Sbjct: 59  LNEIILKLPNLFPRSLEQSARDFKDFKLNAGALQSELLATLPFFPAGDSRRTAEIIRTTV 118

Query: 121 DDEGSSINEFVVYPSNISVPSEKLKHLIFVHGYGAGLGFFLKNLENIKLLNDEWCVHAID 180
           D +G+ INEF + P+ +   S+ +KHLI VHGYGAGLGFFLK  EN+ L+N+ W +HAID
Sbjct: 119 DAQGNYINEFNIRPTAVDT-SKTMKHLILVHGYGAGLGFFLKTFENLNLINENWMIHAID 177

Query: 181 LPGYGFSTRAKFPFQVGKHRHDQVNEWFHSRIRNWMHQRNLLQHSQNNFLIAHSLGAYLM 240
           LPGYGFS+R  FPF+VG     QV +WFHSR   WM +R LL+  +NN ++AHS+GAYL 
Sbjct: 178 LPGYGFSSRPPFPFKVGDSTPAQVEQWFHSRFHRWMERRGLLETPENNMVVAHSMGAYLT 237

Query: 241 ALYVDKHPNDLQKILMCSPAGIGDSM-NLKKKTPAWWFEKLWERNISPFTLVRSSSYIGS 299
           ALY +KHP   +K++MCSPAG+  S   ++K+ P WWF KLW++NISPF+LVR+++ +GS
Sbjct: 238 ALYANKHPGHFKKLVMCSPAGVCHSAPEMRKRPPPWWFAKLWDKNISPFSLVRNANVLGS 297

Query: 300 KLTSGWTYRRFSSLLSQN--NLKQFEALHKYTYSIFNQRGSGEYLLNFALKCGGGPRYPL 357
           KLTSGW+YRR   LL     N +Q EALH+Y Y+IFN++GSGEYLL+FAL+CGG PR PL
Sbjct: 298 KLTSGWSYRRLGQLLKDKVLNARQHEALHRYAYAIFNRKGSGEYLLSFALQCGGEPRVPL 357

Query: 358 EKTLFMNNDKGISKSSTEWIWAYGDNDWMDKNGGIRVSEILTKQLKKRSEVYIVPRAGHH 417
           E+ LF N  +   K++ EW+W YGD DW+D+ GG RVS+ LT ++   S V IV  +GHH
Sbjct: 358 ERRLFHNRGQQF-KANCEWLWLYGDQDWIDRRGGERVSQFLTAEMGHESCVKIVKNSGHH 416

Query: 418 LYFDNHQFFNDLILKEM 434
           LY DNH+ FN ++  EM
Sbjct: 417 LYLDNHRMFNKILEDEM 433

>ABL019W Chr2 (361560..362855) [1296 bp, 431 aa] {ON} Non-syntenic
           homolog of Saccharomyces cerevisiae YGR110W
          Length = 431

 Score =  427 bits (1099), Expect = e-147,   Method: Compositional matrix adjust.
 Identities = 201/380 (52%), Positives = 267/380 (70%), Gaps = 4/380 (1%)

Query: 61  LFELIKQFPRLFPRSFMKSFQDYKQFHSDVENFQVRLLETLPYFPDPSNGIYSKITNTIV 120
           L+E+I+  P LFP    +S++DYK F SD E FQV LL TLP+F     G   KI  T V
Sbjct: 50  LYEIIRNLPNLFPLPTSQSWEDYKAFKSDREAFQVGLLSTLPFFERAREGKIGKIIRTPV 109

Query: 121 DDEGSSINEFVVYPSNISV-PSEKLKHLIFVHGYGAGLGFFLKNLENIKLLNDEWCVHAI 179
           DDEG+ INEF + P+++         HLIF+HGYGAGLGFF+KN E++ LL+D+W +HAI
Sbjct: 110 DDEGNYINEFCIRPASMEENHGAATNHLIFIHGYGAGLGFFIKNFEHLPLLDDQWVIHAI 169

Query: 180 DLPGYGFSTRAKFPFQVGKHRHDQVNEWFHSRIRNWMHQRNLLQHSQNNFLIAHSLGAYL 239
           DLPGYG+STR +FPF V  H   +V  WFH R+  W+ +R LLQ    N ++AHS+GAYL
Sbjct: 170 DLPGYGYSTRCQFPFDVNTHSVREVEAWFHERLETWLSKRGLLQAPHRNMVMAHSMGAYL 229

Query: 240 MALYVDKHPNDLQKILMCSPAGIGDSMNLKKKTPAWWFEKLWERNISPFTLVRSSSYIGS 299
            A Y     N  +K++MCSPAGI  S ++KK+ P WWF KLW+RN+SPF+LVR+S  +GS
Sbjct: 230 TAHYAQSRQNHFKKLIMCSPAGISPSKSMKKQ-PPWWFIKLWDRNVSPFSLVRNSGPLGS 288

Query: 300 KLTSGWTYRRFSSLLSQN--NLKQFEALHKYTYSIFNQRGSGEYLLNFALKCGGGPRYPL 357
           KLTSGW++RRF  LL++    ++QFEALHKY+Y+IFN  GSGEYLL+F LKCGG PR PL
Sbjct: 289 KLTSGWSFRRFRHLLNEGEIGMRQFEALHKYSYAIFNMPGSGEYLLSFVLKCGGDPRIPL 348

Query: 358 EKTLFMNNDKGISKSSTEWIWAYGDNDWMDKNGGIRVSEILTKQLKKRSEVYIVPRAGHH 417
             ++F    +   K+  EW+W YGD+ WMDK GG R S  +T ++  +S V IVP +GHH
Sbjct: 349 LGSMFSPEKEHGFKAQCEWLWLYGDHVWMDKEGGQRASSYITDRIGGKSRVEIVPNSGHH 408

Query: 418 LYFDNHQFFNDLILKEMECM 437
           LYFDN+ +FN ++L+EM+ +
Sbjct: 409 LYFDNYSYFNKILLREMQSI 428

>Ecym_2465 Chr2 complement(908173..909489) [1317 bp, 438 aa] {ON}
           similar to Ashbya gossypii ABL019W
          Length = 438

 Score =  427 bits (1099), Expect = e-147,   Method: Compositional matrix adjust.
 Identities = 200/381 (52%), Positives = 263/381 (69%), Gaps = 5/381 (1%)

Query: 61  LFELIKQFPRLFPRSFMKSFQDYKQFHSDVENFQVRLLETLPYFPDPSNGIYSKITNTIV 120
           L E++   P LFP    +S++DYK FH DV+ FQ  LL TLP+FP  ++G   +I  T V
Sbjct: 51  LMEILLNIPSLFPMPLKESWKDYKIFHDDVDKFQTGLLSTLPFFPSAADGKIGEIIRTPV 110

Query: 121 DDEGSSINEFVVYPSNISV--PSEKLKHLIFVHGYGAGLGFFLKNLENIKLLNDEWCVHA 178
           D+EG+ INEF + P++  V     K+ HLIFVHGYGAGLGFFLKN ENIKLLN+ W +HA
Sbjct: 111 DEEGNYINEFCIRPNSPPVNPKDSKMHHLIFVHGYGAGLGFFLKNFENIKLLNNSWTIHA 170

Query: 179 IDLPGYGFSTRAKFPFQVGKHRHDQVNEWFHSRIRNWMHQRNLLQHSQNNFLIAHSLGAY 238
           ID PGYGFS+R KFPF + K+   +V  WFH R   W+ +R LL+  + N ++AHSLGAY
Sbjct: 171 IDFPGYGFSSRPKFPFSINKNTASEVENWFHDRFEIWLQKRGLLEDQERNLVLAHSLGAY 230

Query: 239 LMALYVDKHPNDLQKILMCSPAGIGDSMNLKKKTPAWWFEKLWERNISPFTLVRSSSYIG 298
           L+ALY    P  L+K++MCSPAGI  S N   K P WWF KLW+RN+SPF+LVR+S   G
Sbjct: 231 LIALYAQSRPKHLKKLIMCSPAGICPS-NKVIKQPPWWFVKLWDRNLSPFSLVRNSGIFG 289

Query: 299 SKLTSGWTYRRFSSLLSQNNL--KQFEALHKYTYSIFNQRGSGEYLLNFALKCGGGPRYP 356
           SKLTSGW++RRF   L++  +   QF+ALH+Y Y+IFN+ GSGEYLL+F LKCGG PR P
Sbjct: 290 SKLTSGWSFRRFKQFLNEGTMGESQFQALHRYAYAIFNKPGSGEYLLSFVLKCGGDPRSP 349

Query: 357 LEKTLFMNNDKGISKSSTEWIWAYGDNDWMDKNGGIRVSEILTKQLKKRSEVYIVPRAGH 416
           L   LF +      K+  +W+W YGD DWMD  GG + S+ + + + K S V+++P++GH
Sbjct: 350 LLSRLFNSQAADSFKAQCDWLWMYGDQDWMDCKGGEQASDFIVRHIGKESNVHVIPQSGH 409

Query: 417 HLYFDNHQFFNDLILKEMECM 437
           HLY DN+  FN+L+  EM  M
Sbjct: 410 HLYLDNYSVFNELLQAEMAKM 430

>NCAS0E00860 Chr5 (157521..158843) [1323 bp, 440 aa] {ON} Anc_3.454
          Length = 440

 Score =  421 bits (1083), Expect = e-145,   Method: Compositional matrix adjust.
 Identities = 204/381 (53%), Positives = 267/381 (70%), Gaps = 8/381 (2%)

Query: 63  ELIKQFPRLFPRSFMKSFQDYKQFHSDVENFQVRLLETLPYFPDPSNGIYSKITNTIVDD 122
           ++I   P LFPRS   S +DY  F +D+++ Q+ LL+TLP+FP  S+   +K+  T +DD
Sbjct: 61  DIITSLPSLFPRSLHDSRRDYNTFTTDIDSLQLNLLKTLPFFPMGSSQKVAKLIRTPIDD 120

Query: 123 EGSSINEFVVYPS--NISVPSEKLKHLIFVHGYGAGLGFFLKNLENIKLLNDEWCVHAID 180
           EG+ INEF + P+  +    S  LKHLIF+HGYGAGLGFFLKNLENI LL+++WC+HAID
Sbjct: 121 EGNYINEFCIMPAVKDGDYSSPDLKHLIFIHGYGAGLGFFLKNLENIPLLDNKWCIHAID 180

Query: 181 LPGYGFSTRAKFPFQVGKHRHDQVNEWFHSRIRNWMHQRNLLQHSQNNFLIAHSLGAYLM 240
           LPGYGFS+R KFPF        +V +WFH RI  W  +RNLLQ+ QNN ++AHSLGAYLM
Sbjct: 181 LPGYGFSSRFKFPFHYPNDSQTKVQKWFHDRIYRWFRERNLLQNPQNNLVMAHSLGAYLM 240

Query: 241 ALYVDKHPNDLQKILMCSPAGIGD-SMNLKKKTPAWWFEKLWERNISPFTLVRSSSYIGS 299
           A Y     N  +KI+MCSPAG+   ++  + K P WW+ KLW+ N SPF+LVR+S   GS
Sbjct: 241 AHYAFHFSNHFKKIIMCSPAGVSQFAVGKQNKQPPWWYNKLWDLNYSPFSLVRNSGIYGS 300

Query: 300 KLTSGWTYRRFS-SLLSQNNLKQFEALHKYTYSIFNQRGSGEYLLNFALKCGGGPRYPLE 358
           K+TSGW+YRRF  +  +  N  QFEALHKYTY IFN+ GSGEYLL+F L CGG PR+ LE
Sbjct: 301 KITSGWSYRRFKPTSFNGLNESQFEALHKYTYGIFNKNGSGEYLLSFILSCGGDPRFALE 360

Query: 359 KTLFMNNDKGISKSSTEWIWAYGDNDWMDKNGGIRVSEILTKQL--KKRSEVYIVPRAGH 416
             LF   ++   +   +W+W YGD DWMD NG  R+S  L K+     +S+V+++P AGH
Sbjct: 361 DNLF--KEENPPEDLCDWVWVYGDRDWMDINGAHRISRRLVKKAGDTSKSKVHVIPSAGH 418

Query: 417 HLYFDNHQFFNDLILKEMECM 437
           HLY DN++ FN+LI+KEME M
Sbjct: 419 HLYLDNYKAFNNLIIKEMETM 439

>NDAI0G01090 Chr7 (230932..232302) [1371 bp, 456 aa] {ON} Anc_3.454
          Length = 456

 Score =  421 bits (1081), Expect = e-144,   Method: Compositional matrix adjust.
 Identities = 206/380 (54%), Positives = 270/380 (71%), Gaps = 10/380 (2%)

Query: 61  LFELIKQFPRLFPRSFMKSFQDYKQFHSDVENFQVRLLETLPYFPDPSNGIYSKITNT-I 119
           L  +I   P+LFPRS  +S QDYK F  D E  Q+ LL+TLP+F + +     KI  T I
Sbjct: 77  LLRIITSLPKLFPRSIKQSIQDYKIFQKDPERLQIDLLKTLPFFSNGAKFKTGKILKTQI 136

Query: 120 VDDEGSSINEFVVYP-SNISVPSEKLKHLIFVHGYGAGLGFFLKNLENIKLLNDEWCVHA 178
            D++   INEF + P +NI++ S  +KHLIF+HGYGAGLGFF+KNLENI LLN+ WC+HA
Sbjct: 137 EDNDDYYINEFCITPDTNININSADVKHLIFIHGYGAGLGFFIKNLENIPLLNNRWCIHA 196

Query: 179 IDLPGYGFSTR-AKFPFQVGKHRHDQVNEWFHSRIRNWMHQRNLLQHSQNNFLIAHSLGA 237
           IDLPGYG+STR  KFPF+  +    +V  WFH +I  W+ +RNLL + +NN ++AHSLGA
Sbjct: 197 IDLPGYGYSTRNKKFPFKYPRDSQLKVQNWFHDKIHIWLQKRNLLNYPKNNLIVAHSLGA 256

Query: 238 YLMALYVDKHPNDLQKILMCSPAGIGDSMNLKK--KTPAWWFEKLWERNISPFTLVRSSS 295
           YLMA Y  K P+  QK++MCSPAG+  S ++KK   +P WW+EKLW+ N SPF++VR+S 
Sbjct: 257 YLMAQYAFKFPSHFQKLIMCSPAGVTKS-SIKKLNNSPPWWYEKLWDLNFSPFSIVRNSG 315

Query: 296 YIGSKLTSGWTYRRFSSLLSQNNLKQFEALHKYTYSIFNQRGSGEYLLNFALKCGGGPRY 355
             GSK+TS W+YRRF  L    + KQFEALH+Y YSIFN+ G GEYLL+F L CGG PR+
Sbjct: 316 IYGSKITSAWSYRRFKPL--DLDHKQFEALHRYAYSIFNRPGCGEYLLSFILSCGGNPRF 373

Query: 356 PLEKTLFMNNDKGISKSSTEWIWAYGDNDWMDKNGGIRVSEILTKQLKKRSEVYIVPRAG 415
            LE TLF   +  +S    +W W YGDNDWMD NG  RVS ++ +Q K +S+V+++P AG
Sbjct: 374 SLEDTLFQREN--LSTELCDWGWIYGDNDWMDINGAKRVSRLINEQQKGKSDVHVIPSAG 431

Query: 416 HHLYFDNHQFFNDLILKEME 435
           HHLY DN++ FN L++KEME
Sbjct: 432 HHLYLDNYKDFNKLLIKEME 451

>KNAG0B00950 Chr2 (173167..174423) [1257 bp, 418 aa] {ON} Anc_3.454
           YGR110W
          Length = 418

 Score =  417 bits (1071), Expect = e-143,   Method: Compositional matrix adjust.
 Identities = 198/374 (52%), Positives = 269/374 (71%), Gaps = 6/374 (1%)

Query: 61  LFELIKQFPRLFPRSFMKSFQDYKQFHSDVENFQVRLLETLPYFPDPSNGIYSKITNTIV 120
           L E+I + P LFPR   +S +DYK F ++ +  Q  LL TLP+FP+  +G  ++I  T +
Sbjct: 48  LTEIIVKLPYLFPRGVAQSLEDYKVFSNNADKIQYDLLSTLPFFPEAKDGKRAEIVRTKI 107

Query: 121 DDEGSSINEFVVYPSNISVPSEKLKHLIFVHGYGAGLGFFLKNLENIKLLNDEWCVHAID 180
           D++ + INEF + P+N++ PS KLKHLIF+HGYGAGLGFFLKN ENI+L ++ WC+HAID
Sbjct: 108 DEDDNFINEFFIQPANVTEPS-KLKHLIFIHGYGAGLGFFLKNFENIQLKDNSWCIHAID 166

Query: 181 LPGYGFSTRAKFPFQVGKHRHDQVNEWFHSRIRNWMHQRNLLQHSQNNFLIAHSLGAYLM 240
           LPG+GFS+R KFPF+  +    +V  WFH R++ W  +R+LL++  NN ++AHSLGAYLM
Sbjct: 167 LPGFGFSSRTKFPFKYPEDDVSKVQTWFHERLKIWFEKRDLLKNPGNNMVVAHSLGAYLM 226

Query: 241 ALYVDKHPNDLQKILMCSPAGIGDSMNLKKKTPAWWFEKLWERNISPFTLVRSSSYIGSK 300
           ALY   +P   +K++MCSPAG+ +S  +KK+ P WW+  LW+ N+SPF+LVR+S ++GSK
Sbjct: 227 ALYKRNNPLHFKKLIMCSPAGMCNSTVVKKQ-PPWWYAALWDMNLSPFSLVRNSGWLGSK 285

Query: 301 LTSGWTYRRFSSLLSQNNLKQFEALHKYTYSIFNQRGSGEYLLNFALKCGGGPRYPLEKT 360
           LTSGW+YRRF SL S+    QFE LH Y+Y+IFN+ G GEYLL FAL+CGG PR  LE T
Sbjct: 286 LTSGWSYRRFRSLHSK---IQFENLHLYSYAIFNRPGCGEYLLAFALRCGGDPRVSLEAT 342

Query: 361 LFMNNDKGISKSSTEWIWAYGDNDWMDKNGGIRVSEILTKQLKKRSEVYIVPRAGHHLYF 420
           LF N+      S +EW+W YGD DWMD  GG R+S+ + +    +S V ++P AGHHLYF
Sbjct: 343 LF-NDVVNKWDSDSEWVWLYGDRDWMDVKGGRRISQKINEIFPGKSSVEVIPNAGHHLYF 401

Query: 421 DNHQFFNDLILKEM 434
           DN   FN ++ KEM
Sbjct: 402 DNISCFNAILEKEM 415

>CAGL0L04686g Chr12 (539203..540558) [1356 bp, 451 aa] {ON} similar
           to uniprot|P53264 Saccharomyces cerevisiae YGR110w
          Length = 451

 Score =  401 bits (1031), Expect = e-137,   Method: Compositional matrix adjust.
 Identities = 193/405 (47%), Positives = 271/405 (66%), Gaps = 30/405 (7%)

Query: 61  LFELIKQFPRLFPRSFMKSFQDYKQFHSDVENFQVRLLETLPYFPDPSNGIYSKITNTIV 120
           L+E+++  PRLFPRS  +S +DY  FHS+V+  Q+ LL TLP+F        + +  T +
Sbjct: 50  LYEIVRDLPRLFPRSLAESKRDYATFHSNVDLMQLELLRTLPFFERTGYNKRAYLRKTEI 109

Query: 121 DDEGSSINEFVVYPSNISVPSEKLKHLIFVHGYGAGLGFFLKNLENIKLLNDEWCVHAID 180
           D +G+ INE V+ P+N+  P++K K LIFVHGYGAGLGF+LKN E++ LL+D W +HAID
Sbjct: 110 DSDGNYINELVIEPANVD-PNKKRKRLIFVHGYGAGLGFYLKNYEHLPLLDDSWSIHAID 168

Query: 181 LPGYGFSTRAKFPFQVGKHRHDQVNEWFHSRIRNWMHQRNLLQHSQNNFLIAHSLGAYLM 240
           LPGYGFS+R  FPFQ  +     V +WF SR+R    +R       +N ++AHS+GAYLM
Sbjct: 169 LPGYGFSSRMDFPFQFPRDDTSVVCDWFISRLRTLFEKRGF--DKSDNIVMAHSMGAYLM 226

Query: 241 ALYVDKHPNDLQKILMCSPAGIGDSM-----NLKKKTPA-------------WWFEKLWE 282
           A Y++K+P+ ++K++MCSPAGI  S      N+ +   +             WW+ KLW+
Sbjct: 227 AFYLNKYPDSVKKMVMCSPAGISRSQYSINNNITEDISSGKEEIKLKIKKVPWWYTKLWD 286

Query: 283 RNISPFTLVRSSSYIGSKLTSGWTYRRFSSLL--SQNNLKQFEALHKYTYSIFNQRGSGE 340
           RNISPF LVR +  +GSK+TSGWTYRRF  +L   +NN +QFE LH+Y+++IFN +GSGE
Sbjct: 287 RNISPFVLVRKTGILGSKITSGWTYRRFKPILLNKENNYEQFEKLHRYSFAIFNMKGSGE 346

Query: 341 YLLNFALKCGGGPRYPLEKTLFMN-------NDKGISKSSTEWIWAYGDNDWMDKNGGIR 393
           YLL+F L+CGG PR PLE +LF +       ++ GI  SS EW+W YG NDWMD +G  R
Sbjct: 347 YLLSFVLECGGDPRSPLENSLFSSDANKFGIDNAGIKNSSCEWVWVYGANDWMDIHGAER 406

Query: 394 VSEILTKQLKKRSEVYIVPRAGHHLYFDNHQFFNDLILKEMECMK 438
           V++      +K+S V  +P +GHHLYFDN+  FN L++ EM+ ++
Sbjct: 407 VTKDFLMNNRKKSRVVTIPESGHHLYFDNYPMFNSLLIDEMKSLQ 451

>KLLA0B12914g Chr2 (1126975..1128255) [1281 bp, 426 aa] {ON} similar
           to uniprot|P53264 Saccharomyces cerevisiae YGR110W
          Length = 426

 Score =  358 bits (920), Expect = e-120,   Method: Compositional matrix adjust.
 Identities = 182/374 (48%), Positives = 248/374 (66%), Gaps = 13/374 (3%)

Query: 61  LFELIKQFPRLFPRSFMKSFQDYKQFHSDVENFQVRLLETLPYFPDPSNGIYSKITNTIV 120
           L +++    +LFP SF +S +DYKQ++ + E FQ  LL  LPY+P+PS    SKI  T +
Sbjct: 65  LLQIVTNLHKLFPLSFAESLKDYKQYNINKEQFQEDLLSVLPYYPEPSARFSSKIIKTPI 124

Query: 121 DDEGSSINEFVVYPSNISVPSEKLKHLIFVHGYGAGLGFFLKNLENIKLLNDEWCVHAID 180
           D  G+ INEF + P       + LKH+I VHGYGAGLGF+LKN     LL++   VHAID
Sbjct: 125 DAAGNYINEFQITPIRPESDGKPLKHIILVHGYGAGLGFYLKNFN--ALLSENVVVHAID 182

Query: 181 LPGYGFSTRAKFPFQVGKHRHDQVNEWFHSRIRNWMHQRNLLQHSQNNFLIAHSLGAYLM 240
           LPGYGFS+R  FPF   K  +  V ++FH  +  W  ++ L+   +NN++IAHS+GAY+ 
Sbjct: 183 LPGYGFSSRPMFPFHYPKDSYLAVEDYFHDALHKWFDKKGLISCWENNYVIAHSMGAYIF 242

Query: 241 ALYVDKHPNDLQKILMCSPAGIGDSMNLKKKTPAWWFEKLWERNISPFTLVRSSSYIGSK 300
           +LY +K+ +  +K+ MCSP GI  S N     P WWF KLW++NISPF+LVR++ ++GSK
Sbjct: 243 SLYANKYKH-FKKLFMCSPGGI--SRNKDMPPPPWWFLKLWDQNISPFSLVRNAGHVGSK 299

Query: 301 LTSGWTYRRFSSLLSQNNLKQFEALHKYTYSIFNQRGSGEYLLNFALKCGGGPRYPLEKT 360
           L SGWT RRF   L   N   F+ LH YTY IFNQ GSGEY+L+F L CGG PR PLE  
Sbjct: 300 LVSGWTARRFG--LHHPN---FDKLHHYTYGIFNQPGSGEYMLSFMLGCGGWPRVPLETR 354

Query: 361 LFMNNDKGISKSSTEWIWAYGDNDWMDKNGGIRVSEILTKQLKKRSEVYIVPRAGHHLYF 420
           LF   ++  + S  +W+W YGD+DWMD NG  R+++ L K+    +++ IVP AGHHLY+
Sbjct: 355 LF--TEENFNSSHLDWVWLYGDSDWMDINGARRINDFLRKKCIN-TKLEIVPNAGHHLYW 411

Query: 421 DNHQFFNDLILKEM 434
           DN  FFN+++ KE+
Sbjct: 412 DNDSFFNNVLRKEL 425

>TBLA0F03460 Chr6 (853280..854605) [1326 bp, 441 aa] {ON} 
          Length = 441

 Score =  352 bits (902), Expect = e-117,   Method: Compositional matrix adjust.
 Identities = 184/396 (46%), Positives = 249/396 (62%), Gaps = 33/396 (8%)

Query: 61  LFELIKQFPRLFPRSFMKSFQDYKQFHSDVENFQVRLLETLPYFP--------------D 106
           L ++++  PRLFPRS   S +DY QF ++ E FQ RLL  L ++P              D
Sbjct: 53  LPQILRNLPRLFPRSMTDSIRDYSQFKTNPEFFQDRLLSQLSFYPSLYNNNSNDTSGNDD 112

Query: 107 PSNGIYSKITNTIVDDEGSSINEFVVYPSNISVPSEKLKHLIFVHGYGAGLGFFLKNLEN 166
           P  G   +I  T V+ E   INEF + P N S P ++LKHLI +HGYGAGLGF++  L++
Sbjct: 113 PRQG---QIIKTYVN-ENEYINEFQILP-NTSTPYDRLKHLILIHGYGAGLGFYINTLQH 167

Query: 167 IKLLNDEWCVHAIDLPGYGFSTRAKFPFQVGKHR---HDQVNEWFHSRIRNWMHQRNLLQ 223
           + +  D WC+HA+DLPGYGFS+R KFP+     R      V +WF  R++ W H++ LL 
Sbjct: 168 LSM--DNWCIHAVDLPGYGFSSRLKFPYGTINPRIYSKKDVLDWFQKRLKTWFHKKGLLA 225

Query: 224 HSQNNFLIAHSLGAYLMALYVDKHPNDLQKILMCSPAGIGDSMNLKKKTPAWWFEKLWER 283
           H +NN + AHS+GAY+M  Y++ HP+D +KI+MCSPAG   + N     P  W+  LW+R
Sbjct: 226 HPENNLVTAHSMGAYIMCHYLNNHPSDFRKIIMCSPAGFYPASNPLTNIPL-WYTYLWDR 284

Query: 284 NISPFTLVRSSSYIGSKLTSGWTYRRF--SSLLSQNNLKQFEALHKYTYSIFNQRGSGEY 341
           N SPF+LVR S  +GSKLTSGW+Y RF  S+    N L    ALH Y YSIFN  GSGEY
Sbjct: 285 NYSPFSLVRISGPLGSKLTSGWSYSRFFHSNQTISNELSL--ALHTYAYSIFNLPGSGEY 342

Query: 342 LLNFALKCGGGPRYPLEKTLFM---NNDKGISKSSTEWIWAYGDNDWMDKNGGIRVSEIL 398
            L+  LK GG PR PL++  F      + GI +S+ E+ W YG +DW++K GG ++S+ L
Sbjct: 343 SLSHILKAGGDPRTPLQEEFFTCQSTTNNGIRRSNVEYSWLYGQSDWINKTGGFKISQFL 402

Query: 399 TKQLKKRSEVYIVPRAGHHLYFDNHQFFNDLILKEM 434
              L K+S V+I P +GHHLYFDN+ +FN  + KEM
Sbjct: 403 -NSLNKKSNVFIAPNSGHHLYFDNYMWFNSYLAKEM 437

>KLTH0C01254g Chr3 complement(113435..114739) [1305 bp, 434 aa] {ON}
           conserved hypothetical protein
          Length = 434

 Score =  159 bits (403), Expect = 1e-43,   Method: Compositional matrix adjust.
 Identities = 121/410 (29%), Positives = 185/410 (45%), Gaps = 83/410 (20%)

Query: 88  SDVENFQVRLLETLPYFPDPSNGIYSKITNTIVDDEGSSINEFVVYPSNI-SVPSEKLKH 146
           +D +  + +LL TL +FP   +    ++ +  + ++   I+EF +   NI S   +  K 
Sbjct: 37  ADAKENEKKLLSTLEFFPGGDSIRNCELLDVDIGNK-QHIHEFSI--QNIESCSRDYCKD 93

Query: 147 LIFVHGYGAGLGFFLKNLENIKLLNDEWCVHAIDLPGYGFSTRAKFP--------FQVGK 198
           L+ VHGYGA LG F++N + +  +     +HA+D+ G G S+R +FP         + G+
Sbjct: 94  LVMVHGYGAALGLFVRNFDGLSRIPG-INLHALDMLGCGLSSRPRFPGTGLISSVIKRGR 152

Query: 199 HRHDQVNE---WFHSRIRNWMHQRNLLQHSQNNFLIAHSLGAYLMALYVDKHPNDLQKIL 255
              ++V E   +F   +  W  QR L +      L+ HSLG YL   Y  K P  ++K++
Sbjct: 153 VTKEEVYEAENFFIDSLEKWRQQRKLDKF----VLVGHSLGGYLSCCYALKFPERVEKLV 208

Query: 256 MCSPAGIGDSM--NLKKKTPA--------------------------------------- 274
           + SP G+  S+    K+ TP+                                       
Sbjct: 209 LVSPVGVEKSVFDLTKEHTPSHNNASELGPDLSKEVTNSSGRPTTDDPVKTSSSFHVPDE 268

Query: 275 -----------WWFEKLWERNISPFTLVRSSSYIGSKLTSGWTYRRFSSLLSQNNLKQFE 323
                      W F  +W  NISPF L+RS+   G  L+S W++RRFS      N +Q  
Sbjct: 269 AGNVERVPNMPWIFSSMWTYNISPFGLLRSAGPAGPLLSSRWSFRRFS---FAENTEQLL 325

Query: 324 ALHKYTYSIFNQRGSGEYLLNFALKCGGGPRYPLEKTLFMNNDKGISKSSTEWIWAYGDN 383
             H+Y YSIF+  GSGEY L   L  G   R PL   +  N          +  W YG +
Sbjct: 326 TFHEYCYSIFSGSGSGEYALTRILAPGVLARVPLLSRVPEN-------LKCDSFWMYGSH 378

Query: 384 DWMDKNGG-IRVSEILTKQLKKRSEVYIVPRAGHHLYFDNHQFFNDLILK 432
           DWM K  G + V +I   +   +++  +V  AGHHLY DN + FN  + K
Sbjct: 379 DWMSKEAGSVIVRQINKTKGSVKADYSVVSDAGHHLYLDNPEEFNQKLAK 428

>Kwal_14.985 s14 complement(142781..144088) [1308 bp, 435 aa] {ON}
           YDR125C (ECM18) - (putative) involved in cell wall
           biogenesis [contig 244] FULL
          Length = 435

 Score =  150 bits (379), Expect = 3e-40,   Method: Compositional matrix adjust.
 Identities = 114/414 (27%), Positives = 181/414 (43%), Gaps = 91/414 (21%)

Query: 88  SDVENFQVRLLETLPYFPDPSNGIYSKITNTIVDDEGSSINEFVVYPSNISVPSEKLKH- 146
           S+    + +LL TL +FP   +    KI +  + D+  +I+E  +   N+   S    + 
Sbjct: 38  SNARENEKQLLSTLEFFPQGDSTRKCKILDVDIGDK-QTIHELEI--ENLKTSSRSYAND 94

Query: 147 LIFVHGYGAGLGFFLKNLENIKLLNDEWCVHAIDLPGYGFSTRAKFPF-----------Q 195
           L+ VHGYGA LG F++N + +  +     +HAID+ G G S+R KFP             
Sbjct: 95  LVLVHGYGAALGLFVRNFDGLSSVPG-IKLHAIDMLGCGLSSRPKFPGTGLISSLIKRGN 153

Query: 196 VGKHRHDQVNEWFHSRIRNWMHQRNLLQHSQNNFLIAHSLGAYLMALYVDKHPNDLQKIL 255
           V K    +  ++F   +  W  +R +    +   L+ HSLG YL + Y  K+P  ++K++
Sbjct: 154 VTKEEVYEAEDFFVDSMEKWRKKRQV----EKFVLVGHSLGGYLSSCYALKYPERVEKLV 209

Query: 256 MCSPAG--------------------------------------------------IGDS 265
           + SP G                                                  + D 
Sbjct: 210 LVSPVGVEKSIFDLTHEHTESHKGAAELGPDVAKEITNNPDKPTTDNPVKNSSSFHVPDE 269

Query: 266 MNLKKKTP--AWWFEKLWERNISPFTLVRSSSYIGSKLTSGWTYRRFSSLLSQNNLKQFE 323
             + ++ P  +  F  +W  NISPF ++R+   +G  ++S W++RRFS     ++ KQ  
Sbjct: 270 HGMVERVPNMSRIFSYMWTYNISPFGILRTLGPVGPLISSNWSFRRFS---FTDDPKQLL 326

Query: 324 ALHKYTYSIFNQRGSGEYLLNFALKCGGGPRYPLEKTLFMNNDKGISKSSTEWIWAYGDN 383
             H+Y Y +F+  GSGEY L   L  G   R PL   +  N          +  W YG  
Sbjct: 327 TFHEYCYGVFSGAGSGEYALTRILAPGVLARLPLLSRMPGN-------LKCDSFWMYGSQ 379

Query: 384 DWMDKNGGIRVSEILTKQLKK-----RSEVYIVPRAGHHLYFDNHQFFNDLILK 432
           DWM K  G     ++ K+L +     +++  IV  AGHHLY DN + FN  +LK
Sbjct: 380 DWMSKEAG----SVMVKKLNESPGLGKADFSIVSDAGHHLYLDNPEEFNRKLLK 429

>SAKL0G19074g Chr7 (1646858..1648156) [1299 bp, 432 aa] {ON}
           conserved hypothetical protein
          Length = 432

 Score =  132 bits (331), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 120/417 (28%), Positives = 179/417 (42%), Gaps = 86/417 (20%)

Query: 76  FMKSFQDYKQFHSDVENFQVRLLETLPYFPDPSNGIYSKITNTIVDD--EGSSINEFVVY 133
           F  SF+ +K   S  E+ +  +L  L ++P+   G  S+   T+  D   G+SI+EF + 
Sbjct: 28  FKASFKTWKHASSLRES-EENILSMLDFYPE---GDESRRCETMDVDIGTGNSIHEFCIE 83

Query: 134 PSNISVPSEKLKHLIFVHGYGAGLGFFLKNLENIKLLNDEWCVHAIDLPGYGFSTRAKFP 193
            +  S   +  + ++ VHGYGA LG F++N + +  +     +HAID+ GYG S+R KFP
Sbjct: 84  NTKES-DRDYCRDMVLVHGYGAALGLFIRNFDGLSQIPG-IRLHAIDMLGYGLSSRPKFP 141

Query: 194 -----------FQVGKHRHDQVNEWFHSRIRNWMHQRNLLQHSQNNFLIAHSLGAYLMAL 242
                       +V K       ++F   I  W H+R+L        L+ HSLG YL   
Sbjct: 142 DTGFLTSFWKKREVTKEDVLLAEDFFIDSIETWRHKRHL----DKFVLVGHSLGGYLSCR 197

Query: 243 YVDKHPNDLQKILMCSPAGIGDSM-NLKKKTPAWWFE------------KLWERNISPFT 289
           Y  K+P  ++K+++ SP G+  S+ +L K+  A                K+   N +   
Sbjct: 198 YALKYPERVEKLILVSPVGVETSIFDLTKEHTATHEHAAELGPDIAQELKVVPENSTTDK 257

Query: 290 LVRSSSYIGSKLTSGWTYR-----RFSSLLSQNNLKQFEAL------------------- 325
            V+ SS       SG   R     +   ++ +NN+  F  L                   
Sbjct: 258 PVQPSSSFHVPNESGHVERIPNLPKIVRIIWENNISPFGILRSLGPWGPLLCSRWSFRRF 317

Query: 326 ------------HKYTYSIFNQRGSGEYLLNFALKCGGGPRYPLEKTLFMNNDKGISKSS 373
                       H Y Y+ FN RGSGEY L   L  G   R PL      N         
Sbjct: 318 SHCGDKEQVMKFHDYAYNTFNARGSGEYALTRILAPGVLARIPLLSCAPKN-------LK 370

Query: 374 TEWIWAYGDNDWMDKNGGIRVSEILTKQLKK---RSEVYIVPRAGHHLYFDNHQFFN 427
            E +W YG +DWM K  G     ++ K+L K    ++  +V  AGHHLY DN   FN
Sbjct: 371 CESLWMYGSHDWMSKEAG----SVIVKELNKAGNTADYSVVSDAGHHLYLDNPHEFN 423

>Ecym_5577 Chr5 (1185997..1187298) [1302 bp, 433 aa] {ON} similar to
           Saccharomyces cerevisiae YGR110W
          Length = 433

 Score =  132 bits (331), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 112/414 (27%), Positives = 178/414 (42%), Gaps = 82/414 (19%)

Query: 78  KSFQDYKQFHSDVENFQVRLLETLPYFPDPSNGIYSKITNTIVDDEGSSINEFVVYPSNI 137
           K+++   + H   +N    +L  L ++PD  +    ++ +  +   G  ++EF +  + +
Sbjct: 29  KTWKSSARLHEAEDN----VLRMLSFYPDGDSERTCEVLHVDIGG-GDYMHEFCI-ENKL 82

Query: 138 SVPSEKLKHLIFVHGYGAGLGFFLKNLENIKLLNDEWCVHAIDLPGYGFSTRAKFPFQ-- 195
            +  +  K ++ VHGYG  LG F++N + +  +     +HAID+ GYG S+R +FP    
Sbjct: 83  PMTRDTCKDIVLVHGYGTALGVFIRNFDELSQIPGVR-LHAIDMLGYGLSSRPRFPRSGF 141

Query: 196 ---------VGKHRHDQVNEWFHSRIRNWMHQRN-----LLQHSQNNFLI---------- 231
                    V K + ++   +F   +  W  +RN     L+ HS   +L           
Sbjct: 142 WDYYVKGKVVTKEQVEEALAFFVDSLEAWREKRNVDSFVLVGHSLGGYLSSFYALRHPER 201

Query: 232 -----------------------------AHSLGAYLMALY---VDKHPNDLQKILMCSP 259
                                        A  LG  + + +     +H  DL  I   SP
Sbjct: 202 IDKLVLVSPVGVETSIYDLTAEHTPEHQHAGQLGPEVASEFKEDATEHTTDLS-IDSNSP 260

Query: 260 AG----IGDSMNLKKKTP--AWWFEKLWERNISPFTLVRSSSYIGSKLTSGWTYRRFSSL 313
                 I +     +  P   W  + LW  N+SPF+L+R    +G K+ + W++RRF + 
Sbjct: 261 QSSSLHIPNEKGFVEHVPNIPWLVKMLWNTNVSPFSLLRLLGPLGPKICANWSFRRFGAC 320

Query: 314 LSQNNLKQFEALHKYTYSIFNQRGSGEYLLNFALKCGGGPRYPLEKTLFMNNDKGISKSS 373
              N L  F   H+Y Y+ F  +GSGEY +   L  G   R PL   L      G  K  
Sbjct: 321 KDTNELMNF---HQYAYNNFKAKGSGEYAMMKILAPGALARVPLLSQL-----PGALKCD 372

Query: 374 TEWIWAYGDNDWMDKNGGIRVSEILTKQLKKRSEVYIVPRAGHHLYFDNHQFFN 427
           +  +W YG NDWM K  G  + E L ++   R+E  IV  AGHHLY DN + FN
Sbjct: 373 S--LWMYGSNDWMSKEAGCIIVEELQEKSDYRAEYKIVNNAGHHLYLDNPEEFN 424

>Suva_10.183 Chr10 complement(344549..345733) [1185 bp, 394 aa] {ON}
           YLR099C (REAL)
          Length = 394

 Score = 74.3 bits (181), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 89/356 (25%), Positives = 138/356 (38%), Gaps = 92/356 (25%)

Query: 135 SNISVPSEKLKHLIFVHGYGAG-LGFF--LKNL-ENIKLLNDEWCVHAIDLPGYGFSTRA 190
           S +S P+      + +HGY A  + F+   KNL +NIK L      +AIDLP  G S   
Sbjct: 67  SKVSTPT------VLIHGYAASSMAFYRTFKNLSDNIKDL------YAIDLPANGASEAP 114

Query: 191 KF-----------------------------PFQVGKHRHDQVNEWFHSRIRNWMHQRNL 221
                                          P +  K   +Q   +F  RI  W    NL
Sbjct: 115 ALQVEGVKKIKSLRFKHVEDDMVTPVLDKRPPAEEIKSHLEQYESYFVDRIEQWRKDNNL 174

Query: 222 LQHSQNNFLIAHSLGAYLMALYVDKHPNDLQKILMCSPAGIGDSMNLKKKTPAWWFEKLW 281
            + +    ++ HS G Y+   Y  K+PN + K+ + SP G+ +S++             W
Sbjct: 175 RKIN----VVGHSFGGYISFKYALKYPNSIDKLCLISPLGVENSIHA--------INHKW 222

Query: 282 ERNIS-PFTLVRSSSY-------------------------IGSKLTSGWTYRRFSSLLS 315
           E N + P T    SS                          IGSKL S +    +  +  
Sbjct: 223 EANTTYPVTFTDPSSRYYTRKLNVPQFIFENQLNVLKWMGPIGSKLCSSYISTAYVKVPD 282

Query: 316 QNNLKQFEALHKYTYSIFNQRGSGEYLLNFALKCGGGPRYPLEKTLFMNNDKGISKSSTE 375
           Q  L +   LH +     NQ    + +  F        R  + +   +NN  G+   +T 
Sbjct: 283 Q--LYKDYLLHSFVGK--NQSVQPQTIKVFTQLF---ERNLIARDPIINN-VGLLNPATH 334

Query: 376 WIWAYGDNDWMDKNGGIRVSEILTKQLKKRSEVYIVPRAGHHLYFDNHQFFNDLIL 431
            ++ YG++DWMDK  G   +E + K  K ++    VP AGH+L+ DN   F   ++
Sbjct: 335 VMFMYGEHDWMDKYAGYLTTESMLKN-KAKASYMEVPDAGHNLFLDNPNHFTSSLV 389

>Skud_12.167 Chr12 complement(322870..324054) [1185 bp, 394 aa] {ON}
           YLR099C (REAL)
          Length = 394

 Score = 73.9 bits (180), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 87/347 (25%), Positives = 130/347 (37%), Gaps = 95/347 (27%)

Query: 148 IFVHGYGAGLGFFLKNLE----NIKLLNDEWCVHAIDLPGYGFSTRAKF----------- 192
           + +HGY A    F +  E    NIK L      +AIDLP  G S                
Sbjct: 74  VLIHGYAASSMAFYRTFESLSDNIKDL------YAIDLPANGASQAPALQVDKTKKIKPL 127

Query: 193 ------------------PFQVGKHRHDQVNEWFHSRIRNWMHQRNLLQHSQNNFLIAHS 234
                             P +  K   +Q   +F  RI  W     L + +    ++ HS
Sbjct: 128 RFKHIEDDVVVPVLDKHPPAEDIKSHLEQYENYFVDRIEQWRKDNKLRRIN----VVGHS 183

Query: 235 LGAYLMALYVDKHPNDLQKILMCSPAGIGDSMNLKKKTPAWWFEKLWERNIS-PFTLVRS 293
            G Y+   Y  K+PN + K+ + SP G+ +S++             WE N + P T    
Sbjct: 184 FGGYISFKYALKYPNSIDKLCLISPLGVENSIHA--------IAHKWEPNTTYPLTFTDP 235

Query: 294 SSY-------------------------IGSKLTSGWTYRRFSSLLSQNNLKQFEALHKY 328
           SS                          IGSKL S +    +  +  Q  L +   LH +
Sbjct: 236 SSRYYTRKLNVPQFIFENQLNVLKWMGPIGSKLCSNYISTAYVKVPDQ--LYKDYLLHSF 293

Query: 329 TYSIFNQRGSGEYLLNFALKCGGGPRYPLEKTLFMN----NDKGISKSSTEWIWAYGDND 384
                NQ    + +  F         +  E+ L       N+ G+   +T  ++ YG++D
Sbjct: 294 VGK--NQTVQPQTIKVFT--------HLFERNLIARDPIINNVGLLNPATHVMFMYGEHD 343

Query: 385 WMDKNGGIRVSEILTKQLKKRSEVYIVPRAGHHLYFDN-HQFFNDLI 430
           WMDK  G   +E + K   K S V  VP AGH+L+ DN H F + L+
Sbjct: 344 WMDKYAGYLTTESMLKNKAKASYVE-VPDAGHNLFLDNPHHFTSSLV 389

>Skud_4.386 Chr4 complement(673125..674465) [1341 bp, 446 aa] {ON}
           YDR125C (REAL)
          Length = 446

 Score = 73.2 bits (178), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 84/342 (24%), Positives = 146/342 (42%), Gaps = 72/342 (21%)

Query: 141 SEKLKHLIFVHGYGAGLGFFLKNLENI-KLLNDEWCVHAIDLPGYGFST----------- 188
           S  L   + +HGY A    + +N   + K + D   +++IDLP  G S+           
Sbjct: 116 STVLTPTLLIHGYAASSMSYFRNYPGLSKHIRD---LYSIDLPASGLSSIPSLEINATTP 172

Query: 189 -----------RAKFPFQVGKHRHDQVNEWFHS----RIRNWMHQRNLLQHSQNNFLIAH 233
                      + K P+ +  + H  V + F      RI  W     L + +    ++ H
Sbjct: 173 LPLDIKFIGKNKFKIPYTINANHHKFVIQMFEDFYLDRIEQWRIDNKLGKMN----IVGH 228

Query: 234 SLGAYLMALYVDKHPNDLQKILMCSPAGIGDSM-----NLKKKTP-AWWFE----KLW-E 282
           S GAYL   Y  K+PN ++K+ + SP G+  ++     N +  +P    FE    K + +
Sbjct: 229 SFGAYLSFKYAVKYPNSVEKLCLVSPLGVERNIWSVNNNFRSNSPYTIDFENPSSKFYSK 288

Query: 283 RNISP-------FTLVRSSSYIGSKLTSGWTYRRFSSLLSQNNLKQFEALHKYTYSIFNQ 335
           RNI P       F ++R    +G+KL   +    +S + S        A  +Y + +F  
Sbjct: 289 RNIIPRYLFQQQFQILRMMGPLGAKLCWNYILAAYSRVPSL-------AYKEYIFELFYG 341

Query: 336 RGSGEYLLNFALKCGGGPRYPLEKTLFMNNDKGISKSSTEWIWAYGDNDWMDKNGGIRVS 395
           +G G   +   +  G   R  L +   M  D   S +  + +  YG  DWM+KN G+   
Sbjct: 342 KG-GIPAVTTEIFEGLFSRSILARDPLM--DSLNSLNVRKLLVVYGQYDWMNKNAGM--- 395

Query: 396 EILTKQLK------KRSEVYIVPRAGHHLYFDNHQFFNDLIL 431
            ++ K+L       +++    +P +GH+L+ DN + FN  I+
Sbjct: 396 -LMVKELNNLGDHFEKATYTEIPFSGHNLFLDNPESFNQSIV 436

>TDEL0F04100 Chr6 complement(756762..758066) [1305 bp, 434 aa] {ON}
           Anc_8.284 YDR125C
          Length = 434

 Score = 72.8 bits (177), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 84/358 (23%), Positives = 144/358 (40%), Gaps = 66/358 (18%)

Query: 120 VDDEGSSINEFVVY---------PSNISVPSEKLKHLIFVHGYGAGLGFFLKNLENI-KL 169
           VD  G+  N+ V +         P+  ++ +  L     +HGY A    + +N   + + 
Sbjct: 83  VDVAGTKDNQIVAHGINQWHFNNPAATAITTPTL----LIHGYAASSMAYYRNFTGLSQT 138

Query: 170 LNDEWCVHAIDLPGYGFSTRAKFPFQVGKHRHDQV----NEWFHSR-IRNWMHQRNLLQH 224
           + D   ++AIDLP  G S    F     K R  +V    N+ F  + + +    + ++Q 
Sbjct: 139 VTD---LYAIDLPANGLSAEQPFKLNGDKPRSLKVKYLDNDKFSVQHVIDESGTKQMIQQ 195

Query: 225 SQNNFL-----------------IAHSLGAYLMALYVDKHPNDLQKILMCSPAGIGDSMN 267
            ++ +L                 + HS G YL   Y  K+PN ++K+ + SP G+     
Sbjct: 196 CESYYLDKIEEWRKVNKLEKINLVGHSFGGYLSFKYALKYPNSIEKLCLVSPLGV----- 250

Query: 268 LKKKTPAWWFEKLWERNISPFTL----VRSSSYIGSKLTSGWTYRRFSSLLSQNNLKQFE 323
              +T  +      E+N + + L      S+ Y   +    + ++  S +L        +
Sbjct: 251 ---ETSIYSVNNKLEKN-TKYALDLEDPTSNFYTRRREIPKFIFKNQSEILRWMGPLGAK 306

Query: 324 ALHKYTYSIFNQRGSGEY-LLNFALKCGGGPRYPLEKTLFMN------------NDKGIS 370
               Y  S +++    EY    F L  G G   P  + +F N             D    
Sbjct: 307 MCWNYILSAYSRIPEMEYKSYIFELLYGKGGIAPTARQIFTNLFTRNLLAKDPIMDSLGQ 366

Query: 371 KSSTEWIWAYGDNDWMDKNGGIRVSEILTKQLKKRSEVYI-VPRAGHHLYFDNHQFFN 427
             + + +  YGD+DWM+K  G ++ E L       S  YI VP +GH+L+ DN  FFN
Sbjct: 367 LQAKKVLLVYGDHDWMNKYAGYKLVERLNTIRNNTSAQYIEVPESGHNLFLDNPTFFN 424

>YLR099C Chr12 complement(339744..340928) [1185 bp, 394 aa] {ON}
           ICT1Lysophosphatidic acid acyltransferase, responsible
           for enhanced phospholipid synthesis during organic
           solvent stress; null displays increased sensitivity to
           Calcofluor white; highly expressed during organic
           solvent stress
          Length = 394

 Score = 71.6 bits (174), Expect = 7e-13,   Method: Compositional matrix adjust.
 Identities = 81/334 (24%), Positives = 130/334 (38%), Gaps = 78/334 (23%)

Query: 148 IFVHGYGAGLGFFLKNLENIKLLNDEWCVHAIDLPGYGFSTRAKF--------------- 192
           + +HGY A    F +  EN  L ++   ++AIDLP  G S                    
Sbjct: 74  VLIHGYAASSMAFYRTFEN--LSDNIKDLYAIDLPANGASEAPALQVNKTKKIKSLRFKH 131

Query: 193 --------------PFQVGKHRHDQVNEWFHSRIRNWMHQRNLLQHSQNNFLIAHSLGAY 238
                         P +  K   +Q   +F  RI  W     L + +    ++ HS G Y
Sbjct: 132 IEDDVVIPVIEKRPPAEDIKSHLEQYESYFVDRIEQWRKDNKLRKIN----VVGHSFGGY 187

Query: 239 LMALYVDKHPNDLQKILMCSPAGIGDSMNLKKKTPAWWFEKLWERNIS-PFTLVRSSSY- 296
           +   Y  K+P+ ++K+ + SP G+ +S++             WE N + P T    SS  
Sbjct: 188 ISFKYALKYPDSIEKLCLISPLGVENSIHA--------ITHKWEPNTTYPLTFTDPSSRY 239

Query: 297 ------------------------IGSKLTSGWTYRRFSSLLSQNNLKQFEALHKYTYSI 332
                                   IGSKL S +    +  +  Q  + +   LH +    
Sbjct: 240 YTRKLNVPRFIFENQLNVLKWMGPIGSKLCSNYISTAYVKVPDQ--IYKDYLLHSFVGK- 296

Query: 333 FNQRGSGEYLLNFALKCGGGPRYPLEKTLFMNNDKGISKSSTEWIWAYGDNDWMDKNGGI 392
            NQ    + +  F        R  + +   +NN + ++  +T  ++ YG++DWMDK  G 
Sbjct: 297 -NQTVQPQTIKVFTHLFE---RNLIARDPIINNVRFLN-PATPVMFMYGEHDWMDKYAGY 351

Query: 393 RVSEILTKQLKKRSEVYIVPRAGHHLYFDNHQFF 426
             +E + K   K S V  VP AGH+L+ DN Q F
Sbjct: 352 LTTESMLKNKAKASYVE-VPDAGHNLFLDNPQHF 384

>Smik_12.158 Chr12 complement(319660..320844) [1185 bp, 394 aa] {ON}
           YLR099C (REAL)
          Length = 394

 Score = 68.6 bits (166), Expect = 7e-12,   Method: Compositional matrix adjust.
 Identities = 79/334 (23%), Positives = 126/334 (37%), Gaps = 86/334 (25%)

Query: 148 IFVHGYGAGLGFFLKNLENIKLLNDEWCVHAIDLPGYGFSTRA----------------- 190
           + +HGY A    F +  E+  L N+   ++AIDLP  G S                    
Sbjct: 74  VLIHGYAASSMAFYRTFES--LSNNIKDLYAIDLPANGASEAPVLQVDKTKKVKSLRFKH 131

Query: 191 ------------KFPFQVGKHRHDQVNEWFHSRIRNWMHQRNLLQHSQNNFLIAHSLGAY 238
                       + P +  K   +Q   +F  RI  W     L + +    ++ HS G Y
Sbjct: 132 IEDDVVIPVLDRRPPAEDIKSHLEQYENYFVDRIEQWRKDNKLRKIN----VVGHSFGGY 187

Query: 239 LMALYVDKHPNDLQKILMCSPAGIGDSMNLKKKTPAWWFEKLWERNIS-PFTLVRSSSY- 296
           +   Y  K+PN + K+ + SP G+ +S++             WE N + P T    SS  
Sbjct: 188 ISFKYALKYPNSIDKLCLISPLGVENSIHA--------ITHKWEPNTTYPLTFTDPSSRY 239

Query: 297 ------------------------IGSKLTSGWTYRRFSSLLSQNNLKQFEALHKYTYSI 332
                                   IGSKL S +    +  +  Q  + +   LH +    
Sbjct: 240 YTRKLNVPRFIFENQLNVLKWMGPIGSKLCSNYISTAYVKVPDQ--IYKDYLLHSFVGK- 296

Query: 333 FNQRGSGEYLLNFALKCGGGPRYPLEKTLFMN----NDKGISKSSTEWIWAYGDNDWMDK 388
            NQ    + +  F         +  E+ L       N+ G+   +   ++ YG++DWMDK
Sbjct: 297 -NQTVQPQTIKVFT--------HLFERNLIARDPIINNVGLLNPTMHVMFMYGEHDWMDK 347

Query: 389 NGGIRVSEILTKQLKKRSEVYIVPRAGHHLYFDN 422
             G   +E + K   K S +  VP AGH+L+ DN
Sbjct: 348 YAGYLTTESMLKNKAKASYIE-VPDAGHNLFLDN 380

>KAFR0B05380 Chr2 (1107049..1108284) [1236 bp, 411 aa] {ON}
           Anc_8.284 YDR125C
          Length = 411

 Score = 68.2 bits (165), Expect = 9e-12,   Method: Compositional matrix adjust.
 Identities = 94/403 (23%), Positives = 160/403 (39%), Gaps = 106/403 (26%)

Query: 90  VENFQVRLLETLPYFPDPSNGIYSKITNTIVDDEGSSINEFVVYPS---NISVPSEKLKH 146
           + +FQ  +++ +P + + SN         ++  EG  +N++  + S   N++VP+     
Sbjct: 47  LRDFQDAIMKKVPSYAEKSN---------VITSEG--LNQWHFHNSKCRNVTVPT----- 90

Query: 147 LIFVHGYGAGLGFFLKNLENIKLLNDEWCVHAIDLPGYGFS--------------TRAKF 192
            + +HG+ +    F +N   +    D   ++AIDLP  G S              TR KF
Sbjct: 91  -LLLHGFASSSMSFFRNFTGLS--QDIMDLYAIDLPANGLSRSLSTKFYRVSPKETR-KF 146

Query: 193 P------FQVGKHRH--------DQVNEWFHSRIRNWMHQRNLLQHSQNNFLIAHSLGAY 238
                  FQ+  H +         +  +++   I  W     L  H  N  ++AHS G Y
Sbjct: 147 DMLDDIHFQLLSHGNYHAEKELIQKCEDYYIDTIERWRRSNEL--HKIN--IVAHSFGGY 202

Query: 239 LMALYVDKHPNDLQKILMCSPAG-------------IGDSMNLKK------------KTP 273
           L   Y  K+P  + K+ + SP G             +G++  + +            + P
Sbjct: 203 LSFKYALKYPESINKLCLVSPLGVEANIYSINNNFNVGETYTVNRLDPSSCCYINENEIP 262

Query: 274 AWWFEKLWERNISPFTLVRSSSYIGSKLTSGW---TYRRFSSLLSQNNLKQFEALHKYTY 330
            + F+ L       F ++R S  IG+KL   +   +Y R SSL             +Y +
Sbjct: 263 KYVFDNL-------FKILRLSGPIGAKLCWNYVLSSYSRISSL----------DFKRYVF 305

Query: 331 SIFNQRGSGEYLLNFALKCGGGPRYPLEKTLFMNNDKGISKSSTEWIWAYGDNDWMDKNG 390
            +   +G G       L         L +   M  D   S S    +  YG+ DWM KN 
Sbjct: 306 ELLYGKG-GMTATAINLFTQLFTTRLLARDPLM--DSAHSLSCNGILLLYGEYDWMAKNA 362

Query: 391 G---IRVSEILTKQLKKRSEVYIVPRAGHHLYFDNHQFFNDLI 430
           G   +   +   K    +++   VP++GH+L+ DN  FFN  I
Sbjct: 363 GKSLLTNCKADNKGSASKTKYLEVPKSGHNLFLDNPAFFNKSI 405

>Suva_2.288 Chr2 complement(496577..497884) [1308 bp, 435 aa] {ON}
           YDR125C (REAL)
          Length = 435

 Score = 66.6 bits (161), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 76/337 (22%), Positives = 133/337 (39%), Gaps = 76/337 (22%)

Query: 148 IFVHGYGAGLGFFLKNLENIKLLNDEWCVHAIDLPGYGFST------------------- 188
           + +HGY A    + +N     L      +++IDLP  G S+                   
Sbjct: 112 LLIHGYAASSMSYFRNYSG--LSKHFQNLYSIDLPASGLSSIPPLEVNTTTPLPLDIKFI 169

Query: 189 ---RAKFPFQVGKHRHDQVNEWFHS----RIRNWMHQRNLLQHSQNNFLIAHSLGAYLMA 241
              + K P+ +    H  V + F      RI  W     L + +    ++ HS G YL  
Sbjct: 170 GKNKFKIPYTINASHHKFVIQMFEDFYIDRIEQWRIDNKLDKMN----IVGHSFGGYLSF 225

Query: 242 LYVDKHPNDLQKILMCSPAGIGDSM-----NLKKKT--------------------PAWW 276
            Y  K+PN ++K+ + SP G+  ++     NL   T                    P + 
Sbjct: 226 KYAVKYPNSVEKLCLVSPLGVERNIWSVNNNLSSNTLYTTDFKDPSSKFYSKGHLIPKYL 285

Query: 277 FEKLWERNISPFTLVRSSSYIGSKLTSGWTYRRFSSLLSQNNLKQFEALHKYTYSIFNQR 336
           FE+        F L+R    +G+K+   +    +S + S        A  +Y + +F  +
Sbjct: 286 FEE-------QFKLLRLMGPLGAKVCWNYIMAAYSRVTSL-------AFKEYIFELFYGK 331

Query: 337 GSGEYLLNFALKCGGGPRYPLEKTLFMNNDKGISKSSTEWIWAYGDNDWMDKNGGIRVSE 396
           G    +     K G   R  L +   +++   +  +  + +  YG  DWM+KN G+ + E
Sbjct: 332 GGIPEVTTDIFK-GLFSRSILARDPILDSLNYL--NVKKLLVVYGQYDWMNKNAGMLLVE 388

Query: 397 ILTKQLK--KRSEVYIVPRAGHHLYFDNHQFFNDLIL 431
            + K     +R+    VP +GH+L+ DN + FN  I+
Sbjct: 389 NVNKLGNGLERASYLEVPSSGHNLFLDNPESFNQSIV 425

>Smik_4.371 Chr4 complement(662692..663999) [1308 bp, 435 aa] {ON}
           YDR125C (REAL)
          Length = 435

 Score = 66.2 bits (160), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 78/340 (22%), Positives = 140/340 (41%), Gaps = 68/340 (20%)

Query: 141 SEKLKHLIFVHGYGAGLGFFLKNLENI-KLLNDEWCVHAIDLPGYGFST----------- 188
           S  L   + +HGY A    F +N   + K + +   +++IDLP  G S+           
Sbjct: 105 STVLTPTLLIHGYAASSMSFFRNYPGLSKHIQN---LYSIDLPASGLSSIPPLEINATTP 161

Query: 189 -----------RAKFPFQVGKHRHDQV----NEWFHSRIRNWMHQRNLLQHSQNNFLIAH 233
                      + K P+ +  + H  V     +++  +I  W     L + +    ++ H
Sbjct: 162 LPLDIEFTGKNKFKIPYTINLNHHKFVIQMYEDFYLDKIEQWRIDNKLGKVN----IVGH 217

Query: 234 SLGAYLMALYVDKHPNDLQKILMCSPAGIGDSM-----NLKKKT--------PAWWFEKL 280
           S G YL   Y  K+PN ++K+ + SP G+  ++     N +  T        P+  F   
Sbjct: 218 SFGGYLSFKYAAKYPNSVEKLCLVSPLGVERNIWSINNNFRSNTLYTIGFEDPSSKFYS- 276

Query: 281 WERNISP-------FTLVRSSSYIGSKLTSGWTYRRFSSLLSQNNLKQFEALHKYTYSIF 333
            +RN+ P       F L+R    +G+KL   +    +S + S        A  +Y + +F
Sbjct: 277 -KRNMIPKYLFERQFQLLRMMGPVGAKLCWNYIMAAYSRVPSL-------AYKEYIFELF 328

Query: 334 NQRGSGEYLLNFALKCGGGPRYPLEKTLFMNNDKGISKSSTEWIWAYGDNDWMDKNGGIR 393
             +G    +     K G   R  L K   M++   +  +  + +  YG  DWM+K  G+ 
Sbjct: 329 YGKGGIPEVTTEIFK-GLFSRCILAKDPLMDSLHYL--NVRKLMVVYGQYDWMNKKAGML 385

Query: 394 VSEILTK--QLKKRSEVYIVPRAGHHLYFDNHQFFNDLIL 431
           + E L       +++    +P +GH+L+ DN   FN  I+
Sbjct: 386 MVENLNSLGNCLEKASYLEIPSSGHNLFLDNPLSFNQSIV 425

>Kpol_543.49 s543 complement(108945..110234) [1290 bp, 429 aa] {ON}
           complement(108945..110234) [1290 nt, 430 aa]
          Length = 429

 Score = 64.7 bits (156), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 84/343 (24%), Positives = 140/343 (40%), Gaps = 81/343 (23%)

Query: 148 IFVHGYGAGLGFFLKNLENI--KLLNDEWCVHAIDLPGYGFSTRAKFPFQ---------- 195
           + +HGY A    + +    +  K+ N    ++AIDLP +G S      F+          
Sbjct: 103 LLIHGYAASSLAYFRTFSGLSDKIKN----LYAIDLPSFGLSNAPPLDFKEKVSDIKIKL 158

Query: 196 ---------VGKHRHDQVN---------EWFHSRIRNWMHQRNLLQHSQNNFLIAHSLGA 237
                       +R D ++         +++  +I +W     L + +    L+ HS G 
Sbjct: 159 SDDNTKFKISDSNRVDSLDLKKLIGKYEDYYVEKIEDWRKANKLEKIN----LVGHSFGG 214

Query: 238 YLMALYVDKHPNDLQKILMCSPAG-------IGDSMNLKKKTP-------AWWFEKLWER 283
           Y+   Y  K+P+ + ++ + SP G       + ++   KK+ P       + ++ K  ER
Sbjct: 215 YISFKYAIKYPDAINRLCLVSPLGMESNIHSVNNNFETKKEYPLDLEDPSSRFYAK--ER 272

Query: 284 NISPF------TLVRSSSYIGSKLTSGWTYRRFSSLLSQNNLKQFEALHKYTYSIFNQRG 337
            I  F       ++R    IGSKL   W Y   S     N L       +Y + +   +G
Sbjct: 273 RIPNFLFKNQLNVLRWMGPIGSKLC--WNYINASYRRVPNPL-----FKEYLFELLYGKG 325

Query: 338 SGEYLLNFALKCGGGPRYPLEKTLFMNNDKGISKSSTEWIWA-YGDNDWMDKNGGIRVSE 396
            G   +   +      R  L +   M+    ISK   E +   YG++DWM+   G  + E
Sbjct: 326 -GMPSVTIDIFTNLFTRSLLARDPIMD---SISKLKAEKVLLLYGEHDWMNNLAGYNMVE 381

Query: 397 ILTKQLKKRSEV-------YI-VPRAGHHLYFDNHQFFNDLIL 431
            L  QLK  + +       Y+ VP AGH+L+ DN QFFN  +L
Sbjct: 382 SLN-QLKPNNNISTIDYANYVEVPDAGHNLFLDNPQFFNSAVL 423

>KNAG0H03120 Chr8 (586146..587450) [1305 bp, 434 aa] {ON} Anc_8.284
           YDR125C
          Length = 434

 Score = 64.3 bits (155), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 80/353 (22%), Positives = 137/353 (38%), Gaps = 84/353 (23%)

Query: 134 PSNISVPSEKLKHLIFVHGYGAGLGFFLKNLENIKLLNDEWCVHAIDLPGYGFSTR---- 189
           PS +   +     ++ +HGY +    + +N   +     +  V+AIDLP  G S      
Sbjct: 98  PSLVGSEAAVKPPVLLIHGYASSSMSYFRNFRGLSSQCKD--VYAIDLPANGLSREISLS 155

Query: 190 --------AKFPFQV-GKHRHDQV------------------NEWFHSRIRNWMHQRNLL 222
                    K+  QV G     QV                   +++   I  W  +  + 
Sbjct: 156 EDADLKDLVKYSLQVKGLDSPGQVKVTKPYNNKLCATQLRILEDYYVDEIERWRVENQID 215

Query: 223 QHSQNNFLIAHSLGAYLMALYVDKHPNDLQKILMCSPAGI-------------------- 262
           Q      L+ HS G Y+   Y  K+P ++ K+ + SP G+                    
Sbjct: 216 QL----HLVGHSFGGYISYKYALKYPQNVMKLALISPLGVERNLYSVNNHLPQDSIVQGT 271

Query: 263 -----GDSMNLKKKTPAWWFEKLWERNISPFTLVRSSSYIGSKLTSGWTYRRFSSLLSQN 317
                  S   K + P + FE       +   ++R    +G++L   W Y   +S  ++ 
Sbjct: 272 FEDPSSPSYLRKLEVPRYIFE-------NQLKILRWGGPMGARLC--WNY--ITSAYAKV 320

Query: 318 NLKQFEALHKYTYSIFNQRG--SGEYLLNFALKCGGGPRYPLEKTLFMNNDKGISKSSTE 375
             ++F+   +Y + +F   G  +   L  F L      R  L +   M  D        +
Sbjct: 321 PSREFK---EYLFELFYGDGGITKTALTTFILLF---TRNLLARDPIM--DSIAELKVKD 372

Query: 376 WIWAYGDNDWMDKNGGIRVSEILTKQLKKRSEVYI-VPRAGHHLYFDNHQFFN 427
            ++ YG  DWM+KN G R +E+L KQ    S +Y+ +P +GH+L+ D+ Q FN
Sbjct: 373 VMFQYGQYDWMNKNAGARAAELLRKQPYNNSALYLEIPESGHNLFLDSPQSFN 425

>Kwal_56.23702 s56 complement(668862..670112) [1251 bp, 416 aa] {ON}
           YDR125C (ECM18) - (putative) involved in cell wall
           biogenesis [contig 174] FULL
          Length = 416

 Score = 64.3 bits (155), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 79/331 (23%), Positives = 146/331 (44%), Gaps = 64/331 (19%)

Query: 148 IFVHGYGAGLGFFLKNLENI-KLLNDEWCVHAIDLPGYGFSTRAKFPFQVGKHRHDQVN- 205
           + VHGY A    F +N   + + + D   ++AIDLP  G S       +  +    ++N 
Sbjct: 100 LLVHGYAASSMGFHRNFPGLSQSIKD---LYAIDLPASGLSPALPLEMRCTQPLDLKINM 156

Query: 206 ---EWFHSRIRNWMHQRNLLQHSQNNFL-----------------IAHSLGAYLMALYVD 245
               +      N++H ++L+Q+ ++ +L                 +AHS G YL   Y  
Sbjct: 157 SKDTFSLPYTINYLHHKSLIQNYEDYYLDAIEQWRHDNKLGPINIVAHSFGGYLSFKYAV 216

Query: 246 KHPNDLQKILMCSPAGI-------------GDSMNLKKKTPAWWF---------EKLWER 283
           K P+ ++K+ + SP G+               S NL  + PA  F           ++E+
Sbjct: 217 KFPHAVEKLCLVSPLGVERNIFSVNNQWRSNTSYNLDFENPASKFYIKKGPAIPRLVFEQ 276

Query: 284 NISPFTLVRSSSYIGSKLTSGWTYRRFSSLLSQNNLKQ-FEALHKYTYSIFNQRGSGEYL 342
                 L+R+   +G+KL+  +    +S + S +  K  FE L  Y  +  NQ     ++
Sbjct: 277 QTQ---LLRNLGPLGAKLSWNYINAAYSRVPSLDYKKYVFELL--YGKNGLNQTSKDLFI 331

Query: 343 LNFALKCGGGPRYPLEKTLFMNNDKGISKSSTEWIWAYGDNDWMDKNGGIR-VSEILTKQ 401
             F  +        L +   +++ +   KS+ + +  YGD+DWM++  G+  V+E    Q
Sbjct: 332 GLFNNRV-------LARDPLLDSIQFFGKSA-KLMCIYGDHDWMNRRAGMEMVNE--ANQ 381

Query: 402 LKKRSEVYIVPRAGHHLYFDNHQFFNDLILK 432
           L   ++   V  +GH+L+ DN + FND +++
Sbjct: 382 LGIEAKYNEVSSSGHNLFLDNPEEFNDKLVR 412

>ZYRO0D06666g Chr4 (576172..577314) [1143 bp, 380 aa] {ON} similar
           to uniprot|Q04623 Saccharomyces cerevisiae YDR125C
          Length = 380

 Score = 61.2 bits (147), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 89/397 (22%), Positives = 158/397 (39%), Gaps = 88/397 (22%)

Query: 88  SDVENFQVRLLETLPYFPDPSNGIYSKITNTIVDDEGSSINEFVVYPSNISVPSEKLKHL 147
           +D+++FQ +++  +         +   + NT+V+ +   +N++  + SN    SE     
Sbjct: 16  ADLKHFQDKIMNLVK--------VGGNMENTMVNGQ---VNQWHFHNSN---ASEVTTPT 61

Query: 148 IFVHGYGAGLGFFLKNLENIKLLNDEWC-VHAIDLPGYGFSTRAKF--------PFQVGK 198
           + +HGY A    + +  +    L D+   ++ IDLP  G S             P +V  
Sbjct: 62  LLIHGYAASSMAYYRTFQG---LTDKISDLYTIDLPSNGLSKELPLILDGQTPPPLKVEI 118

Query: 199 HRHD-------------------QVNEWFHSRIRNWMHQRNLLQHSQNNFLIAHSLGAYL 239
           H+                     Q  +++   I  W     + + +    L+ HS G Y+
Sbjct: 119 HKDGSKFKIIERVDAEHCRSVVKQYEDYYLDSIELWRKHNGIGRFN----LVGHSFGGYI 174

Query: 240 MALYVDKHPNDLQKILMCSPAGIGDSM-------------NLKKKTPA-------WWFEK 279
              Y  K+P  ++++ + SP G+  ++              ++   PA       W   K
Sbjct: 175 AFKYAVKYPKAVEQLGLISPLGVESNIYSVNNDWKLDTVYEMESTDPASRMYGKNWEIPK 234

Query: 280 -LWERNISPFTLVRSSSYIGSKLTSGWTYRRFSSLLSQNNLKQFEALHKYTYSIFNQRGS 338
            L+ER      L+R    IG+KL   W Y       + N L   E    Y + +    G 
Sbjct: 235 VLFERQTE---LLRWMGPIGAKLC--WNY----ITAAYNKLPTME-YKDYVFELLYGNGG 284

Query: 339 GEYLLNFALKCGGG--PRYPLEKTLFMNNDKGISKSSTEWIWAYGDNDWMDKNGGIRVSE 396
              +   A K  GG   R  L +   M++   +       +  YGD+DWM+   G R+ E
Sbjct: 285 ---IPKTARKVFGGLFTRSLLARDPIMDSMDKLGARKV--LLLYGDSDWMNNYAGYRMVE 339

Query: 397 ILTKQLKKRSEVYI-VPRAGHHLYFDNHQFFNDLILK 432
           +L ++  K    Y  VP A H+L+ DN   FND +++
Sbjct: 340 LLNQKRGKGYATYDEVPDARHNLFLDNPDSFNDKLIQ 376

>SAKL0H16500g Chr8 (1450828..1452087) [1260 bp, 419 aa] {ON} similar
           to uniprot|Q04623 Saccharomyces cerevisiae YDR125C
          Length = 419

 Score = 61.2 bits (147), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 80/358 (22%), Positives = 155/358 (43%), Gaps = 78/358 (21%)

Query: 127 INEFVVYPSNISVPSEKLKHLIFVHGYGAGLGFFLKNLENI--KLLNDEWCVHAIDLPGY 184
           IN++  Y ++ S+ +  L     +HGY A    F +N   +  ++ N    ++AIDLP  
Sbjct: 83  INQWHFYNASASIKTPTL----LLHGYAAASMGFHRNFAGLSSRIQN----LYAIDLPAN 134

Query: 185 GFSTRAKFPFQVGKHRHDQVN-EWFHSRIR-----NWMHQRNLLQHSQNNFL-------- 230
           G S  +  P  V       +  E+ + R +      ++HQ++ +Q  ++ +L        
Sbjct: 135 GLSPGSSQPLVVSCGEPLPMKAEFSNDRFKIPYTLEYLHQKSFIQQLEDYYLNSIEQWRI 194

Query: 231 ---------IAHSLGAYLMALYVDKHPNDLQKILMCSPAGIGDSMNLKKKTPAW----WF 277
                    +AHS G YL   Y  K+P+ ++++ + SP G+    N+      W    W+
Sbjct: 195 DNKLNKINIVAHSFGGYLSTKYAIKYPHAVERLCLVSPLGV--ERNIHSVNNHWCSNTWY 252

Query: 278 EKLWE-----------RNI------SPFTLVRSSSYIGSKLTSGWTYRRFSSLLSQNNLK 320
           +  +E           R I      S   L+R    +G+KL   W Y   +    +N   
Sbjct: 253 DLNYEDPGSKYYMRRMRGIPSTVFQSQVKLLRLLGPLGAKLC--WNYINAAYSRVKN--- 307

Query: 321 QFEALHKYTYSIF-NQRGSGEYLLNFALKCGGGPRYPLEKTLFMNNDKGISKSSTEWIWA 379
             E   +Y + +F  + G  +  ++         R  L K   M++ + +       + A
Sbjct: 308 --EKYKEYVFELFYGKEGVTQTAMDIFTNLFT--RQLLAKDPLMDSLQHLHVG--RLMLA 361

Query: 380 YGDNDWMDKNGGIRVSEILTKQ---LKKRSEVY---IVPRAGHHLYFDNHQFFNDLIL 431
           YG++DWM+K  G+    ++TK+   L+ +S+     ++  +GH+++ DN   FN+ ++
Sbjct: 362 YGEHDWMNKYAGV----LMTKEFNHLRGKSDAATYTVISSSGHNMFLDNPDEFNEKVI 415

>NCAS0B05120 Chr2 complement(953798..954988) [1191 bp, 396 aa] {ON} 
          Length = 396

 Score = 60.8 bits (146), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 84/380 (22%), Positives = 152/380 (40%), Gaps = 87/380 (22%)

Query: 113 SKITNTIVDDEGSSINEFVVY---PSNISVPSEKLKHLIFVHGYGAGLGFFLKNLENI-K 168
           + +TN++++ E   IN++ ++    + + VP+      + +HGY A    + + L  + K
Sbjct: 41  TTVTNSLINGE---INQWHLHNPAAAKVDVPT------VLIHGYAASSMAYYRTLATLSK 91

Query: 169 LLNDEWCVHAIDLPGYGFST-------------------------RAKFPFQVG------ 197
            + D   V+ IDLP    S+                           K+ F+V       
Sbjct: 92  NVKD---VYVIDLPANSLSSVPPHSDISHLKINKIKVVQVSKDKENEKYVFKVAPPHAYD 148

Query: 198 ----KHRHDQVNEWFHSRIRNWMHQRNLLQHSQNNFLIAHSLGAYLMALYVDKHPNDLQK 253
               K   D++  ++   I  W      L       L+ HS G YL   Y  K+P  + K
Sbjct: 149 AQREKQVIDKLENYYLDVIEKWRRANYGLDKFN---LVGHSFGGYLSFKYAIKYPEVVDK 205

Query: 254 ILMCSPAGIGD---SMNLKKKTPAWWFEKLW---------ERNISPF------TLVRSSS 295
           + + SP G+     S+N    T   +   L          +R I  F       +++   
Sbjct: 206 LCLVSPLGVASNIRSVNNVFDTKKEYVMDLQNPGSMLYNRQRMIPNFLFNNQLNVLKWMG 265

Query: 296 YIGSKLTSGWTYRRFSSLLSQNNLKQFEALHKYTYSIFNQRGSGEYLLNFALKCGGGPRY 355
            +GSKLT  +    +  + + +          Y Y  F Q G  +  ++   K     R 
Sbjct: 266 PVGSKLTRKYINSAYVKVPTMD-------YKDYLYEYF-QMGVPQVNVDIFTKLFS--RN 315

Query: 356 PLEKTLFMNNDKGISKSSTEWIWAYGDNDWMDKNGGIRVSEILTK---QLKKRSEVYIVP 412
            + +   M+N   +   ST ++  YGDNDWMDK  G  + + + K      +++    +P
Sbjct: 316 LMARDPIMDNMNRLK--STRFMMMYGDNDWMDKFSGYTLVQNINKIKNNFDRKATYVEIP 373

Query: 413 RAGHHLYFDNHQFFNDLILK 432
            AGH+L+ DN + F++ ++K
Sbjct: 374 DAGHNLFLDNPEDFSNNLIK 393

>YDR125C Chr4 complement(701397..702758) [1362 bp, 453 aa] {ON}
           ECM18Protein of unknown function, similar to Rlp24p
          Length = 453

 Score = 59.3 bits (142), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 72/333 (21%), Positives = 136/333 (40%), Gaps = 68/333 (20%)

Query: 148 IFVHGYGAGLGFFLKNLENI-KLLNDEWCVHAIDLPGYGFST------------------ 188
           + +HGY A    F +N   + K + +   +++ID+P  G S+                  
Sbjct: 130 LLIHGYAASSMSFFRNYPGLSKHIRN---LYSIDMPASGLSSVPSLEINTTTPLPLDIKF 186

Query: 189 ----RAKFPFQVGKHRHDQV----NEWFHSRIRNWMHQRNLLQHSQNNFLIAHSLGAYLM 240
               + K P+ +  + +  V     +++  RI  W     L + +    ++ HS G YL 
Sbjct: 187 IGENKFKVPYTINANHNKFVIQMYEDFYLDRIEQWRIDNKLGKMN----VVGHSFGGYLS 242

Query: 241 ALYVDKHPNDLQKILMCSPAGIGDSM-------------NLKKKTPAWWFEKLWERNISP 287
             Y  K+PN + K+ + SP G+  ++              +  K P   F    +RN+ P
Sbjct: 243 FKYAVKYPNSVNKLCLVSPLGVERNIWSVNNNFHSNTLYTIDFKNPNSKFYS--KRNMIP 300

Query: 288 -------FTLVRSSSYIGSKLTSGWTYRRFSSLLSQNNLKQFEALHKYTYSIFNQRGSGE 340
                  F ++R    +G+KL   +    +S + S        A  +Y + +F  +G   
Sbjct: 301 KYLFEQQFHILRMMGPLGAKLCWNYIMAAYSRVPSL-------AYKEYIFELFYGKGGIP 353

Query: 341 YLLNFALKCGGGPRYPLEKTLFMNNDKGISKSSTEWIWAYGDNDWMDKNGGIRVSEILT- 399
            +     K     R  L K   M++ + +  +  + +  YG  DWM+K  G+ + + L  
Sbjct: 354 EVTTDIFKALFS-RCILAKDPLMDSLQYL--NVKKLLIVYGQYDWMNKKAGMFMVKELNN 410

Query: 400 -KQLKKRSEVYIVPRAGHHLYFDNHQFFNDLIL 431
            K   + +    +P +GH+L+ DN + FN  I+
Sbjct: 411 LKNCLEGASYLEIPSSGHNLFLDNPESFNQSIV 443

>NDAI0J01210 Chr10 (282384..283634) [1251 bp, 416 aa] {ON} Anc_8.284
          Length = 416

 Score = 58.9 bits (141), Expect = 8e-09,   Method: Compositional matrix adjust.
 Identities = 85/373 (22%), Positives = 150/373 (40%), Gaps = 90/373 (24%)

Query: 115 ITNTIVDDEGSSINEFVVYPSN---ISVPSEKLKHLIFVHGYGAGLGFFLKNLENIKLLN 171
           +TN +V+DE   +N++  Y +N   +++P+      + +HGY A    F +      L N
Sbjct: 71  MTNEMVNDE---LNQWSFYNNNTSTVTIPT------LLLHGYAASSMSFYRTFA--PLSN 119

Query: 172 DEWCVHAIDLPGYGFSTRAKFPFQVGKHRH----------------------------DQ 203
           +   ++AIDLP  G S     P ++ K R                             +Q
Sbjct: 120 NFKNLYAIDLPANGLS--VAIPLKITKQRKRLYEVKYKENNKFSISYPVPIEEQKPLIEQ 177

Query: 204 VNEWFHSRIRNWMHQRNLLQHSQNNFLIAHSLGAYLMALYVDKHPNDLQKILMCSPAGIG 263
              ++   +R+W    N+ + +    L+ HS G Y    Y  + P+ + K+ + SP G+ 
Sbjct: 178 YENYYLDAMRSWQVANNIEKFN----LVGHSFGGYFSFKYALRFPDSINKLCLVSPLGME 233

Query: 264 DSM-NLKKKTPAWWFE--KLWERNISPFTLVRSSSYIGSKLTSGWTYRRFSSLLSQNNLK 320
            ++ ++  K     FE  K++  N++  T    S + G K        +  + L +N L 
Sbjct: 234 SNIFSIHNK-----FEENKIYNVNLTDPT----SPFYGKKF-------QIPNYLFENQLD 277

Query: 321 QFEALH--------KYTYSIFNQRGSGEYL-LNFALKCGGGPRYPLEKTLFMN------- 364
               L          Y  S + +  S EY    F L  G     P+   LF N       
Sbjct: 278 VIRKLGPFGARLCWNYILSAYKRVPSMEYKEYLFELFYGNRQVSPILCELFTNLLTRNLL 337

Query: 365 -----NDKGISKSSTEWIWAYGDNDWMDKNGG-IRVSEILTKQLKKRSEVYI-VPRAGHH 417
                 D       +  +  YG++DWM++  G   VS +   +    +  Y+ VP AGH+
Sbjct: 338 ARDPILDSIDQLQLSNVLVMYGEHDWMNRYAGYCMVSRLNNIRRTPNTAQYLQVPAAGHN 397

Query: 418 LYFDNHQFFNDLI 430
           L+ DN ++F+  +
Sbjct: 398 LFLDNPEYFSSAL 410

>KLTH0G13178g Chr7 (1131579..1132826) [1248 bp, 415 aa] {ON} similar
           to uniprot|Q04623 Saccharomyces cerevisiae YDR125C
          Length = 415

 Score = 57.4 bits (137), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 76/333 (22%), Positives = 131/333 (39%), Gaps = 71/333 (21%)

Query: 148 IFVHGYGAGLGFFLKNLENI-KLLNDEWCVHAIDLPGYGFSTRA---------------- 190
           + +HGY A    F +N E + K + D   ++AIDLP  G S                   
Sbjct: 100 LLLHGYAASSMAFHRNFEGLSKCIRD---LYAIDLPANGLSPPQPLEIRCTEPQPLKIEI 156

Query: 191 -----KFPFQVGKHRHDQVNEWFHSRIRNWMHQRNLLQHSQNNFLIAHSLGAYLMALYVD 245
                K P+ +    H    + F     + + Q  L        ++AHS G Y+   Y  
Sbjct: 157 SNDTFKLPYTINSLHHKSAIQNFEDYYLDALEQWRLDNKLGPINIVAHSFGGYISFRYAV 216

Query: 246 KHPNDLQKILMCSPAGIGDSM-------------NLKKKTPAWWFEKLWERNISPFT--- 289
           K+P+ ++++ + SP G+  ++              L  + PA  F       I P     
Sbjct: 217 KYPHAVKRLCLLSPLGVERNIFSVNNNWRSNTQYKLDFENPASKFYIRKGPAIPPAIFEL 276

Query: 290 ---LVRSSSYIGSKLTSGW---TYRRFSSLLSQNNLKQF----EALHKYTYSIFNQRGSG 339
              ++R    +G++L   +    Y R  SL  +  + +      AL + +  IF    + 
Sbjct: 277 QTKVLRGLGPLGARLCWNYITAAYARVPSLKYKQYIFEMFYGKNALTQTSKDIFTGLFTN 336

Query: 340 EYLLNFALKCGGGPRYPLEKTLFMNNDKGISKSSTEWIWAYGDNDWMDKNGGIR-VSEIL 398
             L           R PL  +L           S + +  YGD+DWM++  G+  V+E  
Sbjct: 337 RLL----------ARDPLLDSL-------CHVRSKKLLLMYGDHDWMNRKAGLEMVTE-- 377

Query: 399 TKQLKKRSEVYIVPRAGHHLYFDNHQFFNDLIL 431
            K+L   ++   V  +GH+L+ DN +  N+LI+
Sbjct: 378 AKKLGIDAQYGEVSSSGHNLFLDNPEESNELIV 410

>CAGL0B01969g Chr2 complement(181406..182677) [1272 bp, 423 aa] {ON}
           similar to uniprot|Q04623 Saccharomyces cerevisiae
           YDR125c ECM18 or uniprot|Q12385 Saccharomyces cerevisiae
           YLR099c ICT1
          Length = 423

 Score = 57.0 bits (136), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 76/328 (23%), Positives = 128/328 (39%), Gaps = 73/328 (22%)

Query: 148 IFVHGYGAGLGFFLKNLENIKLLNDEWCVHAIDLPGYGFSTRAKFPFQVGK------HRH 201
           + +HGY A    F +++  +    D   ++ IDLPG G S       +V K         
Sbjct: 110 VLIHGYAATSTAFFRSIPYLN--RDIKDLYTIDLPGNGLSFTPSLDLEVSKPLPLKIENI 167

Query: 202 DQVNEWFHSRIRNWMHQRNLLQHSQNNFL-----------------IAHSLGAYLMALYV 244
           D  NE+    + +  H R +LQ   + ++                 +AHS G YL   Y 
Sbjct: 168 DDGNEFQLPYVIDSAHHRYVLQKLLDYYVDRIEQWRLDNKLGKINVVAHSYGGYLSFNYA 227

Query: 245 DKHPNDLQKILMCSPAGIG----------DSMNLKKK----TPAWWFEK-------LWER 283
            K+P ++  + + SP G+            S  + K+      + ++++       L+++
Sbjct: 228 LKYPANINTLGLISPLGVERNIYSINNEFHSRTIYKREWNDCNSMFYDRKFKLNDYLFQK 287

Query: 284 NISPFTLVRSSSYIGSKLTSGWTYRRFSSLLSQNNLKQFEALHKYTYSIFNQRGS----G 339
            + P   +R    IG+KL   +    ++ + S +          YT+  F  RG      
Sbjct: 288 QLKP---LRWLGPIGAKLCWNYIRSAYARVPSID-------YKDYTFETFYGRGGLPEQT 337

Query: 340 EYLLNFALKCGGGPRYPLEKTLFMNNDKGISKSSTEWIWAYGDNDWMDKNGGIRVSEILT 399
             +    L      R PL        D        + I  YG  DWM+KNGG  +++I  
Sbjct: 338 SQIFTSLLTSSLLARDPLL-------DHVSQLQVPKLIMMYGQYDWMNKNGGKLMTQIFN 390

Query: 400 KQLKKRSEVYI-VPRAGHHLYFDNHQFF 426
            + K     YI +P AGH+L+ DN   F
Sbjct: 391 GETK-----YIDIPNAGHNLFLDNPSDF 413

>TPHA0A01690 Chr1 (344521..345738) [1218 bp, 405 aa] {ON} Anc_8.284
           YDR125C
          Length = 405

 Score = 56.6 bits (135), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 86/372 (23%), Positives = 146/372 (39%), Gaps = 124/372 (33%)

Query: 148 IFVHGYG----------AGLGFFLKNLENIKLLNDEWCVHAIDLPGYGFSTRAKFP---- 193
           + VHGY           AGL  ++K+L            ++IDLP +G S   + P    
Sbjct: 65  LLVHGYATSSLAYYRNFAGLSSYIKDL------------YSIDLPTFGLSKTPELPTRKV 112

Query: 194 -----------------------FQVGKH--RHDQ-----------VNE-WFHSRIRNWM 216
                                  FQ+ K   +H++           +NE ++  RI  W 
Sbjct: 113 TKNLKVTLSNSNDKSDDPKKITSFQLSKDDIKHNEKYYNETKKELEINENYYIDRIEKWR 172

Query: 217 HQRNLLQHSQNNFLIAHSLGAYLMALYVDKHPNDLQKILMCSPAGIGDSMNLKKKTPAWW 276
            +  L + +    L+ HS G YL   Y  K+P+ ++K+ + SP G+    N+      + 
Sbjct: 173 IENKLDKIN----LVGHSFGGYLSYKYATKYPDSIEKLCLVSPLGM--ESNIYSINNKFE 226

Query: 277 FEKLWE--------------RNISPF------TLVRSSSYIGSKLTSGW---TYRRFSSL 313
            +K++E              R I  F       ++R    +GS LT  +   +YRR    
Sbjct: 227 NDKIYEIEEEDPSSIFFTNTRTIPKFLFNNQLNVLRWLGPVGSTLTWKYIKASYRRVDDA 286

Query: 314 LSQNNLKQFEALHKYTYSIFNQRGSGEYLLN-----FALKCGGGPRYPLEKTLFMNNDKG 368
           L ++ + +          I+ + G  E  +      F  K     + P+  T+    DK 
Sbjct: 287 LYKDYIHEL---------IYGKGGMEETTIKTFTNLFTTKLLA--KDPITDTV----DKL 331

Query: 369 ISKSSTEWIWAYGDNDWMDKNGGIRVSEILTK----QLKKRSEV----YI-VPRAGHHLY 419
            +K+    +  YG  DWM+   G ++++ L +       K  E+    Y+ VP AGH+L+
Sbjct: 332 KAKNV---LLLYGQEDWMNNYAGYQMTKKLNELKGYNTSKVGELNYATYMEVPEAGHNLF 388

Query: 420 FDNHQFFNDLIL 431
            DN  FFN  +L
Sbjct: 389 LDNPSFFNKALL 400

>KAFR0B02830 Chr2 complement(578530..579705) [1176 bp, 391 aa] {ON}
           Anc_8.284 YDR125C
          Length = 391

 Score = 56.2 bits (134), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 81/373 (21%), Positives = 146/373 (39%), Gaps = 89/373 (23%)

Query: 116 TNTIVDDEGSSINEFVVYPSNISVPSEKLKH-LIFVHGYGAGLGFFLKNLENIKLLNDEW 174
           TN +V++E   INE+  +  N S    K+K   + +HGY A    F +     +L  D  
Sbjct: 46  TNQMVNNE---INEWHFHNPNAS----KIKTPTLLIHGYAASSMAFHRTFN--RLSTDIK 96

Query: 175 CVHAIDLPGYG--------------------------FSTRAKFPFQVGKHRHDQVNEWF 208
            ++AIDLPG G                          F+ +     ++ K    +   ++
Sbjct: 97  DLYAIDLPGNGLSSAPELSDVIKMKDLKITLNKSKDGFTLKKAIDLEIEKANLAKYENYY 156

Query: 209 HSRIRNWMHQRNLLQHSQNNFLIAHSLGAYLMALYVDKHPNDLQKILMCSPAGIGDSMNL 268
            SRI  W     + + +    +I HS G ++   Y   HPN +  +++ SP  +G   N+
Sbjct: 157 LSRIDEWRKFHGIEKLN----VIGHSFGGFISFKYAITHPNQVNDLILVSP--LGMEKNI 210

Query: 269 KKKTPAWWFEKLWERNI-SPFTLVRSSSY-------------------IGSKLTSGW--- 305
                 +  E  +  +  +P +L  + S+                   +G ++   +   
Sbjct: 211 HSLNNNFELETKYTLDFENPASLYYARSFNVPSILFNNQLNILRWMGPLGGRMARQYIDM 270

Query: 306 TYRRFSSLLSQNNLKQF----EALHKYTYSIFNQRGSGEYLLNFALKCGGGPRYPLEKTL 361
            Y++   +  +N L       ++  K T + F    S   L           R P+   L
Sbjct: 271 AYKKVPDVAYKNYLYYVFYDGKSFPKVTINNFTNMFSKNLL----------ARDPIMDNL 320

Query: 362 FMNNDKGISKSSTEWIWAYGDNDWMDKNGGIRVSEILTK---QLKKRSEVYIVPRAGHHL 418
                K +       +  YG++DWMDK  G  + E+L+K   +LK       +P AGH+L
Sbjct: 321 LKLRAKKV-------MLVYGEHDWMDKYAGYNMVELLSKSNYKLKDTVHYVEIPDAGHNL 373

Query: 419 YFDNHQFFNDLIL 431
           + DN   F++ ++
Sbjct: 374 FLDNPTDFSENVV 386

>KLLA0F19624g Chr6 complement(1817206..1818435) [1230 bp, 409 aa]
           {ON} similar to uniprot|Q04623 Saccharomyces cerevisiae
           YDR125C ECM18 Protein of unknown function, similar to
           Rlp24p
          Length = 409

 Score = 55.1 bits (131), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 89/347 (25%), Positives = 144/347 (41%), Gaps = 79/347 (22%)

Query: 137 ISVPSEKLKHL--IFVHGYGAGLGFFLKNLENIKL-LNDEWCVHAIDLPGYGFSTRAKFP 193
           IS P+ K   +  + +HGY A    F +N E + L L D   V+A+DLPG G S   + P
Sbjct: 77  ISNPTAKAVGVPTLMIHGYAASSMTFFRNFEQLSLSLKD---VYAVDLPGNGLSK--ELP 131

Query: 194 FQVGK-HRHDQV--NEWFHS---RIRNWMHQRNLLQH----------------SQNNF-- 229
             V    + D+V  NE       R++N + +    +H                 +N    
Sbjct: 132 LSVDSMQKPDRVEFNETVKGQYFRLQNPVDEEKYKKHLAHYEDYYVDALEKWRKENKLSK 191

Query: 230 --LIAHSLGAYLMALYVDKHPNDLQKILMCSPAGIGDSM-------------NLKKKTPA 274
             L+ HS G YL   Y  K+P+++ K+ + SP G+  S+              ++ + P+
Sbjct: 192 INLVGHSYGGYLTFKYSLKYPDNVHKLCLVSPLGVERSIFSIHNHLEPERDYEIQSEDPS 251

Query: 275 WWFEKLWERNISPFTL------VRSSSYIGSKLTSGW---TYRRFSSLLSQNNLKQF--- 322
                  +RNI    L      +R    +G+K   G+   +Y R  S+  +  + Q    
Sbjct: 252 -KSNYSNKRNIPKLILQYQNKALRWMGPLGAKACWGYVNSSYGRVPSVPYREYVFQLVFG 310

Query: 323 -EALHKYTYSIFNQRGSGEYLLNFALKCGGGPRYPLEKTLFMNNDKGISKSSTEWIWAYG 381
              +   +  IFNQ  S   LL +          P+  +L    DK      ++ +  YG
Sbjct: 311 KGIMTDTSIRIFNQLFS-RSLLAYD---------PIMDSL----DK---VKVSKLMLVYG 353

Query: 382 DNDWMDKNGG-IRVSEILTKQLKKRSEVYIVPRAGHHLYFDNHQFFN 427
           ++DWM+K  G + + E  + +        IV RAGH+L  DN   FN
Sbjct: 354 EHDWMNKVAGRLAIEEFNSIRKSYDGTFDIVSRAGHNLVLDNPSEFN 400

>AGR062C Chr7 complement(833212..834366) [1155 bp, 384 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YLR099C
           (ICT1) and YDR125C (ECM18)
          Length = 384

 Score = 55.1 bits (131), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 80/376 (21%), Positives = 148/376 (39%), Gaps = 108/376 (28%)

Query: 117 NTIVDDEGSSINEFVV------YPSNISVPSEKLKHLIFVHGYGAGLGFFLKNLENIKLL 170
             +++  G++  E VV      Y +N   P       + +HGY +    F +NL  +   
Sbjct: 51  TALMEPLGAAGRESVVGGLHQWYFANAGAPIRTPT--VLLHGYASSAVSFHRNLAALGAQ 108

Query: 171 NDEWCVHAIDLPGYGFSTRAKFPF-------------------QVGKHRHDQVNEWFHSR 211
            ++  ++A+DLPG G S   + P                     +  +  D +  W   R
Sbjct: 109 VEQ--LYALDLPGNGMSQ--ELPLGPAAARALARRCGARADIRALADYYLDALERW---R 161

Query: 212 IRNWMHQRNLLQHSQNNFLIAHSLGAYLMALYVDKHPNDLQKILMCSPAGIGDSMNLKKK 271
             N +   N            HS G YL   Y  +HP  +Q++ + SP G+ ++    ++
Sbjct: 162 AANGLETLNA---------AGHSFGGYLAFKYALRHPARVQRLCLVSPLGV-EAQTAGRR 211

Query: 272 TP---------------------AWWFEKLWERNISPFTLVRSSSYIGSKLTSGWTYRRF 310
            P                     A     L+E+ +    ++R    +G+ L   W Y   
Sbjct: 212 MPGRATRRRTRPPTPASPHYTRAAALPPLLFEQQLR---VLRWLGPLGAHLL--WQYVNA 266

Query: 311 SSLLSQNNLKQFEALHKYTYSIFNQRGSGEYLLNFALKCGGGPRYPLEKTLF-------- 362
           S   S+   ++F   H+YT+++ ++          AL+       PL + LF        
Sbjct: 267 S--FSRVPGREF---HRYTFALLHR---------LALR-------PLPRKLFTGLFTNAL 305

Query: 363 ------MNNDKGISKSSTEWIWAYGDNDWMDKNGG-IRVSEILTKQLKKRSEVYIVPRAG 415
                 +++   +   + + +  YGD+DWMD   G   V+E+   + +  + + IVP AG
Sbjct: 306 LARDPLLDSLAELKVPNVQLL--YGDHDWMDARAGRALVAELNALRGRPDASLAIVPAAG 363

Query: 416 HHLYFDNHQFFNDLIL 431
           H+L+ DN + F+  +L
Sbjct: 364 HNLFLDNPEDFHSWLL 379

>KNAG0G02140 Chr7 complement(484440..485666) [1227 bp, 408 aa] {ON} 
          Length = 408

 Score = 54.3 bits (129), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 76/343 (22%), Positives = 127/343 (37%), Gaps = 82/343 (23%)

Query: 148 IFVHGYGAGLGFFLKNLENIKLLNDEWCVHAIDLPGYGFSTRAKFPFQVGKHRHDQVNEW 207
           + +HGY A    F  N+  +     + CV  +DLP  G S   + P  +G     Q   W
Sbjct: 84  VLIHGYAASSMAFHLNVAGLSNAFSDLCV--VDLPANGLS---REPPMLGPKVKGQPVHW 138

Query: 208 -----------------------------------FHSRIRNWMHQRNLLQHSQNNF-LI 231
                                              F  RI  W      L H  +N  ++
Sbjct: 139 KELDKKTGSLTVVCEPPSKMSSSGVLDDPGVYEDYFVDRIEKWR-----LAHGFDNINVV 193

Query: 232 AHSLGAYLMALYVDKHPNDLQKILMCSPAGIGDSMNLKKKTPAWWFEKLWERN------- 284
            HS G Y+   Y  K+   + K+++ SP G+    N+   +  W   K ++         
Sbjct: 194 GHSFGGYMSFKYAIKYSKHVDKLVLLSPLGV--ERNIDSVSNKWDVGKTYDLTDIDATSP 251

Query: 285 --ISPFTL-----------VRSSSYIGSKLTSGWTYRRFSSLLSQNNLKQFEALHKYTYS 331
               PFT+           +R    +G+ +       R+S++          A H Y + 
Sbjct: 252 LYYRPFTVPGYLFNNQLNVLRKMGPLGNHMAKRAIASRYSNVPGT-------AYHAYLHH 304

Query: 332 IFNQRGSGEY-LLNFALKCGGGPRYPLEKTLFMNNDKGISKSSTEWIWAYGDNDWMDKNG 390
           +F   G+  +   N         R  L +   ++N + +  +  + +  YGD+DWM+K  
Sbjct: 305 VF--YGAHTFPSANITAFTHLFTRQLLARDPLLDNIQRLKVN--KLMMVYGDHDWMNKEA 360

Query: 391 GI-RVSEILTKQLKKRSEVYI-VPRAGHHLYFDNHQFFNDLIL 431
           G   V EI  ++      VY  +P AGH+L+ DN   FN L++
Sbjct: 361 GYGMVQEINKERYVPAKAVYAELPSAGHNLFLDNPSGFNKLLI 403

>Ecym_4285 Chr4 (612053..613270) [1218 bp, 405 aa] {ON} similar to
           Ashbya gossypii AGR062C
          Length = 405

 Score = 53.9 bits (128), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 82/370 (22%), Positives = 146/370 (39%), Gaps = 73/370 (19%)

Query: 110 GIYSKITNTIVDDEGSSINEFVVYPSNISVPSEKLKHLIFVHGYGAGLGFFLKNL----E 165
           G+ SK  N ++ D    IN++  Y  +  + +  L     +HGY      + +N+    E
Sbjct: 56  GMPSKPENVLLMD---VINQWSFYNPDAKIQTPTL----LLHGYATSSMCYHRNMPQLSE 108

Query: 166 NIKLLNDEWCVHAIDLPGYGFSTRAKFPFQVGKH-----RHDQVNEWFH-SRIRNWMHQR 219
            IK L      + IDLP  G S        + K        + V   FH     + +H R
Sbjct: 109 GIKHL------YTIDLPANGLSKELPLELDIAKPIVFKPEFNSVKSEFHIPYTIDGLHHR 162

Query: 220 NLLQHSQNNF-----------------LIAHSLGAYLMALYVDKHPNDLQKILMCSPAGI 262
             +Q  ++ +                 L+ HS G Y+   Y  K+P +++K+ + SP G+
Sbjct: 163 CAIQKLEDYYIDSIELWRRKNSLGAINLVGHSFGGYISFKYSIKYPQNVKKLCLISPIGV 222

Query: 263 GDSM-----NLKKKTP-AWWFEKLWERNISPFTLV------------RSSSYIGSKLTSG 304
             ++     N +   P +  +E    ++ +  T++            R    +G+KL  G
Sbjct: 223 ERNIYSVHNNWRSNCPYSIDYEDPSSKHFANKTMIPEFVFNEQTKLLRLMGPLGAKL--G 280

Query: 305 WTYRRFSSLLSQ-NNLKQFEALHKYTYSIFNQRGSGEYLLNFALKCGGGPRYPLEKTL-F 362
           W Y   +++ S+  N    E +    Y       +   +  +        R P+  +L  
Sbjct: 281 WKY--INAVYSKVPNFLYLEFIFTLIYGKNVMTDTSRNIFTYLFTNSLLARDPMLDSLEH 338

Query: 363 MNNDKGISKSSTEWIWAYGDNDWMDKNGGIRVSEILTKQLKKRS-EVYIVPRAGHHLYFD 421
           ++ DK         +  YG++DW+    G  + E   KQ    S  + +VP A H+L+ D
Sbjct: 339 LHVDK--------LLMLYGEHDWVRSQPGKMMVEEFNKQRSHPSGTLTVVPDASHNLFLD 390

Query: 422 NHQFFNDLIL 431
           N  FFN  +L
Sbjct: 391 NPVFFNVALL 400

>CAGL0M11462g Chr13 complement(1129244..1130404) [1161 bp, 386 aa]
           {ON} similar to uniprot|Q12385 Saccharomyces cerevisiae
           YLR099c ICT1
          Length = 386

 Score = 52.4 bits (124), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 80/362 (22%), Positives = 135/362 (37%), Gaps = 104/362 (28%)

Query: 148 IFVHGYGAGLGFFLKNLENI-KLLNDEWCVHAIDLPGYGFST-----------RAKFPFQ 195
           + VHGYGA    + +    + + + D   ++AIDLP  G S            +AKF  +
Sbjct: 48  LLVHGYGASSMAYHRCFAPLSRHIRD---LYAIDLPANGLSEAPPLVAEGEAPKAKFKIE 104

Query: 196 VGK---------------------------HRH-----DQVNEWFHSRIRNWMHQRNLLQ 223
             K                           HR       Q  +++   I  W  + NL +
Sbjct: 105 ENKFTVVQGARRAAEPVTDAQVDQELMLRTHREKRRYLQQYEDYYVESIEQWRKENNLDK 164

Query: 224 HSQNNFLIAHSLGAYLMALYVDKHPNDLQKILMCSPAGIGDSM----------------- 266
            +    L+ HS G YL   Y  K+P  + K+ + SP G+  ++                 
Sbjct: 165 FN----LVGHSFGGYLSYKYALKYPESVNKLCLLSPLGMERNIHSINNTFEENVVYELQE 220

Query: 267 --------NLKKKTPAWWFEKLWERNISPFTLVRSSSYIGSKLTSGWTYRRFSSLLSQNN 318
                     K+K P + FE       + F+++R    IG KL   +    ++ + SQ  
Sbjct: 221 SDPSSYLYTRKRKAPKFLFE-------NQFSVLRWMGPIGDKLCLSFINSSYAKVPSQ-- 271

Query: 319 LKQFEALHKYTYSIFNQRGSGEYLLNFALKCGGGPRYPLEKTLFMNND--KGISKSSTEW 376
                A   Y +  F  +       +FA +     ++   ++L   +     I K     
Sbjct: 272 -----AYKDYLFESFLGKK------HFAKQNVHALKHLFTRSLLARDPIMDTIDKLKVPD 320

Query: 377 IWA-YGDNDWMDKNGGIRVSEILTK----QLKKRSEVYI-VPRAGHHLYFDNHQFFNDLI 430
           +   YGD+DWM+   G  + E L K         S  Y+ VP AGH+L+ DN  +F+  +
Sbjct: 321 VSVFYGDHDWMNSYAGYLMVERLKKFRVASTSGGSASYLEVPDAGHNLFLDNPDYFSKKL 380

Query: 431 LK 432
           ++
Sbjct: 381 VQ 382

>NCAS0B03710 Chr2 (664097..665389) [1293 bp, 430 aa] {ON} Anc_8.284
          Length = 430

 Score = 48.9 bits (115), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 74/324 (22%), Positives = 132/324 (40%), Gaps = 68/324 (20%)

Query: 148 IFVHGYGAGLGFFLKNLENIKLLNDEWCVHAIDLPGYGFSTRAKFPFQVG------KHRH 201
           + +HGY A    F +    + L      ++A DLPG G S    F F V       K ++
Sbjct: 112 LLLHGYAASSLCFFRTF--VPLSRSIKNLYATDLPGNGLSKNKSF-FSVMYGNEYMKVKY 168

Query: 202 DQVNEWFHSRIRNWMHQRNLLQHSQNNF-----------------LIAHSLGAYLMALYV 244
           ++ N++    + +   Q N ++HS++ +                 L+ HS G YL   Y 
Sbjct: 169 EENNKFSIKYLNSLKDQTNSIKHSEDYYIDAIREWQLSNNLPKINLVGHSFGGYLSFKYA 228

Query: 245 DKHPNDLQKILMCSPAGIGDSM----NLKKKTPAWWFE------KLWERNIS-------- 286
            ++P+++ K+ + SP G+  ++    N  K+   +  +        + RN +        
Sbjct: 229 LRYPDNVNKLCLVSPLGVESNLYSVNNSLKENYLYDVDYSDPKSSYYSRNFAIPKSLFEG 288

Query: 287 PFTLVRSSSYIGSKLTSGW---TYRRFSSLLSQNNLKQFEALHKYTYSIFNQR-GSGEYL 342
            F ++R    IG+++   +   +Y+R  S+             KY   +F+   G+ + L
Sbjct: 289 QFGILRWMGPIGARVCWNYILSSYKRVPSM-------------KYKEYLFHLLFGNAKKL 335

Query: 343 LNFALKCGG-GPRYPLEKTLFMNNDKGISKSSTEWIWA-YGDNDWMDKNGGIRVSEILTK 400
           +  A        R  L K   M++   I K   E +   YG +DWM+K  G  +   L  
Sbjct: 336 VTSAKTFTNLFTRNLLAKDPIMDS---IEKLQCEKLMVMYGQHDWMNKYAGYCLIAKLNN 392

Query: 401 QLKKRSEVYI--VPRAGHHLYFDN 422
               +   Y   +P AGH+L  DN
Sbjct: 393 YRSTKDAGYFTEIPEAGHNLILDN 416

>NDAI0J01200 Chr10 (280820..282103) [1284 bp, 427 aa] {ON} 
          Length = 427

 Score = 48.5 bits (114), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 73/345 (21%), Positives = 135/345 (39%), Gaps = 80/345 (23%)

Query: 135 SNISVPSEKLKHLIFVHGYG-AGLGFFLKNLENIKLLNDEWCVHAIDLPGYGFST----- 188
           S I+ P+      + +HGY  + + FF       K + D   ++AID P  G S      
Sbjct: 100 SQITTPT------LLLHGYATSSIAFFRTFGPLSKQIRD---LYAIDFPANGLSKAPPLN 150

Query: 189 ----RAKFPFQVGKHRHDQVNEWFHSRIRNWMHQRNLLQHSQNNFL-------------- 230
               +   P++V K + D   ++  S   +   Q+  ++H +N +L              
Sbjct: 151 VNHLKKHTPYKV-KFKDDNT-KFQISHTVDVQLQKETIEHYENYYLDAVRKWQLTNKIEK 208

Query: 231 ---IAHSLGAYLMALYVDKHPNDLQKILMCSPAGIGDSM-------------NLKKKTPA 274
              + HS G Y    Y  ++P+ + K+ + SP G+  ++             NL+ + P 
Sbjct: 209 FNLVGHSFGGYFAYKYALRYPDSVDKLCLVSPLGVERNIYSVNNNFEDKKVYNLELEDPT 268

Query: 275 WWFEKLWERNIS--------PFTLVRSSSYIGSKLTSGW---TYRRFSSLLSQNNLKQFE 323
               K + R            F ++R    +G + T  +   +YRR  S+  +  + +  
Sbjct: 269 ---SKYYGRTFQIPKCLFEGQFDILRKFGPLGPRFTWNYINSSYRRVPSMEFKEYIFELL 325

Query: 324 ALHKYTYSIFNQRGSGEYLLNFALKCGGGPRYPLEKTLFMNNDKGISKSSTEWIWAYGDN 383
             ++ T  I  +  S     N            L +   +++   +  S+   +  YG  
Sbjct: 326 YGNRKTSPILTEVFSNIVSRNL-----------LARDPILDSIDELKASNV--MLMYGQE 372

Query: 384 DWMDKNGG-IRVSEILTKQLKKRSEVYI-VPRAGHHLYFDNHQFF 426
           DWM+   G + V E+   +    +  Y+ VP AGH+L+ DN  FF
Sbjct: 373 DWMNSQAGYLMVKELNEIRENPNAASYVEVPNAGHNLFLDNPDFF 417

>TPHA0L01600 Chr12 (338450..339568) [1119 bp, 372 aa] {ON} Anc_8.524
           YBR204C
          Length = 372

 Score = 41.6 bits (96), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 42/172 (24%), Positives = 79/172 (45%), Gaps = 23/172 (13%)

Query: 90  VENFQVRLLETLPYFPDPSNGIYSKITNTIVDDEGSSINEFVVYPSNISVPSEKLKHLIF 149
            +NFQ++ ++    + D SN           DD+G S +  + +  N+   S   +  IF
Sbjct: 48  TKNFQLKFIKEHEQYLDVSN-----------DDKGLSGSVRICH--NLKEQSSIDEIYIF 94

Query: 150 VHGYGAGLGFFLKNLENIKLLNDEWCVHAIDLPGYGFSTRAKFPFQVGKHRHDQVNEWFH 209
           +HG G  L  FL  L+   L N  +   A+DLPG+G  +     + +  +    +  +  
Sbjct: 95  IHGLGGSLEQFLPLLKLTDLSNKSFI--AVDLPGFG-QSEFNDEYNIANYSMSSIIGFLK 151

Query: 210 SRIRNWMHQRNLLQHSQNNFLIAHSLGAYLMALYVDKHPND--LQKILMCSP 259
           S++      R L  +++   L  HS+G YL   +  ++  +  +QKI++ +P
Sbjct: 152 SQV----FSRYLTTNTK-IILTGHSMGCYLALHFYQQYKTEYQIQKIVLLAP 198

>TBLA0H01400 Chr8 (312727..313992) [1266 bp, 421 aa] {ON} Anc_8.284
           YDR125C
          Length = 421

 Score = 41.6 bits (96), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 41/142 (28%), Positives = 66/142 (46%), Gaps = 17/142 (11%)

Query: 288 FTLVRSSSYIGSKLTSGWTYRRFSSLLSQNNLKQFEALHKYTYSIFNQRGSGEYLLNFAL 347
           F +++    +GSKLT  +  RR+  + S       EA   + + +F        + NF+ 
Sbjct: 284 FNVLKCMGPLGSKLTWSFISRRYEHIAS-------EAYQNFLFKLF-ATVPNVTINNFS- 334

Query: 348 KCGGGPRYPLEKTLFMNNDKGISK-SSTEWIWAYGDNDWMDKNGGIRVSEILT--KQLKK 404
                 R  L K   M+    I+K  S + +  YG+NDWM+K  G  ++E L   K   K
Sbjct: 335 --NMFTRNLLAKDPIMD---SINKLQSKKLLLFYGENDWMNKEAGFLMAEKLNILKGDSK 389

Query: 405 RSEVYIVPRAGHHLYFDNHQFF 426
            +    VP +GH+L  D+ +FF
Sbjct: 390 YANWIEVPNSGHNLILDDPKFF 411

 Score = 36.6 bits (83), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 33/154 (21%), Positives = 56/154 (36%), Gaps = 45/154 (29%)

Query: 148 IFVHGYGAGLGFFLKNLENIKLLNDEWCVHAIDLPGYGFSTRAKF--------------- 192
           + +HGY A    + K      L      ++ IDLPG+G S   K                
Sbjct: 54  VLIHGYAASSMAYYKTFR--YLTGSIKDLYTIDLPGFGLSASPKIIINDHNRKKSQFDIK 111

Query: 193 ----------PFQVGKHR---------HDQV-----NEWFHSRIRNWMHQRNLLQHSQNN 228
                      F + K            D+      ++++  RI  W    NL + +   
Sbjct: 112 LIDSKDSNNNKFSISKKNLKLLENGNIEDKAFISAFDDYYIDRIEKWRKFNNLGKIN--- 168

Query: 229 FLIAHSLGAYLMALYVDKHPNDLQKILMCSPAGI 262
            +I HS G Y+   Y  K+P+ ++ + + SP G+
Sbjct: 169 -VIGHSFGGYISFKYAIKYPDSIENLCLVSPFGM 201

>KNAG0A03770 Chr1 complement(494021..495091) [1071 bp, 356 aa] {ON}
           Anc_8.524 YBR204C
          Length = 356

 Score = 38.9 bits (89), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 37/118 (31%), Positives = 58/118 (49%), Gaps = 20/118 (16%)

Query: 148 IFVHGYGAGLGFFLKNLENIKLLNDEWCVHAIDLPGYGFSTR-AKFP-FQVGKHRHDQVN 205
           IF+HG G  L  F   L+ +  L++++ V AIDLPG+G S     +P  QV KH    ++
Sbjct: 86  IFIHGLGGSLDQFFPLLKLLD-LSEKYFV-AIDLPGFGKSDEHTDYPMIQVVKHIDAVIS 143

Query: 206 EWFHSRIRNWMHQRNLLQHSQNNFLIAHSLGAYL----MALYVDKHPNDLQKILMCSP 259
           E  +     +   R          LI HS+G YL    M L+  K+   + K+++ +P
Sbjct: 144 ELLNEARLAFDTVR----------LIGHSMGCYLTLHFMTLFSKKY--RIGKVVLLAP 189

>CAGL0J08547g Chr10 (846742..847881) [1140 bp, 379 aa] {ON} similar
           to uniprot|Q12405 Saccharomyces cerevisiae YOR084w
          Length = 379

 Score = 37.4 bits (85), Expect = 0.057,   Method: Compositional matrix adjust.
 Identities = 35/140 (25%), Positives = 57/140 (40%), Gaps = 10/140 (7%)

Query: 142 EKLKHLIFVHGYGAGLGFFLKNLENIKLLNDEWCVH---AIDLPGYGFSTRAKFPFQVGK 198
           +K  +L+F HG G     +  + + I  LN  W V     ID   +G S        + K
Sbjct: 53  KKKVNLVFCHGSGMNRAIWEYHADRIADLNSNWVVDKIVVIDQVNHGDSA------LLNK 106

Query: 199 HRHDQVNEWFH-SRIRNWMHQRNLLQHSQNNFLIAHSLGAYLMALYVDKHPNDLQKILMC 257
            R     +WF  +R    + +      +  N ++ HS+G +     V  +PN  Q  ++ 
Sbjct: 107 GRLGLEFDWFDGARDICKVAEEEFNFMNNYNVIVGHSMGGFQTLAAVAHNPNLFQLAIVI 166

Query: 258 SPAGIGDSMNLKKKTPAWWF 277
            P  I D   L+ KT   +F
Sbjct: 167 EPVIIKDPSQLEPKTEYLFF 186

>KNAG0E03240 Chr5 (650902..652014) [1113 bp, 370 aa] {ON} Anc_8.37
           YFL030W
          Length = 370

 Score = 36.6 bits (83), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 19/54 (35%), Positives = 28/54 (51%), Gaps = 4/54 (7%)

Query: 201 HDQVNEWFHSRIRNWMHQRNLLQHSQNNFLIAHSLGAYLMALYVDKHPNDLQKI 254
           H +++EWF S+I   +H + +   S     IAH     L ALYVD     +Q+I
Sbjct: 275 HKELSEWFRSQITQQLHYKLVTTTSDGGAHIAHG----LTALYVDDPAKAIQEI 324

>NCAS0B02260 Chr2 complement(374788..375879) [1092 bp, 363 aa] {ON}
           Anc_8.524 YBR204C
          Length = 363

 Score = 35.4 bits (80), Expect = 0.28,   Method: Compositional matrix adjust.
 Identities = 34/121 (28%), Positives = 57/121 (47%), Gaps = 22/121 (18%)

Query: 148 IFVHGYGAGLGFF-----LKNLENIKLLNDEWCVHAIDLPGYGFSTRAKFPFQVGKHRHD 202
           +F+HG G  LG F     L +L+  K L        +DLPG+G S       ++  +   
Sbjct: 85  LFIHGLGGSLGQFEPLLRLTHLKGKKFL-------TLDLPGFGQSD------ELESYSMK 131

Query: 203 QVNEWFHSRIR-NWMHQRNLLQHSQNNF-LIAHSLGAYLMALYVDKHPN--DLQKILMCS 258
            V E   S +     +Q++L +++Q    L  HS+G YL   + + +    D++KI + S
Sbjct: 132 SVIETIRSVVDLATGNQKSLGENTQLKLILTGHSMGCYLCLHFFETYSKNYDIRKIALLS 191

Query: 259 P 259
           P
Sbjct: 192 P 192

>Kpol_1030.46 s1030 (103691..104797) [1107 bp, 369 aa] {ON}
           (103691..104797) [1107 nt, 369 aa]
          Length = 369

 Score = 33.5 bits (75), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 29/101 (28%), Positives = 44/101 (43%), Gaps = 9/101 (8%)

Query: 119 IVDDEGSSINEFVVYPSNISVPSEKLKHLIFVHGYG-AGLGFFLKNLENIKLLNDEWCVH 177
           ++D    SIN +   P+N+  PS  L   I  HG G + L F L   E    L  +  + 
Sbjct: 78  VIDKNNISINLYYKLPNNLESPSIPL--FICHHGAGSSALTFALLAKELYDRLEGKCAIL 135

Query: 178 AIDLPGYG----FSTRAKFPFQVGKHRHD--QVNEWFHSRI 212
             D  G+G         KFPF +     D  +++ WF++ I
Sbjct: 136 TFDARGHGKTRPLDRNKKFPFNLDDFISDFVELSTWFYNEI 176

>Kpol_2000.61 s2000 (123249..123272,123369..124205) [861 bp, 286 aa]
           {ON} (123249..123272,123369..124205) [861 nt, 287 aa]
          Length = 286

 Score = 32.7 bits (73), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 28/116 (24%), Positives = 49/116 (42%), Gaps = 17/116 (14%)

Query: 174 WC--VHAIDLPGYGFSTRAKFPFQVGKHRHDQVNEWFHSRIRNWMHQRNLLQHSQNNFLI 231
           +C  +HA  +   G    A+    + KH  D ++E   S + + +H   + + SQ   LI
Sbjct: 75  YCELLHARVMIVNGIENEAQM---IEKHIEDGIDEAIRSLVYSTLHVPEVKELSQLRDLI 131

Query: 232 AHSLGAYLMALYVDKHPNDLQKIL-MCSPAGIGDSMNLKKKTPAWWFEKLWERNIS 286
           A   G   + + +D H    +K++  CSP           K P     +L+ R I+
Sbjct: 132 AMKFGPDFIKIIIDDHLGVPEKVVKKCSP-----------KLPTEDLVELYLREIA 176

>TDEL0D00200 Chr4 (32432..34135) [1704 bp, 567 aa] {ON} 
          Length = 567

 Score = 32.7 bits (73), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 20/63 (31%), Positives = 30/63 (47%), Gaps = 1/63 (1%)

Query: 102 PYFPDPSNGIYSKITNTIVDDEGSSINEFVVYPSNISVPSEKLKHL-IFVHGYGAGLGFF 160
           PYFP+          N ++D+E  SI+E  V P N  V   K +H+ +   G   G G F
Sbjct: 15  PYFPNQMKENMKASVNEVIDEEQGSISELEVKPQNEMVRGLKSRHIQLIALGDAIGTGLF 74

Query: 161 LKN 163
           + +
Sbjct: 75  IGS 77

>SAKL0H10450g Chr8 complement(897598..898776) [1179 bp, 392 aa] {ON}
           similar to uniprot|P38139 Saccharomyces cerevisiae
           YBR204C Hypothetical ORF
          Length = 392

 Score = 31.6 bits (70), Expect = 4.1,   Method: Compositional matrix adjust.
 Identities = 31/118 (26%), Positives = 53/118 (44%), Gaps = 19/118 (16%)

Query: 148 IFVHGYGAGLGFFLKNLENIKLLNDEWCVHAIDLPGYGFSTRAKFPFQVGKHRHDQVNEW 207
           +F+HG G  L  F   L+ + LLN  +   ++DLPG+G S              D+V  +
Sbjct: 133 VFIHGLGGTLAQFEPLLKLLSLLNKGF--FSMDLPGFGSS--------------DEVESY 176

Query: 208 FHSRIRNWMHQR-NLLQHSQNNFLIAHSLGAYLMALYVD--KHPNDLQKILMCSPAGI 262
               I   + +    L  S+N  LI HS+G YL   +    +     Q++++ +P  +
Sbjct: 177 GMLEIVAIVQKTFAKLTPSRNLVLIGHSMGCYLAIHFCSAFQEQYSFQELVLLAPPSL 234

>CAGL0C00297g Chr3 (29470..31620) [2151 bp, 716 aa] {ON} similar to
           uniprot|P46995 Saccharomyces cerevisiae YJL168c EZL1
           enhancer of zeste-like
          Length = 716

 Score = 31.2 bits (69), Expect = 5.8,   Method: Compositional matrix adjust.
 Identities = 24/97 (24%), Positives = 44/97 (45%), Gaps = 4/97 (4%)

Query: 77  MKSFQDYKQFHSDVENFQVRLLETLPYFPDPSNGIYSKITNTIVDDEGSSINEFVVYPSN 136
           +K  +  K   S+ EN  +  LE++   P  +     K+ + ++  E  ++ + ++    
Sbjct: 310 LKKAEGQKIEKSEAENINIEFLESITINPCNTATDVQKVMSVLLQIENKTVAQKLLQRLY 369

Query: 137 ISVPSEKLKHLIFVHGYGAGLGFFLKNLENIKLLNDE 173
           +S   E L H+I +HGY      F K L+   L  DE
Sbjct: 370 LSSNEELLHHVIKLHGYTC----FTKLLQLFALEEDE 402

>NDAI0E00120 Chr5 (1990..4239) [2250 bp, 749 aa] {ON} 
          Length = 749

 Score = 31.2 bits (69), Expect = 6.8,   Method: Compositional matrix adjust.
 Identities = 31/154 (20%), Positives = 64/154 (41%), Gaps = 29/154 (18%)

Query: 122 DEGSSINEFVVYPSNISVPSEKLKHLIFVHGYGAGLGFFLKNL-------ENIKLLNDEW 174
           ++ + +++F+ YP    V    L++L F+H     +   L          E ++ L D W
Sbjct: 97  EDSTPVDQFIKYPV---VSDASLENLAFIHRSLPNMNVNLTESQRTMMSNERLEFLGDSW 153

Query: 175 CVHAIDLPGYGFSTRAKFPFQ----VGKHRHDQVNE----------WFHSRIRNWMHQRN 220
               +      +S   K+PF     + K +   VN            F  ++R  +   +
Sbjct: 154 LGALV-----AYSLYKKYPFANEGALSKMKQAIVNNDNLEKISKKLGFPEKLRGNIPHTS 208

Query: 221 LLQHSQNNFLIAHSLGAYLMALYVDKHPNDLQKI 254
           L +  + + L A  + AY+ AL VD++  + +++
Sbjct: 209 LRKKDKKSKLYADCVEAYIGALVVDRYSAEFKEV 242

>TPHA0L01660 Chr12 complement(348715..350358) [1644 bp, 547 aa] {ON}
           Anc_8.539 YBR200W
          Length = 547

 Score = 31.2 bits (69), Expect = 6.8,   Method: Compositional matrix adjust.
 Identities = 22/74 (29%), Positives = 31/74 (41%), Gaps = 19/74 (25%)

Query: 84  KQFHSDVENFQVRLLET-------------------LPYFPDPSNGIYSKITNTIVDDEG 124
           K+++ D  + QV+LL+T                   LPY P P   +   ITN   DD  
Sbjct: 311 KRYYQDFYDLQVKLLDTFPSESGKLRNSSGQWTKRILPYIPGPVPQVTESITNKRKDDLN 370

Query: 125 SSINEFVVYPSNIS 138
             ++E V  P  IS
Sbjct: 371 IYVSELVHLPDYIS 384

>Kpol_1000.24 s1000 complement(56352..59846,59848..61095) [4743 bp,
           1580 aa] {ON} complement(56352..59846,59848..61095)
           [4743 nt, 1581 aa]
          Length = 1580

 Score = 31.2 bits (69), Expect = 7.5,   Method: Compositional matrix adjust.
 Identities = 21/53 (39%), Positives = 26/53 (49%), Gaps = 1/53 (1%)

Query: 310 FSSLLSQNNLKQFEALHKYTYSIFNQRGSGEYLLNFA-LKCGGGPRYPLEKTL 361
           FSS L  N  KQ +  H  T+ I    GSG Y +N+  LK  G     LE T+
Sbjct: 439 FSSTLLTNPFKQLDLRHTTTHVIIISPGSGLYDVNYDLLKLTGKKLSTLEMTM 491

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.322    0.138    0.432 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 49,712,274
Number of extensions: 2279800
Number of successful extensions: 5908
Number of sequences better than 10.0: 78
Number of HSP's gapped: 5903
Number of HSP's successfully gapped: 104
Length of query: 438
Length of database: 53,481,399
Length adjustment: 113
Effective length of query: 325
Effective length of database: 40,524,141
Effective search space: 13170345825
Effective search space used: 13170345825
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 67 (30.4 bits)