Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
TPHA0M003003.162ON77477437360.0
Kpol_1032.103.162ON79182616690.0
NCAS0I020803.162ON77469515100.0
TDEL0D046003.162ON79557414730.0
KLTH0F06468g3.162ON83758514590.0
ADR317C3.162ON81985214510.0
Kwal_33.141673.162ON83860414440.0
ZYRO0B04906g3.162ON84743714140.0
Suva_4.2213.162ON76555813890.0
NDAI0A066203.162ON74781013870.0
KAFR0F022203.162ON74779513751e-179
Skud_4.2233.162ON76956613561e-176
Ecym_52363.162ON86437513271e-171
SAKL0C07348g3.162ON86134713201e-170
KLLA0C03828g3.162ON79371913131e-169
YDL028C (MPS1)3.162ON76435612941e-167
Smik_4.2073.162ON76535612831e-165
CAGL0K01617g3.162ON77442212201e-156
TBLA0F008603.162ON98038012361e-156
KNAG0K017403.162ON76554111341e-143
NCAS0C035603.162ON6415358901e-109
YHR102W (KIC1)5.406ON10802992657e-23
CAGL0L11550g5.406ON10723252658e-23
Skud_8.1635.406ON10762992622e-22
Smik_8.1805.406ON10733002585e-22
KAFR0D049505.406ON10083032541e-21
Ecym_10301.24ON4402922481e-21
Suva_15.2975.406ON10743002541e-21
KNAG0B043205.406ON10273432542e-21
AFR724C1.24ON4402922444e-21
NDAI0C017005.406ON10203002488e-21
NCAS0H019405.406ON10153172452e-20
Kpol_2002.461.52ON11232432442e-20
Kwal_55.215455.406ON8653452433e-20
KLTH0F16676g5.406ON8782952423e-20
NDAI0F045201.24ON4893062384e-20
Kpol_1031.105.406ON11272992416e-20
TDEL0A075606.341ON15753472416e-20
Suva_2.6871.52ON11282272407e-20
CAGL0L12474g8.482ON3022502289e-20
TDEL0E021805.406ON9872992381e-19
SAKL0H11638g8.482ON3042512271e-19
Skud_16.2518.482ON3052522271e-19
KAFR0H015308.482ON3062512262e-19
KLTH0F00946g1.24ON5122782332e-19
KNAG0F002901.52ON11252302362e-19
TDEL0D026504.184ON3661622273e-19
Kwal_56.224766.31ON6973222334e-19
KLTH0E11220g8.482ON3022512234e-19
Kwal_33.131121.24ON5052782304e-19
Kpol_499.34.184ON3741622264e-19
NDAI0I003406.341ON18363392345e-19
TBLA0A071501.52ON13912402335e-19
SAKL0C00946g1.24ON5643002305e-19
CAGL0K05709g1.52ON11032302335e-19
Suva_16.2868.482ON3052352226e-19
YPL031C (PHO85)8.482ON3052562226e-19
TPHA0H016305.406ON10363002326e-19
TBLA0H013308.302ON4812292287e-19
TDEL0B015408.482ON3042502227e-19
TBLA0A035705.406ON9752942317e-19
SAKL0H16038g8.302ON4342282268e-19
YDR507C (GIN4)1.52ON11422272318e-19
KNAG0D003906.341ON16563142319e-19
Smik_4.7891.52ON11362302319e-19
KLTH0D03454g1.271ON14333182319e-19
NCAS0C024708.482ON3112342201e-18
KLLA0D11990g8.482ON3043322191e-18
NCAS0A002801.24ON5353102261e-18
AGL242C8.482ON3032282192e-18
SAKL0C09174g3.92ON10713392292e-18
KLTH0C10912g6.31ON6973162272e-18
SAKL0G01848g5.406ON8853182282e-18
KNAG0A023108.482ON3022502182e-18
YDR490C (PKH1)3.92ON7663332272e-18
CAGL0K04169g4.184ON3982342222e-18
Skud_4.7643.92ON7562222272e-18
NDAI0D040504.184ON3662372202e-18
Smik_4.7673.92ON7582222262e-18
KNAG0D039804.184ON3732362203e-18
SAKL0B04488g4.184ON3682362193e-18
CAGL0I07513g3.92ON10762162263e-18
Ecym_24996.341ON15413132273e-18
Kpol_2002.241.24ON4872812223e-18
ABL034W2.479ON14252102263e-18
KAFR0B029808.302ON4442282213e-18
Skud_3.1466.341ON13342172264e-18
NCAS0C049403.92ON11162142264e-18
Kpol_1007.178.482ON3072352154e-18
TPHA0A016308.302ON4352282204e-18
AER264C6.341ON14832852254e-18
TPHA0C017808.482ON3052912155e-18
ZYRO0A06446g5.406ON9432922245e-18
KLLA0A02497g4.184ON3622352185e-18
Suva_2.7031.24ON4852802215e-18
Smik_3.1736.341ON13403232246e-18
KLLA0F20053g8.302ON4442282206e-18
ZYRO0A12826g4.184ON3661612176e-18
Kwal_23.63256.341ON15423082246e-18
CAGL0K02673g2.496ON9152162237e-18
NDAI0A006601.52ON10222302237e-18
ACL104C5.406ON9472792237e-18
Skud_4.7831.52ON11352272237e-18
KAFR0D033902.496ON7983072228e-18
Kpol_463.81.271ON14472992238e-18
KAFR0D041001.52ON11172312239e-18
Kwal_56.226933.92ON9843362229e-18
KAFR0E010403.229ON5023022199e-18
Ecym_25318.482ON3012562139e-18
Kpol_543.558.302ON4252282171e-17
TDEL0C064901.52ON11532542221e-17
TPHA0E038501.24ON4822782181e-17
CAGL0M11748g8.302ON4472282171e-17
Ecym_61454.184ON3652432141e-17
Kwal_56.238418.302ON4322282161e-17
YDR523C (SPS1)1.24ON4902802181e-17
Skud_2.1413.229ON5263352181e-17
KLTH0A06776g6.341ON15233322211e-17
Suva_10.2028.302ON4352282161e-17
Smik_4.8031.24ON4902802171e-17
NCAS0D046006.341ON16833442211e-17
TPHA0G032002.479ON15342132212e-17
NDAI0G027008.302ON4472282162e-17
KNAG0G023008.302ON4192282152e-17
Skud_12.1818.302ON4312282152e-17
KLTH0G12738g8.302ON4342282152e-17
TBLA0C029401.271ON16432892202e-17
Smik_12.1738.302ON4352282152e-17
Suva_3.1106.341ON13762192192e-17
KLLA0C08525g6.341ON15513242192e-17
TBLA0I011502.479ON17452062192e-17
NDAI0A038702.496ON8952842183e-17
KLTH0C09548g3.92ON9933062183e-17
AGR048C8.302ON4532282143e-17
KAFR0A017602.496ON8852752183e-17
Smik_2.1463.229ON5263392153e-17
NCAS0A053706.341ON15083372183e-17
NCAS0C033808.302ON4322282133e-17
Ecym_42668.302ON4642282143e-17
KLLA0C04191g3.177ON7972852173e-17
Sklu_YGOB_Anc_2.4962.496ON6192862163e-17
TDEL0F042908.302ON4272282134e-17
NCAS0D021006.31ON7263242164e-17
TPHA0E036401.52ON11372312174e-17
ACL191C4.184ON3651682104e-17
ZYRO0F08074g8.482ON3042502075e-17
TBLA0I002802.496ON13162862175e-17
Ecym_35863.92ON10772082165e-17
ZYRO0A03894g3.229ON4522892125e-17
KLLA0F11143g8.676ON8133272156e-17
KLLA0F14190g1.271ON13383142166e-17
TPHA0M018406.341ON16213322166e-17
TDEL0C067801.24ON4682772126e-17
NDAI0C026806.31ON7503242146e-17
AFR205C2.425ON4572602116e-17
Skud_4.7971.24ON4852802127e-17
Suva_2.6663.92ON7642222147e-17
AFR696C1.52ON11422272157e-17
ZYRO0D06182g8.302ON4312282108e-17
TBLA0B016303.177ON12953052158e-17
Suva_7.3254.184ON3681642088e-17
KLLA0F24618g3.229ON5562922128e-17
Ecym_55055.406ON10032742148e-17
Skud_7.3374.184ON3681632088e-17
KNAG0J017008.676ON8203042139e-17
NDAI0K021002.496ON9093422131e-16
SAKL0C01716g1.52ON12152392141e-16
SAKL0E04092g2.425ON4603312101e-16
TBLA0I024006.341ON17301972141e-16
TPHA0I009201.271ON14342992131e-16
TPHA0J006304.184ON3742382071e-16
YOL100W (PKH2)3.92ON10812582131e-16
KAFR0C045906.341ON14683242131e-16
NDAI0G054701.271ON15553142131e-16
KLLA0B13607g2.496ON9892852121e-16
KLLA0C01650g1.52ON11122272131e-16
TPHA0G028002.425ON5032482101e-16
SAKL0A01254g6.341ON15581792131e-16
KLTH0C08932g3.229ON5193192101e-16
KLTH0A07458g6.371ON8732932122e-16
NCAS0B086001.52ON11172302122e-16
Kwal_27.118038.482ON2461772002e-16
Kwal_26.77882.479ON12672732122e-16
NCAS0A021204.184ON3772142062e-16
KLLA0E21693g5.406ON10162772112e-16
Smik_6.1254.184ON3681632052e-16
TBLA0H016605.406ON9962922112e-16
YLR113W (HOG1)8.302ON4352282072e-16
CAGL0G04609g3.92ON9652882102e-16
YCR073C (SSK22)6.341ON13313232112e-16
KLTH0D06006g2.496ON9541852102e-16
KAFR0F039004.184ON3692402042e-16
Kwal_23.64586.371ON8682942102e-16
KNAG0K006803.92ON10952232102e-16
NDAI0E031708.482ON3232242032e-16
TDEL0D053203.92ON10572152102e-16
Suva_2.1573.229ON5263312073e-16
Skud_11.1262.479ON15182052103e-16
Kwal_23.55765.274ON5042792073e-16
Ecym_73922.479ON14342052103e-16
CAGL0K08514g2.479ON14892192103e-16
TPHA0M015003.338ON4303662053e-16
TDEL0A020102.425ON4852882063e-16
ACL006W6.31ON7082352083e-16
Kpol_1040.207.86ON12971982093e-16
Smik_8.422.496ON9392842093e-16
Kpol_1054.23.92ON10962202093e-16
Kwal_26.78612.496ON9551862093e-16
SAKL0E01584g6.31ON6953002084e-16
NCAS0B055608.162ON3522362024e-16
NDAI0G042903.92ON11133292094e-16
KLLA0C12485g3.92ON9252152084e-16
YMR001C (CDC5)6.31ON7052302084e-16
Smik_16.2048.482ON2491781974e-16
NDAI0B029008.162ON3522352024e-16
Smik_13.1596.31ON7052302084e-16
Suva_6.1691.271ON14842902094e-16
KLLA0F13552g2.479ON12672052094e-16
Skud_13.1546.31ON7052302074e-16
Skud_10.1191.271ON14812902094e-16
CAGL0L03520g1.271ON14471822094e-16
KNAG0A061402.425ON5662312064e-16
YKL101W (HSL1)2.479ON15182012095e-16
Suva_2.1058.162ON3532362025e-16
TDEL0A025502.479ON13692362085e-16
AFR335C3.92ON10332502085e-16
Kpol_1072.168.676ON7952062075e-16
Skud_3.391.52ON10172492085e-16
YNR031C (SSK2)6.341ON15792252085e-16
Suva_13.1636.31ON7052302075e-16
Kwal_26.73551.271ON14462892085e-16
ZYRO0B06512g3.92ON11112102085e-16
Skud_2.908.162ON3532362015e-16
TBLA0B023103.92ON8192142076e-16
ZYRO0G20306g2.425ON5492282056e-16
NCAS0A102903.229ON5093082046e-16
Kwal_26.75522.425ON4613032046e-16
ZYRO0D08184g6.341ON15813552076e-16
YJL095W (BCK1)1.271ON14783002077e-16
TDEL0G043806.31ON7223092067e-16
Skud_8.392.496ON9232842067e-16
TDEL0D014001.271ON14293002077e-16
YGR040W (KSS1)4.184ON3681632008e-16
YAR019C (CDC15)3.177ON9742862068e-16
KAFR0G026906.31ON7132922058e-16
KAFR0C028408.162ON3502322008e-16
Smik_3.541.52ON10322202069e-16
KAFR0C014403.92ON10951532069e-16
TPHA0J004206.31ON7073062049e-16
Ecym_60922.425ON4442212029e-16
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= TPHA0M00300
         (774 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

TPHA0M00300 Chr13 (59377..61701) [2325 bp, 774 aa] {ON} Anc_3.16...  1443   0.0  
Kpol_1032.10 s1032 (24479..26854) [2376 bp, 791 aa] {ON} (24479....   647   0.0  
NCAS0I02080 Chr9 (390551..392875) [2325 bp, 774 aa] {ON} Anc_3.162    586   0.0  
TDEL0D04600 Chr4 (843530..845917) [2388 bp, 795 aa] {ON} Anc_3.1...   572   0.0  
KLTH0F06468g Chr6 (559256..561769) [2514 bp, 837 aa] {ON} simila...   566   0.0  
ADR317C Chr4 complement(1263080..1265539) [2460 bp, 819 aa] {ON}...   563   0.0  
Kwal_33.14167 s33 (554863..557379) [2517 bp, 838 aa] {ON} YDL028...   560   0.0  
ZYRO0B04906g Chr2 (395546..398089) [2544 bp, 847 aa] {ON} simila...   549   0.0  
Suva_4.221 Chr4 complement(391492..393789) [2298 bp, 765 aa] {ON...   539   0.0  
NDAI0A06620 Chr1 complement(1510218..1512461) [2244 bp, 747 aa] ...   538   0.0  
KAFR0F02220 Chr6 (432967..435210) [2244 bp, 747 aa] {ON} Anc_3.1...   534   e-179
Skud_4.223 Chr4 complement(395836..398145) [2310 bp, 769 aa] {ON...   526   e-176
Ecym_5236 Chr5 (486270..488864) [2595 bp, 864 aa] {ON} similar t...   515   e-171
SAKL0C07348g Chr3 (677348..679933) [2586 bp, 861 aa] {ON} some s...   513   e-170
KLLA0C03828g Chr3 (349187..351568) [2382 bp, 793 aa] {ON} simila...   510   e-169
YDL028C Chr4 complement(400997..403291) [2295 bp, 764 aa] {ON}  ...   503   e-167
Smik_4.207 Chr4 complement(381159..383456) [2298 bp, 765 aa] {ON...   498   e-165
CAGL0K01617g Chr11 complement(143308..145632) [2325 bp, 774 aa] ...   474   e-156
TBLA0F00860 Chr6 (219628..222570) [2943 bp, 980 aa] {ON} Anc_3.1...   480   e-156
KNAG0K01740 Chr11 (364195..366492) [2298 bp, 765 aa] {ON} Anc_3....   441   e-143
NCAS0C03560 Chr3 complement(710551..712476) [1926 bp, 641 aa] {O...   347   e-109
YHR102W Chr8 (316572..319814) [3243 bp, 1080 aa] {ON}  KIC1Prote...   106   7e-23
CAGL0L11550g Chr12 (1232015..1235233) [3219 bp, 1072 aa] {ON} si...   106   8e-23
Skud_8.163 Chr8 (290415..293645) [3231 bp, 1076 aa] {ON} YHR102W...   105   2e-22
Smik_8.180 Chr8 (292993..296214) [3222 bp, 1073 aa] {ON} YHR102W...   103   5e-22
KAFR0D04950 Chr4 (971956..974982) [3027 bp, 1008 aa] {ON} Anc_5....   102   1e-21
Ecym_1030 Chr1 (56043..57365) [1323 bp, 440 aa] {ON} similar to ...   100   1e-21
Suva_15.297 Chr15 (518854..520850,520945..522172) [3225 bp, 1074...   102   1e-21
KNAG0B04320 Chr2 complement(821265..824348) [3084 bp, 1027 aa] {...   102   2e-21
AFR724C Chr6 complement(1770338..1771660) [1323 bp, 440 aa] {ON}...    99   4e-21
NDAI0C01700 Chr3 complement(367077..370139) [3063 bp, 1020 aa] {...   100   8e-21
NCAS0H01940 Chr8 (374913..377960) [3048 bp, 1015 aa] {ON} Anc_5....    99   2e-20
Kpol_2002.46 s2002 (95107..98478) [3372 bp, 1123 aa] {ON} (95107...    99   2e-20
Kwal_55.21545 s55 complement(882294..884891) [2598 bp, 865 aa] {...    98   3e-20
KLTH0F16676g Chr6 complement(1351362..1353998) [2637 bp, 878 aa]...    98   3e-20
NDAI0F04520 Chr6 complement(1098426..1099895) [1470 bp, 489 aa] ...    96   4e-20
Kpol_1031.10 s1031 (25064..28447) [3384 bp, 1127 aa] {ON} (25064...    97   6e-20
TDEL0A07560 Chr1 complement(1316498..1321225) [4728 bp, 1575 aa]...    97   6e-20
Suva_2.687 Chr2 complement(1215095..1218481) [3387 bp, 1128 aa] ...    97   7e-20
CAGL0L12474g Chr12 complement(1347340..1348248) [909 bp, 302 aa]...    92   9e-20
TDEL0E02180 Chr5 complement(408232..411195) [2964 bp, 987 aa] {O...    96   1e-19
SAKL0H11638g Chr8 complement(994049..994946,995016..995032) [915...    92   1e-19
Skud_16.251 Chr16 complement(457106..458006,458108..458124) [918...    92   1e-19
KAFR0H01530 Chr8 complement(283589..284509) [921 bp, 306 aa] {ON...    92   2e-19
KLTH0F00946g Chr6 (73412..74950) [1539 bp, 512 aa] {ON} similar ...    94   2e-19
KNAG0F00290 Chr6 (31750..35127) [3378 bp, 1125 aa] {ON} Anc_1.52...    96   2e-19
TDEL0D02650 Chr4 complement(505536..506636) [1101 bp, 366 aa] {O...    92   3e-19
Kwal_56.22476 s56 complement(145039..147132) [2094 bp, 697 aa] {...    94   4e-19
KLTH0E11220g Chr5 (1005953..1005969,1006040..1006931) [909 bp, 3...    91   4e-19
Kwal_33.13112 s33 (76807..78324) [1518 bp, 505 aa] {ON} YDR523C ...    93   4e-19
Kpol_499.3 s499 complement(6075..7199) [1125 bp, 374 aa] {ON} co...    92   4e-19
NDAI0I00340 Chr9 (65047..70557) [5511 bp, 1836 aa] {ON} Anc_6.341      95   5e-19
TBLA0A07150 Chr1 (1776160..1780335) [4176 bp, 1391 aa] {ON} Anc_...    94   5e-19
SAKL0C00946g Chr3 (84995..86689) [1695 bp, 564 aa] {ON} similar ...    93   5e-19
CAGL0K05709g Chr11 complement(556732..560043) [3312 bp, 1103 aa]...    94   5e-19
Suva_16.286 Chr16 complement(495354..496254,496351..496367) [918...    90   6e-19
YPL031C Chr16 complement(492018..492918,493021..493037) [918 bp,...    90   6e-19
TPHA0H01630 Chr8 (371333..374443) [3111 bp, 1036 aa] {ON} Anc_5....    94   6e-19
TBLA0H01330 Chr8 complement(297718..299163) [1446 bp, 481 aa] {O...    92   7e-19
TDEL0B01540 Chr2 complement(272561..273458,273562..273578) [915 ...    90   7e-19
TBLA0A03570 Chr1 (892930..895857) [2928 bp, 975 aa] {ON} Anc_5.4...    94   7e-19
SAKL0H16038g Chr8 complement(1401627..1402931) [1305 bp, 434 aa]...    92   8e-19
YDR507C Chr4 complement(1462358..1465786) [3429 bp, 1142 aa] {ON...    94   8e-19
KNAG0D00390 Chr4 (53459..58429) [4971 bp, 1656 aa] {ON} Anc_6.34...    94   9e-19
Smik_4.789 Chr4 complement(1385209..1388619) [3411 bp, 1136 aa] ...    94   9e-19
KLTH0D03454g Chr4 (327039..331340) [4302 bp, 1433 aa] {ON} simil...    94   9e-19
NCAS0C02470 Chr3 complement(460460..461378,461483..461499) [936 ...    89   1e-18
KLLA0D11990g Chr4 complement(1022895..1023792,1023928..1023944) ...    89   1e-18
NCAS0A00280 Chr1 (40406..42013) [1608 bp, 535 aa] {ON} Anc_1.24        92   1e-18
AGL242C Chr7 complement(246896..247790,247838..247854) [912 bp, ...    89   2e-18
SAKL0C09174g Chr3 complement(833618..836833) [3216 bp, 1071 aa] ...    93   2e-18
KLTH0C10912g Chr3 (898372..900465) [2094 bp, 697 aa] {ON} highly...    92   2e-18
SAKL0G01848g Chr7 (154547..157204) [2658 bp, 885 aa] {ON} weakly...    92   2e-18
KNAG0A02310 Chr1 complement(216545..217453) [909 bp, 302 aa] {ON...    89   2e-18
YDR490C Chr4 complement(1431968..1434268) [2301 bp, 766 aa] {ON}...    92   2e-18
CAGL0K04169g Chr11 (384567..385763) [1197 bp, 398 aa] {ON} simil...    90   2e-18
Skud_4.764 Chr4 complement(1351725..1353995) [2271 bp, 756 aa] {...    92   2e-18
NDAI0D04050 Chr4 (952438..953538) [1101 bp, 366 aa] {ON} Anc_4.184     89   2e-18
Smik_4.767 Chr4 complement(1353354..1355630) [2277 bp, 758 aa] {...    92   2e-18
KNAG0D03980 Chr4 (721049..722170) [1122 bp, 373 aa] {ON} Anc_4.1...    89   3e-18
SAKL0B04488g Chr2 (395136..396242) [1107 bp, 368 aa] {ON} highly...    89   3e-18
CAGL0I07513g Chr9 (722045..725275) [3231 bp, 1076 aa] {ON} simil...    92   3e-18
Ecym_2499 Chr2 complement(976395..981020) [4626 bp, 1541 aa] {ON...    92   3e-18
Kpol_2002.24 s2002 (48405..49868) [1464 bp, 487 aa] {ON} (48405....    90   3e-18
ABL034W Chr2 (333432..337709) [4278 bp, 1425 aa] {ON} Syntenic h...    92   3e-18
KAFR0B02980 Chr2 (623470..624804) [1335 bp, 444 aa] {ON} Anc_8.3...    90   3e-18
Skud_3.146 Chr3 complement(227229..231233) [4005 bp, 1334 aa] {O...    92   4e-18
NCAS0C04940 Chr3 (1006185..1009535) [3351 bp, 1116 aa] {ON} Anc_...    92   4e-18
Kpol_1007.17 s1007 (32671..32687,32861..33767) [924 bp, 307 aa] ...    87   4e-18
TPHA0A01630 Chr1 complement(328040..329347) [1308 bp, 435 aa] {O...    89   4e-18
AER264C Chr5 complement(1120017..1124468) [4452 bp, 1483 aa] {ON...    91   4e-18
TPHA0C01780 Chr3 complement(407048..407965) [918 bp, 305 aa] {ON...    87   5e-18
ZYRO0A06446g Chr1 complement(513126..515957) [2832 bp, 943 aa] {...    91   5e-18
KLLA0A02497g Chr1 (218592..219680) [1089 bp, 362 aa] {ON} highly...    89   5e-18
Suva_2.703 Chr2 complement(1238496..1239953) [1458 bp, 485 aa] {...    90   5e-18
Smik_3.173 Chr3 complement(242285..246307) [4023 bp, 1340 aa] {O...    91   6e-18
KLLA0F20053g Chr6 (1867209..1868543) [1335 bp, 444 aa] {ON} high...    89   6e-18
ZYRO0A12826g Chr1 (1014651..1015751) [1101 bp, 366 aa] {ON} high...    88   6e-18
Kwal_23.6325 s23 complement(1533223..1537851) [4629 bp, 1542 aa]...    91   6e-18
CAGL0K02673g Chr11 complement(241338..244085) [2748 bp, 915 aa] ...    91   7e-18
NDAI0A00660 Chr1 (121773..124841) [3069 bp, 1022 aa] {ON} Anc_1.52     91   7e-18
ACL104C Chr3 complement(157357..160200) [2844 bp, 947 aa] {ON} S...    91   7e-18
Skud_4.783 Chr4 complement(1382552..1385959) [3408 bp, 1135 aa] ...    91   7e-18
KAFR0D03390 Chr4 (667896..670292) [2397 bp, 798 aa] {ON} Anc_2.4...    90   8e-18
Kpol_463.8 s463 complement(18696..23039) [4344 bp, 1447 aa] {ON}...    91   8e-18
KAFR0D04100 Chr4 complement(809681..813034) [3354 bp, 1117 aa] {...    91   9e-18
Kwal_56.22693 s56 complement(239982..242936) [2955 bp, 984 aa] {...    90   9e-18
KAFR0E01040 Chr5 complement(214744..216252) [1509 bp, 502 aa] {O...    89   9e-18
Ecym_2531 Chr2 (1034031..1034047,1034135..1035023) [906 bp, 301 ...    87   9e-18
Kpol_543.55 s543 (126256..127533) [1278 bp, 425 aa] {ON} (126256...    88   1e-17
TDEL0C06490 Chr3 complement(1191461..1194922) [3462 bp, 1153 aa]...    90   1e-17
TPHA0E03850 Chr5 complement(810694..812142) [1449 bp, 482 aa] {O...    89   1e-17
CAGL0M11748g Chr13 (1168856..1170199) [1344 bp, 447 aa] {ON} hig...    88   1e-17
Ecym_6145 Chr6 complement(266766..267863) [1098 bp, 365 aa] {ON}...    87   1e-17
Kwal_56.23841 s56 (732202..733500) [1299 bp, 432 aa] {ON} YLR113...    88   1e-17
YDR523C Chr4 complement(1485566..1487038) [1473 bp, 490 aa] {ON}...    89   1e-17
Skud_2.141 Chr2 complement(264097..265677) [1581 bp, 526 aa] {ON...    89   1e-17
KLTH0A06776g Chr1 complement(562932..567503) [4572 bp, 1523 aa] ...    90   1e-17
Suva_10.202 Chr10 (380079..381386) [1308 bp, 435 aa] {ON} YLR113...    88   1e-17
Smik_4.803 Chr4 complement(1408345..1409817) [1473 bp, 490 aa] {...    88   1e-17
NCAS0D04600 Chr4 (875553..880604) [5052 bp, 1683 aa] {ON} Anc_6....    90   1e-17
TPHA0G03200 Chr7 (683296..687900) [4605 bp, 1534 aa] {ON} Anc_2....    90   2e-17
NDAI0G02700 Chr7 complement(618268..619611) [1344 bp, 447 aa] {O...    88   2e-17
KNAG0G02300 Chr7 (528489..529748) [1260 bp, 419 aa] {ON} Anc_8.3...    87   2e-17
Skud_12.181 Chr12 (354407..355702) [1296 bp, 431 aa] {ON} YLR113...    87   2e-17
KLTH0G12738g Chr7 complement(1085500..1086804) [1305 bp, 434 aa]...    87   2e-17
TBLA0C02940 Chr3 complement(706091..711022) [4932 bp, 1643 aa] {...    89   2e-17
Smik_12.173 Chr12 (351727..353034) [1308 bp, 435 aa] {ON} YLR113...    87   2e-17
Suva_3.110 Chr3 complement(160016..164146) [4131 bp, 1376 aa] {O...    89   2e-17
KLLA0C08525g Chr3 (744554..749209) [4656 bp, 1551 aa] {ON} simil...    89   2e-17
TBLA0I01150 Chr9 complement(235187..240424) [5238 bp, 1745 aa] {...    89   2e-17
NDAI0A03870 Chr1 (867910..870597) [2688 bp, 895 aa] {ON} Anc_2.496     89   3e-17
KLTH0C09548g Chr3 (792218..795199) [2982 bp, 993 aa] {ON} simila...    89   3e-17
AGR048C Chr7 complement(807464..808825) [1362 bp, 453 aa] {ON} S...    87   3e-17
KAFR0A01760 Chr1 complement(363462..366119) [2658 bp, 885 aa] {O...    89   3e-17
Smik_2.146 Chr2 complement(275270..276850) [1581 bp, 526 aa] {ON...    87   3e-17
NCAS0A05370 Chr1 complement(1061671..1066197) [4527 bp, 1508 aa]...    89   3e-17
NCAS0C03380 Chr3 complement(664012..665310) [1299 bp, 432 aa] {O...    87   3e-17
Ecym_4266 Chr4 complement(564935..566329) [1395 bp, 464 aa] {ON}...    87   3e-17
KLLA0C04191g Chr3 (384198..386591) [2394 bp, 797 aa] {ON} weakly...    88   3e-17
Sklu_YGOB_Anc_2.496 Chr5 (185447..187306) [1860 bp, 619 aa] {ON}...    88   3e-17
TDEL0F04290 Chr6 (801456..802739) [1284 bp, 427 aa] {ON} Anc_8.3...    87   4e-17
NCAS0D02100 Chr4 (385878..388058) [2181 bp, 726 aa] {ON} Anc_6.31      88   4e-17
TPHA0E03640 Chr5 complement(769962..773375) [3414 bp, 1137 aa] {...    88   4e-17
ACL191C Chr3 complement(26475..27572) [1098 bp, 365 aa] {ON} Syn...    86   4e-17
ZYRO0F08074g Chr6 (654009..654025,654107..655004) [915 bp, 304 a...    84   5e-17
TBLA0I00280 Chr9 (42870..46820) [3951 bp, 1316 aa] {ON} Anc_2.49...    88   5e-17
Ecym_3586 Chr3 complement(1112070..1115303) [3234 bp, 1077 aa] {...    88   5e-17
ZYRO0A03894g Chr1 (307915..309273) [1359 bp, 452 aa] {ON} simila...    86   5e-17
KLLA0F11143g Chr6 complement(1026129..1028570) [2442 bp, 813 aa]...    87   6e-17
KLLA0F14190g Chr6 (1311121..1315137) [4017 bp, 1338 aa] {ON} uni...    88   6e-17
TPHA0M01840 Chr13 complement(380953..385818) [4866 bp, 1621 aa] ...    88   6e-17
TDEL0C06780 Chr3 complement(1236767..1238173) [1407 bp, 468 aa] ...    86   6e-17
NDAI0C02680 Chr3 complement(621951..624203) [2253 bp, 750 aa] {O...    87   6e-17
AFR205C Chr6 complement(805580..806953) [1374 bp, 457 aa] {ON} S...    86   6e-17
Skud_4.797 Chr4 complement(1405618..1407075) [1458 bp, 485 aa] {...    86   7e-17
Suva_2.666 Chr2 complement(1183839..1186133) [2295 bp, 764 aa] {...    87   7e-17
AFR696C Chr6 complement(1722130..1725558) [3429 bp, 1142 aa] {ON...    87   7e-17
ZYRO0D06182g Chr4 complement(529121..530416) [1296 bp, 431 aa] {...    86   8e-17
TBLA0B01630 Chr2 (360963..364850) [3888 bp, 1295 aa] {ON} Anc_3....    87   8e-17
Suva_7.325 Chr7 (550760..551866) [1107 bp, 368 aa] {ON} YGR040W ...    85   8e-17
KLLA0F24618g Chr6 complement(2288943..2290613) [1671 bp, 556 aa]...    86   8e-17
Ecym_5505 Chr5 (1027605..1030616) [3012 bp, 1003 aa] {ON} simila...    87   8e-17
Skud_7.337 Chr7 (562750..563856) [1107 bp, 368 aa] {ON} YGR040W ...    85   8e-17
KNAG0J01700 Chr10 (309962..312424) [2463 bp, 820 aa] {ON}              87   9e-17
NDAI0K02100 Chr11 complement(469575..472304) [2730 bp, 909 aa] {...    87   1e-16
SAKL0C01716g Chr3 (143880..147527) [3648 bp, 1215 aa] {ON} simil...    87   1e-16
SAKL0E04092g Chr5 complement(326532..327901,327970..327982) [138...    86   1e-16
TBLA0I02400 Chr9 complement(548975..554167) [5193 bp, 1730 aa] {...    87   1e-16
TPHA0I00920 Chr9 (204753..209057) [4305 bp, 1434 aa] {ON} Anc_1....    87   1e-16
TPHA0J00630 Chr10 (139476..140600) [1125 bp, 374 aa] {ON} Anc_4....    84   1e-16
YOL100W Chr15 (129237..132482) [3246 bp, 1081 aa] {ON}  PKH2Seri...    87   1e-16
KAFR0C04590 Chr3 complement(917915..922321) [4407 bp, 1468 aa] {...    87   1e-16
NDAI0G05470 Chr7 (1340175..1344842) [4668 bp, 1555 aa] {ON} Anc_...    87   1e-16
KLLA0B13607g Chr2 (1191592..1194561) [2970 bp, 989 aa] {ON} simi...    86   1e-16
KLLA0C01650g Chr3 (128119..131457) [3339 bp, 1112 aa] {ON} simil...    87   1e-16
TPHA0G02800 Chr7 (597211..598722) [1512 bp, 503 aa] {ON} Anc_2.4...    86   1e-16
SAKL0A01254g Chr1 (119884..124560) [4677 bp, 1558 aa] {ON} simil...    87   1e-16
KLTH0C08932g Chr3 (749308..750867) [1560 bp, 519 aa] {ON} simila...    86   1e-16
KLTH0A07458g Chr1 (620459..623080) [2622 bp, 873 aa] {ON} simila...    86   2e-16
NCAS0B08600 Chr2 (1649375..1652728) [3354 bp, 1117 aa] {ON} Anc_...    86   2e-16
Kwal_27.11803 s27 (952938..953678) [741 bp, 246 aa] {ON} YPL031C...    82   2e-16
Kwal_26.7788 s26 (511530..515333) [3804 bp, 1267 aa] {ON} YKL101...    86   2e-16
NCAS0A02120 Chr1 (401097..402230) [1134 bp, 377 aa] {ON} Anc_4.184     84   2e-16
KLLA0E21693g Chr5 complement(1936438..1939488) [3051 bp, 1016 aa...    86   2e-16
Smik_6.125 Chr6 (201071..202177) [1107 bp, 368 aa] {ON} YGR040W ...    84   2e-16
TBLA0H01660 Chr8 complement(377521..380511) [2991 bp, 996 aa] {O...    86   2e-16
YLR113W Chr12 (371620..372927) [1308 bp, 435 aa] {ON}  HOG1Mitog...    84   2e-16
CAGL0G04609g Chr7 complement(437162..440059) [2898 bp, 965 aa] {...    86   2e-16
YCR073C Chr3 complement(242588..246583) [3996 bp, 1331 aa] {ON} ...    86   2e-16
KLTH0D06006g Chr4 complement(532589..535453) [2865 bp, 954 aa] {...    86   2e-16
KAFR0F03900 Chr6 (763094..764203) [1110 bp, 369 aa] {ON} Anc_4.1...    83   2e-16
Kwal_23.6458 s23 (1592349..1594955) [2607 bp, 868 aa] {ON} YNR04...    86   2e-16
KNAG0K00680 Chr11 (120919..124206) [3288 bp, 1095 aa] {ON} Anc_3...    86   2e-16
NDAI0E03170 Chr5 complement(677441..678392,678524..678543) [972 ...    83   2e-16
TDEL0D05320 Chr4 complement(965082..968255) [3174 bp, 1057 aa] {...    86   2e-16
Suva_2.157 Chr2 complement(275484..277064) [1581 bp, 526 aa] {ON...    84   3e-16
Skud_11.126 Chr11 (235011..239567) [4557 bp, 1518 aa] {ON} YKL10...    86   3e-16
Kwal_23.5576 s23 complement(1223517..1225031) [1515 bp, 504 aa] ...    84   3e-16
Ecym_7392 Chr7 complement(803240..807544) [4305 bp, 1434 aa] {ON...    86   3e-16
CAGL0K08514g Chr11 complement(854143..858612) [4470 bp, 1489 aa]...    86   3e-16
TPHA0M01500 Chr13 (317999..319291) [1293 bp, 430 aa] {ON} Anc_3....    84   3e-16
TDEL0A02010 Chr1 (365325..366782) [1458 bp, 485 aa] {ON} Anc_2.4...    84   3e-16
ACL006W Chr3 (344395..346521) [2127 bp, 708 aa] {ON} Syntenic ho...    85   3e-16
Kpol_1040.20 s1040 (57057..60950) [3894 bp, 1297 aa] {ON} (57057...    85   3e-16
Smik_8.42 Chr8 complement(74075..76894) [2820 bp, 939 aa] {ON} Y...    85   3e-16
Kpol_1054.2 s1054 complement(4365..7655) [3291 bp, 1096 aa] {ON}...    85   3e-16
Kwal_26.7861 s26 complement(544126..546993) [2868 bp, 955 aa] {O...    85   3e-16
SAKL0E01584g Chr5 complement(121830..123917) [2088 bp, 695 aa] {...    85   4e-16
NCAS0B05560 Chr2 complement(1050313..1051371) [1059 bp, 352 aa] ...    82   4e-16
NDAI0G04290 Chr7 complement(1030530..1033871) [3342 bp, 1113 aa]...    85   4e-16
KLLA0C12485g Chr3 (1060167..1062944) [2778 bp, 925 aa] {ON} simi...    85   4e-16
YMR001C Chr13 complement(269019..271136) [2118 bp, 705 aa] {ON} ...    85   4e-16
Smik_16.204 Chr16 complement(369272..370021) [750 bp, 249 aa] {O...    80   4e-16
NDAI0B02900 Chr2 complement(737651..738709) [1059 bp, 352 aa] {O...    82   4e-16
Smik_13.159 Chr13 complement(260249..262366) [2118 bp, 705 aa] {...    85   4e-16
Suva_6.169 Chr6 complement(300200..304654) [4455 bp, 1484 aa] {O...    85   4e-16
KLLA0F13552g Chr6 complement(1252906..1256709) [3804 bp, 1267 aa...    85   4e-16
Skud_13.154 Chr13 complement(255263..257380) [2118 bp, 705 aa] {...    84   4e-16
Skud_10.119 Chr10 (215299..219744) [4446 bp, 1481 aa] {ON} YJL09...    85   4e-16
CAGL0L03520g Chr12 complement(403100..407443) [4344 bp, 1447 aa]...    85   4e-16
KNAG0A06140 Chr1 (931737..933437) [1701 bp, 566 aa] {ON} Anc_2.4...    84   4e-16
YKL101W Chr11 (248920..253476) [4557 bp, 1518 aa] {ON}  HSL1Nim1...    85   5e-16
Suva_2.105 Chr2 (186428..187489) [1062 bp, 353 aa] {ON} YBL016W ...    82   5e-16
TDEL0A02550 Chr1 (457841..461950) [4110 bp, 1369 aa] {ON} Anc_2....    85   5e-16
AFR335C Chr6 complement(1046756..1049857) [3102 bp, 1033 aa] {ON...    85   5e-16
Kpol_1072.16 s1072 complement(37585..39972) [2388 bp, 795 aa] {O...    84   5e-16
Skud_3.39 Chr3 (66201..69254) [3054 bp, 1017 aa] {ON} YCL024W (R...    85   5e-16
YNR031C Chr14 complement(680694..685433) [4740 bp, 1579 aa] {ON}...    85   5e-16
Suva_13.163 Chr13 complement(259136..261253) [2118 bp, 705 aa] {...    84   5e-16
Kwal_26.7355 s26 (326867..331207) [4341 bp, 1446 aa] {ON} YJL095...    85   5e-16
ZYRO0B06512g Chr2 complement(521075..524410) [3336 bp, 1111 aa] ...    85   5e-16
Skud_2.90 Chr2 (176138..177199) [1062 bp, 353 aa] {ON} YBL016W (...    82   5e-16
TBLA0B02310 Chr2 (539362..541821) [2460 bp, 819 aa] {ON} Anc_3.9...    84   6e-16
ZYRO0G20306g Chr7 complement(1675578..1677227) [1650 bp, 549 aa]...    84   6e-16
NCAS0A10290 Chr1 complement(2051582..2053111) [1530 bp, 509 aa] ...    83   6e-16
Kwal_26.7552 s26 (416444..417829) [1386 bp, 461 aa] {ON} YKL139W...    83   6e-16
ZYRO0D08184g Chr4 (706856..711601) [4746 bp, 1581 aa] {ON} simil...    84   6e-16
YJL095W Chr10 (247255..251691) [4437 bp, 1478 aa] {ON}  BCK1Mito...    84   7e-16
TDEL0G04380 Chr7 (792278..794446) [2169 bp, 722 aa] {ON} Anc_6.3...    84   7e-16
Skud_8.39 Chr8 complement(76730..79501) [2772 bp, 923 aa] {ON} Y...    84   7e-16
TDEL0D01400 Chr4 (269367..273656) [4290 bp, 1429 aa] {ON} Anc_1....    84   7e-16
YGR040W Chr7 (575398..576504) [1107 bp, 368 aa] {ON}  KSS1Mitoge...    82   8e-16
YAR019C Chr1 complement(172211..175135) [2925 bp, 974 aa] {ON}  ...    84   8e-16
KAFR0G02690 Chr7 complement(555573..557714) [2142 bp, 713 aa] {O...    84   8e-16
KAFR0C02840 Chr3 (559821..560873) [1053 bp, 350 aa] {ON} Anc_8.1...    82   8e-16
Smik_3.54 Chr3 (80309..83407) [3099 bp, 1032 aa] {ON} YCL024W (R...    84   9e-16
KAFR0C01440 Chr3 complement(295468..298755) [3288 bp, 1095 aa] {...    84   9e-16
TPHA0J00420 Chr10 complement(96445..98568) [2124 bp, 707 aa] {ON...    83   9e-16
Ecym_6092 Chr6 (178965..180299) [1335 bp, 444 aa] {ON} similar t...    82   9e-16
Suva_11.123 Chr11 (235064..239644) [4581 bp, 1526 aa] {ON} YKL10...    84   9e-16
Ecym_3035 Chr3 complement(70391..72613) [2223 bp, 740 aa] {ON} s...    83   1e-15
KLTH0G17512g Chr7 complement(1518329..1519426) [1098 bp, 365 aa]...    81   1e-15
TPHA0M02080 Chr13 (426966..429635) [2670 bp, 889 aa] {ON} Anc_6....    84   1e-15
Kpol_1018.65 s1018 (189779..191584) [1806 bp, 601 aa] {ON} (1897...    83   1e-15
ZYRO0C13156g Chr3 complement(1041022..1042068) [1047 bp, 348 aa]...    81   1e-15
CAGL0C05005g Chr3 complement(467626..470856) [3231 bp, 1076 aa] ...    84   1e-15
Smik_10.147 Chr10 (239101..243537) [4437 bp, 1478 aa] {ON} YJL09...    84   1e-15
NCAS0A05050 Chr1 complement(1002107..1004788) [2682 bp, 893 aa] ...    83   1e-15
Skud_1.72 Chr1 (141337..144261) [2925 bp, 974 aa] {ON} YAR019C (...    83   1e-15
NDAI0K02390 Chr11 (537260..539920) [2661 bp, 886 aa] {ON} Anc_6....    83   1e-15
KAFR0F04340 Chr6 (848844..853628) [4785 bp, 1594 aa] {ON} Anc_6....    84   1e-15
Smik_2.101 Chr2 (186008..187069) [1062 bp, 353 aa] {ON} YBL016W ...    81   1e-15
NCAS0I02680 Chr9 (498371..500752) [2382 bp, 793 aa] {ON}               83   1e-15
Kpol_1028.16 s1028 complement(45186..47825) [2640 bp, 879 aa] {O...    83   1e-15
CAGL0C03509g Chr3 complement(350846..353533) [2688 bp, 895 aa] {...    83   2e-15
Kpol_1037.6 s1037 (12601..15534) [2934 bp, 977 aa] {ON} (12601.....    83   2e-15
TDEL0D04460 Chr4 complement(813075..815816) [2742 bp, 913 aa] {O...    83   2e-15
TBLA0A08430 Chr1 complement(2075682..2076773) [1092 bp, 363 aa] ...    81   2e-15
KLTH0G06974g Chr7 (556626..558125) [1500 bp, 499 aa] {ON} highly...    82   2e-15
Smik_1.79 Chr1 complement(149839..152763) [2925 bp, 974 aa] {ON}...    83   2e-15
ZYRO0C07480g Chr3 (565426..567750) [2325 bp, 774 aa] {ON} highly...    82   2e-15
KAFR0D02900 Chr4 (575853..577313) [1461 bp, 486 aa] {ON} Anc_7.5...    82   2e-15
KNAG0K01240 Chr11 (243154..246096) [2943 bp, 980 aa] {ON} Anc_3....    83   2e-15
Kpol_1037.20 s1037 (41658..43772) [2115 bp, 704 aa] {ON} (41658....    82   2e-15
TBLA0A10420 Chr1 (2562614..2564092) [1479 bp, 492 aa] {ON} Anc_5...    82   2e-15
Ecym_6344 Chr6 complement(664647..668840) [4194 bp, 1397 aa] {ON...    83   2e-15
TBLA0A07460 Chr1 (1848207..1849757) [1551 bp, 516 aa] {ON} Anc_1...    82   2e-15
Smik_11.139 Chr11 (235511..240115) [4605 bp, 1534 aa] {ON} YKL10...    83   2e-15
TDEL0A07860 Chr1 (1365985..1368498) [2514 bp, 837 aa] {ON} Anc_6...    82   2e-15
Kpol_431.9 s431 complement(22310..26968) [4659 bp, 1552 aa] {ON}...    83   2e-15
Kwal_14.1416 s14 (315842..316939) [1098 bp, 365 aa] {ON} YGR040W...    80   2e-15
Ecym_1058 Chr1 (105835..109329) [3495 bp, 1164 aa] {ON} similar ...    82   2e-15
Kpol_1037.52 s1037 complement(128841..130379) [1539 bp, 512 aa] ...    82   2e-15
SAKL0E02860g Chr5 complement(228726..232859) [4134 bp, 1377 aa] ...    83   2e-15
YHL007C Chr8 complement(95118..97937) [2820 bp, 939 aa] {ON}  ST...    82   2e-15
TPHA0G03290 Chr7 (702953..705874) [2922 bp, 973 aa] {ON} Anc_2.4...    82   2e-15
KAFR0H01040 Chr8 complement(189604..190860) [1257 bp, 418 aa] {O...    81   2e-15
CAGL0H01639g Chr8 (158967..160532) [1566 bp, 521 aa] {ON} simila...    82   2e-15
YNR047W Chr14 (708523..711204) [2682 bp, 893 aa] {ON}  FPK1Ser/T...    82   3e-15
NDAI0A07190 Chr1 (1636773..1638380) [1608 bp, 535 aa] {ON} Anc_3...    81   3e-15
SAKL0D05522g Chr4 (437018..441442) [4425 bp, 1474 aa] {ON} simil...    82   3e-15
TPHA0H00760 Chr8 complement(152442..155384) [2943 bp, 980 aa] {O...    82   3e-15
KNAG0B05350 Chr2 complement(1034166..1036676) [2511 bp, 836 aa] ...    82   3e-15
KNAG0E00850 Chr5 complement(158992..161127) [2136 bp, 711 aa] {O...    82   3e-15
Skud_14.362 Chr14 complement(648801..653540) [4740 bp, 1579 aa] ...    82   3e-15
KNAG0A06750 Chr1 (1053919..1056294) [2376 bp, 791 aa] {ON} Anc_2...    82   3e-15
TDEL0D03950 Chr4 (720229..721710) [1482 bp, 493 aa] {ON} Anc_3.2...    81   3e-15
YBL016W Chr2 (192451..193512) [1062 bp, 353 aa] {ON}  FUS3Mitoge...    80   3e-15
Suva_15.46 Chr15 (81948..83909) [1962 bp, 653 aa] {ON} YOL113W (...    82   3e-15
ZYRO0F17402g Chr6 complement(1445685..1449254) [3570 bp, 1189 aa...    82   3e-15
SAKL0H06534g Chr8 complement(575439..577853) [2415 bp, 804 aa] {...    82   3e-15
KNAG0B01780 Chr2 (326438..331180) [4743 bp, 1580 aa] {ON} Anc_1....    82   3e-15
Suva_14.385 Chr14 complement(661987..666732) [4746 bp, 1581 aa] ...    82   3e-15
ZYRO0G03366g Chr7 (261014..265864) [4851 bp, 1616 aa] {ON} simil...    82   3e-15
KLLA0C06138g Chr3 (540409..542535) [2127 bp, 708 aa] {ON} simila...    82   3e-15
CAGL0D01694g Chr4 complement(176981..178279) [1299 bp, 432 aa] {...    80   3e-15
Suva_1.86 Chr1 complement(150761..153685) [2925 bp, 974 aa] {ON}...    82   4e-15
TBLA0F00240 Chr6 complement(45510..49256) [3747 bp, 1248 aa] {ON...    82   4e-15
KLLA0B11946g Chr2 complement(1048033..1049352) [1320 bp, 439 aa]...    80   4e-15
SAKL0G06952g Chr7 (570584..572383) [1800 bp, 599 aa] {ON} simila...    81   4e-15
TBLA0A08810 Chr1 (2161249..2162304) [1056 bp, 351 aa] {ON} Anc_8...    79   4e-15
KNAG0F00170 Chr6 (13778..15409) [1632 bp, 543 aa] {ON} Anc_1.24 ...    81   4e-15
NCAS0J00960 Chr10 (157010..159121) [2112 bp, 703 aa] {ON}              81   4e-15
Smik_14.360 Chr14 complement(638655..643406) [4752 bp, 1583 aa] ...    82   4e-15
KLTH0E16126g Chr5 complement(1427208..1429814) [2607 bp, 868 aa]...    82   4e-15
Kwal_56.22788 s56 complement(281404..282951) [1548 bp, 515 aa] {...    81   4e-15
CAGL0D02002g Chr4 (207419..209080) [1662 bp, 553 aa] {ON} simila...    81   4e-15
TDEL0A06220 Chr1 (1088622..1091006) [2385 bp, 794 aa] {ON} Anc_8...    81   4e-15
NCAS0A05570 Chr1 (1093653..1096409) [2757 bp, 918 aa] {ON} Anc_6...    81   5e-15
NCAS0A08080 Chr1 complement(1594221..1596092) [1872 bp, 623 aa] ...    81   5e-15
NCAS0A09470 Chr1 complement(1883183..1887730) [4548 bp, 1515 aa]...    82   5e-15
KAFR0H02430 Chr8 complement(464446..466800) [2355 bp, 784 aa] {O...    81   5e-15
Smik_3.189 Chr3 (273885..276044) [2160 bp, 719 aa] {ON} YCR091W ...    81   6e-15
ZYRO0G15290g Chr7 complement(1237119..1241582) [4464 bp, 1487 aa...    81   6e-15
ACR142W Chr3 (597519..600032) [2514 bp, 837 aa] {ON} Syntenic ho...    81   6e-15
KNAG0J01290 Chr10 complement(230493..232019) [1527 bp, 508 aa] {...    80   6e-15
KLLA0B12716g Chr2 (1109939..1112089) [2151 bp, 716 aa] {ON} simi...    81   6e-15
KLTH0D04356g Chr4 (405904..405987,406076..407401) [1410 bp, 469 ...    80   6e-15
KAFR0G00480 Chr7 complement(131066..132268) [1203 bp, 400 aa] {O...    79   6e-15
Kpol_183.1 s183 (158..2257) [2100 bp, 699 aa] {ON} (158..2257) [...    80   7e-15
TBLA0A01630 Chr1 complement(385348..386386,386496..386512) [1056...    79   7e-15
Kpol_520.17 s520 complement(37953..41447) [3495 bp, 1164 aa] {ON...    81   7e-15
NCAS0A04220 Chr1 (855791..857353) [1563 bp, 520 aa] {ON} Anc_2.425     80   7e-15
CAGL0K07458g Chr11 complement(737165..739279) [2115 bp, 704 aa] ...    80   7e-15
KAFR0D03020 Chr4 (596365..598398) [2034 bp, 677 aa] {ON} Anc_2.4...    80   8e-15
ACR191C Chr3 complement(680398..683847) [3450 bp, 1149 aa] {ON} ...    81   8e-15
TPHA0H02390 Chr8 (561244..563436) [2193 bp, 730 aa] {ON} Anc_6.3...    80   8e-15
Kpol_1002.111 s1002 (277615..278664) [1050 bp, 349 aa] {ON} (277...    79   8e-15
Ecym_6196 Chr6 (364576..365652) [1077 bp, 358 aa] {ON} similar t...    79   8e-15
YCR091W Chr3 (274404..276566) [2163 bp, 720 aa] {ON}  KIN82Putat...    80   9e-15
KAFR0D03200 Chr4 (628993..633339) [4347 bp, 1448 aa] {ON} Anc_2....    81   9e-15
AFR377C Chr6 complement(1116589..1118769) [2181 bp, 726 aa] {ON}...    80   9e-15
AFR019W Chr6 (471481..472560) [1080 bp, 359 aa] {ON} Syntenic ho...    79   9e-15
Suva_3.190 Chr3 (288639..288813,288870..291766) [3072 bp, 1024 a...    80   9e-15
Suva_15.216 Chr15 complement(376197..377624) [1428 bp, 475 aa] {...    79   9e-15
Suva_8.47 Chr8 complement(91615..94557) [2943 bp, 980 aa] {ON} Y...    80   1e-14
SAKL0A00484g Chr1 complement(57938..60544) [2607 bp, 868 aa] {ON...    80   1e-14
KAFR0C00930 Chr3 complement(186877..189687) [2811 bp, 936 aa] {O...    80   1e-14
Smik_15.39 Chr15 (72332..74314) [1983 bp, 660 aa] {ON} YOL113W (...    80   1e-14
NCAS0D04710 Chr4 complement(901442..903856) [2415 bp, 804 aa] {O...    80   1e-14
CAGL0M08910g Chr13 complement(887703..889541) [1839 bp, 612 aa] ...    80   1e-14
Smik_14.377 Chr14 (666338..669025) [2688 bp, 895 aa] {ON} YNR047...    80   1e-14
Kpol_1055.24 s1055 complement(57430..60243) [2814 bp, 937 aa] {O...    80   1e-14
KNAG0B03230 Chr2 complement(625072..626997) [1926 bp, 641 aa] {O...    80   1e-14
Smik_8.97 Chr8 complement(148421..149857) [1437 bp, 478 aa] {ON}...    79   1e-14
KLTH0D11242g Chr4 (918232..920619) [2388 bp, 795 aa] {ON} simila...    80   1e-14
TPHA0B02440 Chr2 (560189..561592) [1404 bp, 467 aa] {ON} Anc_5.2...    79   1e-14
YHR030C Chr8 complement(168890..170344) [1455 bp, 484 aa] {ON}  ...    79   1e-14
Ecym_5251 Chr5 (522785..525466) [2682 bp, 893 aa] {ON} similar t...    80   1e-14
NCAS0A12350 Chr1 complement(2446237..2447236,2447319..2448559) [...    80   1e-14
TDEL0E01710 Chr5 complement(330667..332706) [2040 bp, 679 aa] {O...    80   1e-14
KLLA0B13112g Chr2 complement(1146006..1148198) [2193 bp, 730 aa]...    80   1e-14
KNAG0C01060 Chr3 complement(205965..207374) [1410 bp, 469 aa] {O...    79   1e-14
TDEL0A02720 Chr1 complement(491618..494365) [2748 bp, 915 aa] {O...    80   1e-14
KLLA0B11902g Chr2 (1041657..1043144) [1488 bp, 495 aa] {ON} unip...    79   1e-14
NDAI0D01620 Chr4 (386654..388132) [1479 bp, 492 aa] {ON} Anc_5.274     79   1e-14
TPHA0H02630 Chr8 complement(614048..618151) [4104 bp, 1367 aa] {...    80   2e-14
Ecym_3547 Chr3 complement(1034494..1036107) [1614 bp, 537 aa] {O...    79   2e-14
KNAG0I02830 Chr9 (549811..554358) [4548 bp, 1515 aa] {ON} Anc_1....    80   2e-14
TPHA0C00470 Chr3 (81482..83377) [1896 bp, 631 aa] {ON} Anc_5.611...    79   2e-14
TBLA0D00220 Chr4 (52218..54500) [2283 bp, 760 aa] {ON} Anc_2.96 ...    79   2e-14
KNAG0C02440 Chr3 complement(475652..476857) [1206 bp, 401 aa] {O...    78   2e-14
YKL139W Chr11 (182958..184544) [1587 bp, 528 aa] {ON}  CTK1Catal...    79   2e-14
KLTH0F01672g Chr6 (127277..130771) [3495 bp, 1164 aa] {ON} simil...    80   2e-14
Skud_16.129 Chr16 complement(233341..235824) [2484 bp, 827 aa] {...    79   2e-14
ZYRO0B01166g Chr2 complement(97168..100059) [2892 bp, 963 aa] {O...    79   2e-14
CAGL0M08404g Chr13 complement(836791..838179) [1389 bp, 462 aa] ...    78   2e-14
Skud_2.4 Chr2 complement(4805..8260) [3456 bp, 1151 aa] {ON} YBL...    79   2e-14
CAGL0M03729g Chr13 complement(420316..422901) [2586 bp, 861 aa] ...    79   2e-14
NDAI0H02340 Chr8 complement(568767..570887) [2121 bp, 706 aa] {O...    79   2e-14
CAGL0J11638g Chr10 complement(1130744..1132984) [2241 bp, 746 aa...    79   2e-14
Skud_15.54 Chr15 (88576..91824) [3249 bp, 1082 aa] {ON} YOL100W ...    79   2e-14
ZYRO0G16082g Chr7 complement(1320266..1321714) [1449 bp, 482 aa]...    78   2e-14
Smik_10.66 Chr10 complement(108043..109236) [1194 bp, 397 aa] {O...    78   2e-14
Skud_3.165 Chr3 (258916..261066) [2151 bp, 716 aa] {ON} YCR091W ...    79   2e-14
Skud_11.58 Chr11 complement(120855..122042) [1188 bp, 395 aa] {O...    78   2e-14
NDAI0A00960 Chr1 complement(197205..198431) [1227 bp, 408 aa] {O...    78   2e-14
KAFR0F01800 Chr6 complement(350480..351754) [1275 bp, 424 aa] {O...    78   2e-14
Ecym_7361 Chr7 complement(753862..755313) [1452 bp, 483 aa] {ON}...    78   2e-14
TBLA0B03840 Chr2 complement(881914..884490) [2577 bp, 858 aa] {O...    79   2e-14
TDEL0H01070 Chr8 complement(192834..194624) [1791 bp, 596 aa] {O...    79   2e-14
Skud_14.379 Chr14 (677081..679774) [2694 bp, 897 aa] {ON} YNR047...    79   2e-14
Suva_11.86 Chr11 (169096..170685) [1590 bp, 529 aa] {ON} YKL139W...    78   2e-14
Ecym_6040 Chr6 complement(77854..80544) [2691 bp, 896 aa] {ON} s...    79   2e-14
Smik_6.350 Chr6 (559997..562465) [2469 bp, 822 aa] {ON} YPL153C ...    79   2e-14
NCAS0A04360 Chr1 (880768..882822) [2055 bp, 684 aa] {ON} Anc_2.446     79   3e-14
AFR092W Chr6 (595092..599363) [4272 bp, 1423 aa] {ON} Syntenic h...    79   3e-14
Smik_11.97 Chr11 (168854..170491) [1638 bp, 545 aa] {ON} YKL139W...    78   3e-14
SAKL0G10978g Chr7 (929164..930729) [1566 bp, 521 aa] {ON} highly...    78   3e-14
KLLA0C18568g Chr3 (1639958..1642282) [2325 bp, 774 aa] {ON} simi...    79   3e-14
KNAG0M01450 Chr13 (254622..256061) [1440 bp, 479 aa] {ON}              78   3e-14
KAFR0C04780 Chr3 (948771..951131) [2361 bp, 786 aa] {ON} Anc_6.3...    79   3e-14
KAFR0K00700 Chr11 complement(153981..158126) [4146 bp, 1381 aa] ...    79   3e-14
KLLA0B07205g Chr2 complement(624606..625973) [1368 bp, 455 aa] {...    78   3e-14
CAGL0M10153g Chr13 complement(1010688..1013291) [2604 bp, 867 aa...    79   3e-14
NDAI0I00250 Chr9 (42174..44867) [2694 bp, 897 aa] {ON} Anc_3.177...    79   3e-14
Kwal_47.18233 s47 complement(743846..745642) [1797 bp, 598 aa] {...    78   3e-14
AER223C Chr5 complement(1044971..1047679) [2709 bp, 902 aa] {ON}...    79   3e-14
Smik_11.62 Chr11 complement(120153..121346) [1194 bp, 397 aa] {O...    77   3e-14
Kpol_1045.46 s1045 complement(106567..108372) [1806 bp, 601 aa] ...    78   3e-14
KNAG0A06290 Chr1 (958438..960516) [2079 bp, 692 aa] {ON} Anc_2.4...    78   3e-14
Ecym_4652 Chr4 (1272725..1276156) [3432 bp, 1143 aa] {ON} simila...    79   3e-14
Suva_2.651 Chr2 (1164264..1166165) [1902 bp, 633 aa] {ON} YDR477...    78   3e-14
Smik_15.57 Chr15 (92331..95576) [3246 bp, 1081 aa] {ON} YOL100W ...    79   4e-14
KLTH0D05566g Chr4 (498055..501441) [3387 bp, 1128 aa] {ON} weakl...    79   4e-14
Skud_8.86 Chr8 complement(149508..150953) [1446 bp, 481 aa] {ON}...    78   4e-14
YBL105C Chr2 complement(14241..17696) [3456 bp, 1151 aa] {ON}  P...    79   4e-14
TBLA0B00490 Chr2 complement(94755..97118) [2364 bp, 787 aa] {ON}...    78   4e-14
Suva_11.56 Chr11 complement(119479..120675) [1197 bp, 398 aa] {O...    77   4e-14
NCAS0A06680 Chr1 (1320265..1321704) [1440 bp, 479 aa] {ON} Anc_5...    77   4e-14
NCAS0A05770 Chr1 (1132854..1137239) [4386 bp, 1461 aa] {ON} Anc_...    79   4e-14
Suva_16.157 Chr16 complement(270891..273389) [2499 bp, 832 aa] {...    78   4e-14
Kpol_1060.53 s1060 complement(126120..128330) [2211 bp, 736 aa] ...    78   4e-14
CAGL0I09504g Chr9 (909589..911175) [1587 bp, 528 aa] {ON} simila...    77   4e-14
ZYRO0F18062g Chr6 complement(1494752..1496167) [1416 bp, 471 aa]...    77   4e-14
TPHA0C02880 Chr3 (623723..624778) [1056 bp, 351 aa] {ON} Anc_8.1...    76   5e-14
ADL315C Chr4 complement(146096..147400) [1305 bp, 434 aa] {ON} S...    77   5e-14
Skud_11.67 Chr11 complement(135815..137341) [1527 bp, 508 aa] {O...    77   6e-14
Kwal_27.10004 s27 complement(156153..158360) [2208 bp, 735 aa] {...    78   6e-14
Smik_2.13 Chr2 complement(14021..17473) [3453 bp, 1150 aa] {ON} ...    78   6e-14
Smik_2.14 Chr2 complement(14021..17473) [3453 bp, 1150 aa] {ON} ...    78   6e-14
ZYRO0D17468g Chr4 (1439376..1441958) [2583 bp, 860 aa] {ON} weak...    77   7e-14
YKL166C Chr11 complement(134509..135705) [1197 bp, 398 aa] {ON} ...    76   7e-14
ZYRO0F13310g Chr6 (1092612..1096322) [3711 bp, 1236 aa] {ON} som...    78   7e-14
YBR028C Chr2 complement(294425..296002) [1578 bp, 525 aa] {ON}  ...    77   7e-14
Kwal_27.10581 s27 complement(403249..406713) [3465 bp, 1154 aa] ...    78   7e-14
ZYRO0A05214g Chr1 complement(418443..421268) [2826 bp, 941 aa] {...    77   7e-14
Kpol_1018.148 s1018 (393064..394413) [1350 bp, 449 aa] {ON} (393...    76   7e-14
Kpol_2002.75 s2002 complement(168123..169394) [1272 bp, 423 aa] ...    76   8e-14
KNAG0A06540 Chr1 (1002435..1006733) [4299 bp, 1432 aa] {ON} Anc_...    78   8e-14
NDAI0H02470 Chr8 complement(597707..601942) [4236 bp, 1411 aa] {...    78   8e-14
Ecym_2434 Chr2 complement(843308..846676) [3369 bp, 1122 aa] {ON...    77   8e-14
KLLA0F23155g Chr6 (2157146..2158429) [1284 bp, 427 aa] {ON} simi...    76   8e-14
KLTH0H08316g Chr8 (730027..731094) [1068 bp, 355 aa] {ON} simila...    75   8e-14
CAGL0I06248g Chr9 (600351..602792) [2442 bp, 813 aa] {ON} simila...    77   8e-14
NCAS0C03690 Chr3 (741930..744881) [2952 bp, 983 aa] {ON}               77   9e-14
YKL126W Chr11 (205707..207749) [2043 bp, 680 aa] {ON}  YPK1Serin...    77   9e-14
TPHA0D02840 Chr4 (591733..593637) [1905 bp, 634 aa] {ON}               77   9e-14
KAFR0J02620 Chr10 complement(502187..504265) [2079 bp, 692 aa] {...    77   9e-14
KLLA0E12145g Chr5 (1080245..1081612) [1368 bp, 455 aa] {ON} simi...    76   9e-14
Kwal_47.18307 s47 complement(776521..778386) [1866 bp, 621 aa] {...    77   9e-14
TBLA0C05830 Chr3 complement(1408930..1410210) [1281 bp, 426 aa] ...    76   9e-14
ABL011C Chr2 complement(378257..380362) [2106 bp, 701 aa] {ON} S...    77   9e-14
KAFR0A01420 Chr1 (276454..280650) [4197 bp, 1398 aa] {ON} Anc_1....    77   1e-13
TPHA0P01050 Chr16 complement(212259..215624) [3366 bp, 1121 aa] ...    77   1e-13
SAKL0B05082g Chr2 (436707..438896) [2190 bp, 729 aa] {ON} simila...    77   1e-13
YOL045W Chr15 (243497..246802) [3306 bp, 1101 aa] {ON}  PSK2One ...    77   1e-13
KLTH0F05522g Chr6 complement(477035..478975) [1941 bp, 646 aa] {...    77   1e-13
CAGL0J00539g Chr10 (47095..48561) [1467 bp, 488 aa] {ON} highly ...    76   1e-13
YOL113W Chr15 (104326..106293) [1968 bp, 655 aa] {ON}  SKM1Membe...    77   1e-13
KNAG0D00210 Chr4 complement(22721..25222) [2502 bp, 833 aa] {ON}...    77   1e-13
NDAI0G03450 Chr7 (822716..825562) [2847 bp, 948 aa] {ON} Anc_8.141     77   1e-13
NDAI0D02750 Chr4 (639802..644349) [4548 bp, 1515 aa] {ON} Anc_2....    77   1e-13
KAFR0E01810 Chr5 complement(372094..373524) [1431 bp, 476 aa] {O...    76   1e-13
CAGL0K03399g Chr11 complement(311316..313427) [2112 bp, 703 aa] ...    77   1e-13
KAFR0A07370 Chr1 complement(1487868..1490012) [2145 bp, 714 aa] ...    77   1e-13
CAGL0J06072g Chr10 complement(574501..576822) [2322 bp, 773 aa] ...    77   1e-13
KAFR0G01200 Chr7 (273238..274761) [1524 bp, 507 aa] {ON} Anc_1.2...    76   1e-13
NDAI0E02110 Chr5 complement(430989..433700) [2712 bp, 903 aa] {O...    77   1e-13
Kpol_541.49 s541 complement(156530..159514) [2985 bp, 994 aa] {O...    77   1e-13
TBLA0E02790 Chr5 complement(693136..695562) [2427 bp, 808 aa] {O...    77   1e-13
Ecym_3488 Chr3 complement(915087..916400) [1314 bp, 437 aa] {ON}...    75   1e-13
CAGL0M09361g Chr13 complement(928484..931918) [3435 bp, 1144 aa]...    77   1e-13
YPL153C Chr16 complement(261727..264192) [2466 bp, 821 aa] {ON} ...    77   1e-13
Kwal_26.8796 s26 (946406..948796) [2391 bp, 796 aa] {ON} YPL153C...    76   1e-13
SAKL0E03608g Chr5 complement(291806..294007) [2202 bp, 733 aa] {...    76   1e-13
SAKL0F13618g Chr6 (1085967..1089494) [3528 bp, 1175 aa] {ON} sim...    77   2e-13
YCL024W Chr3 (79162..82275) [3114 bp, 1037 aa] {ON}  KCC4Protein...    77   2e-13
NCAS0E03010 Chr5 (599358..602810) [3453 bp, 1150 aa] {ON} Anc_7....    77   2e-13
Kwal_17.2687 s17 complement(6084..7172) [1089 bp, 362 aa] {ON} Y...    75   2e-13
NCAS0I02840 Chr9 (528136..529344) [1209 bp, 402 aa] {ON} Anc_1.2...    75   2e-13
TBLA0I01370 Chr9 complement(294202..296526) [2325 bp, 774 aa] {O...    76   2e-13
Kpol_1023.26 s1023 (51805..54024) [2220 bp, 739 aa] {ON} (51805....    76   2e-13
NDAI0G06240 Chr7 (1546580..1549282) [2703 bp, 900 aa] {ON} Anc_1...    76   2e-13
KLLA0E03587g Chr5 complement(323764..325707) [1944 bp, 647 aa] {...    76   2e-13
TPHA0G02480 Chr7 (509815..511860) [2046 bp, 681 aa] {ON} Anc_2.4...    76   2e-13
Smik_11.113 Chr11 (191688..193730) [2043 bp, 680 aa] {ON} YMR104...    76   2e-13
TBLA0E03360 Chr5 complement(838512..840476) [1965 bp, 654 aa] {O...    76   2e-13
Suva_15.65 Chr15 (102271..105513) [3243 bp, 1080 aa] {ON} YOL100...    76   2e-13
Skud_11.103 Chr11 (192587..194629) [2043 bp, 680 aa] {ON} YMR104...    76   2e-13
KLTH0G05698g Chr7 (453530..455323) [1794 bp, 597 aa] {ON} simila...    76   2e-13
TBLA0D02230 Chr4 (557816..561280) [3465 bp, 1154 aa] {ON} Anc_8....    76   2e-13
Suva_11.99 Chr11 (192143..194197) [2055 bp, 684 aa] {ON} YMR104C...    76   2e-13
SAKL0H19668g Chr8 (1736301..1737674) [1374 bp, 457 aa] {ON} high...    75   2e-13
TPHA0G02910 Chr7 (624676..626727) [2052 bp, 683 aa] {ON} Anc_2.4...    76   2e-13
KLTH0C05478g Chr3 complement(471760..475254) [3495 bp, 1164 aa] ...    76   2e-13
KLLA0F07623g Chr6 (720246..723935) [3690 bp, 1229 aa] {ON} simil...    76   2e-13
NCAS0F01580 Chr6 complement(313801..317949) [4149 bp, 1382 aa] {...    76   2e-13
Ecym_7473 Chr7 (963826..966045) [2220 bp, 739 aa] {ON} similar t...    76   2e-13
TPHA0F02430 Chr6 complement(535865..538261) [2397 bp, 798 aa] {O...    76   2e-13
TBLA0B08250 Chr2 complement(1968879..1972922) [4044 bp, 1347 aa]...    76   2e-13
KAFR0C05860 Chr3 (1160586..1162520) [1935 bp, 644 aa] {ON} Anc_5...    75   2e-13
Skud_8.272 Chr8 (478199..480706) [2508 bp, 835 aa] {ON} YHR205W ...    76   2e-13
KLTH0E04334g Chr5 complement(391495..393723) [2229 bp, 742 aa] {...    76   2e-13
KAFR0D01220 Chr4 (246927..250094) [3168 bp, 1055 aa] {ON} Anc_7....    76   2e-13
Skud_11.88 Chr11 (169115..170659) [1545 bp, 514 aa] {ON} YKL139W...    75   2e-13
SAKL0G06402g Chr7 (535632..537986) [2355 bp, 784 aa] {ON} simila...    75   2e-13
SAKL0C07722g Chr3 (717419..720157) [2739 bp, 912 aa] {ON} simila...    76   3e-13
KAFR0C03010 Chr3 (598970..601342) [2373 bp, 790 aa] {ON} Anc_8.1...    75   3e-13
Skud_15.112 Chr15 (202308..205613) [3306 bp, 1101 aa] {ON} YOL04...    76   3e-13
TDEL0H00890 Chr8 complement(146908..149088) [2181 bp, 726 aa] {O...    75   3e-13
YDR477W Chr4 (1412373..1414274) [1902 bp, 633 aa] {ON}  SNF1AMP-...    75   3e-13
Kwal_33.13984 s33 complement(471429..473378) [1950 bp, 649 aa] {...    75   3e-13
Kwal_33.13846 s33 complement(419630..420757) [1128 bp, 375 aa] {...    74   3e-13
Suva_2.11 Chr2 complement(17473..18858) [1386 bp, 461 aa] {ON} Y...    75   3e-13
Kpol_1033.55 s1033 (138831..140555,140557..140895) [2064 bp, 687...    75   3e-13
Smik_4.754 Chr4 (1333667..1335565) [1899 bp, 632 aa] {ON} YDR477...    75   3e-13
KLLA0E07437g Chr5 complement(672690..673787) [1098 bp, 365 aa] {...    74   3e-13
AAR009W Chr1 (358947..360308) [1362 bp, 453 aa] {ON} Syntenic ho...    74   3e-13
Kpol_513.17 s513 (49097..50824) [1728 bp, 575 aa] {ON} (49097..5...    75   3e-13
NCAS0I02850 Chr9 (529637..532042) [2406 bp, 801 aa] {ON} Anc_1.180     75   3e-13
Smik_8.295 Chr8 (484074..486548) [2475 bp, 824 aa] {ON} YHR205W ...    75   3e-13
Suva_15.411 Chr15 (716095..718542) [2448 bp, 815 aa] {ON} YHR205...    75   3e-13
KNAG0M00190 Chr13 complement(25224..27602) [2379 bp, 792 aa] {ON...    75   4e-13
CAGL0J04290g Chr10 complement(403542..404615) [1074 bp, 357 aa] ...    74   4e-13
KAFR0C04280 Chr3 (848308..849912) [1605 bp, 534 aa] {ON} Anc_1.3...    75   4e-13
NDAI0G03920 Chr7 complement(934765..935889) [1125 bp, 374 aa] {O...    74   4e-13
YPR054W Chr16 (666280..667446) [1167 bp, 388 aa] {ON}  SMK1Middl...    74   4e-13
TBLA0I01800 Chr9 complement(401728..403617) [1890 bp, 629 aa] {O...    75   4e-13
YHR205W Chr8 (509363..511837) [2475 bp, 824 aa] {ON}  SCH9AGC fa...    75   4e-13
Ecym_2457 Chr2 (888054..890165) [2112 bp, 703 aa] {ON} similar t...    75   4e-13
Suva_14.402 Chr14 (690198..692915) [2718 bp, 905 aa] {ON} YNR047...    75   4e-13
Smik_16.296 Chr16 (542962..544128) [1167 bp, 388 aa] {ON} YPR054...    74   4e-13
NDAI0D03420 Chr4 (806856..809261) [2406 bp, 801 aa] {ON} Anc_4.384     75   4e-13
NCAS0F01460 Chr6 complement(290441..292465) [2025 bp, 674 aa] {O...    75   4e-13
KLTH0F04840g Chr6 complement(427194..428339) [1146 bp, 381 aa] {...    74   4e-13
AER232C Chr5 complement(1066272..1067981) [1710 bp, 569 aa] {ON}...    74   5e-13
Skud_4.751 Chr4 (1332135..1334039) [1905 bp, 634 aa] {ON} YDR477...    75   5e-13
KAFR0K00330 Chr11 (74162..75283) [1122 bp, 373 aa] {ON} Anc_6.21...    73   5e-13
Kpol_495.14 s495 (33810..35684) [1875 bp, 624 aa] {ON} (33810..3...    74   5e-13
Suva_11.65 Chr11 complement(134606..136120) [1515 bp, 504 aa] {O...    74   5e-13
KLLA0A03806g Chr1 complement(338807..340615) [1809 bp, 602 aa] {...    74   5e-13
ABR014W Chr2 (417708..420623) [2916 bp, 971 aa] {ON} Syntenic ho...    75   5e-13
NCAS0B08280 Chr2 (1579804..1581033) [1230 bp, 409 aa] {ON} Anc_1...    74   5e-13
AEL115C Chr5 complement(405062..406222) [1161 bp, 386 aa] {ON} S...    73   5e-13
Smik_15.122 Chr15 (209665..212970) [3306 bp, 1101 aa] {ON} YOL04...    75   5e-13
ABL028W Chr2 (345953..348121) [2169 bp, 722 aa] {ON} Syntenic ho...    74   5e-13
AEL230W Chr5 (198401..200227) [1827 bp, 608 aa] {ON} Syntenic ho...    74   6e-13
Kpol_1066.45 s1066 complement(76786..79428) [2643 bp, 880 aa] {O...    75   6e-13
Skud_10.50 Chr10 complement(84697..85890) [1194 bp, 397 aa] {ON}...    73   6e-13
TPHA0E03300 Chr5 (703575..704912) [1338 bp, 445 aa] {ON} Anc_1.1...    74   6e-13
Kwal_55.20326 s55 complement(351010..353262) [2253 bp, 750 aa] {...    74   6e-13
KAFR0A06790 Chr1 complement(1371892..1372806) [915 bp, 304 aa] {...    72   6e-13
SAKL0C06248g Chr3 complement(577990..580185) [2196 bp, 731 aa] {...    74   6e-13
TDEL0C03050 Chr3 (545862..549299) [3438 bp, 1145 aa] {ON} Anc_7....    75   6e-13
KLTH0B06424g Chr2 complement(518184..520328) [2145 bp, 714 aa] {...    74   6e-13
CAGL0I05896g Chr9 (560169..562505) [2337 bp, 778 aa] {ON} some s...    74   6e-13
NDAI0H00940 Chr8 complement(209645..211702) [2058 bp, 685 aa] {O...    74   6e-13
Kpol_376.5 s376 (6334..7767) [1434 bp, 477 aa] {ON} (6334..7767)...    74   6e-13
NCAS0A09750 Chr1 (1940202..1942370) [2169 bp, 722 aa] {ON}             74   6e-13
KNAG0C02600 Chr3 complement(504486..507134) [2649 bp, 882 aa] {O...    74   7e-13
TDEL0B04490 Chr2 (792559..793629) [1071 bp, 356 aa] {ON} Anc_8.1...    73   7e-13
NDAI0G03030 Chr7 (704910..708269) [3360 bp, 1119 aa] {ON}              74   7e-13
TPHA0A04170 Chr1 (937692..939233) [1542 bp, 513 aa] {ON} Anc_3.2...    74   7e-13
Kpol_1028.40 s1028 (95617..100392) [4776 bp, 1591 aa] {ON} (9561...    75   7e-13
Kpol_2001.10 s2001 (30724..33018) [2295 bp, 764 aa] {ON} (30724....    74   8e-13
ZYRO0F07370g Chr6 (595931..598219) [2289 bp, 762 aa] {ON} simila...    74   8e-13
ZYRO0G02530g Chr7 (194463..196577) [2115 bp, 704 aa] {ON} highly...    74   8e-13
Kwal_27.9763 s27 (54483..57089) [2607 bp, 868 aa] {ON} YAR019C (...    74   8e-13
SAKL0D06534g Chr4 complement(538606..540091,540155..540237) [156...    74   8e-13
NCAS0C04100 Chr3 (834997..837714) [2718 bp, 905 aa] {ON} Anc_8.141     74   8e-13
ZYRO0G00506g Chr7 complement(38488..40854) [2367 bp, 788 aa] {ON...    74   8e-13
NDAI0A05280 Chr1 complement(1191032..1192342) [1311 bp, 436 aa] ...    73   9e-13
CAGL0B02739g Chr2 complement(262590..264620) [2031 bp, 676 aa] {...    74   9e-13
KLLA0C17160g Chr3 (1498959..1501454) [2496 bp, 831 aa] {ON} simi...    74   9e-13
Kwal_26.7635 s26 (451306..453381) [2076 bp, 691 aa] {ON} YKL126W...    74   9e-13
Kwal_26.7154 s26 (237387..241028) [3642 bp, 1213 aa] {ON} YOL045...    74   9e-13
Ecym_5588 Chr5 complement(1205102..1206943) [1842 bp, 613 aa] {O...    74   9e-13
TDEL0E03520 Chr5 (657779..659251) [1473 bp, 490 aa] {ON} Anc_5.2...    73   1e-12
CAGL0F09075g Chr6 (894761..897001) [2241 bp, 746 aa] {ON} simila...    74   1e-12
NCAS0A06440 Chr1 (1270771..1273020) [2250 bp, 749 aa] {ON} Anc_4...    74   1e-12
KAFR0F01940 Chr6 complement(379908..382283) [2376 bp, 791 aa] {O...    74   1e-12
TBLA0A10690 Chr1 (2642723..2645632) [2910 bp, 969 aa] {ON} Anc_4...    74   1e-12
Suva_1.50 Chr1 (96474..100556) [4083 bp, 1360 aa] {ON} YAL017W (...    74   1e-12
NDAI0E04610 Chr5 (1042690..1046154) [3465 bp, 1154 aa] {ON} Anc_...    74   1e-12
SAKL0B12364g Chr2 (1060853..1063021) [2169 bp, 722 aa] {ON} high...    74   1e-12
Smik_10.91 Chr10 complement(145745..148153) [2409 bp, 802 aa] {O...    74   1e-12
ZYRO0C02288g Chr3 complement(181604..184327) [2724 bp, 907 aa] {...    74   1e-12
KAFR0G01080 Chr7 complement(243965..247417) [3453 bp, 1150 aa] {...    74   1e-12
Skud_10.73 Chr10 complement(123049..125436) [2388 bp, 795 aa] {O...    74   1e-12
Kwal_27.12559 s27 (1273349..1274593) [1245 bp, 414 aa] {ON} YPR0...    72   1e-12
ZYRO0B07854g Chr2 complement(613992..616007) [2016 bp, 671 aa] {...    73   1e-12
YJL164C Chr10 complement(109966..111159) [1194 bp, 397 aa] {ON} ...    72   1e-12
Ecym_8095 Chr8 (205952..207106) [1155 bp, 384 aa] {ON} similar t...    72   1e-12
TDEL0D00330 Chr4 complement(55638..57872) [2235 bp, 744 aa] {ON}...    73   1e-12
KNAG0I02670 Chr9 complement(524008..526734) [2727 bp, 908 aa] {O...    73   1e-12
TBLA0A08290 Chr1 complement(2039328..2041376) [2049 bp, 682 aa] ...    73   1e-12
TDEL0F00840 Chr6 (144884..146875) [1992 bp, 663 aa] {ON} Anc_2.9...    73   1e-12
CAGL0B04301g Chr2 (420544..422172) [1629 bp, 542 aa] {ON} simila...    73   1e-12
TDEL0C03710 Chr3 (653934..655169) [1236 bp, 411 aa] {ON} Anc_1.1...    72   1e-12
TDEL0C04800 Chr3 (866157..867467) [1311 bp, 436 aa] {ON} Anc_3.3...    72   1e-12
TPHA0P01270 Chr16 complement(254480..257137) [2658 bp, 885 aa] {...    73   1e-12
TDEL0A04580 Chr1 (816247..818331) [2085 bp, 694 aa] {ON} Anc_5.5...    73   1e-12
Skud_16.340 Chr16 (631100..632266) [1167 bp, 388 aa] {ON} YPR054...    72   2e-12
TBLA0C03140 Chr3 (759258..760763) [1506 bp, 501 aa] {ON} Anc_5.2...    72   2e-12
KLTH0E15004g Chr5 (1328930..1330165) [1236 bp, 411 aa] {ON} simi...    72   2e-12
TBLA0E04970 Chr5 (1272310..1273944) [1635 bp, 544 aa] {ON} Anc_4...    72   2e-12
YNL307C Chr14 complement(56446..57573) [1128 bp, 375 aa] {ON}  M...    72   2e-12
ZYRO0C15862g Chr3 (1239992..1241305) [1314 bp, 437 aa] {ON} simi...    72   2e-12
TBLA0D05640 Chr4 (1380616..1383066) [2451 bp, 816 aa] {ON} Anc_1...    73   2e-12
KAFR0A05090 Chr1 (1011918..1013924) [2007 bp, 668 aa] {ON}             73   2e-12
YJL141C Chr10 complement(147967..150390) [2424 bp, 807 aa] {ON} ...    73   2e-12
TBLA0I00910 Chr9 complement(170526..173945) [3420 bp, 1139 aa] {...    73   2e-12
KAFR0E01580 Chr5 (318991..320280) [1290 bp, 429 aa] {ON} Anc_5.2...    72   2e-12
YAL017W Chr1 (120225..124295) [4071 bp, 1356 aa] {ON}  PSK1One o...    73   2e-12
TBLA0A06670 Chr1 complement(1630701..1632023) [1323 bp, 440 aa] ...    72   2e-12
Ecym_3525 Chr3 (993328..995784) [2457 bp, 818 aa] {ON} similar t...    73   2e-12
TBLA0C02310 Chr3 complement(546887..548596) [1710 bp, 569 aa] {O...    72   2e-12
Kpol_1031.32 s1031 (76827..78821) [1995 bp, 664 aa] {ON} (76827....    72   2e-12
NCAS0E01150 Chr5 complement(217594..219315) [1722 bp, 573 aa] {O...    72   2e-12
NDAI0E01960 Chr5 (397897..399717) [1821 bp, 606 aa] {ON} Anc_2.425     72   2e-12
NCAS0C01370 Chr3 complement(250693..253092) [2400 bp, 799 aa] {O...    73   2e-12
NDAI0B04700 Chr2 complement(1164332..1165918) [1587 bp, 528 aa] ...    72   2e-12
TPHA0C00160 Chr3 complement(17339..19603) [2265 bp, 754 aa] {ON}...    72   2e-12
SAKL0C08844g Chr3 (811712..813307) [1596 bp, 531 aa] {ON} simila...    72   2e-12
KAFR0B06980 Chr2 (1452754..1455081) [2328 bp, 775 aa] {ON} Anc_4...    72   3e-12
ADR167W Chr4 (994581..997202) [2622 bp, 873 aa] {ON} Syntenic ho...    72   3e-12
Suva_6.245 Chr6 (438131..439315) [1185 bp, 394 aa] {ON} YJL164C ...    71   3e-12
KLLA0A05819g Chr1 (541545..543659) [2115 bp, 704 aa] {ON} simila...    72   3e-12
Suva_2.642 Chr2 (1147428..1148865,1149541..1150805) [2703 bp, 90...    72   3e-12
TDEL0B04700 Chr2 (834336..836996) [2661 bp, 886 aa] {ON} Anc_8.1...    72   3e-12
TPHA0F03520 Chr6 (755480..757756) [2277 bp, 758 aa] {ON} Anc_1.5...    72   3e-12
KLTH0D04818g Chr4 (439491..441566) [2076 bp, 691 aa] {ON} simila...    72   3e-12
ZYRO0D05500g Chr4 (473262..477050) [3789 bp, 1262 aa] {ON} weakl...    72   3e-12
YDR466W Chr4 (1395121..1397817) [2697 bp, 898 aa] {ON}  PKH3Prot...    72   3e-12
NDAI0K01370 Chr11 (313672..315714) [2043 bp, 680 aa] {ON}              72   3e-12
Smik_1.50 Chr1 (103132..107205) [4074 bp, 1357 aa] {ON} YAL017W ...    72   3e-12
ADL168C Chr4 complement(398517..399605) [1089 bp, 362 aa] {ON} S...    71   3e-12
AEL083W Chr5 (470964..472574) [1611 bp, 536 aa] {ON} Syntenic ho...    72   3e-12
KLLA0E10539g Chr5 (929989..931104) [1116 bp, 371 aa] {ON} highly...    71   3e-12
CAGL0H06259g Chr8 (615045..619055) [4011 bp, 1336 aa] {ON} simil...    72   3e-12
Suva_10.464 Chr10 (809505..811721) [2217 bp, 738 aa] {ON} YLR362...    72   3e-12
Ecym_2640 Chr2 complement(1232617..1236594) [3978 bp, 1325 aa] {...    72   3e-12
Smik_13.290 Chr13 complement(457921..459951) [2031 bp, 676 aa] {...    72   3e-12
TPHA0F02150 Chr6 complement(475516..477768) [2253 bp, 750 aa] {O...    72   4e-12
Kpol_1042.20 s1042 (45090..47261) [2172 bp, 723 aa] {ON} (45090....    72   4e-12
CAGL0L05632g Chr12 (612478..614511) [2034 bp, 677 aa] {ON} simil...    72   4e-12
Skud_13.262 Chr13 complement(448758..450791) [2034 bp, 677 aa] {...    72   4e-12
KNAG0G01430 Chr7 complement(322758..323822) [1065 bp, 354 aa] {O...    70   4e-12
Suva_6.221 Chr6 (399862..400920,400924..402096) [2232 bp, 743 aa...    72   4e-12
ADL389W Chr4 (27641..29776) [2136 bp, 711 aa] {ON} Syntenic homo...    72   4e-12
NDAI0H03520 Chr8 (860096..861472) [1377 bp, 458 aa] {ON}               71   4e-12
CAGL0H09152g Chr8 complement(895722..898055) [2334 bp, 777 aa] {...    72   4e-12
KLLA0B03586g Chr2 complement(326871..329075) [2205 bp, 734 aa] {...    72   4e-12
CAGL0K02167g Chr11 complement(192297..195785) [3489 bp, 1162 aa]...    72   4e-12
Kpol_265.1 s265 (4826..7099) [2274 bp, 757 aa] {ON} (4826..7099)...    72   5e-12
TDEL0A04780 Chr1 (842715..844580) [1866 bp, 621 aa] {ON} Anc_5.6...    71   5e-12
SAKL0C12870g Chr3 (1145051..1146142) [1092 bp, 363 aa] {ON} high...    70   5e-12
KLLA0B09790g Chr2 complement(855327..856214) [888 bp, 295 aa] {O...    69   5e-12
Smik_14.24 Chr14 complement(40883..42010) [1128 bp, 375 aa] {ON}...    70   5e-12
Skud_14.32 Chr14 complement(49930..51057) [1128 bp, 375 aa] {ON}...    70   5e-12
TPHA0E02270 Chr5 (471696..472916) [1221 bp, 406 aa] {ON} Anc_5.2...    70   5e-12
TPHA0D01140 Chr4 (238656..240524) [1869 bp, 622 aa] {ON} Anc_8.6...    71   5e-12
Smik_6.178 Chr6 (291601..293322) [1722 bp, 573 aa] {ON} YGR092W ...    71   5e-12
TPHA0B01520 Chr2 complement(336164..339616) [3453 bp, 1150 aa] {...    72   5e-12
Kwal_47.16761 s47 (100315..102549) [2235 bp, 744 aa] {ON} YHR205...    71   5e-12
Suva_6.222 Chr6 (400975..402096) [1122 bp, 373 aa] {ON} YJL141C ...    70   5e-12
NDAI0B00220 Chr2 (29825..32470) [2646 bp, 881 aa] {ON} Anc_1.180       72   5e-12
Kpol_1018.54 s1018 (163688..166192) [2505 bp, 834 aa] {ON} (1636...    71   5e-12
KAFR0E00330 Chr5 complement(74619..76574) [1956 bp, 651 aa] {ON}...    71   5e-12
TPHA0A04570 Chr1 (1038551..1040674) [2124 bp, 707 aa] {ON} Anc_1...    71   5e-12
SAKL0C05368g Chr3 complement(510576..511832) [1257 bp, 418 aa] {...    70   6e-12
SAKL0E12342g Chr5 complement(1021369..1023795) [2427 bp, 808 aa]...    71   6e-12
Skud_15.39 Chr15 (69445..71412) [1968 bp, 655 aa] {ON} YOL113W (...    71   6e-12
SAKL0B09856g Chr2 complement(830531..834355) [3825 bp, 1274 aa] ...    72   6e-12
Suva_14.178 Chr14 (328862..331195) [2334 bp, 777 aa] {ON} YNL161...    71   7e-12
YMR104C Chr13 complement(473420..475453) [2034 bp, 677 aa] {ON} ...    71   7e-12
Ecym_1275 Chr1 complement(560481..561836) [1356 bp, 451 aa] {ON}...    70   7e-12
Suva_7.375 Chr7 (643870..645591) [1722 bp, 573 aa] {ON} YGR092W ...    71   7e-12
ZYRO0A05544g Chr1 (450809..452704) [1896 bp, 631 aa] {ON} highly...    71   7e-12
KLTH0F18942g Chr6 (1535941..1537032) [1092 bp, 363 aa] {ON} high...    70   7e-12
NCAS0A08880 Chr1 (1756271..1757539) [1269 bp, 422 aa] {ON} Anc_1...    70   8e-12
TPHA0P00640 Chr16 (132185..133963) [1779 bp, 592 aa] {ON} Anc_3....    70   8e-12
Kpol_1018.162 s1018 (414868..416904) [2037 bp, 678 aa] {ON} (414...    70   8e-12
TBLA0D05010 Chr4 complement(1234934..1236238) [1305 bp, 434 aa] ...    70   9e-12
Smik_12.450 Chr12 (788896..791106) [2211 bp, 736 aa] {ON} YLR362...    70   9e-12
NDAI0B00210 Chr2 (27983..29185) [1203 bp, 400 aa] {ON} Anc_1.182       70   9e-12
Ecym_4523 Chr4 (1039929..1042070) [2142 bp, 713 aa] {ON} similar...    70   9e-12
NCAS0B06000 Chr2 complement(1134919..1135808,1135909..1135957) [...    69   9e-12
Skud_4.742 Chr4 (1315170..1317881) [2712 bp, 903 aa] {ON} YDR466...    71   9e-12
CAGL0M02233g Chr13 complement(267332..269635) [2304 bp, 767 aa] ...    70   9e-12
Smik_7.319 Chr7 complement(534132..535472) [1341 bp, 446 aa] {ON...    70   9e-12
Skud_5.249 Chr5 complement(400867..404310) [3444 bp, 1147 aa] {O...    71   9e-12
ACL054W Chr3 (269703..272621) [2919 bp, 972 aa] {ON} Syntenic ho...    71   9e-12
Kwal_27.9773 s27 (57252..58472) [1221 bp, 406 aa] {ON} YAR018C (...    70   9e-12
Skud_1.44 Chr1 (95573..99643) [4071 bp, 1356 aa] {ON} YAL017W (R...    71   9e-12
YLR362W Chr12 (849866..852019) [2154 bp, 717 aa] {ON}  STE11Sign...    70   9e-12
SAKL0D06666g Chr4 (551260..552522) [1263 bp, 420 aa] {ON} some s...    70   1e-11
Suva_13.281 Chr13 complement(455094..457136) [2043 bp, 680 aa] {...    70   1e-11
YGR092W Chr7 (668189..669907) [1719 bp, 572 aa] {ON}  DBF2Ser/Th...    70   1e-11
Kwal_55.22001 s55 (1069907..1070998) [1092 bp, 363 aa] {ON} YNL3...    69   1e-11
KNAG0A03040 Chr1 complement(372150..374084) [1935 bp, 644 aa] {O...    70   1e-11
KNAG0C06060 Chr3 (1183766..1186654) [2889 bp, 962 aa] {ON} Anc_5...    70   1e-11
ZYRO0C06776g Chr3 complement(508813..511485) [2673 bp, 890 aa] {...    70   1e-11
YNL298W Chr14 (68915..71443) [2529 bp, 842 aa] {ON}  CLA4Cdc42p-...    70   1e-11
TDEL0A02220 Chr1 (402496..404565) [2070 bp, 689 aa] {ON} Anc_2.4...    70   1e-11
Suva_14.32 Chr14 complement(52757..53884) [1128 bp, 375 aa] {ON}...    69   1e-11
CAGL0H07535g Chr8 (736241..737137) [897 bp, 298 aa] {ON} highly ...    68   1e-11
Suva_15.124 Chr15 (215781..219101) [3321 bp, 1106 aa] {ON} YOL04...    70   1e-11
TBLA0J00990 Chr10 (224999..227335) [2337 bp, 778 aa] {ON} Anc_1....    70   1e-11
Kwal_27.11919 s27 (1003201..1003827) [627 bp, 209 aa] {OFF} YBR1...    67   1e-11
KNAG0C04310 Chr3 complement(842994..846503) [3510 bp, 1169 aa] {...    70   1e-11
NDAI0B03310 Chr2 complement(844616..845557) [942 bp, 313 aa] {ON...    69   1e-11
Smik_4.745 Chr4 (1316457..1319201) [2745 bp, 914 aa] {ON} YDR466...    70   1e-11
Suva_16.382 Chr16 (673009..674205) [1197 bp, 398 aa] {ON} YPR054...    69   1e-11
Ecym_2397 Chr2 complement(771343..773961) [2619 bp, 872 aa] {ON}...    70   1e-11
NDAI0A06130 Chr1 complement(1391744..1394203) [2460 bp, 819 aa] ...    70   1e-11
ZYRO0G18502g Chr7 (1528075..1529265) [1191 bp, 396 aa] {ON} simi...    69   1e-11
KNAG0D04810 Chr4 (867817..872139) [4323 bp, 1440 aa] {ON} Anc_7....    70   1e-11
KLLA0A07403g Chr1 (661261..663900) [2640 bp, 879 aa] {ON} simila...    70   1e-11
CAGL0F00913g Chr6 (97023..100643) [3621 bp, 1206 aa] {ON} simila...    70   1e-11
TPHA0G01630 Chr7 (336511..339126) [2616 bp, 871 aa] {ON} Anc_8.6...    70   1e-11
Kwal_33.13831 s33 complement(413256..415358) [2103 bp, 700 aa] {...    70   1e-11
Suva_6.208 Chr6 (369853..371880) [2028 bp, 675 aa] {ON} YJL128C ...    70   1e-11
KNAG0F01440 Chr6 (261403..263685) [2283 bp, 760 aa] {ON}               70   1e-11
Suva_6.78 Chr6 (135988..137325) [1338 bp, 445 aa] {ON} YFR014C (...    69   1e-11
Kpol_1069.13 s1069 complement(27223..28506) [1284 bp, 427 aa] {O...    69   1e-11
Smik_7.92 Chr7 (155049..157742) [2694 bp, 897 aa] {ON} YGL180W (...    70   1e-11
Skud_12.447 Chr12 (790003..792210) [2208 bp, 735 aa] {ON} YLR362...    70   1e-11
KLTH0D17204g Chr4 complement(1426818..1429085) [2268 bp, 755 aa]...    70   1e-11
NCAS0A11020 Chr1 (2193556..2194869) [1314 bp, 437 aa] {ON} Anc_3...    69   1e-11
Kwal_56.24059 s56 complement(829673..830734) [1062 bp, 353 aa] {...    69   2e-11
Ecym_2042 Chr2 complement(67312..68397) [1086 bp, 361 aa] {ON} s...    69   2e-11
Smik_14.34 Chr14 (53272..55788) [2517 bp, 838 aa] {ON} YNL298W (...    70   2e-11
KAFR0A08360 Chr1 complement(1677561..1680050) [2490 bp, 829 aa] ...    70   2e-11
Kpol_161.2 s161 complement(3125..4246) [1122 bp, 373 aa] {ON} co...    69   2e-11
SAKL0D07656g Chr4 complement(627469..628767) [1299 bp, 432 aa] {...    69   2e-11
CAGL0E01683g Chr5 complement(166821..167948) [1128 bp, 375 aa] {...    69   2e-11
Smik_2.300 Chr2 (546211..547107) [897 bp, 298 aa] {ON} YBR160W (...    68   2e-11
Skud_6.89 Chr6 (166257..167594) [1338 bp, 446 aa] {ON} YFR014C (...    69   2e-11
ACR249C Chr3 complement(797020..798951) [1932 bp, 643 aa] {ON} S...    69   2e-11
Skud_14.172 Chr14 (323327..325564) [2238 bp, 745 aa] {ON} YNL161...    70   2e-11
SAKL0C12386g Chr3 complement(1108341..1110923) [2583 bp, 860 aa]...    70   2e-11
Skud_14.40 Chr14 (62496..65006) [2511 bp, 836 aa] {ON} YNL298W (...    70   2e-11
NDAI0G06150 Chr7 (1519393..1521780) [2388 bp, 795 aa] {ON} Anc_1...    70   2e-11
NDAI0F03200 Chr6 complement(770618..772924) [2307 bp, 768 aa] {O...    70   2e-11
YBR160W Chr2 (560078..560974) [897 bp, 298 aa] {ON}  CDC28Cataly...    67   2e-11
Suva_4.535 Chr4 (921278..922861) [1584 bp, 527 aa] {ON} YBR274W ...    69   2e-11
Suva_14.42 Chr14 (65645..68239) [2595 bp, 864 aa] {ON} YNL298W (...    70   2e-11
NCAS0G03420 Chr7 (628644..630668) [2025 bp, 674 aa] {ON} Anc_1.507     69   2e-11
TBLA0A02050 Chr1 (495735..497039) [1305 bp, 434 aa] {ON}               69   2e-11
YDL101C Chr4 complement(280307..281848) [1542 bp, 513 aa] {ON}  ...    69   2e-11
Suva_7.82 Chr7 (156049..158751) [2703 bp, 900 aa] {ON} YGL180W (...    70   2e-11
Ecym_4448 Chr4 complement(917136..918872) [1737 bp, 578 aa] {ON}...    69   2e-11
KLTH0E16104g Chr5 complement(1425822..1427042) [1221 bp, 406 aa]...    69   2e-11
CAGL0K06479g Chr11 (637125..640100) [2976 bp, 991 aa] {ON} some ...    70   2e-11
NCAS0D00630 Chr4 complement(107310..108593) [1284 bp, 427 aa] {O...    69   2e-11
Kwal_14.2497 s14 complement(784224..785480) [1257 bp, 418 aa] {O...    69   2e-11
YGL180W Chr7 (160065..162758) [2694 bp, 897 aa] {ON}  ATG1Protei...    69   2e-11
CAGL0L06006g Chr12 complement(672704..675532) [2829 bp, 942 aa] ...    69   2e-11
SAKL0H10758g Chr8 complement(930403..931302) [900 bp, 299 aa] {O...    67   2e-11
YNL161W Chr14 (332597..334867) [2271 bp, 756 aa] {ON}  CBK1Serin...    69   2e-11
TPHA0B03850 Chr2 (909219..910841) [1623 bp, 540 aa] {ON} Anc_1.4...    69   2e-11
KNAG0G01250 Chr7 complement(280791..283364) [2574 bp, 857 aa] {O...    69   2e-11
TDEL0F03120 Chr6 (570471..572192) [1722 bp, 573 aa] {ON} Anc_3.4...    69   2e-11
ZYRO0G19074g Chr7 complement(1580648..1583413) [2766 bp, 921 aa]...    69   2e-11
TBLA0B09590 Chr2 (2272405..2273328) [924 bp, 307 aa] {ON} Anc_2....    67   3e-11
Ecym_6400 Chr6 complement(779716..781983) [2268 bp, 755 aa] {ON}...    69   3e-11
KLLA0E06447g Chr5 complement(577669..581154) [3486 bp, 1161 aa] ...    69   3e-11
KNAG0D01140 Chr4 (192308..193495) [1188 bp, 395 aa] {ON}               68   3e-11
Skud_7.391 Chr7 (652479..654200) [1722 bp, 573 aa] {ON} YGR092W ...    69   3e-11
Suva_4.411 Chr4 (729465..730361) [897 bp, 298 aa] {ON} YBR160W (...    67   3e-11
Skud_7.91 Chr7 (165681..168374) [2694 bp, 897 aa] {ON} YGL180W (...    69   3e-11
ZYRO0E05588g Chr5 (430271..431686) [1416 bp, 471 aa] {ON} simila...    68   3e-11
AFR035W Chr6 (498529..500688) [2160 bp, 719 aa] {ON} Syntenic ho...    69   3e-11
NDAI0D04110 Chr4 (966439..967560) [1122 bp, 373 aa] {ON} Anc_4.192     68   3e-11
KLTH0H10318g Chr8 complement(888661..890128,890228..890316) [155...    69   3e-11
Smik_14.167 Chr14 (311655..312284,312591..314228) [2268 bp, 755 ...    69   3e-11
TBLA0B08520 Chr2 complement(2038517..2041321) [2805 bp, 934 aa] ...    69   3e-11
NCAS0A07990 Chr1 complement(1578473..1581346) [2874 bp, 957 aa] ...    69   3e-11
YFR014C Chr6 complement(172537..173877) [1341 bp, 446 aa] {ON}  ...    68   3e-11
KNAG0B05880 Chr2 (1155395..1157695) [2301 bp, 766 aa] {ON} Anc_4...    69   3e-11
TBLA0B03970 Chr2 complement(904167..907793) [3627 bp, 1208 aa] {...    69   3e-11
KLLA0D09328g Chr4 complement(788565..791705) [3141 bp, 1046 aa] ...    69   3e-11
KLLA0D07810g Chr4 complement(669095..671251) [2157 bp, 718 aa] {...    69   3e-11
TDEL0H03640 Chr8 complement(600211..603924) [3714 bp, 1237 aa] {...    69   3e-11
TDEL0A00600 Chr1 complement(101753..102877) [1125 bp, 374 aa] {O...    67   3e-11
KNAG0A01330 Chr1 complement(34784..35977) [1194 bp, 397 aa] {ON}...    68   3e-11
TBLA0B06510 Chr2 (1536156..1538489) [2334 bp, 777 aa] {ON} Anc_1...    69   3e-11
KLTH0F12012g Chr6 complement(1013169..1014881) [1713 bp, 570 aa]...    69   3e-11
YJL128C Chr10 complement(178097..180103) [2007 bp, 668 aa] {ON} ...    69   4e-11
TBLA0B00770 Chr2 complement(168444..170519) [2076 bp, 691 aa] {O...    69   4e-11
NCAS0B02350 Chr2 complement(394128..395018) [891 bp, 296 aa] {ON...    67   4e-11
NDAI0G01280 Chr7 complement(281834..283573) [1740 bp, 579 aa] {O...    68   4e-11
KLTH0C02662g Chr3 complement(240347..242674) [2328 bp, 775 aa] {...    69   4e-11
TPHA0H00410 Chr8 (79426..82197) [2772 bp, 923 aa] {ON} Anc_8.141...    69   4e-11
SAKL0B07304g Chr2 (625541..627007) [1467 bp, 488 aa] {ON} simila...    68   4e-11
Kpol_1033.1 s1033 complement(1..828) [828 bp, 276 aa] {ON} compl...    66   4e-11
TBLA0A04720 Chr1 (1168895..1172683) [3789 bp, 1262 aa] {ON} Anc_...    69   4e-11
NCAS0C04540 Chr3 complement(929920..931056) [1137 bp, 378 aa] {O...    67   4e-11
Suva_15.155 Chr15 complement(267680..269038) [1359 bp, 452 aa] {...    68   4e-11
KAFR0A06190 Chr1 complement(1251546..1253690) [2145 bp, 714 aa] ...    69   4e-11
TPHA0E02840 Chr5 (594381..595589) [1209 bp, 402 aa] {ON} Anc_6.2...    67   4e-11
Kwal_YGOB_27.11919 s27 (1003201..1003830,1004866..1005135) [900 ...    67   4e-11
ZYRO0D02970g Chr4 complement(231363..233669) [2307 bp, 768 aa] {...    68   4e-11
CAGL0J03872g Chr10 (368472..370457) [1986 bp, 661 aa] {ON} simil...    68   4e-11
TBLA0A07770 Chr1 complement(1916632..1917939) [1308 bp, 435 aa] ...    67   5e-11
KLLA0F11319g Chr6 (1042436..1044967) [2532 bp, 843 aa] {ON} simi...    68   5e-11
TPHA0G01600 Chr7 complement(329313..331850) [2538 bp, 845 aa] {O...    68   5e-11
KLLA0C00979g Chr3 (73295..74746) [1452 bp, 483 aa] {ON} similar ...    67   5e-11
ZYRO0F08778g Chr6 (702733..703626) [894 bp, 297 aa] {ON} highly ...    66   5e-11
KNAG0K01710 Chr11 (360438..361931) [1494 bp, 497 aa] {ON} Anc_3....    68   5e-11
SAKL0C07744g Chr3 (720519..721799) [1281 bp, 426 aa] {ON} simila...    67   5e-11
Ecym_5209 Chr5 complement(445530..448133) [2604 bp, 867 aa] {ON}...    68   6e-11
CAGL0G05720g Chr7 complement(547617..549833) [2217 bp, 738 aa] {...    68   6e-11
Kpol_534.14 s534 (34465..34591,34724..35616) [1020 bp, 339 aa] {...    67   6e-11
NCAS0B07380 Chr2 complement(1396315..1397898) [1584 bp, 527 aa] ...    67   6e-11
Ecym_2566 Chr2 (1105239..1106126) [888 bp, 295 aa] {ON} similar ...    66   6e-11
TBLA0B08650 Chr2 (2065061..2066308) [1248 bp, 415 aa] {ON} Anc_3...    67   6e-11
KLTH0E11924g Chr5 (1059134..1060030) [897 bp, 298 aa] {ON} highl...    66   6e-11
TDEL0E00690 Chr5 (144269..146770) [2502 bp, 833 aa] {ON} Anc_3.6...    68   6e-11
NCAS0H03070 Chr8 complement(590494..592440) [1947 bp, 648 aa] {O...    68   6e-11
Kpol_1033.50 s1033 complement(126043..127197) [1155 bp, 384 aa] ...    67   6e-11
Smik_6.408 Chr6 complement(657018..658163) [1146 bp, 381 aa] {ON...    67   6e-11
Kwal_23.5290 s23 complement(1095011..1097470) [2460 bp, 819 aa] ...    68   6e-11
Skud_10.87 Chr10 complement(153140..155164) [2025 bp, 674 aa] {O...    68   7e-11
Skud_2.406 Chr2 (718522..720105) [1584 bp, 527 aa] {ON} YBR274W ...    67   7e-11
NDAI0A08560 Chr1 complement(1969778..1973731) [3954 bp, 1317 aa]...    68   7e-11
YPL203W Chr16 (166256..167398) [1143 bp, 380 aa] {ON}  TPK2cAMP-...    67   7e-11
KLTH0F04730g Chr6 complement(417013..419133) [2121 bp, 706 aa] {...    67   8e-11
TDEL0G02620 Chr7 (501589..501613,501677..502566) [915 bp, 304 aa...    66   8e-11
KAFR0D04500 Chr4 (887515..889989) [2475 bp, 824 aa] {ON} Anc_1.5...    67   8e-11
KNAG0L00520 Chr12 (79786..80892) [1107 bp, 368 aa] {ON} Anc_7.86...    66   9e-11
KNAG0I01480 Chr9 (287733..289055) [1323 bp, 440 aa] {ON} Anc_1.3...    67   9e-11
YBR274W Chr2 (749594..751177) [1584 bp, 527 aa] {ON}  CHK1Serine...    67   9e-11
SAKL0D12628g Chr4 (1048973..1051429) [2457 bp, 818 aa] {ON} weak...    67   9e-11
Smik_2.417 Chr2 (735214..736797) [1584 bp, 527 aa] {ON} YBR274W ...    67   9e-11
Ecym_8400 Chr8 complement(825315..828515) [3201 bp, 1066 aa] {ON...    67   9e-11
ADR033W Chr4 (764716..766449) [1734 bp, 577 aa] {ON} Syntenic ho...    67   9e-11
Kwal_23.3992 s23 complement(515493..517208) [1716 bp, 571 aa] {O...    67   1e-10
Smik_4.128 Chr4 (244339..244354,244439..245331) [909 bp, 302 aa]...    65   1e-10
KAFR0C01720 Chr3 (351078..352208) [1131 bp, 376 aa] {ON} Anc_3.4...    66   1e-10
KLTH0A01320g Chr1 (118671..121115) [2445 bp, 814 aa] {ON} simila...    67   1e-10
KLLA0F01276g Chr6 complement(120001..121560) [1560 bp, 519 aa] {...    67   1e-10
Ecym_2194 Chr2 complement(381633..382733) [1101 bp, 366 aa] {ON}...    66   1e-10
TPHA0D03940 Chr4 (825250..826989) [1740 bp, 579 aa] {ON} Anc_3.4...    67   1e-10
SAKL0H24750g Chr8 complement(2152673..2155420) [2748 bp, 915 aa]...    67   1e-10
KAFR0H01460 Chr8 complement(269957..271705) [1749 bp, 582 aa] {O...    67   1e-10
YKL161C Chr11 complement(149386..150687) [1302 bp, 433 aa] {ON} ...    66   1e-10
KLTH0D10714g Chr4 (880389..883007) [2619 bp, 872 aa] {ON} simila...    67   1e-10
TBLA0H02950 Chr8 complement(721123..723906) [2784 bp, 927 aa] {O...    67   1e-10
SAKL0C05280g Chr3 complement(502205..504490) [2286 bp, 761 aa] {...    67   1e-10
NCAS0G02070 Chr7 (372747..374960) [2214 bp, 737 aa] {ON} Anc_2.96      67   1e-10
KNAG0J02660 Chr10 (495011..497425) [2415 bp, 804 aa] {ON} Anc_1....    67   1e-10
NCAS0B01470 Chr2 (241003..243186) [2184 bp, 727 aa] {ON} Anc_8.654     67   1e-10
AEL205W Chr5 (246871..249252) [2382 bp, 793 aa] {ON} Syntenic ho...    67   1e-10
Kwal_0.96 s0 complement(46082..47365) [1284 bp, 427 aa] {ON} YOL...    66   1e-10
TBLA0H00370 Chr8 (71216..73393) [2178 bp, 725 aa] {ON} Anc_2.425...    67   1e-10
TBLA0E02290 Chr5 complement(563483..567385) [3903 bp, 1300 aa] {...    67   1e-10
Kpol_513.7 s513 (14160..15050) [891 bp, 296 aa] {ON} (14160..150...    65   1e-10
KNAG0H00790 Chr8 complement(124926..126131) [1206 bp, 401 aa] {O...    66   1e-10
KLLA0B02332g Chr2 complement(206863..207948) [1086 bp, 361 aa] {...    66   1e-10
TDEL0F00930 Chr6 complement(160181..163573) [3393 bp, 1130 aa] {...    67   1e-10
SAKL0F06094g Chr6 (457709..459442) [1734 bp, 577 aa] {ON} unipro...    67   1e-10
Ecym_6307 Chr6 (578677..580227) [1551 bp, 516 aa] {ON} similar t...    66   1e-10
Suva_4.145 Chr4 complement(268826..270370) [1545 bp, 514 aa] {ON...    66   1e-10
KLTH0H04180g Chr8 (381111..382172) [1062 bp, 353 aa] {ON} highly...    65   1e-10
YDL108W Chr4 (267698..267725,267807..268699) [921 bp, 306 aa] {O...    65   1e-10
KLTH0E06754g Chr5 (619163..621784) [2622 bp, 873 aa] {ON} simila...    67   1e-10
CAGL0L07326g Chr12 (810529..812049) [1521 bp, 506 aa] {ON} simil...    66   2e-10
Smik_10.106 Chr10 complement(175752..177776) [2025 bp, 674 aa] {...    67   2e-10
TDEL0B06320 Chr2 (1118534..1119868) [1335 bp, 444 aa] {ON} Anc_1...    66   2e-10
Kwal_33.14554 s33 (717776..719920) [2145 bp, 714 aa] {ON} YNL161...    67   2e-10
ADR058C Chr4 complement(810939..811826) [888 bp, 295 aa] {ON} Sy...    65   2e-10
Kpol_1050.13 s1050 (34788..36578) [1791 bp, 596 aa] {ON} (34788....    66   2e-10
Skud_15.25 Chr15 complement(43728..44864) [1137 bp, 378 aa] {ON}...    65   2e-10
CAGL0K10604g Chr11 complement(1030055..1031395) [1341 bp, 446 aa...    66   2e-10
CAGL0B04147g Chr2 (402798..404498) [1701 bp, 566 aa] {ON} highly...    66   2e-10
AFL217C Chr6 complement(30765..32840) [2076 bp, 691 aa] {ON} Syn...    66   2e-10
ZYRO0G05214g Chr7 (420482..422980) [2499 bp, 832 aa] {ON} some s...    66   2e-10
CAGL0G09020g Chr7 (860266..861351) [1086 bp, 361 aa] {ON} highly...    65   2e-10
KLTH0D03080g Chr4 (295808..297730) [1923 bp, 640 aa] {ON} simila...    66   2e-10
Smik_6.339 Chr6 (538177..540774) [2598 bp, 865 aa] {ON} YPL141C ...    66   2e-10
NDAI0C03900 Chr3 complement(883841..885310) [1470 bp, 489 aa] {O...    66   2e-10
NDAI0E02320 Chr5 (480203..483001) [2799 bp, 932 aa] {ON}               67   2e-10
Smik_4.25 Chr4 complement(52454..54547) [2094 bp, 697 aa] {ON} Y...    66   2e-10
KLLA0D14905g Chr4 (1256065..1257768) [1704 bp, 567 aa] {ON} simi...    66   2e-10
TPHA0P01380 Chr16 (278259..279380) [1122 bp, 373 aa] {ON} Anc_3....    65   2e-10
Skud_16.140 Chr16 complement(255090..257687) [2598 bp, 865 aa] {...    66   2e-10
KLTH0D02486g Chr4 (247566..251237) [3672 bp, 1223 aa] {ON} simil...    67   2e-10
TPHA0H00420 Chr8 complement(82575..85691) [3117 bp, 1038 aa] {ON...    67   2e-10
Smik_10.349 Chr10 (534756..537209) [2454 bp, 817 aa] {ON} YJR059...    66   2e-10
TBLA0F00820 Chr6 (209607..211844) [2238 bp, 745 aa] {ON} Anc_3.1...    66   2e-10
ZYRO0G19052g Chr7 (1576638..1580033) [3396 bp, 1131 aa] {ON} sim...    66   2e-10
Skud_11.56 Chr11 complement(117617..119776) [2160 bp, 719 aa] {O...    66   2e-10
KAFR0K02450 Chr11 (504087..504131,504190..505680) [1536 bp, 511 ...    66   2e-10
KAFR0F01790 Chr6 complement(347491..349884) [2394 bp, 797 aa] {O...    66   2e-10
Smik_15.25 Chr15 complement(46541..47668) [1128 bp, 375 aa] {ON}...    65   2e-10
TPHA0O01030 Chr15 complement(191875..193890) [2016 bp, 671 aa] {...    66   2e-10
NCAS0B08300 Chr2 (1582859..1584796) [1938 bp, 645 aa] {ON} Anc_1...    66   2e-10
SAKL0A04246g Chr1 complement(396019..397221) [1203 bp, 400 aa] {...    65   2e-10
Suva_16.169 Chr16 complement(292738..295314) [2577 bp, 858 aa] {...    66   2e-10
Kpol_1000.14 s1000 complement(36018..38015) [1998 bp, 665 aa] {O...    66   3e-10
SAKL0H06754g Chr8 (594995..597649) [2655 bp, 884 aa] {ON} simila...    66   3e-10
TPHA0L01470 Chr12 (303604..304497) [894 bp, 297 aa] {ON} Anc_8.5...    64   3e-10
TPHA0O00670 Chr15 (125331..127088) [1758 bp, 585 aa] {ON} Anc_1....    65   3e-10
YPL141C Chr16 complement(283464..286061) [2598 bp, 865 aa] {ON} ...    66   3e-10
Skud_2.287 Chr2 (527443..528339) [897 bp, 298 aa] {ON} YBR160W (...    64   3e-10
KAFR0E03030 Chr5 (606567..607457) [891 bp, 296 aa] {ON} Anc_8.51...    64   3e-10
Kpol_1072.29 s1072 complement(61987..64668) [2682 bp, 893 aa] {O...    66   3e-10
Skud_16.76 Chr16 (139571..140719) [1149 bp, 382 aa] {ON} YPL203W...    65   3e-10
Kpol_1018.137 s1018 complement(366178..367914) [1737 bp, 578 aa]...    65   3e-10
TBLA0A02030 Chr1 complement(491365..492576) [1212 bp, 403 aa] {O...    65   3e-10
ZYRO0E07018g Chr5 (531316..532419) [1104 bp, 367 aa] {ON} simila...    64   3e-10
KLTH0H11396g Chr8 complement(973355..974668) [1314 bp, 437 aa] {...    65   3e-10
YOL128C Chr15 complement(78352..79479) [1128 bp, 375 aa] {ON}  Y...    64   3e-10
Kpol_1035.17 s1035 complement(39908..41503) [1596 bp, 531 aa] {O...    65   3e-10
Kpol_463.19 s463 complement(53246..55561) [2316 bp, 771 aa] {ON}...    65   3e-10
TPHA0O01120 Chr15 complement(217462..218751) [1290 bp, 429 aa] {...    65   4e-10
ZYRO0F11418g Chr6 complement(936573..938117) [1545 bp, 514 aa] {...    65   4e-10
Ecym_5624 Chr5 (1256658..1258022) [1365 bp, 454 aa] {ON} similar...    65   4e-10
KAFR0C04480 Chr3 (894906..896213) [1308 bp, 435 aa] {ON} Anc_1.3...    65   4e-10
Suva_16.439 Chr16 (755102..756796) [1695 bp, 564 aa] {ON} YPR111...    65   4e-10
ZYRO0D03344g Chr4 complement(278347..280326) [1980 bp, 659 aa] {...    65   4e-10
Suva_15.32 Chr15 complement(56314..57447) [1134 bp, 377 aa] {ON}...    64   4e-10
YGL179C Chr7 complement(163409..165091) [1683 bp, 560 aa] {ON}  ...    65   4e-10
KLLA0F02838g Chr6 (264329..266596) [2268 bp, 755 aa] {ON} simila...    65   4e-10
KAFR0K02490 Chr11 (515669..518356) [2688 bp, 895 aa] {ON} Anc_5....    65   4e-10
Suva_11.54 Chr11 complement(116221..118401) [2181 bp, 726 aa] {O...    65   5e-10
Kpol_448.13 s448 (25051..27063) [2013 bp, 670 aa] {ON} (25051..2...    65   5e-10
Suva_16.104 Chr16 (176201..177352) [1152 bp, 383 aa] {ON} YPL203...    64   5e-10
ZYRO0F06842g Chr6 (561269..563800) [2532 bp, 843 aa] {ON} simila...    65   5e-10
TBLA0A01580 Chr1 complement(367370..369976) [2607 bp, 868 aa] {O...    65   5e-10
CAGL0H10318g Chr8 complement(1006299..1007222) [924 bp, 307 aa] ...    64   5e-10
NCAS0I00470 Chr9 (74336..77584) [3249 bp, 1082 aa] {ON} Anc_7.86       65   5e-10
Skud_4.39 Chr4 complement(70857..72947) [2091 bp, 696 aa] {ON} Y...    65   5e-10
Smik_16.354 Chr16 (625456..627150) [1695 bp, 564 aa] {ON} YPR111...    65   5e-10
KAFR0C00920 Chr3 complement(185475..186674) [1200 bp, 399 aa] {O...    64   5e-10
KNAG0G01240 Chr7 (277868..280597) [2730 bp, 909 aa] {ON} Anc_8.1...    65   5e-10
NDAI0J01990 Chr10 (491491..493758) [2268 bp, 755 aa] {ON} Anc_4....    65   5e-10
NDAI0H03460 Chr8 complement(836849..838726) [1878 bp, 625 aa] {O...    65   5e-10
Kwal_47.17252 s47 (318148..320766) [2619 bp, 872 aa] {ON} YGL180...    65   6e-10
YOL016C Chr15 complement(294777..296120) [1344 bp, 447 aa] {ON} ...    64   6e-10
KAFR0A01340 Chr1 (259300..261171) [1872 bp, 623 aa] {ON} Anc_1.2...    65   6e-10
NDAI0A00940 Chr1 complement(193710..195800) [2091 bp, 696 aa] {O...    65   6e-10
YJR059W Chr10 (545787..548243) [2457 bp, 818 aa] {ON}  PTK2Putat...    65   6e-10
NDAI0F01600 Chr6 complement(392424..393662) [1239 bp, 412 aa] {O...    64   6e-10
SAKL0H07084g Chr8 complement(619288..622047) [2760 bp, 919 aa] {...    65   6e-10
NCAS0A11530 Chr1 (2281835..2283223) [1389 bp, 462 aa] {ON} Anc_3...    64   6e-10
NCAS0C04120 Chr3 complement(840008..842755) [2748 bp, 915 aa] {O...    65   6e-10
KAFR0H02540 Chr8 complement(483399..485852) [2454 bp, 817 aa] {O...    65   6e-10
TPHA0B01150 Chr2 complement(259998..262070) [2073 bp, 690 aa] {O...    64   7e-10
Ecym_2203 Chr2 (401590..402648) [1059 bp, 352 aa] {ON} similar t...    64   7e-10
KNAG0K02370 Chr11 complement(475088..477739) [2652 bp, 883 aa] {...    65   7e-10
Ecym_2540 Chr2 (1048071..1049792) [1722 bp, 573 aa] {ON} similar...    64   7e-10
CAGL0L07810g Chr12 complement(859653..861443) [1791 bp, 596 aa] ...    64   7e-10
ZYRO0C12408g Chr3 (979857..981593) [1737 bp, 578 aa] {ON} highly...    64   7e-10
Skud_16.398 Chr16 (712145..713827) [1683 bp, 560 aa] {ON} YPR111...    64   7e-10
TPHA0G01710 Chr7 complement(350452..352869) [2418 bp, 805 aa] {O...    64   8e-10
TDEL0C03740 Chr3 (658468..660702) [2235 bp, 744 aa] {ON} Anc_1.1...    64   8e-10
Kpol_2001.30 s2001 (87817..90093) [2277 bp, 758 aa] {ON} (87817....    64   8e-10
Suva_7.83 Chr7 complement(159329..161038) [1710 bp, 569 aa] {ON}...    64   8e-10
KAFR0F02190 Chr6 (428623..430095) [1473 bp, 490 aa] {ON} Anc_3.1...    64   8e-10
KLLA0E01585g Chr5 (149305..149370,149488..150960) [1539 bp, 512 ...    64   8e-10
CAGL0G03047g Chr7 (282299..283918) [1620 bp, 539 aa] {ON} highly...    64   8e-10
TPHA0K02030 Chr11 (432238..434505) [2268 bp, 755 aa] {ON} Anc_4....    64   8e-10
NDAI0G03470 Chr7 complement(829975..832455) [2481 bp, 826 aa] {O...    64   8e-10
Smik_15.153 Chr15 complement(261920..263248) [1329 bp, 442 aa] {...    64   9e-10
Skud_10.283 Chr10 (503324..505765) [2442 bp, 813 aa] {ON} YJR059...    64   9e-10
KLTH0E11396g Chr5 (1018348..1020069) [1722 bp, 573 aa] {ON} simi...    64   9e-10
Smik_4.135 Chr4 complement(256861..258402) [1542 bp, 513 aa] {ON...    64   9e-10
Kpol_1065.3 s1065 complement(4445..5575) [1131 bp, 376 aa] {ON} ...    63   9e-10
AGL249C Chr7 complement(234347..236092) [1746 bp, 581 aa] {ON} S...    64   1e-09
TBLA0B03860 Chr2 (887855..890821) [2967 bp, 988 aa] {ON} Anc_8.6...    64   1e-09
Ecym_8098 Chr8 (210698..212857) [2160 bp, 719 aa] {ON} similar t...    64   1e-09
NDAI0C05340 Chr3 (1236394..1237296) [903 bp, 300 aa] {ON}              62   1e-09
ZYRO0B09196g Chr2 complement(721019..722569) [1551 bp, 516 aa] {...    64   1e-09
SAKL0A04466g Chr1 (413816..414937) [1122 bp, 373 aa] {ON} highly...    63   1e-09
TDEL0A06000 Chr1 (1053427..1055799) [2373 bp, 790 aa] {ON} Anc_8...    64   1e-09
AFL090W Chr6 (274336..275376) [1041 bp, 346 aa] {ON} Syntenic ho...    63   1e-09
Skud_4.154 Chr4 complement(275783..277324) [1542 bp, 513 aa] {ON...    64   1e-09
KAFR0A03730 Chr1 (761946..764312) [2367 bp, 788 aa] {ON} Anc_8.6...    64   1e-09
KNAG0C02080 Chr3 complement(404332..405588) [1257 bp, 418 aa] {O...    63   1e-09
TBLA0H03440 Chr8 (840759..841643) [885 bp, 294 aa] {ON} Anc_8.51...    62   1e-09
KNAG0A05670 Chr1 complement(847460..849016) [1557 bp, 518 aa] {O...    64   1e-09
TPHA0B01010 Chr2 complement(229538..231634) [2097 bp, 698 aa] {O...    64   1e-09
KLTH0E03652g Chr5 (330227..332671) [2445 bp, 814 aa] {ON} simila...    64   1e-09
NCAS0D00400 Chr4 complement(61545..63716) [2172 bp, 723 aa] {ON}...    64   1e-09
KNAG0A02220 Chr1 complement(198240..199979) [1740 bp, 579 aa] {O...    64   1e-09
KLLA0C04213g Chr3 (386815..387999) [1185 bp, 394 aa] {ON} simila...    63   1e-09
Skud_15.144 Chr15 complement(254620..255969) [1350 bp, 449 aa] {...    63   1e-09
KLLA0C16577g Chr3 complement(1451181..1452695) [1515 bp, 504 aa]...    63   1e-09
Smik_5.275 Chr5 (426176..429601) [3426 bp, 1141 aa] {ON} YER129W...    64   1e-09
AFL101C Chr6 complement(249144..250247) [1104 bp, 367 aa] {ON} S...    63   1e-09
ZYRO0C02772g Chr3 (216325..217464) [1140 bp, 379 aa] {ON} highly...    63   1e-09
KNAG0B01130 Chr2 complement(208528..210279) [1752 bp, 583 aa] {O...    63   1e-09
NDAI0G05300 Chr7 (1289208..1290521) [1314 bp, 437 aa] {ON} Anc_1...    63   1e-09
KNAG0I01360 Chr9 complement(262712..264556) [1845 bp, 614 aa] {O...    63   2e-09
NDAI0A04040 Chr1 complement(907696..910041) [2346 bp, 781 aa] {O...    64   2e-09
YDL214C Chr4 complement(74446..76545) [2100 bp, 699 aa] {ON}  PR...    63   2e-09
Ecym_2405 Chr2 (788655..791222) [2568 bp, 855 aa] {ON} similar t...    64   2e-09
KLTH0E09658g Chr5 (869857..870957) [1101 bp, 366 aa] {ON} highly...    62   2e-09
NDAI0G05060 Chr7 complement(1227369..1229495) [2127 bp, 708 aa] ...    63   2e-09
Suva_5.250 Chr5 (392904..396323) [3420 bp, 1139 aa] {ON} YER129W...    64   2e-09
NCAS0A12200 Chr1 (2417539..2419782) [2244 bp, 747 aa] {ON} Anc_1...    63   2e-09
YKL168C Chr11 complement(131288..133462) [2175 bp, 724 aa] {ON} ...    63   2e-09
SAKL0H11352g Chr8 complement(975064..976857) [1794 bp, 597 aa] {...    63   2e-09
Ecym_2744 Chr2 complement(1442759..1444465) [1707 bp, 568 aa] {O...    63   2e-09
KLLA0E15313g Chr5 (1362851..1365025) [2175 bp, 724 aa] {ON} simi...    63   2e-09
TDEL0F00530 Chr6 complement(88187..90517) [2331 bp, 776 aa] {ON}...    63   2e-09
NDAI0H01020 Chr8 complement(225366..228566) [3201 bp, 1066 aa] {...    63   2e-09
TDEL0A06140 Chr1 complement(1074016..1076601) [2586 bp, 861 aa] ...    63   2e-09
KLTH0G05214g Chr7 (423793..425754) [1962 bp, 653 aa] {ON} weakly...    63   2e-09
SAKL0D09240g Chr4 (764130..765761) [1632 bp, 543 aa] {ON} some s...    63   2e-09
ZYRO0F07194g Chr6 complement(581438..584254) [2817 bp, 938 aa] {...    63   2e-09
ACR133C Chr3 complement(581468..584023) [2556 bp, 851 aa] {ON} S...    63   2e-09
NCAS0A09960 Chr1 complement(1993554..1995926) [2373 bp, 790 aa] ...    63   2e-09
Kpol_529.18 s529 (52782..55118) [2337 bp, 778 aa] {ON} (52782..5...    63   2e-09
TDEL0B01250 Chr2 complement(228145..229038) [894 bp, 297 aa] {ON...    61   2e-09
ZYRO0G18546g Chr7 (1530693..1533050) [2358 bp, 785 aa] {ON} simi...    63   2e-09
NCAS0D00710 Chr4 (122875..124737) [1863 bp, 620 aa] {ON}               63   2e-09
TDEL0E05220 Chr5 complement(957515..958597) [1083 bp, 360 aa] {O...    62   2e-09
CAGL0M13541g Chr13 (1333846..1335714) [1869 bp, 622 aa] {ON} sim...    63   2e-09
TBLA0C05800 Chr3 complement(1402262..1405207) [2946 bp, 981 aa] ...    63   2e-09
Kwal_47.17263 s47 complement(321115..324498) [3384 bp, 1127 aa] ...    63   3e-09
YER129W Chr5 (417281..420709) [3429 bp, 1142 aa] {ON}  SAK1Upstr...    63   3e-09
YGR052W Chr7 (593596..594705) [1110 bp, 369 aa] {ON}  FMP48Putat...    62   3e-09
YJL165C Chr10 complement(106894..109461) [2568 bp, 855 aa] {ON} ...    63   3e-09
CAGL0M08360g Chr13 complement(833220..835520) [2301 bp, 766 aa] ...    63   3e-09
NDAI0E01690 Chr5 (335849..337051) [1203 bp, 400 aa] {ON} Anc_2.391     62   3e-09
KLLA0D03190g Chr4 (267933..269051) [1119 bp, 372 aa] {ON} highly...    62   3e-09
Kwal_26.8709 s26 (907885..910374) [2490 bp, 829 aa] {ON} YPL141C...    63   3e-09
TPHA0D02740 Chr4 (566279..568819) [2541 bp, 846 aa] {ON} Anc_5.5...    63   3e-09
KLLA0D11814g Chr4 complement(1007240..1009021) [1782 bp, 593 aa]...    62   3e-09
TPHA0B00240 Chr2 complement(44468..46525) [2058 bp, 685 aa] {ON}...    62   3e-09
SAKL0C06666g Chr3 complement(628448..630367) [1920 bp, 639 aa] {...    62   3e-09
Kwal_26.8751 s26 complement(928853..931399) [2547 bp, 848 aa] {O...    62   3e-09
TBLA0D05770 Chr4 (1424960..1427671) [2712 bp, 903 aa] {ON} Anc_1...    62   3e-09
CAGL0H01837g Chr8 complement(176352..178736) [2385 bp, 794 aa] {...    62   3e-09
YPR111W Chr16 (747306..749000) [1695 bp, 564 aa] {ON}  DBF20Ser/...    62   3e-09
TPHA0L02180 Chr12 (453556..455538) [1983 bp, 660 aa] {ON} Anc_5....    62   3e-09
TPHA0L01350 Chr12 (282034..283884) [1851 bp, 616 aa] {ON}              62   3e-09
TBLA0D02240 Chr4 complement(561856..566547) [4692 bp, 1563 aa] {...    63   3e-09
NCAS0C01590 Chr3 (293327..295921) [2595 bp, 864 aa] {ON} Anc_8.654     62   3e-09
Smik_15.417 Chr15 (725513..727933) [2421 bp, 806 aa] {ON} YOR233...    62   3e-09
KAFR0K01540 Chr11 (320997..322706) [1710 bp, 569 aa] {ON} Anc_3....    62   3e-09
KAFR0B02140 Chr2 (417972..420662) [2691 bp, 896 aa] {ON} Anc_8.1...    62   3e-09
KAFR0I02440 Chr9 complement(493668..495128) [1461 bp, 486 aa] {O...    62   3e-09
Kwal_27.11830 s27 (964584..966311) [1728 bp, 575 aa] {ON} YPL042...    62   3e-09
Kwal_55.20189 s55 (288918..291356) [2439 bp, 812 aa] {ON} YHR082...    62   3e-09
KNAG0J01590 Chr10 (292565..294982) [2418 bp, 805 aa] {ON} Anc_8....    62   3e-09
TDEL0A05980 Chr1 (1049221..1050771) [1551 bp, 516 aa] {ON} Anc_8...    62   3e-09
Skud_15.399 Chr15 (714789..717212) [2424 bp, 807 aa] {ON} YOR233...    62   3e-09
ACR119W Chr3 (560761..563556) [2796 bp, 931 aa] {ON} Syntenic ho...    62   3e-09
Skud_10.49 Chr10 complement(81651..84206) [2556 bp, 851 aa] {ON}...    62   3e-09
CAGL0L12650g Chr12 (1360085..1361788) [1704 bp, 567 aa] {ON} sim...    62   3e-09
TDEL0D02040 Chr4 (395555..397138) [1584 bp, 527 aa] {ON} Anc_1.3...    62   3e-09
NDAI0F01650 Chr6 (403635..404738) [1104 bp, 367 aa] {ON} Anc_6.214     61   4e-09
KNAG0K01250 Chr11 (246241..247467) [1227 bp, 408 aa] {ON} Anc_3....    62   4e-09
ZYRO0E04246g Chr5 complement(322215..324035) [1821 bp, 606 aa] {...    62   4e-09
NDAI0J01250 Chr10 complement(291314..294844) [3531 bp, 1176 aa] ...    62   4e-09
TBLA0C01750 Chr3 (412762..415707) [2946 bp, 981 aa] {ON} Anc_8.6...    62   4e-09
KNAG0A03900 Chr1 complement(520500..521390) [891 bp, 296 aa] {ON...    60   4e-09
Suva_6.246 Chr6 (439815..442373) [2559 bp, 852 aa] {ON} YJL165C ...    62   4e-09
NCAS0B01450 Chr2 (237824..239341) [1518 bp, 505 aa] {ON} Anc_8.652     62   4e-09
Smik_10.65 Chr10 complement(104987..107545) [2559 bp, 852 aa] {O...    62   4e-09
Smik_8.160 Chr8 complement(245207..248323) [3117 bp, 1038 aa] {O...    62   4e-09
YHR082C Chr8 complement(268459..271548) [3090 bp, 1029 aa] {ON} ...    62   4e-09
AER195C Chr5 complement(1005431..1006945) [1515 bp, 504 aa] {ON}...    62   4e-09
Skud_8.143 Chr8 complement(242422..245535) [3114 bp, 1037 aa] {O...    62   4e-09
Suva_16.274 Chr16 complement(476249..477916) [1668 bp, 555 aa] {...    62   5e-09
TPHA0G02990 Chr7 complement(640488..642098) [1611 bp, 536 aa] {O...    62   5e-09
CAGL0F04741g Chr6 (478256..479584) [1329 bp, 442 aa] {ON} simila...    61   5e-09
Suva_8.282 Chr8 (511665..513185) [1521 bp, 506 aa] {ON} YOR231W ...    61   5e-09
ZYRO0B04796g Chr2 (385611..387683) [2073 bp, 690 aa] {ON} simila...    62   5e-09
KNAG0A03060 Chr1 complement(375640..377142) [1503 bp, 500 aa] {O...    61   5e-09
Kpol_1004.19 s1004 (36090..36101,36217..37689) [1485 bp, 494 aa]...    61   5e-09
Kpol_1072.19 s1072 (44906..47596) [2691 bp, 896 aa] {ON} (44906....    62   5e-09
TPHA0A05460 Chr1 (1233608..1235170) [1563 bp, 520 aa] {ON} Anc_5...    61   5e-09
SAKL0E05984g Chr5 complement(485895..487391,487462..487482) [151...    61   5e-09
ZYRO0F06798g Chr6 (558198..559676) [1479 bp, 492 aa] {ON} simila...    61   5e-09
Kpol_1012.6 s1012 (11581..13467) [1887 bp, 628 aa] {ON} (11581.....    62   5e-09
Kpol_1031.76 s1031 (193193..194923) [1731 bp, 576 aa] {ON} (1931...    61   6e-09
TPHA0O01400 Chr15 complement(277678..279258) [1581 bp, 526 aa] {...    61   6e-09
AER222C Chr5 complement(1043479..1044750) [1272 bp, 423 aa] {ON}...    61   6e-09
KAFR0F02710 Chr6 (528336..529493) [1158 bp, 385 aa] {ON} Anc_2.3...    61   6e-09
Kpol_541.48 s541 (152877..153692,153695..156046) [3168 bp, 1055 ...    62   6e-09
NDAI0C01850 Chr3 (407978..411712) [3735 bp, 1244 aa] {ON}              62   6e-09
Suva_7.334 Chr7 (568847..569956) [1110 bp, 369 aa] {ON} YGR052W ...    60   6e-09
YOR233W Chr15 (775846..778248) [2403 bp, 800 aa] {ON}  KIN4Serin...    61   6e-09
NDAI0B03190 Chr2 complement(815759..817309) [1551 bp, 516 aa] {O...    61   7e-09
NCAS0D01230 Chr4 complement(225213..226661) [1449 bp, 482 aa] {O...    61   7e-09
ZYRO0G08844g Chr7 complement(711678..712766) [1089 bp, 362 aa] {...    60   7e-09
CAGL0M02519g Chr13 complement(290723..292993) [2271 bp, 756 aa] ...    61   7e-09
KNAG0C02430 Chr3 complement(472213..474804) [2592 bp, 863 aa] {O...    61   8e-09
ZYRO0D10252g Chr4 (860458..863109) [2652 bp, 883 aa] {ON} simila...    61   8e-09
KLLA0F12188g Chr6 (1122745..1124385) [1641 bp, 546 aa] {ON} some...    61   8e-09
YPL042C Chr16 complement(473040..474707) [1668 bp, 555 aa] {ON} ...    61   8e-09
KAFR0G00460 Chr7 complement(128077..130023) [1947 bp, 648 aa] {O...    61   8e-09
Kpol_1044.3 s1044 (4910..5845,5849..7711) [2799 bp, 932 aa] {ON}...    61   8e-09
TBLA0C00720 Chr3 (149299..151149) [1851 bp, 616 aa] {ON} Anc_1.4...    61   8e-09
AFL188C Chr6 complement(88793..90211) [1419 bp, 472 aa] {ON} Syn...    60   8e-09
ACR281C Chr3 complement(864528..868307) [3780 bp, 1259 aa] {ON} ...    61   8e-09
KAFR0I02010 Chr9 complement(411589..412887) [1299 bp, 432 aa] {O...    60   8e-09
Suva_8.284 Chr8 (514891..517317) [2427 bp, 808 aa] {ON} YOR233W ...    61   8e-09
KLTH0F09504g Chr6 (824743..824770,824831..825729) [927 bp, 308 a...    60   8e-09
KLTH0E06776g Chr5 complement(622147..625575) [3429 bp, 1142 aa] ...    61   9e-09
CAGL0F00649g Chr6 (71961..73505) [1545 bp, 514 aa] {ON} similar ...    60   9e-09
TBLA0F02350 Chr6 complement(578797..580467) [1671 bp, 556 aa] {O...    60   9e-09
Suva_16.160 Chr16 (277393..280149) [2757 bp, 918 aa] {ON} YPL150...    61   9e-09
KLLA0D07304g Chr4 (623352..624749) [1398 bp, 465 aa] {ON} some s...    60   9e-09
Suva_12.148 Chr12 (223571..225982) [2412 bp, 804 aa] {ON} YJR059...    61   1e-08
NCAS0A01100 Chr1 (218400..219464) [1065 bp, 354 aa] {ON}               60   1e-08
CAGL0J04972g Chr10 (475587..476606) [1020 bp, 339 aa] {ON} some ...    60   1e-08
KNAG0D01090 Chr4 complement(183319..184437) [1119 bp, 372 aa] {O...    60   1e-08
Skud_16.239 Chr16 complement(438063..439727) [1665 bp, 554 aa] {...    60   1e-08
SAKL0D08294g Chr4 (692455..693966) [1512 bp, 503 aa] {ON} some s...    60   1e-08
NCAS0A14050 Chr1 complement(2763082..2764551) [1470 bp, 489 aa] ...    60   1e-08
NDAI0G05370 Chr7 (1313015..1315555) [2541 bp, 846 aa] {ON} Anc_1...    61   1e-08
Smik_16.193 Chr16 complement(350311..351978) [1668 bp, 555 aa] {...    60   1e-08
KLLA0D07348g Chr4 (626999..629728) [2730 bp, 909 aa] {ON} simila...    61   1e-08
AEL118C Chr5 complement(399738..401789) [2052 bp, 683 aa] {ON} S...    60   1e-08
KLTH0F05918g Chr6 complement(525566..527254) [1689 bp, 562 aa] {...    60   1e-08
NCAS0C01670 Chr3 complement(306682..309372) [2691 bp, 896 aa] {O...    61   1e-08
TPHA0A02770 Chr1 complement(597703..600129) [2427 bp, 808 aa] {O...    60   1e-08
CAGL0B03509g Chr2 complement(349638..351431) [1794 bp, 597 aa] {...    60   1e-08
Suva_4.33 Chr4 complement(63334..65427) [2094 bp, 697 aa] {ON} Y...    60   1e-08
TDEL0B05820 Chr2 complement(1031136..1032863) [1728 bp, 575 aa] ...    60   1e-08
TPHA0C04570 Chr3 (985491..987071) [1581 bp, 526 aa] {ON} Anc_2.3...    60   1e-08
NDAI0A06630 Chr1 complement(1514165..1515943) [1779 bp, 592 aa] ...    60   1e-08
TPHA0B03130 Chr2 complement(719624..721372) [1749 bp, 582 aa] {O...    60   1e-08
KNAG0E00360 Chr5 (54187..55563) [1377 bp, 458 aa] {ON}                 60   1e-08
TBLA0F01550 Chr6 complement(385184..386716) [1533 bp, 510 aa] {O...    60   1e-08
TPHA0C04650 Chr3 complement(1006190..1007119) [930 bp, 309 aa] {...    59   1e-08
Kwal_56.24091 s56 (845680..846825) [1146 bp, 381 aa] {ON} YPL209...    59   1e-08
KNAG0G00280 Chr7 complement(43196..45262) [2067 bp, 688 aa] {ON}...    60   1e-08
TDEL0G00630 Chr7 complement(128151..129764) [1614 bp, 537 aa] {O...    60   1e-08
Suva_15.275 Chr15 complement(470782..473862) [3081 bp, 1026 aa] ...    60   2e-08
Ecym_4647 Chr4 (1261859..1263511) [1653 bp, 550 aa] {ON} similar...    60   2e-08
NDAI0E03080 Chr5 complement(653882..655798) [1917 bp, 638 aa] {O...    60   2e-08
NCAS0B03740 Chr2 complement(668231..671380) [3150 bp, 1049 aa] {...    60   2e-08
Kwal_0.155 s0 (84856..86619) [1764 bp, 587 aa] {ON} YLR248W (RCK...    60   2e-08
KAFR0B00920 Chr2 (170792..172300) [1509 bp, 502 aa] {ON} Anc_7.3...    60   2e-08
KNAG0F02900 Chr6 (549477..551426) [1950 bp, 649 aa] {ON}               60   2e-08
NDAI0E01290 Chr5 complement(255593..257782) [2190 bp, 729 aa] {O...    60   2e-08
KNAG0G02110 Chr7 (477260..480838) [3579 bp, 1192 aa] {ON} Anc_8....    60   2e-08
NCAS0F02190 Chr6 complement(435844..437706) [1863 bp, 620 aa] {O...    60   2e-08
YPL150W Chr16 (268188..270893) [2706 bp, 901 aa] {ON} Protein ki...    60   2e-08
Skud_4.146 Chr4 (263181..263196,263281..264173) [909 bp, 302 aa]...    59   2e-08
YDL079C Chr4 complement(312951..314044,314337..314748) [1506 bp,...    59   2e-08
TPHA0D00360 Chr4 complement(55596..60206) [4611 bp, 1536 aa] {ON...    60   2e-08
Skud_15.397 Chr15 (711559..713082) [1524 bp, 507 aa] {ON} YOR231...    59   2e-08
Smik_11.60 Chr11 complement(116793..118970) [2178 bp, 725 aa] {O...    60   2e-08
KAFR0G01810 Chr7 (386620..389130) [2511 bp, 836 aa] {ON} Anc_1.2...    60   2e-08
NCAS0H01780 Chr8 complement(341549..344773) [3225 bp, 1074 aa] {...    60   2e-08
ZYRO0G17094g Chr7 complement(1404552..1406804) [2253 bp, 750 aa]...    60   2e-08
Kwal_26.7276 s26 (293129..295069) [1941 bp, 646 aa] {ON} YJL106W...    59   2e-08
Suva_4.138 Chr4 (256421..257197) [777 bp, 258 aa] {ON} YDL108W (...    58   2e-08
ZYRO0A07062g Chr1 (576600..576615,576675..577561) [903 bp, 300 a...    58   2e-08
CAGL0E05720g Chr5 (569265..570341) [1077 bp, 358 aa] {ON} simila...    59   2e-08
Suva_4.87 Chr4 (160236..161810) [1575 bp, 524 aa] {ON} YDL159W (...    59   3e-08
NDAI0E02390 Chr5 complement(496256..498907) [2652 bp, 883 aa] {O...    59   3e-08
Skud_4.97 Chr4 (168099..169670) [1572 bp, 523 aa] {ON} YDL159W (...    59   3e-08
KAFR0B04630 Chr2 (964764..966302) [1539 bp, 512 aa] {ON} Anc_1.3...    59   3e-08
SAKL0H24706g Chr8 (2145552..2149100) [3549 bp, 1182 aa] {ON} sim...    59   3e-08
KNAG0J01670 Chr10 complement(304021..307050) [3030 bp, 1009 aa] ...    59   3e-08
ZYRO0G16632g Chr7 (1360854..1365827) [4974 bp, 1657 aa] {ON} hig...    60   3e-08
ACR196C Chr3 complement(692321..693913) [1593 bp, 530 aa] {ON} S...    59   3e-08
ZYRO0F08272g Chr6 (668685..670508) [1824 bp, 607 aa] {ON} simila...    59   3e-08
Smik_7.93 Chr7 complement(158441..160132) [1692 bp, 563 aa] {ON}...    59   3e-08
KNAG0A05920 Chr1 complement(883522..884742) [1221 bp, 406 aa] {O...    59   3e-08
Ecym_8004 Chr8 complement(5273..7957) [2685 bp, 894 aa] {ON} sim...    59   3e-08
Smik_3.94 Chr3 (128344..130155) [1812 bp, 603 aa] {ON} YCR008W (...    59   3e-08
YDL025C Chr4 complement(405344..407206) [1863 bp, 620 aa] {ON}  ...    59   3e-08
KLTH0G18612g Chr7 (1604066..1608640) [4575 bp, 1524 aa] {ON} sim...    59   3e-08
CAGL0B01925g Chr2 (176316..179150) [2835 bp, 944 aa] {ON} simila...    59   3e-08
ZYRO0G04488g Chr7 complement(360635..362545) [1911 bp, 636 aa] {...    59   3e-08
KNAG0C01820 Chr3 (355604..357376) [1773 bp, 590 aa] {ON}               59   4e-08
KLTH0B07106g Chr2 (571005..573260) [2256 bp, 751 aa] {ON} simila...    59   4e-08
ZYRO0A07546g Chr1 complement(619278..620747,620833..620847) [148...    59   4e-08
Ecym_8339 Chr8 (684113..686875) [2763 bp, 920 aa] {ON} similar t...    59   4e-08
NDAI0D01450 Chr4 (339780..341948) [2169 bp, 722 aa] {ON} Anc_1.507     59   4e-08
Suva_13.319 Chr13 (525309..526421) [1113 bp, 370 aa] {ON} YMR139...    58   4e-08
CAGL0M10829g Chr13 complement(1076233..1081236) [5004 bp, 1667 a...    59   4e-08
TPHA0L00500 Chr12 (83710..86589) [2880 bp, 959 aa] {ON} Anc_7.86...    59   4e-08
SAKL0G08250g Chr7 (703212..705707) [2496 bp, 831 aa] {ON} simila...    59   4e-08
Kwal_23.3590 s23 complement(353755..355254) [1500 bp, 499 aa] {O...    59   4e-08
KNAG0E01390 Chr5 (275055..276776) [1722 bp, 573 aa] {ON} Anc_1.4...    59   4e-08
Suva_7.106 Chr7 (202969..204540) [1572 bp, 523 aa] {ON} YGL158W ...    59   4e-08
Smik_4.157 Chr4 complement(289446..290605,290830..291250) [1581 ...    59   4e-08
Kpol_1041.29 s1041 (73725..74876) [1152 bp, 383 aa] {ON} (73725....    58   4e-08
KLLA0C03938g Chr3 complement(358851..360632) [1782 bp, 593 aa] {...    59   5e-08
Smik_15.415 Chr15 (722292..723815) [1524 bp, 507 aa] {ON} YOR231...    58   5e-08
TDEL0B01470 Chr2 complement(257397..259169) [1773 bp, 590 aa] {O...    59   5e-08
Skud_12.164 Chr12 (315700..319182) [3483 bp, 1160 aa] {ON} YLR09...    59   5e-08
SAKL0F11110g Chr6 (868447..869832) [1386 bp, 461 aa] {ON} simila...    58   5e-08
Smik_4.79 Chr4 (149246..150796) [1551 bp, 516 aa] {ON} YDL159W (...    58   5e-08
Skud_3.73 Chr3 (110742..112556) [1815 bp, 604 aa] {ON} YCR008W (...    58   5e-08
CAGL0K01661g Chr11 complement(147781..149229) [1449 bp, 482 aa] ...    58   5e-08
TBLA0C04600 Chr3 (1112043..1115990) [3948 bp, 1315 aa] {ON} Anc_...    59   5e-08
TPHA0G01730 Chr7 complement(355001..356779) [1779 bp, 592 aa] {O...    58   5e-08
KLTH0D11044g Chr4 complement(901388..903937) [2550 bp, 849 aa] {...    59   5e-08
YCR008W Chr3 (128470..130281) [1812 bp, 603 aa] {ON}  SAT4Ser/Th...    58   5e-08
Smik_12.155 Chr12 (312480..315968) [3489 bp, 1162 aa] {ON} YLR09...    59   5e-08
Suva_4.223 Chr4 complement(395869..397719) [1851 bp, 616 aa] {ON...    58   6e-08
TPHA0I00820 Chr9 (177222..179651) [2430 bp, 809 aa] {ON} Anc_1.2...    59   6e-08
KAFR0A04070 Chr1 complement(817388..819325) [1938 bp, 645 aa] {O...    58   6e-08
TDEL0B06160 Chr2 complement(1086672..1088327) [1656 bp, 551 aa] ...    58   6e-08
KLTH0F09988g Chr6 complement(868693..869931) [1239 bp, 412 aa] {...    58   6e-08
KLTH0H03982g Chr8 complement(363432..364628) [1197 bp, 398 aa] {...    57   6e-08
Kwal_33.14434 s33 complement(672031..674310) [2280 bp, 759 aa] {...    58   6e-08
SAKL0D05104g Chr4 (402641..404692) [2052 bp, 683 aa] {ON} simila...    58   6e-08
Kwal_33.13222 s33 (127342..127788) [447 bp, 148 aa] {OFF} YDR507...    54   6e-08
Skud_7.350 Chr7 (580913..582022) [1110 bp, 369 aa] {ON} YGR052W ...    57   6e-08
SAKL0E04950g Chr5 (401903..402994) [1092 bp, 363 aa] {ON} highly...    57   7e-08
YDL159W Chr4 (172481..174028) [1548 bp, 515 aa] {ON}  STE7Signal...    58   7e-08
TBLA0B07330 Chr2 complement(1745229..1746821,1746990..1747013) [...    58   7e-08
TDEL0E05310 Chr5 (972769..973893) [1125 bp, 374 aa] {ON} Anc_6.2...    57   7e-08
NCAS0A09570 Chr1 complement(1907017..1909200) [2184 bp, 727 aa] ...    58   7e-08
NCAS0B04490 Chr2 (814474..815523) [1050 bp, 349 aa] {ON} Anc_8.141     57   7e-08
Suva_3.33 Chr3 (42176..44020) [1845 bp, 614 aa] {ON} YCR008W (REAL)    58   7e-08
KAFR0F03970 Chr6 (777047..778201) [1155 bp, 384 aa] {ON} Anc_4.1...    57   8e-08
Kpol_530.41 s530 (94710..96326) [1617 bp, 538 aa] {ON} (94710..9...    58   8e-08
NCAS0A06000 Chr1 (1184842..1187133) [2292 bp, 763 aa] {ON} Anc_4...    58   8e-08
Ecym_4364 Chr4 (772870..773997) [1128 bp, 375 aa] {ON} similar t...    57   8e-08
KLLA0A06820g Chr1 complement(615686..618004) [2319 bp, 772 aa] {...    58   8e-08
TPHA0E02820 Chr5 complement(589816..590970) [1155 bp, 384 aa] {O...    57   8e-08
Skud_7.92 Chr7 complement(169006..170697) [1692 bp, 563 aa] {ON}...    58   8e-08
Suva_3.129 Chr3 (193311..194282) [972 bp, 323 aa] {ON} YCR091W (...    57   8e-08
CAGL0I05192g Chr9 complement(493635..494756) [1122 bp, 373 aa] {...    57   8e-08
ADR300C Chr4 complement(1222344..1225016) [2673 bp, 890 aa] {ON}...    58   8e-08
TBLA0C01320 Chr3 complement(289223..290626) [1404 bp, 467 aa] {O...    57   8e-08
Ecym_6425 Chr6 (825834..828095) [2262 bp, 753 aa] {ON} similar t...    58   9e-08
KAFR0K00280 Chr11 complement(64906..65988) [1083 bp, 360 aa] {ON...    57   9e-08
NCAS0C01110 Chr3 (207664..209664) [2001 bp, 666 aa] {ON} Anc_8.716     58   9e-08
NDAI0E01310 Chr5 complement(260484..262094) [1611 bp, 536 aa] {O...    57   9e-08
YMR139W Chr13 (546125..547237) [1113 bp, 370 aa] {ON}  RIM11Prot...    57   9e-08
Skud_4.225 Chr4 complement(400160..401992) [1833 bp, 610 aa] {ON...    57   9e-08
NCAS0B05910 Chr2 (1120092..1121645) [1554 bp, 517 aa] {ON} Anc_2...    57   9e-08
KNAG0D02140 Chr4 complement(362745..365357) [2613 bp, 870 aa] {O...    58   9e-08
TBLA0A03220 Chr1 complement(765108..768590) [3483 bp, 1160 aa] {...    58   1e-07
NDAI0D02970 Chr4 (701299..704058) [2760 bp, 919 aa] {ON} Anc_4.4...    58   1e-07
Suva_9.165 Chr9 complement(276469..277587) [1119 bp, 372 aa] {ON...    57   1e-07
TPHA0J00820 Chr10 (193408..197064) [3657 bp, 1218 aa] {ON} Anc_8...    58   1e-07
Kpol_1027.1 s1027 (1..2088) [2088 bp, 695 aa] {ON} (1..2088) [20...    57   1e-07
KNAG0C01040 Chr3 complement(203429..204976) [1548 bp, 515 aa] {O...    57   1e-07
KNAG0B04460 Chr2 (856495..859461) [2967 bp, 988 aa] {ON} Anc_5.3...    57   1e-07
Kwal_0.307 s0 (145676..147145) [1470 bp, 490 aa] {OFF} YCR008W (...    57   1e-07
YJL106W Chr10 (221390..223327) [1938 bp, 645 aa] {ON}  IME2Serin...    57   1e-07
Kwal_YGOB_0.307 s0 (145676..147175) [1500 bp, 500 aa] {ON} ANNOT...    57   1e-07
NDAI0J00420 Chr10 (73312..75606) [2295 bp, 764 aa] {ON} Anc_7.515      57   1e-07
YOR231W Chr15 (772601..774127) [1527 bp, 508 aa] {ON}  MKK1Mitog...    57   1e-07
NCAS0C02390 Chr3 complement(446642..448468) [1827 bp, 608 aa] {O...    57   1e-07
KLTH0H12650g Chr8 (1072961..1074592) [1632 bp, 543 aa] {ON} simi...    57   1e-07
Suva_16.170 Chr16 complement(296877..298406) [1530 bp, 509 aa] {...    57   1e-07
TBLA0B03990 Chr2 complement(910314..912455) [2142 bp, 713 aa] {O...    57   1e-07
Kwal_26.8703 s26 (905007..906341) [1335 bp, 444 aa] {ON} YOR231W...    57   1e-07
NCAS0I02060 Chr9 (386630..388573) [1944 bp, 647 aa] {ON} Anc_3.1...    57   1e-07
Suva_13.481 Chr13 (834531..836279) [1749 bp, 582 aa] {ON} YMR291...    57   1e-07
Smik_6.347 Chr6 complement(553316..556069) [2754 bp, 917 aa] {ON...    57   1e-07
Ecym_8337 Chr8 (679844..681460) [1617 bp, 538 aa] {ON} similar t...    57   1e-07
AEL185C Chr5 complement(291129..292676) [1548 bp, 515 aa] {ON} S...    57   1e-07
KAFR0C03020 Chr3 complement(601565..603121) [1557 bp, 518 aa] {O...    57   1e-07
KNAG0A05580 Chr1 (830643..831560) [918 bp, 305 aa] {ON} Anc_2.33...    56   1e-07
Kpol_1041.9 s1041 (27806..29059) [1254 bp, 417 aa] {ON} (27806.....    57   1e-07
Smik_4.209 Chr4 complement(385530..386995,387230..387623) [1860 ...    57   1e-07
ZYRO0D04752g Chr4 complement(397364..398215,398290..398907) [147...    57   1e-07
Kwal_56.24584 s56 complement(1063271..1064578) [1308 bp, 435 aa]...    57   1e-07
CAGL0J03828g Chr10 (365325..366728) [1404 bp, 467 aa] {ON} simil...    57   1e-07
Kwal_47.17868 s47 (587449..588546) [1098 bp, 365 aa] {ON} YMR139...    56   1e-07
Smik_10.132 Chr10 (212933..214873) [1941 bp, 646 aa] {ON} YJL106...    57   2e-07
ACL053C Chr3 complement(273163..276708) [3546 bp, 1181 aa] {ON} ...    57   2e-07
KAFR0B01510 Chr2 complement(284425..286092) [1668 bp, 555 aa] {O...    57   2e-07
KLLA0E14785g Chr5 complement(1323743..1324675) [933 bp, 310 aa] ...    56   2e-07
SAKL0E06534g Chr5 complement(533369..534267,534334..534358) [924...    55   2e-07
TPHA0F02870 Chr6 complement(636574..638259) [1686 bp, 561 aa] {O...    57   2e-07
Skud_13.465 Chr13 (826172..827929) [1758 bp, 585 aa] {ON} YMR291...    57   2e-07
Suva_10.345 Chr10 (601536..603365) [1830 bp, 609 aa] {ON} YLR248...    57   2e-07
KLTH0H11858g Chr8 (1013677..1015374) [1698 bp, 565 aa] {ON} some...    57   2e-07
TDEL0E02510 Chr5 (486415..489156) [2742 bp, 913 aa] {ON} Anc_5.3...    57   2e-07
ZYRO0A05192g Chr1 complement(416951..418198) [1248 bp, 415 aa] {...    56   2e-07
SAKL0H07128g Chr8 complement(623681..625141) [1461 bp, 486 aa] {...    56   2e-07
Ecym_6136 Chr6 complement(248721..250187) [1467 bp, 488 aa] {ON}...    56   2e-07
KAFR0A02560 Chr1 complement(532248..533351) [1104 bp, 367 aa] {O...    56   2e-07
Kpol_487.14 s487 complement(56520..58394) [1875 bp, 624 aa] {ON}...    57   2e-07
TPHA0H01500 Chr8 complement(336652..339639) [2988 bp, 995 aa] {O...    57   2e-07
Ecym_6359 Chr6 complement(699564..702176) [2613 bp, 870 aa] {ON}...    57   2e-07
Kpol_1044.26 s1044 complement(60216..62666) [2451 bp, 816 aa] {O...    57   2e-07
NCAS0A04010 Chr1 complement(809163..810299) [1137 bp, 378 aa] {O...    56   2e-07
KAFR0D04800 Chr4 complement(942369..944690) [2322 bp, 773 aa] {O...    57   2e-07
Ecym_5252 Chr5 (525687..526976) [1290 bp, 429 aa] {ON} similar t...    56   2e-07
TDEL0G02820 Chr7 complement(543911..545377,545450..545476) [1494...    56   2e-07
KLLA0E17073g Chr5 complement(1515721..1518279) [2559 bp, 852 aa]...    57   2e-07
Kpol_1037.7 s1037 (15938..17182) [1245 bp, 414 aa] {ON} (15938.....    56   2e-07
TPHA0G00730 Chr7 (139442..141364) [1923 bp, 640 aa] {ON} Anc_8.7...    57   2e-07
KAFR0H02510 Chr8 complement(476574..479213) [2640 bp, 879 aa] {O...    57   2e-07
Skud_9.134 Chr9 complement(256610..257728) [1119 bp, 372 aa] {ON...    56   2e-07
Kpol_1066.46 s1066 (82874..86551) [3678 bp, 1225 aa] {ON} (82874...    57   2e-07
KAFR0A07560 Chr1 (1525225..1527504) [2280 bp, 759 aa] {ON} Anc_2...    57   2e-07
Smik_6.136 Chr6 (219577..220686) [1110 bp, 369 aa] {ON} YGR052W ...    55   2e-07
Smik_13.507 Chr13 (835298..837058) [1761 bp, 586 aa] {ON} YMR291...    56   2e-07
KAFR0A00840 Chr1 complement(151896..152894) [999 bp, 332 aa] {ON...    55   2e-07
NDAI0C03610 Chr3 (829317..831476) [2160 bp, 719 aa] {ON} Anc_5.38      56   2e-07
YIL035C Chr9 complement(287790..288908) [1119 bp, 372 aa] {ON}  ...    55   2e-07
KNAG0H03140 Chr8 complement(589553..592363) [2811 bp, 936 aa] {O...    56   2e-07
Smik_13.338 Chr13 (528578..529690) [1113 bp, 370 aa] {ON} YMR139...    55   3e-07
Kwal_33.14081 s33 complement(519343..521085) [1743 bp, 580 aa] {...    56   3e-07
TDEL0D01220 Chr4 complement(228529..230451) [1923 bp, 640 aa] {O...    56   3e-07
KLLA0A09713g Chr1 (851952..853625) [1674 bp, 557 aa] {ON} simila...    56   3e-07
Suva_4.168 Chr4 complement(302527..303654) [1128 bp, 375 aa] {ON...    55   3e-07
NDAI0A02720 Chr1 complement(612346..613455) [1110 bp, 369 aa] {O...    55   3e-07
KLLA0D08415g Chr4 (714473..716797) [2325 bp, 774 aa] {ON} simila...    56   3e-07
KAFR0A03710 Chr1 (758918..760399) [1482 bp, 493 aa] {ON} Anc_8.6...    55   3e-07
CAGL0I03498g Chr9 (297344..298699) [1356 bp, 451 aa] {ON} simila...    55   3e-07
Kpol_1072.31 s1072 complement(67104..68684) [1581 bp, 526 aa] {O...    55   3e-07
TBLA0E02460 Chr5 (620609..621745) [1137 bp, 378 aa] {ON} Anc_7.2...    55   3e-07
NCAS0C01580 Chr3 (291554..292873) [1320 bp, 439 aa] {ON} Anc_8.652     55   3e-07
Ecym_2302 Chr2 (587299..588951) [1653 bp, 550 aa] {ON} similar t...    55   4e-07
ADL043C Chr4 complement(612088..614109) [2022 bp, 673 aa] {ON} S...    55   4e-07
Kwal_YGOB_23.3471 s23 (305207..305234,305298..306196) [927 bp, 3...    54   4e-07
Suva_6.182 Chr6 complement(328699..330642) [1944 bp, 647 aa] {ON...    55   4e-07
Skud_12.48 Chr12 complement(97218..99422) [2205 bp, 734 aa] {ON}...    55   4e-07
KLTH0H01584g Chr8 (143065..144453) [1389 bp, 462 aa] {ON} simila...    55   4e-07
CAGL0G04455g Chr7 (426386..428641) [2256 bp, 751 aa] {ON} simila...    55   4e-07
AAL029W Chr1 (289989..291593) [1605 bp, 534 aa] {ON} Syntenic ho...    55   4e-07
SAKL0H24288g Chr8 (2099353..2101317) [1965 bp, 654 aa] {ON} simi...    55   4e-07
Smik_6.338 Chr6 (535192..536727) [1536 bp, 511 aa] {ON} YPL140C ...    55   4e-07
ADL102C Chr4 complement(503667..504785) [1119 bp, 372 aa] {ON} S...    55   4e-07
TPHA0D01770 Chr4 (365255..370279) [5025 bp, 1674 aa] {ON} Anc_5....    56   4e-07
YPL140C Chr16 complement(287514..289034) [1521 bp, 506 aa] {ON} ...    55   4e-07
KAFR0B02800 Chr2 (571295..574582) [3288 bp, 1095 aa] {ON} Anc_8....    55   4e-07
TPHA0H00750 Chr8 complement(150811..152043) [1233 bp, 410 aa] {O...    55   4e-07
Kpol_1064.31 s1064 complement(52651..54350) [1700 bp, 566.666666...    55   4e-07
YMR291W Chr13 (852630..854390) [1761 bp, 586 aa] {ON}  TDA1Prote...    55   4e-07
KAFR0C05130 Chr3 (1018035..1019402) [1368 bp, 455 aa] {ON} Anc_7...    55   4e-07
ZYRO0D06776g Chr4 complement(583027..586641) [3615 bp, 1204 aa] ...    55   4e-07
Kpol_YGOB_1064.31 s1064 complement(52620..54350) [1731 bp, 577 a...    55   4e-07
KLTH0D10670g Chr4 (877472..878806) [1335 bp, 444 aa] {ON} some s...    55   4e-07
Skud_16.141 Chr16 complement(259166..260707) [1542 bp, 513 aa] {...    55   5e-07
Kwal_14.1159 s14 complement(219896..224461) [4566 bp, 1521 aa] {...    55   5e-07
Ecym_3371 Chr3 (706573..706597,706675..707570) [921 bp, 306 aa] ...    54   5e-07
TDEL0D04450 Chr4 complement(811665..812924) [1260 bp, 419 aa] {O...    55   5e-07
TPHA0O01080 Chr15 complement(205407..207653) [2247 bp, 748 aa] {...    55   5e-07
Suva_10.180 Chr10 (337364..340843) [3480 bp, 1159 aa] {ON} YLR09...    55   5e-07
KAFR0F02730 Chr6 (537477..539309) [1833 bp, 610 aa] {ON} Anc_4.4...    55   5e-07
KAFR0B03170 Chr2 complement(656163..658025) [1863 bp, 620 aa] {O...    55   5e-07
TDEL0H04100 Chr8 complement(706443..707306,707369..707974) [1470...    55   5e-07
Skud_10.107 Chr10 (189314..191254) [1941 bp, 646 aa] {ON} YJL106...    55   5e-07
YLR248W Chr12 (634252..636084) [1833 bp, 610 aa] {ON}  RCK2Prote...    55   5e-07
TBLA0D03740 Chr4 complement(926538..929057) [2520 bp, 839 aa] {O...    55   6e-07
TPHA0G02090 Chr7 complement(429178..430527) [1350 bp, 449 aa] {O...    55   6e-07
Kpol_1063.4 s1063 complement(10790..11932) [1143 bp, 380 aa] {ON...    54   6e-07
YGL158W Chr7 (207033..208571) [1539 bp, 512 aa] {ON}  RCK1Protei...    55   6e-07
ADR253W Chr4 (1141941..1143083) [1143 bp, 380 aa] {ON} Syntenic ...    54   6e-07
SAKL0H16632g Chr8 complement(1461613..1464801) [3189 bp, 1062 aa...    55   6e-07
Kwal_47.18098 s47 (685497..686621) [1125 bp, 374 aa] {ON} YIL035...    54   6e-07
KAFR0B05410 Chr2 complement(1111152..1112771) [1620 bp, 539 aa] ...    55   6e-07
TBLA0H01820 Chr8 (429920..433417) [3498 bp, 1165 aa] {ON} Anc_5....    55   6e-07
CAGL0D06600g Chr4 (626571..628748) [2178 bp, 725 aa] {ON} simila...    55   6e-07
Skud_13.300 Chr13 (519521..520633) [1113 bp, 370 aa] {ON} YMR139...    54   6e-07
Skud_12.329 Chr12 (580813..582645) [1833 bp, 610 aa] {ON} YLR248...    55   6e-07
CAGL0I08349g Chr9 complement(813998..816001) [2004 bp, 667 aa] {...    55   6e-07
ABL143C Chr2 complement(128215..130392) [2178 bp, 725 aa] {ON} S...    55   6e-07
NCAS0B05090 Chr2 (946126..949758) [3633 bp, 1210 aa] {ON}              55   7e-07
NCAS0I01210 Chr9 complement(218242..222582) [4341 bp, 1446 aa] {...    55   7e-07
Suva_11.178 Chr11 complement(330253..332184) [1932 bp, 643 aa] {...    55   7e-07
KAFR0F00380 Chr6 complement(91358..92800) [1443 bp, 480 aa] {ON}...    54   7e-07
Ecym_1508 Chr1 (1045857..1050941) [5085 bp, 1694 aa] {ON} simila...    55   7e-07
KAFR0I02100 Chr9 (431876..433258) [1383 bp, 460 aa] {ON} Anc_1.3...    54   7e-07
TBLA0B09740 Chr2 (2312062..2314815) [2754 bp, 917 aa] {ON} Anc_2...    55   7e-07
CAGL0L06820g Chr12 (769035..770135) [1101 bp, 366 aa] {ON} highl...    54   8e-07
YLR096W Chr12 (332590..336033) [3444 bp, 1147 aa] {ON}  KIN2Seri...    55   8e-07
NCAS0A08610 Chr1 complement(1700839..1702704) [1866 bp, 621 aa] ...    54   8e-07
SAKL0F07854g Chr6 (600324..601442) [1119 bp, 372 aa] {ON} highly...    54   8e-07
ZYRO0E05170g Chr5 complement(390866..392593) [1728 bp, 575 aa] {...    54   8e-07
TBLA0B01990 Chr2 complement(458264..461623) [3360 bp, 1119 aa] {...    55   8e-07
CAGL0J11308g Chr10 (1099969..1102155) [2187 bp, 728 aa] {ON} sim...    55   8e-07
AFR076W Chr6 (564252..566714) [2463 bp, 820 aa] {ON} Syntenic ho...    55   8e-07
TBLA0D01200 Chr4 (303528..305198) [1671 bp, 556 aa] {ON} Anc_8.7...    54   8e-07
Suva_10.55 Chr10 complement(110943..113177) [2235 bp, 744 aa] {O...    55   8e-07
NCAS0A13320 Chr1 (2622149..2623258) [1110 bp, 369 aa] {ON}             54   8e-07
YLL019C Chr12 complement(105686..107899) [2214 bp, 737 aa] {ON} ...    54   9e-07
NDAI0G03110 Chr7 complement(725984..731107) [5124 bp, 1707 aa] {...    55   9e-07
Skud_16.132 Chr16 (239797..242571) [2775 bp, 924 aa] {ON} YPL150...    55   9e-07
KLLA0F22297g Chr6 complement(2083448..2085547) [2100 bp, 699 aa]...    54   9e-07
TDEL0C02110 Chr3 (364853..366340) [1488 bp, 495 aa] {ON} Anc_7.3...    54   9e-07
Smik_9.156 Chr9 complement(261998..263116) [1119 bp, 372 aa] {ON...    54   9e-07
TBLA0B10030 Chr2 (2399979..2402123) [2145 bp, 714 aa] {ON} Anc_4...    54   9e-07
CAGL0D02244g Chr4 complement(229504..230967) [1464 bp, 487 aa] {...    54   9e-07
TBLA0D04420 Chr4 complement(1097314..1099356) [2043 bp, 680 aa] ...    54   9e-07
KLTH0F03916g Chr6 complement(348177..350282) [2106 bp, 701 aa] {...    54   9e-07
NDAI0H00610 Chr8 complement(141913..143022) [1110 bp, 369 aa] {O...    54   1e-06
Skud_15.519 Chr15 complement(932720..934216) [1497 bp, 498 aa] {...    54   1e-06
Smik_12.44 Chr12 complement(92046..94262) [2217 bp, 738 aa] {ON}...    54   1e-06
NDAI0B02500 Chr2 (625206..629036) [3831 bp, 1276 aa] {ON} Anc_8....    54   1e-06
Ecym_8380 Chr8 (772519..774573) [2055 bp, 684 aa] {ON} similar t...    54   1e-06
KLLA0C10802g Chr3 complement(926916..931934) [5019 bp, 1672 aa] ...    55   1e-06
AFL143C Chr6 complement(164241..165326) [1086 bp, 361 aa] {ON} S...    54   1e-06
CAGL0F03707g Chr6 complement(359839..361665) [1827 bp, 608 aa] {...    54   1e-06
AEL179W Chr5 (302948..303817) [870 bp, 289 aa] {ON} NOHBY510; No...    53   1e-06
NCAS0G01820 Chr7 complement(323288..325690) [2403 bp, 800 aa] {O...    54   1e-06
AGR334W Chr7 (1355098..1356693) [1596 bp, 531 aa] {ON} Syntenic ...    54   1e-06
ADR379C Chr4 complement(1386598..1388076) [1479 bp, 492 aa] {ON}...    54   1e-06
TPHA0B02780 Chr2 complement(633307..634449) [1143 bp, 380 aa] {O...    54   1e-06
Skud_11.20 Chr11 complement(51603..53558) [1956 bp, 651 aa] {ON}...    54   1e-06
CAGL0K04301g Chr11 (405248..406315) [1068 bp, 355 aa] {ON} simil...    53   1e-06
CAGL0K12562g Chr11 (1235695..1240743) [5049 bp, 1682 aa] {ON} si...    54   1e-06
SAKL0E12958g Chr5 (1066434..1068653) [2220 bp, 739 aa] {ON} simi...    54   1e-06
KLTH0F17490g Chr6 (1413752..1414774) [1023 bp, 340 aa] {ON} high...    53   1e-06
Kwal_33.13681 s33 complement(350547..352694) [2148 bp, 715 aa] {...    54   1e-06
TBLA0A09370 Chr1 complement(2310412..2311443) [1032 bp, 343 aa] ...    53   1e-06
Ecym_7206 Chr7 complement(423402..425576) [2175 bp, 724 aa] {ON}...    54   1e-06
KAFR0D03100 Chr4 complement(610106..611635) [1530 bp, 509 aa] {O...    54   1e-06
KNAG0I00590 Chr9 (100275..102068) [1794 bp, 597 aa] {ON}               54   1e-06
NCAS0C03770 Chr3 complement(761101..765897) [4797 bp, 1598 aa] {...    54   1e-06
KNAG0C03830 Chr3 (751393..752877) [1485 bp, 494 aa] {ON} Anc_7.3...    54   1e-06
KAFR0H01570 Chr8 complement(290698..291897) [1200 bp, 399 aa] {O...    53   1e-06
Skud_15.432 Chr15 complement(761490..763601) [2112 bp, 703 aa] {...    54   1e-06
ADL283W Chr4 (205173..205197,205250..206145) [921 bp, 306 aa] {O...    53   1e-06
ZYRO0F12122g Chr6 complement(984069..985910) [1842 bp, 613 aa] {...    54   1e-06
KLLA0E11947g Chr5 complement(1060048..1061892) [1845 bp, 614 aa]...    54   1e-06
TDEL0D04560 Chr4 (835822..837885) [2064 bp, 687 aa] {ON} Anc_3.1...    54   1e-06
TDEL0E03300 Chr5 complement(621448..626409) [4962 bp, 1653 aa] {...    54   1e-06
TDEL0B02610 Chr2 complement(470263..471282) [1020 bp, 339 aa] {O...    53   2e-06
SAKL0C07458g Chr3 complement(687452..689395) [1944 bp, 647 aa] {...    54   2e-06
Kwal_55.21709 s55 (948619..949641) [1023 bp, 340 aa] {ON} YOR061...    53   2e-06
Suva_8.405 Chr8 complement(730738..732348) [1611 bp, 536 aa] {ON...    53   2e-06
TBLA0D02070 Chr4 complement(522456..523958) [1503 bp, 500 aa] {O...    53   2e-06
KAFR0K01310 Chr11 (270172..271191) [1020 bp, 339 aa] {ON} Anc_5....    53   2e-06
SAKL0G00990g Chr7 complement(89700..90824) [1125 bp, 374 aa] {ON...    53   2e-06
KLLA0E04247g Chr5 (382874..383995) [1122 bp, 373 aa] {ON} simila...    53   2e-06
NDAI0A01970 Chr1 (440268..442184) [1917 bp, 638 aa] {ON} Anc_7.335     54   2e-06
TDEL0H02380 Chr8 complement(399810..400931) [1122 bp, 373 aa] {O...    53   2e-06
Smik_6.414 Chr6 (666806..667909) [1104 bp, 367 aa] {ON} YPL209C ...    53   2e-06
KLTH0D01386g Chr4 (129448..130053,130132..130974) [1449 bp, 482 ...    53   2e-06
TDEL0A06610 Chr1 complement(1151052..1152824) [1773 bp, 590 aa] ...    53   2e-06
KNAG0B00260 Chr2 complement(36240..38477) [2238 bp, 745 aa] {ON}...    53   2e-06
ZYRO0A08448g Chr1 complement(677122..678225) [1104 bp, 367 aa] {...    53   2e-06
TPHA0O01620 Chr15 (321912..324359) [2448 bp, 815 aa] {ON} Anc_2....    54   2e-06
Kpol_1056.20 s1056 complement(44529..46724) [2196 bp, 731 aa] {O...    53   2e-06
TDEL0F04060 Chr6 (749896..753276) [3381 bp, 1126 aa] {ON} Anc_8....    54   2e-06
Kwal_47.17345 s47 complement(364905..367004) [2100 bp, 699 aa] {...    53   2e-06
NDAI0G05190 Chr7 complement(1258638..1260452) [1815 bp, 604 aa] ...    53   2e-06
TBLA0B06940 Chr2 (1639189..1643520) [4332 bp, 1443 aa] {ON} Anc_...    54   2e-06
CAGL0M11396g Chr13 (1122109..1125687) [3579 bp, 1192 aa] {ON} si...    54   2e-06
NDAI0F03390 Chr6 (816047..818380) [2334 bp, 777 aa] {ON}               53   2e-06
TBLA0B03590 Chr2 (834488..837022) [2535 bp, 844 aa] {ON} Anc_8.7...    53   2e-06
Suva_11.24 Chr11 complement(52742..52930,52961..54523) [1752 bp,...    53   3e-06
Ecym_4773 Chr4 complement(1504949..1506541) [1593 bp, 530 aa] {O...    53   3e-06
Kpol_1014.8 s1014 (13007..14368) [1362 bp, 453 aa] {ON} (13007.....    52   3e-06
NDAI0H03740 Chr8 (912611..915373) [2763 bp, 920 aa] {ON} Anc_2.71      53   3e-06
KAFR0I01570 Chr9 (330982..332574) [1593 bp, 530 aa] {ON} Anc_2.5...    52   3e-06
Ecym_4056 Chr4 complement(119406..120428) [1023 bp, 340 aa] {ON}...    52   3e-06
Skud_4.176 Chr4 complement(308461..309594) [1134 bp, 377 aa] {ON...    52   3e-06
NDAI0B02070 Chr2 (514024..517800) [3777 bp, 1258 aa] {ON}              53   3e-06
ABR177C Chr2 complement(735829..738090) [2262 bp, 753 aa] {ON} S...    53   3e-06
NCAS0G00490 Chr7 complement(83953..84996) [1044 bp, 347 aa] {ON}...    52   3e-06
ZYRO0B00638g Chr2 (42738..44930) [2193 bp, 730 aa] {ON} similar ...    53   3e-06
TDEL0F01550 Chr6 (282677..284839) [2163 bp, 720 aa] {ON} Anc_4.4...    53   3e-06
NCAS0A02180 Chr1 (410419..411489) [1071 bp, 356 aa] {ON} Anc_4.192     52   3e-06
CAGL0F03311g Chr6 complement(327599..330736) [3138 bp, 1045 aa] ...    53   3e-06
Kwal_55.21900 s55 complement(1027253..1029130) [1878 bp, 625 aa]...    53   3e-06
Ecym_4291 Chr4 complement(620549..623986) [3438 bp, 1145 aa] {ON...    53   3e-06
NCAS0A15040 Chr1 complement(2962030..2964036) [2007 bp, 668 aa] ...    53   3e-06
TPHA0H01300 Chr8 (293254..294282) [1029 bp, 342 aa] {ON} Anc_5.6...    52   3e-06
ZYRO0D16170g Chr4 (1348849..1349982) [1134 bp, 377 aa] {ON} high...    52   3e-06
TPHA0N01450 Chr14 complement(318088..320340) [2253 bp, 750 aa] {...    53   3e-06
Kpol_1002.21 s1002 complement(62702..63895) [1194 bp, 397 aa] {O...    52   3e-06
KLTH0A03542g Chr1 (306667..307803) [1137 bp, 378 aa] {ON} highly...    52   3e-06
ABR088C Chr2 complement(546325..547920) [1596 bp, 531 aa] {ON} S...    52   3e-06
KLLA0F19536g Chr6 (1808263..1811577) [3315 bp, 1104 aa] {ON} sim...    53   3e-06
NCAS0F02520 Chr6 (495799..500631) [4833 bp, 1610 aa] {ON} Anc_5....    53   4e-06
KLLA0C14278g Chr3 (1240990..1242615) [1626 bp, 541 aa] {ON} simi...    52   4e-06
SAKL0H01364g Chr8 complement(143450..145141) [1692 bp, 563 aa] {...    52   4e-06
Kpol_185.2 s185 complement(1614..3704) [2091 bp, 696 aa] {ON} co...    52   4e-06
Ecym_6056 Chr6 complement(107449..108888) [1440 bp, 479 aa] {ON}...    52   4e-06
Skud_4.237 Chr4 (418979..420502) [1524 bp, 507 aa] {ON} YDL017W ...    52   4e-06
YKL048C Chr11 complement(347214..349136) [1923 bp, 640 aa] {ON} ...    52   4e-06
KLLA0B06501g Chr2 complement(576636..579089) [2454 bp, 817 aa] {...    52   4e-06
Kpol_489.20 s489 complement(59150..60178) [1029 bp, 342 aa] {ON}...    52   4e-06
Kwal_14.1273 s14 complement(259953..261200) [1248 bp, 415 aa] {O...    52   4e-06
NCAS0E02230 Chr5 (429499..430176,430250..431104) [1533 bp, 510 a...    52   4e-06
ACR117W Chr3 (557738..559312) [1575 bp, 524 aa] {ON} Syntenic ho...    52   4e-06
Smik_15.241 Chr15 (407598..408617) [1020 bp, 339 aa] {ON} YOR061...    51   5e-06
YOR061W Chr15 (441534..442553) [1020 bp, 339 aa] {ON}  CKA2Alpha...    51   5e-06
KLLA0C07535g Chr3 (658746..660620) [1875 bp, 624 aa] {ON} some s...    52   5e-06
NDAI0E00960 Chr5 (195116..197251) [2136 bp, 711 aa] {ON} Anc_8.716     52   5e-06
KLLA0F17006g Chr6 complement(1561859..1563106) [1248 bp, 415 aa]...    52   5e-06
KAFR0E01490 Chr5 (298209..303167) [4959 bp, 1652 aa] {ON} Anc_5....    52   5e-06
KNAG0D04040 Chr4 (730581..731897) [1317 bp, 438 aa] {ON} Anc_4.1...    52   5e-06
NDAI0C04000 Chr3 (907842..912812) [4971 bp, 1656 aa] {ON} Anc_5....    52   5e-06
KLTH0E07128g Chr5 complement(657986..660064) [2079 bp, 692 aa] {...    52   5e-06
Skud_15.228 Chr15 (403382..404401) [1020 bp, 339 aa] {ON} YOR061...    51   5e-06
Smik_12.321 Chr12 (579087..580919) [1833 bp, 610 aa] {ON} YLR248...    52   5e-06
CAGL0M02299g Chr13 (273725..276406) [2682 bp, 893 aa] {ON} simil...    52   5e-06
KNAG0K01660 Chr11 complement(345808..347331) [1524 bp, 507 aa] {...    52   5e-06
Skud_11.113 Chr11 complement(207796..209355) [1560 bp, 519 aa] {...    52   5e-06
ZYRO0C09768g Chr3 (740592..742925) [2334 bp, 777 aa] {ON} simila...    52   5e-06
KNAG0L01860 Chr12 (336795..337817) [1023 bp, 340 aa] {ON} Anc_5....    51   5e-06
KLLA0D12100g Chr4 complement(1031728..1033161) [1434 bp, 477 aa]...    52   6e-06
NCAS0E01560 Chr5 (294095..295345) [1251 bp, 416 aa] {ON}               51   6e-06
CAGL0G02035g Chr7 (179911..180930) [1020 bp, 339 aa] {ON} highly...    51   6e-06
NDAI0C05160 Chr3 (1199533..1201026) [1494 bp, 497 aa] {ON} Anc_8...    51   6e-06
SAKL0B01210g Chr2 complement(109892..114658) [4767 bp, 1588 aa] ...    52   6e-06
KLTH0F06578g Chr6 complement(568519..570309) [1791 bp, 596 aa] {...    52   6e-06
TDEL0E02600 Chr5 (501545..504934) [3390 bp, 1129 aa] {ON} Anc_5....    52   7e-06
AFR372W Chr6 (1109169..1111493) [2325 bp, 774 aa] {ON} Syntenic ...    52   7e-06
NDAI0G01760 Chr7 (384420..385700) [1281 bp, 426 aa] {ON}               51   7e-06
Skud_16.70 Chr16 complement(129918..131021) [1104 bp, 367 aa] {O...    51   7e-06
TPHA0L01240 Chr12 (263357..264814) [1458 bp, 485 aa] {ON} Anc_8....    51   8e-06
KNAG0F01240 Chr6 complement(223003..225591) [2589 bp, 862 aa] {O...    52   8e-06
Ecym_8399 Chr8 (821221..824766) [3546 bp, 1181 aa] {ON} similar ...    52   8e-06
KNAG0I03000 Chr9 (596789..598840) [2052 bp, 683 aa] {ON} Anc_4.4...    51   8e-06
Kwal_33.14192 s33 complement(563582..565315) [1734 bp, 577 aa] {...    51   8e-06
KAFR0B00520 Chr2 (105553..107502) [1950 bp, 649 aa] {ON} Anc_4.1...    51   8e-06
ZYRO0A05060g Chr1 complement(405402..406886) [1485 bp, 494 aa] {...    51   8e-06
AGR058W Chr7 (823626..826841) [3216 bp, 1071 aa] {ON} Syntenic h...    51   9e-06
Kpol_1013.52 s1013 (123332..125881) [2550 bp, 849 aa] {ON} (1233...    51   9e-06
Smik_11.24 Chr11 complement(52600..54522) [1923 bp, 640 aa] {ON}...    51   9e-06
KNAG0J01950 Chr10 complement(352815..354317) [1503 bp, 500 aa] {...    51   9e-06
SAKL0H11748g Chr8 complement(1002207..1003541) [1335 bp, 444 aa]...    51   9e-06
TDEL0A01120 Chr1 complement(189217..191466) [2250 bp, 749 aa] {O...    51   9e-06
TBLA0G00820 Chr7 complement(191559..192833) [1275 bp, 424 aa] {O...    51   9e-06
KLTH0G13288g Chr7 complement(1139058..1142486) [3429 bp, 1142 aa...    51   9e-06
KNAG0F03410 Chr6 (640115..645094) [4980 bp, 1659 aa] {ON}              51   1e-05
KNAG0C02250 Chr3 complement(444156..446639) [2484 bp, 827 aa] {O...    51   1e-05
Kwal_56.23717 s56 complement(674222..676798) [2577 bp, 858 aa] {...    51   1e-05
CAGL0F03245g Chr6 complement(316924..320034) [3111 bp, 1036 aa] ...    51   1e-05
CAGL0I04422g Chr9 (394159..395427) [1269 bp, 422 aa] {ON} some s...    50   1e-05
YNL183C Chr14 complement(293137..295509) [2373 bp, 790 aa] {ON} ...    51   1e-05
Smik_4.218 Chr4 (406174..407697) [1524 bp, 507 aa] {ON} YDL017W ...    51   1e-05
NCAS0B00420 Chr2 complement(54562..56718) [2157 bp, 718 aa] {ON}...    51   1e-05
Ecym_5241 Chr5 complement(495748..497586) [1839 bp, 612 aa] {ON}...    51   1e-05
TDEL0B06900 Chr2 complement(1220590..1222257) [1668 bp, 555 aa] ...    51   1e-05
SAKL0H05588g Chr8 (502752..504602) [1851 bp, 616 aa] {ON} simila...    51   1e-05
NDAI0A07790 Chr1 (1790683..1795206) [4524 bp, 1507 aa] {ON} Anc_...    51   1e-05
NCAS0C05490 Chr3 (1114733..1115755) [1023 bp, 340 aa] {ON} Anc_5...    50   1e-05
TPHA0I03100 Chr9 complement(681645..683666) [2022 bp, 673 aa] {O...    51   1e-05
YPR161C Chr16 complement(864449..866422) [1974 bp, 657 aa] {ON} ...    51   1e-05
KLTH0G18194g Chr7 (1570885..1572132) [1248 bp, 415 aa] {ON} weak...    50   1e-05
TBLA0B01650 Chr2 (370837..372306) [1470 bp, 489 aa] {ON} Anc_3.1...    50   1e-05
Smik_11.200 Chr11 complement(333676..335592) [1917 bp, 638 aa] {...    51   1e-05
KNAG0H02860 Chr8 (531728..532843) [1116 bp, 371 aa] {ON}               50   1e-05
YDL017W Chr4 (424209..425732) [1524 bp, 507 aa] {ON}  CDC7DDK (D...    50   1e-05
Suva_14.158 Chr14 complement(289281..291650) [2370 bp, 789 aa] {...    51   1e-05
Suva_8.316 Chr8 complement(561812..563914) [2103 bp, 700 aa] {ON...    50   1e-05
ZYRO0B16038g Chr2 (1300484..1301515) [1032 bp, 343 aa] {ON} high...    50   1e-05
KLTH0F18458g Chr6 complement(1491777..1493663) [1887 bp, 628 aa]...    50   1e-05
KLLA0A02717g Chr1 (245082..246380) [1299 bp, 432 aa] {ON} weakly...    50   1e-05
NCAS0F02410 Chr6 complement(476683..478071) [1389 bp, 462 aa] {O...    50   1e-05
Skud_7.114 Chr7 (211645..213153) [1509 bp, 502 aa] {ON} YGL158W ...    50   1e-05
Smik_15.535 Chr15 complement(940569..942050) [1482 bp, 493 aa] {...    50   1e-05
NDAI0H02930 Chr8 (715278..716846) [1569 bp, 522 aa] {ON} Anc_2.391     50   1e-05
SAKL0B11044g Chr2 complement(962142..962940,963019..963086,96315...    50   1e-05
YKL198C Chr11 complement(68232..70220) [1989 bp, 662 aa] {ON}  P...    50   1e-05
Kpol_1031.67 s1031 (174170..175663) [1494 bp, 497 aa] {ON} (1741...    50   1e-05
Skud_1.73 Chr1 (144821..146128) [1308 bp, 435 aa] {ON} YAR018C (...    50   1e-05
CAGL0H01199g Chr8 (110610..115556) [4947 bp, 1648 aa] {ON} highl...    51   1e-05
Smik_1.78 Chr1 complement(147996..149303) [1308 bp, 435 aa] {ON}...    50   1e-05
ZYRO0C12078g Chr3 (946320..948647) [2328 bp, 775 aa] {ON} simila...    50   2e-05
Kpol_1033.63 s1033 complement(158652..160205) [1554 bp, 517 aa] ...    50   2e-05
Smik_7.115 Chr7 (201140..202663) [1524 bp, 507 aa] {ON} YGL158W ...    50   2e-05
Smik_15.449 Chr15 complement(772245..774437) [2193 bp, 730 aa] {...    50   2e-05
CAGL0K11550g Chr11 (1118971..1120587) [1617 bp, 538 aa] {ON} sim...    50   2e-05
Suva_8.111 Chr8 (204414..205433) [1020 bp, 339 aa] {ON} YOR061W ...    50   2e-05
NDAI0A04760 Chr1 complement(1088637..1090103) [1467 bp, 488 aa] ...    50   2e-05
KNAG0E03200 Chr5 complement(641437..646020) [4584 bp, 1527 aa] {...    50   2e-05
Suva_1.84 Chr1 complement(148430..149737) [1308 bp, 435 aa] {ON}...    50   2e-05
TBLA0C03180 Chr3 complement(770462..775468) [5007 bp, 1668 aa] {...    50   2e-05
NDAI0F00560 Chr6 complement(128674..129717) [1044 bp, 347 aa] {O...    49   2e-05
Kpol_1035.40 s1035 (101912..102910,102960..102968,103011..106556...    50   2e-05
KLLA0F23507g Chr6 complement(2198603..2200066) [1464 bp, 487 aa]...    50   2e-05
NCAS0A08770 Chr1 complement(1733181..1734890) [1710 bp, 569 aa] ...    50   2e-05
YAR018C Chr1 complement(170396..171703) [1308 bp, 435 aa] {ON}  ...    50   2e-05
Kpol_1067.14 s1067 (29413..31050) [1638 bp, 545 aa] {ON} (29413....    50   2e-05
YOR351C Chr15 complement(995018..996511) [1494 bp, 497 aa] {ON} ...    50   2e-05
YOR267C Chr15 complement(822588..824867) [2280 bp, 759 aa] {ON} ...    50   2e-05
ZYRO0F01034g Chr6 (80328..82826) [2499 bp, 832 aa] {ON} similar ...    50   2e-05
Skud_4.383 Chr4 (666354..669551) [3198 bp, 1065 aa] {ON} YDR122W...    50   2e-05
Kwal_26.8941 s26 complement(1014543..1016528) [1986 bp, 661 aa] ...    50   2e-05
ACR218W Chr3 (731433..736142) [4710 bp, 1569 aa] {ON} Syntenic h...    50   2e-05
Kwal_23.5668 s23 (1263868..1268937) [5070 bp, 1689 aa] {ON} YDR2...    50   2e-05
Smik_4.532 Chr4 complement(956572..961554) [4983 bp, 1660 aa] {O...    50   2e-05
NDAI0K01480 Chr11 complement(337108..338706) [1599 bp, 532 aa] {...    50   2e-05
AAL083W Chr1 (196774..201870) [5097 bp, 1698 aa] {ON} Syntenic h...    50   2e-05
NCAS0C02510 Chr3 complement(468113..469390) [1278 bp, 425 aa] {O...    49   3e-05
Skud_11.181 Chr11 complement(326935..328845) [1911 bp, 636 aa] {...    50   3e-05
Smik_16.420 Chr16 complement(725685..727658) [1974 bp, 657 aa] {...    50   3e-05
NDAI0E03760 Chr5 (817014..818765) [1752 bp, 583 aa] {ON} Anc_7.41      49   3e-05
Smik_4.367 Chr4 (655941..659141) [3201 bp, 1066 aa] {ON} YDR122W...    50   3e-05
TDEL0G03220 Chr7 complement(600259..601350) [1092 bp, 363 aa] {O...    49   3e-05
Skud_14.151 Chr14 complement(284115..286490) [2376 bp, 791 aa] {...    50   3e-05
YDR122W Chr4 (694700..697894) [3195 bp, 1064 aa] {ON}  KIN1Serin...    50   3e-05
KLTH0D12166g Chr4 complement(987310..989061) [1752 bp, 583 aa] {...    49   3e-05
KLTH0B09042g Chr2 (736520..738112) [1593 bp, 530 aa] {ON} simila...    49   3e-05
ADR204W Chr4 (1062593..1063612) [1020 bp, 339 aa] {ON} Syntenic ...    49   3e-05
NCAS0B04580 Chr2 (831695..835255) [3561 bp, 1186 aa] {ON} Anc_8....    50   3e-05
KAFR0F02310 Chr6 (452380..453912) [1533 bp, 510 aa] {ON} Anc_3.1...    49   3e-05
Smik_14.147 Chr14 complement(272373..274742) [2370 bp, 789 aa] {...    49   3e-05
Suva_2.283 Chr2 (489490..492759) [3270 bp, 1089 aa] {ON} YDR122W...    49   3e-05
TBLA0C06820 Chr3 (1645811..1647508) [1698 bp, 565 aa] {ON} Anc_5...    49   4e-05
TDEL0C00590 Chr3 complement(94223..99031) [4809 bp, 1602 aa] {ON...    49   4e-05
AER216C Chr5 complement(1032840..1034348) [1509 bp, 502 aa] {ON}...    49   4e-05
Kpol_251.4 s251 (5802..8318) [2517 bp, 838 aa] {ON} (5802..8318)...    49   4e-05
Suva_11.108 Chr11 complement(207520..209070) [1551 bp, 516 aa] {...    49   4e-05
ADR163W Chr4 (989728..991008) [1281 bp, 426 aa] {ON} Syntenic ho...    49   4e-05
Suva_4.232 Chr4 (417104..418627) [1524 bp, 507 aa] {ON} YDL017W ...    49   4e-05
Kwal_33.15381 s33 complement(1080902..1083868) [2967 bp, 988 aa]...    49   4e-05
Ecym_2357 Chr2 (700079..701914) [1836 bp, 611 aa] {ON} similar t...    49   4e-05
KNAG0B01670 Chr2 (307587..309860) [2274 bp, 757 aa] {ON} Anc_1.2...    49   4e-05
SAKL0F15510g Chr6 complement(1251475..1253373) [1899 bp, 632 aa]...    49   5e-05
Kwal_23.3471 s23 (305414..306196) [783 bp, 260 aa] {OFF} YDL108W...    48   5e-05
CAGL0C02893g Chr3 complement(286017..287966) [1950 bp, 649 aa] {...    49   5e-05
TDEL0B01590 Chr2 complement(280143..281573) [1431 bp, 476 aa] {O...    49   5e-05
ADR313W Chr4 (1255930..1257666) [1737 bp, 578 aa] {ON} Syntenic ...    49   5e-05
AEL284C Chr5 complement(106480..107919) [1440 bp, 479 aa] {ON} S...    49   5e-05
CAGL0K12496g Chr11 (1219220..1220302) [1083 bp, 360 aa] {ON} sim...    48   5e-05
KLLA0F16467g Chr6 (1519800..1520822) [1023 bp, 340 aa] {ON} high...    48   5e-05
ZYRO0F03014g Chr6 complement(255189..260003) [4815 bp, 1604 aa] ...    49   6e-05
TDEL0D04390 Chr4 complement(799835..801340) [1506 bp, 501 aa] {O...    49   6e-05
CAGL0M13167g Chr13 complement(1293074..1294906) [1833 bp, 610 aa...    49   6e-05
TBLA0B08810 Chr2 (2094401..2095375) [975 bp, 324 aa] {ON} Anc_2....    48   6e-05
NCAS0I01870 Chr9 (345214..346866) [1653 bp, 550 aa] {ON} Anc_3.1...    48   6e-05
NDAI0A06470 Chr1 (1470263..1472083) [1821 bp, 606 aa] {ON} Anc_3...    49   6e-05
YPL026C Chr16 complement(500675..502183) [1509 bp, 502 aa] {ON} ...    48   6e-05
ZYRO0D07502g Chr4 complement(652782..654320) [1539 bp, 512 aa] {...    48   6e-05
YDR283C Chr4 complement(1025070..1030049) [4980 bp, 1659 aa] {ON...    49   7e-05
Kpol_1066.19 s1066 (31013..32806) [1794 bp, 597 aa] {OFF} (31013...    48   7e-05
Kpol_YGOB_1066.19 s1066 (30983..32806) [1824 bp, 607 aa] {ON} AN...    48   7e-05
Smik_16.209 Chr16 complement(377965..379425) [1461 bp, 486 aa] {...    48   7e-05
Skud_4.546 Chr4 complement(967636..972618) [4983 bp, 1660 aa] {O...    49   7e-05
Suva_16.491 Chr16 complement(848824..850794) [1971 bp, 656 aa] {...    48   8e-05
SAKL0G10384g Chr7 complement(883824..888848) [5025 bp, 1674 aa] ...    49   8e-05
KLLA0F26983g Chr6 (2489326..2490729) [1404 bp, 467 aa] {ON} some...    48   8e-05
Kwal_27.11777 s27 (942591..943985) [1395 bp, 464 aa] {ON} YPL026...    48   8e-05
Suva_2.449 Chr2 complement(789612..794603) [4992 bp, 1663 aa] {O...    48   9e-05
NDAI0K01150 Chr11 complement(264377..266527) [2151 bp, 716 aa] {...    48   1e-04
Ecym_1313 Chr1 complement(633556..634455) [900 bp, 299 aa] {ON} ...    47   1e-04
TBLA0A01660 Chr1 complement(391368..392828) [1461 bp, 486 aa] {O...    47   1e-04
YDR247W Chr4 (956013..957398) [1386 bp, 461 aa] {ON}  VHS1Cytopl...    47   1e-04
Kpol_1055.25 s1055 complement(62930..67933) [5004 bp, 1667 aa] {...    48   1e-04
TBLA0E02590 Chr5 complement(651679..654864) [3186 bp, 1061 aa] {...    48   1e-04
TBLA0G01910 Chr7 complement(500551..502596) [2046 bp, 681 aa] {O...    48   1e-04
KNAG0A04080 Chr1 complement(551409..552635) [1227 bp, 408 aa] {O...    47   1e-04
Skud_16.460 Chr16 complement(807116..809077) [1962 bp, 653 aa] {...    47   1e-04
Smik_4.494 Chr4 (900954..902321) [1368 bp, 455 aa] {ON} YDR247W ...    47   1e-04
CAGL0I05390g Chr9 complement(508677..510041) [1365 bp, 454 aa] {...    47   1e-04
TDEL0A06750 Chr1 (1179818..1180936) [1119 bp, 372 aa] {ON} Anc_6...    47   1e-04
YKL116C Chr11 complement(221344..222900) [1557 bp, 518 aa] {ON} ...    47   1e-04
Skud_16.256 Chr16 complement(465728..467362) [1635 bp, 544 aa] {...    47   1e-04
YPL209C Chr16 complement(156490..157593) [1104 bp, 367 aa] {ON} ...    47   1e-04
TDEL0A02330 Chr1 complement(420205..421662) [1458 bp, 485 aa] {O...    47   1e-04
TDEL0H00560 Chr8 (94614..96500) [1887 bp, 628 aa] {ON} Anc_7.515...    47   1e-04
KLLA0C04345g Chr3 (397899..399326) [1428 bp, 475 aa] {ON} simila...    47   1e-04
Klac_YGOB_Anc_8.34 Chr6 (836287..839007,839010..841004) [4716 bp...    48   1e-04
Suva_16.291 Chr16 complement(504006..505433) [1428 bp, 475 aa] {...    47   1e-04
TBLA0I01310 Chr9 (279407..281245) [1839 bp, 612 aa] {ON} Anc_2.4...    47   1e-04
Ecym_1502 Chr1 (1030765..1031838) [1074 bp, 357 aa] {ON} similar...    47   2e-04
Kpol_1065.6 s1065 (12266..12916,12918..13280,13332..13340,13394....    47   2e-04
Ecym_5258 Chr5 (536868..538376) [1509 bp, 502 aa] {ON} similar t...    47   2e-04
KAFR0G01670 Chr7 (363200..367459) [4260 bp, 1419 aa] {ON} Anc_3....    47   2e-04
Smik_6.46 Chr6 complement(84451..89733) [5283 bp, 1760 aa] {ON} ...    47   2e-04
CAGL0K00693g Chr11 complement(75466..78096) [2631 bp, 876 aa] {O...    47   2e-04
TPHA0I02660 Chr9 (582108..584219) [2112 bp, 703 aa] {ON} Anc_1.3...    47   2e-04
ADR174C Chr4 complement(1008796..1010811) [2016 bp, 671 aa] {ON}...    47   2e-04
TPHA0G01450 Chr7 (297855..299861) [2007 bp, 668 aa] {ON}               47   2e-04
KNAG0B05340 Chr2 complement(1031600..1033588) [1989 bp, 662 aa] ...    47   2e-04
Kpol_2001.46 s2001 (127016..129376) [2361 bp, 786 aa] {ON} (1270...    47   2e-04
KNAG0C01020 Chr3 (200271..202595) [2325 bp, 774 aa] {ON} Anc_1.1...    47   2e-04
CAGL0K01815g Chr11 (162973..164487) [1515 bp, 504 aa] {ON} simil...    47   2e-04
CAGL0H08437g Chr8 complement(825191..829423) [4233 bp, 1410 aa] ...    47   2e-04
KAFR0E02850 Chr5 (575512..576786) [1275 bp, 424 aa] {ON} Anc_8.4...    46   2e-04
Ecym_8129 Chr8 (269437..271626) [2190 bp, 729 aa] {ON} similar t...    47   2e-04
NCAS0I03020 Chr9 (555481..557853) [2373 bp, 790 aa] {ON} Anc_1.149     47   3e-04
TBLA0J00250 Chr10 (42058..44457) [2400 bp, 799 aa] {ON} Anc_7.51...    46   3e-04
KLTH0B02178g Chr2 (171582..174551) [2970 bp, 989 aa] {ON} simila...    47   3e-04
TBLA0G03450 Chr7 (913497..919415) [5919 bp, 1972 aa] {ON} Anc_8....    47   3e-04
TBLA0A02240 Chr1 (539297..540538) [1242 bp, 413 aa] {ON} Anc_6.2...    46   3e-04
KNAG0H00560 Chr8 (89502..91268) [1767 bp, 588 aa] {ON} Anc_2.597...    46   3e-04
KAFR0C03520 Chr3 (715667..720019) [4353 bp, 1450 aa] {ON} Anc_8....    47   3e-04
Kpol_1051.42 s1051 (98030..99379,99382..100212) [2181 bp, 726 aa...    46   3e-04
NCAS0G03810 Chr7 complement(703842..705827) [1986 bp, 661 aa] {O...    46   3e-04
Kwal_26.7682 s26 complement(470565..472121) [1557 bp, 518 aa] {O...    46   3e-04
TPHA0A04330 Chr1 (974713..976218) [1506 bp, 501 aa] {ON} Anc_3.1...    46   3e-04
YFL033C Chr6 complement(69115..74427) [5313 bp, 1770 aa] {ON}  R...    46   3e-04
KNAG0B04500 Chr2 (865766..869089) [3324 bp, 1107 aa] {ON} Anc_5....    46   3e-04
Ecym_7414 Chr7 (848665..850440) [1776 bp, 591 aa] {ON} similar t...    46   3e-04
NCAS0A10590 Chr1 complement(2108142..2111429) [3288 bp, 1095 aa]...    46   4e-04
KNAG0G02780 Chr7 complement(615058..617202) [2145 bp, 714 aa] {O...    46   4e-04
ADR293C Chr4 complement(1207021..1210425) [3405 bp, 1134 aa] {ON...    46   4e-04
KLTH0G06468g Chr7 complement(513119..518251) [5133 bp, 1710 aa] ...    46   4e-04
TBLA0D02730 Chr4 complement(674994..676427) [1434 bp, 477 aa] {O...    45   4e-04
SAKL0C07876g Chr3 (732534..733970) [1437 bp, 478 aa] {ON} simila...    45   5e-04
KAFR0C00430 Chr3 complement(88561..91410) [2850 bp, 949 aa] {ON}...    46   5e-04
TPHA0D01540 Chr4 complement(316471..318594) [2124 bp, 707 aa] {O...    45   5e-04
Kpol_1052.22 s1052 (72364..75669) [3306 bp, 1101 aa] {ON} (72364...    45   5e-04
SAKL0B11308g Chr2 complement(984543..986369) [1827 bp, 608 aa] {...    45   5e-04
Kwal_55.20221 s55 (304482..308006) [3525 bp, 1174 aa] {ON} YHR07...    45   5e-04
TPHA0C01810 Chr3 complement(413495..414790) [1296 bp, 431 aa] {O...    45   5e-04
SAKL0D03234g Chr4 (262365..264941) [2577 bp, 858 aa] {ON} some s...    45   5e-04
Kpol_1010.68 s1010 complement(168093..169595) [1503 bp, 500 aa] ...    45   5e-04
NCAS0B02530 Chr2 complement(422882..424207) [1326 bp, 441 aa] {O...    45   5e-04
Suva_6.26 Chr6 complement(42811..48072) [5262 bp, 1753 aa] {ON} ...    45   6e-04
Kwal_26.8347 s26 complement(748254..750032) [1779 bp, 592 aa] {O...    45   6e-04
KLTH0C07260g Chr3 (626334..629039) [2706 bp, 901 aa] {ON} simila...    45   6e-04
KLTH0E15972g Chr5 complement(1414595..1416016) [1422 bp, 473 aa]...    45   6e-04
Kpol_365.3 s365 complement(2204..4177,4180..4206,4209..4874) [26...    45   6e-04
NCAS0A04440 Chr1 complement(895181..896935) [1755 bp, 584 aa] {O...    45   7e-04
Skud_6.38 Chr6 complement(72416..77692) [5277 bp, 1758 aa] {ON} ...    45   7e-04
KNAG0F03730 Chr6 complement(697517..699586) [2070 bp, 689 aa] {O...    45   7e-04
KLLA0D13266g Chr4 complement(1137750..1141208) [3459 bp, 1152 aa...    45   7e-04
YBR059C Chr2 complement(356861..360187) [3327 bp, 1108 aa] {ON} ...    45   7e-04
Kpol_1072.1 s1072 (686..2683) [1998 bp, 665 aa] {ON} (686..2683)...    45   7e-04
KNAG0E03260 Chr5 complement(654134..655246) [1113 bp, 370 aa] {O...    44   8e-04
SAKL0E03344g Chr5 (272024..273754) [1731 bp, 576 aa] {ON} simila...    45   8e-04
TPHA0A04030 Chr1 (901665..904829) [3165 bp, 1054 aa] {ON} Anc_3....    45   8e-04
ZYRO0A02772g Chr1 complement(223226..224473) [1248 bp, 415 aa] {...    44   8e-04
KAFR0A01040 Chr1 complement(197612..200350) [2739 bp, 912 aa] {O...    45   0.001
KLTH0H03080g Chr8 complement(274038..275078) [1041 bp, 346 aa] {...    44   0.001
KNAG0J00820 Chr10 complement(137927..141202) [3276 bp, 1091 aa] ...    45   0.001
CAGL0K11275g Chr11 (1094626..1096203) [1578 bp, 525 aa] {ON} sim...    44   0.001
Kwal_27.9804 s27 (69307..70728) [1422 bp, 473 aa] {ON} YDL017W (...    44   0.001
KLLA0D10527g Chr4 (892955..894892) [1938 bp, 645 aa] {ON} simila...    44   0.001
KLLA0B07579g Chr2 (659591..661759) [2169 bp, 722 aa] {ON} simila...    44   0.001
ZYRO0F03190g Chr6 complement(270262..271371) [1110 bp, 369 aa] {...    44   0.001
YBR097W Chr2 (436951..441315) [4365 bp, 1454 aa] {ON}  VPS15Myri...    45   0.001
NDAI0F01340 Chr6 complement(327928..329148) [1221 bp, 406 aa] {O...    44   0.001
TDEL0E01820 Chr5 complement(348423..349403) [981 bp, 326 aa] {ON...    44   0.001
TDEL0F02980 Chr6 (539327..541549) [2223 bp, 740 aa] {ON} Anc_1.1...    44   0.001
NCAS0B06260 Chr2 complement(1180650..1182821) [2172 bp, 723 aa] ...    44   0.001
SAKL0C04576g Chr3 complement(444365..446611) [2247 bp, 748 aa] {...    44   0.001
ZYRO0G20570g Chr7 (1695518..1697305) [1788 bp, 595 aa] {ON} simi...    44   0.001
Skud_2.179 Chr2 complement(325193..328465) [3273 bp, 1090 aa] {O...    44   0.001
NDAI0G00640 Chr7 (139655..141520) [1866 bp, 621 aa] {ON} Anc_2.284     44   0.001
TBLA0I01930 Chr9 complement(436511..440596) [4086 bp, 1361 aa] {...    44   0.001
Kpol_1035.34 s1035 (79914..80978) [1065 bp, 354 aa] {ON} (79914....    44   0.001
Ecym_6294 Chr6 complement(551351..552982) [1632 bp, 543 aa] {ON}...    44   0.002
Ecym_8210 Chr8 (431406..434297) [2892 bp, 963 aa] {ON} similar t...    44   0.002
Smik_11.125 Chr11 complement(208208..209764) [1557 bp, 518 aa] {...    44   0.002
KNAG0A06390 Chr1 complement(974644..976254) [1611 bp, 536 aa] {O...    44   0.002
Ecym_2650 Chr2 complement(1257641..1260325) [2685 bp, 894 aa] {O...    44   0.002
Suva_4.297 Chr4 complement(523650..526973) [3324 bp, 1107 aa] {O...    44   0.002
KLLA0F01408g Chr6 (135424..136302) [879 bp, 292 aa] {ON} conserv...    43   0.002
CAGL0H00979g Chr8 complement(94328..95527) [1200 bp, 399 aa] {ON...    43   0.002
KAFR0G00440 Chr7 (124896..127328) [2433 bp, 810 aa] {ON} Anc_1.1...    44   0.002
Suva_6.29 Chr6 complement(51588..52691) [1104 bp, 367 aa] {ON} Y...    43   0.002
ZYRO0G02816g Chr7 complement(213421..214980) [1560 bp, 519 aa] {...    43   0.002
NDAI0G05790 Chr7 complement(1433294..1435252) [1959 bp, 652 aa] ...    43   0.002
AEL149C Chr5 complement(348350..350533) [2184 bp, 727 aa] {ON} S...    43   0.003
KLTH0D05082g Chr4 complement(457124..458680) [1557 bp, 518 aa] {...    43   0.003
KLTH0H10582g Chr8 (914695..916440) [1746 bp, 581 aa] {ON} weakly...    43   0.003
Suva_16.97 Chr16 complement(165977..167083) [1107 bp, 368 aa] {O...    43   0.003
SAKL0G13882g Chr7 complement(1191656..1194604) [2949 bp, 982 aa]...    43   0.003
KLTH0D08712g Chr4 complement(728072..729886) [1815 bp, 604 aa] {...    43   0.003
TPHA0A02630 Chr1 complement(562516..565164) [2649 bp, 882 aa] {O...    43   0.003
SAKL0B04752g Chr2 (416940..418259) [1320 bp, 439 aa] {ON} weakly...    43   0.003
NDAI0C00570 Chr3 (108274..110547) [2274 bp, 757 aa] {ON}               43   0.003
Smik_2.191 Chr2 complement(338792..342118) [3327 bp, 1108 aa] {O...    43   0.003
SAKL0E07722g Chr5 complement(625066..627441) [2376 bp, 791 aa] {...    43   0.004
Ecym_6044 Chr6 complement(84500..85756) [1257 bp, 418 aa] {ON} s...    42   0.004
Kwal_33.13225 s33 (127676..130570) [2895 bp, 964 aa] {ON} YFR016...    43   0.004
SAKL0D06820g Chr4 (566145..567938) [1794 bp, 597 aa] {ON} simila...    42   0.004
ZYRO0E06864g Chr5 complement(516731..520078) [3348 bp, 1115 aa] ...    43   0.004
NCAS0H01740 Chr8 complement(331436..335284) [3849 bp, 1282 aa] {...    43   0.004
YJL187C Chr10 complement(76803..79262) [2460 bp, 819 aa] {ON}  S...    42   0.004
Ecym_8164 Chr8 (342672..346076) [3405 bp, 1134 aa] {ON} similar ...    42   0.004
CAGL0J03432g Chr10 (330031..331899) [1869 bp, 622 aa] {ON} simil...    42   0.005
Suva_6.268 Chr6 (470348..472519) [2172 bp, 723 aa] {ON} YJL187C ...    42   0.005
KLTH0E03828g Chr5 (345775..349131) [3357 bp, 1118 aa] {ON} simil...    42   0.005
NDAI0A05700 Chr1 (1288604..1292077) [3474 bp, 1157 aa] {ON} Anc_...    42   0.005
Suva_14.327 Chr14 complement(578572..580470) [1899 bp, 632 aa] {...    42   0.005
TDEL0C04810 Chr3 (867670..871932) [4263 bp, 1420 aa] {ON} Anc_3....    42   0.005
NCAS0B08320 Chr2 complement(1585766..1588471) [2706 bp, 901 aa] ...    42   0.006
SAKL0B01474g Chr2 complement(145734..146777) [1044 bp, 347 aa] {...    42   0.006
Kpol_1039.33 s1039 complement(102096..104201) [2106 bp, 701 aa] ...    42   0.006
Kwal_23.4276 s23 complement(648061..649626) [1566 bp, 521 aa] {O...    42   0.006
KNAG0A02350 Chr1 complement(223757..225022) [1266 bp, 421 aa] {O...    42   0.007
Kwal_56.24274 s56 (932404..933444) [1041 bp, 346 aa] {ON} YPL236...    41   0.007
YFL029C Chr6 complement(78055..79161) [1107 bp, 368 aa] {ON}  CA...    41   0.007
CAGL0J05082g Chr10 (483782..485743) [1962 bp, 653 aa] {ON} simil...    42   0.008
KAFR0J01370 Chr10 complement(250424..252766) [2343 bp, 780 aa] {...    42   0.008
SAKL0B07326g Chr2 (627224..631477) [4254 bp, 1417 aa] {ON} simil...    42   0.008
Suva_16.70 Chr16 complement(110631..111725) [1095 bp, 364 aa] {O...    41   0.008
TPHA0N00370 Chr14 (68298..69650) [1353 bp, 450 aa] {ON} Anc_7.41...    41   0.008
CAGL0I08899g Chr9 complement(863906..866701) [2796 bp, 931 aa] {...    42   0.009
Kwal_27.10945 s27 (565717..568524) [2808 bp, 935 aa] {ON} YBR059...    41   0.010
CAGL0G02607g Chr7 complement(240244..242310) [2067 bp, 688 aa] {...    41   0.010
Kwal_14.1249 s14 (252877..253911) [1035 bp, 344 aa] {ON} YFL029C...    41   0.010
Smik_9.84 Chr9 (162983..165409) [2427 bp, 808 aa] {ON} YIL095W (...    41   0.011
ZYRO0C15884g Chr3 (1241605..1245873) [4269 bp, 1422 aa] {ON} sim...    41   0.011
Ecym_6301 Chr6 complement(566248..567324) [1077 bp, 358 aa] {ON}...    41   0.011
Ecym_3160 Chr3 complement(304537..306957) [2421 bp, 806 aa] {ON}...    41   0.011
Smik_2.239 Chr2 (421843..426207) [4365 bp, 1454 aa] {ON} YBR097W...    41   0.011
TBLA0B09215 Chr2 complement(2180179..2181375) [1197 bp, 398 aa] ...    41   0.012
Skud_9.78 Chr9 (160531..162960) [2430 bp, 809 aa] {ON} YIL095W (...    41   0.012
CAGL0K11990g Chr11 complement(1156224..1159199) [2976 bp, 991 aa...    41   0.013
ABL055C Chr2 complement(295495..297105) [1611 bp, 536 aa] {ON} S...    41   0.013
NCAS0A01090 Chr1 (216576..218042) [1467 bp, 488 aa] {ON} Anc_6.215     41   0.013
TPHA0H01880 Chr8 (441140..442402) [1263 bp, 420 aa] {ON} Anc_6.2...    40   0.013
Suva_2.413 Chr2 (735541..736923) [1383 bp, 460 aa] {ON} YDR247W ...    40   0.014
KLTH0E15026g Chr5 (1331171..1335730) [4560 bp, 1519 aa] {ON} sim...    41   0.014
KLLA0E08405g Chr5 complement(756205..758538) [2334 bp, 777 aa] {...    41   0.015
TPHA0M01120 Chr13 complement(223548..225914) [2367 bp, 788 aa] {...    41   0.015
Skud_10.30 Chr10 complement(51698..54124) [2427 bp, 808 aa] {ON}...    41   0.016
NDAI0A00920 Chr1 (189693..192521) [2829 bp, 942 aa] {ON} Anc_1.1...    41   0.016
CAGL0H10208g Chr8 complement(996853..999936) [3084 bp, 1027 aa] ...    40   0.017
SAKL0A03344g Chr1 complement(305149..306243) [1095 bp, 364 aa] {...    40   0.018
KAFR0C03480 Chr3 (708186..709277) [1092 bp, 363 aa] {ON} Anc_8.4...    40   0.019
NDAI0G03150 Chr7 complement(741321..742463) [1143 bp, 380 aa] {O...    40   0.019
Smik_11.58 Chr11 (112932..115715) [2784 bp, 927 aa] {ON} YKL171W...    40   0.019
Kwal_14.2554 s14 (811455..813233) [1779 bp, 592 aa] {ON} YJL057C...    40   0.019
Smik_10.45 Chr10 complement(74813..77278) [2466 bp, 821 aa] {ON}...    40   0.021
Suva_9.104 Chr9 (178011..180428) [2418 bp, 805 aa] {ON} YIL095W ...    40   0.021
AGR315C Chr7 complement(1319993..1322872) [2880 bp, 959 aa] {ON}...    40   0.021
TBLA0D02510 Chr4 complement(626101..627234) [1134 bp, 377 aa] {O...    40   0.021
TBLA0A06660 Chr1 complement(1626147..1630400) [4254 bp, 1417 aa]...    40   0.021
YIL095W Chr9 (183937..186369) [2433 bp, 810 aa] {ON}  PRK1Protei...    40   0.022
Skud_6.41 Chr6 complement(81310..82416) [1107 bp, 368 aa] {ON} Y...    40   0.023
KNAG0H02020 Chr8 complement(357248..359026) [1779 bp, 592 aa] {O...    40   0.024
TDEL0D03520 Chr4 (647828..650977) [3150 bp, 1049 aa] {ON} Anc_3....    40   0.024
TBLA0B06620 Chr2 complement(1556378..1559671) [3294 bp, 1097 aa]...    40   0.024
TDEL0C00660 Chr3 complement(107849..108952) [1104 bp, 367 aa] {O...    40   0.027
KAFR0F01630 Chr6 complement(323802..326057) [2256 bp, 751 aa] {O...    40   0.028
Suva_15.271 Chr15 complement(460466..463813) [3348 bp, 1115 aa] ...    40   0.028
KLTH0E11110g Chr5 (997486..998847) [1362 bp, 453 aa] {ON} simila...    39   0.033
Ecym_3323 Chr3 (618386..620632) [2247 bp, 748 aa] {ON} similar t...    39   0.039
ADL217W Chr4 (321491..323743) [2253 bp, 750 aa] {ON} Syntenic ho...    39   0.040
NDAI0E03210 Chr5 complement(686073..687317) [1245 bp, 414 aa] {O...    39   0.043
Skud_4.509 Chr4 (910551..911945) [1395 bp, 464 aa] {ON} YDR247W ...    39   0.043
TBLA0D01110 Chr4 (283160..285640) [2481 bp, 826 aa] {ON} Anc_8.7...    39   0.043
KAFR0C02290 Chr3 complement(449963..451204) [1242 bp, 413 aa] {O...    39   0.044
ZYRO0A01848g Chr1 (152134..154248) [2115 bp, 704 aa] {ON} simila...    39   0.046
TBLA0F01730 Chr6 complement(431961..433004) [1044 bp, 347 aa] {O...    39   0.046
NCAS0A09170 Chr1 (1813960..1815846) [1887 bp, 628 aa] {ON} Anc_1...    39   0.047
TDEL0E04680 Chr5 complement(875878..878862) [2985 bp, 994 aa] {O...    39   0.047
NDAI0B00400 Chr2 (74403..76643) [2241 bp, 746 aa] {ON} Anc_1.149       39   0.048
KNAG0D02790 Chr4 (507235..508848) [1614 bp, 537 aa] {ON} Anc_5.3...    39   0.051
KAFR0B03270 Chr2 complement(677477..679231) [1755 bp, 584 aa] {O...    39   0.051
NDAI0F01640 Chr6 (401323..403086) [1764 bp, 587 aa] {ON} Anc_6.215     39   0.051
NCAS0A07080 Chr1 complement(1400590..1403607) [3018 bp, 1005 aa]...    39   0.051
Skud_13.385 Chr13 complement(672612..674966) [2355 bp, 784 aa] {...    39   0.052
TPHA0A02760 Chr1 (594482..597502) [3021 bp, 1006 aa] {ON} Anc_1....    39   0.053
Smik_8.156 Chr8 complement(234928..238269) [3342 bp, 1113 aa] {O...    39   0.053
KAFR0A01740 Chr1 complement(356086..358035) [1950 bp, 649 aa] {O...    39   0.058
KAFR0D04760 Chr4 complement(932849..936205) [3357 bp, 1118 aa] {...    39   0.059
KNAG0H01220 Chr8 (209884..212625) [2742 bp, 913 aa] {ON} Anc_3.2...    39   0.059
AFR150C Chr6 complement(707303..708352) [1050 bp, 349 aa] {ON} S...    38   0.062
Smik_6.441 Chr6 (721619..722713) [1095 bp, 364 aa] {ON} YPL236C ...    38   0.063
Smik_14.311 Chr14 complement(558013..559926) [1914 bp, 637 aa] {...    39   0.063
Suva_3.128 Chr3 (192094..193266) [1173 bp, 390 aa] {ON} YCR091W ...    39   0.064
Skud_2.225 Chr2 (405095..409459) [4365 bp, 1454 aa] {ON} YBR097W...    39   0.065
KLLA0F22605g Chr6 complement(2109034..2111913) [2880 bp, 959 aa]...    39   0.073
Smik_6.306 Chr6 complement(480942..484031) [3090 bp, 1029 aa] {O...    39   0.075
ZYRO0G12232g Chr7 (964508..967591) [3084 bp, 1027 aa] {ON} simil...    39   0.081
TBLA0J01200 Chr10 (271800..275420) [3621 bp, 1206 aa] {ON} Anc_1...    39   0.085
Kpol_1003.35 s1003 (89266..91407) [2142 bp, 713 aa] {ON} (89266....    38   0.085
SAKL0A04444g Chr1 (412103..413527) [1425 bp, 474 aa] {ON} highly...    38   0.094
TDEL0D01930 Chr4 complement(373906..375753) [1848 bp, 615 aa] {O...    38   0.094
Kwal_33.13825 s33 (409772..412477) [2706 bp, 901 aa] {ON} YKL171...    38   0.10 
Skud_16.42 Chr16 complement(75193..76287) [1095 bp, 364 aa] {ON}...    38   0.10 
TPHA0G00610 Chr7 (114519..116138) [1620 bp, 539 aa] {ON} Anc_8.7...    38   0.12 
YHR079C Chr8 complement(258244..261591) [3348 bp, 1115 aa] {ON} ...    38   0.13 
KLLA0C07216g Chr3 (626227..628278) [2052 bp, 683 aa] {ON} simila...    38   0.14 
NCAS0D03820 Chr4 complement(708820..710241) [1422 bp, 473 aa] {O...    37   0.14 
TPHA0C03380 Chr3 (740939..743032) [2094 bp, 697 aa] {ON} Anc_2.2...    37   0.18 
YKL171W Chr11 (127475..130261) [2787 bp, 928 aa] {ON}  NNK1Prote...    37   0.18 
Skud_8.139 Chr8 complement(232178..235534) [3357 bp, 1118 aa] {O...    37   0.18 
TPHA0E02830 Chr5 (591805..593364) [1560 bp, 519 aa] {ON} Anc_6.2...    37   0.18 
Suva_4.344 Chr4 (606007..610371) [4365 bp, 1454 aa] {ON} YBR097W...    37   0.18 
KLLA0F18612g Chr6 (1711131..1713575) [2445 bp, 814 aa] {ON} some...    37   0.19 
NCAS0C03810 Chr3 complement(772530..773660) [1131 bp, 376 aa] {O...    37   0.19 
TDEL0G02150 Chr7 (422718..424703) [1986 bp, 661 aa] {ON} Anc_2.2...    37   0.19 
YMR216C Chr13 complement(698811..701039) [2229 bp, 742 aa] {ON} ...    37   0.21 
Kpol_1033.51 s1033 complement(127843..129165) [1323 bp, 440 aa] ...    37   0.22 
TPHA0A03700 Chr1 complement(808996..813273) [4278 bp, 1425 aa] {...    37   0.22 
Kwal_26.9032 s26 complement(1047382..1049157) [1776 bp, 591 aa] ...    37   0.22 
Skud_11.54 Chr11 (113775..116570) [2796 bp, 931 aa] {ON} YKL171W...    37   0.24 
KLLA0B11924g Chr2 complement(1043344..1047582) [4239 bp, 1412 aa...    37   0.25 
Smik_6.49 Chr6 complement(93305..94408) [1104 bp, 367 aa] {ON} Y...    37   0.25 
ZYRO0E07876g Chr5 (616134..617243) [1110 bp, 369 aa] {ON} simila...    37   0.25 
Kpol_209.1 s209 (1823..5734) [3912 bp, 1303 aa] {ON} (1823..5734...    37   0.25 
TBLA0J01000 Chr10 complement(227869..231072) [3204 bp, 1067 aa] ...    37   0.26 
Ecym_3487 Chr3 complement(910575..914810) [4236 bp, 1411 aa] {ON...    37   0.28 
KAFR0K00320 Chr11 (72569..73942) [1374 bp, 457 aa] {ON} Anc_6.21...    36   0.29 
KLLA0D03168g Chr4 (265761..267278) [1518 bp, 505 aa] {ON} simila...    36   0.29 
Suva_16.102 Chr16 (173734..175209) [1476 bp, 491 aa] {ON} YPL204...    36   0.31 
NDAI0D02140 Chr4 complement(496708..499785) [3078 bp, 1025 aa] {...    37   0.32 
Kpol_1006.14 s1006 (52420..54042) [1623 bp, 540 aa] {ON} (52420....    36   0.32 
Suva_11.52 Chr11 (112355..115156) [2802 bp, 933 aa] {ON} YKL171W...    37   0.32 
Smik_6.409 Chr6 complement(658629..660119) [1491 bp, 496 aa] {ON...    36   0.33 
Ecym_8100 Chr8 complement(214001..216547) [2547 bp, 848 aa] {ON}...    36   0.33 
KNAG0E03740 Chr5 complement(738877..741528) [2652 bp, 883 aa] {O...    36   0.36 
Suva_13.399 Chr13 complement(679223..681388) [2166 bp, 721 aa] {...    36   0.36 
YPL236C Chr16 complement(101608..102702) [1095 bp, 364 aa] {ON} ...    36   0.36 
CAGL0F03905g Chr6 complement(377962..380088) [2127 bp, 708 aa] {...    36   0.37 
AGR027C Chr7 complement(763303..766188) [2886 bp, 961 aa] {ON} S...    36   0.37 
KLTH0G10318g Chr7 (872129..874501) [2373 bp, 790 aa] {ON} simila...    36   0.39 
Smik_13.424 Chr13 complement(682907..685177) [2271 bp, 756 aa] {...    36   0.40 
YPL204W Chr16 (164276..165760) [1485 bp, 494 aa] {ON}  HRR25Prot...    36   0.41 
TDEL0E05230 Chr5 complement(958851..960323) [1473 bp, 490 aa] {O...    36   0.41 
KNAG0D01130 Chr4 (190658..191947) [1290 bp, 429 aa] {ON} Anc_6.2...    36   0.42 
KLLA0F01507g Chr6 (144356..145774) [1419 bp, 472 aa] {ON} some s...    36   0.42 
KNAG0F01980 Chr6 (379013..380368) [1356 bp, 451 aa] {ON} Anc_6.2...    36   0.42 
KLTH0D12518g Chr4 complement(1023214..1024992) [1779 bp, 592 aa]...    36   0.42 
CAGL0H03553g Chr8 complement(328668..330155) [1488 bp, 495 aa] {...    36   0.44 
AEL173W Chr5 (313261..314856) [1596 bp, 531 aa] {ON} Syntenic ho...    36   0.44 
YNL020C Chr14 complement(595623..597539) [1917 bp, 638 aa] {ON} ...    36   0.44 
Skud_16.75 Chr16 (137624..139108) [1485 bp, 494 aa] {ON} YPL204W...    36   0.45 
KAFR0F01150 Chr6 complement(218711..219811) [1101 bp, 366 aa] {O...    35   0.46 
NDAI0I01070 Chr9 (259836..261278) [1443 bp, 480 aa] {ON} Anc_6.215     36   0.48 
AEL120W Chr5 (396394..398715) [2322 bp, 773 aa] {ON} Syntenic ho...    36   0.49 
KNAG0J02030 Chr10 complement(368141..370327) [2187 bp, 728 aa] {...    36   0.50 
KLLA0D11044g Chr4 complement(942458..944068) [1611 bp, 536 aa] {...    35   0.52 
TDEL0B03770 Chr2 (676581..678575) [1995 bp, 664 aa] {ON} Anc_8.7...    36   0.54 
Ecym_2202 Chr2 (399184..400629) [1446 bp, 481 aa] {ON} similar t...    35   0.54 
KNAG0D00830 Chr4 complement(130823..131986) [1164 bp, 387 aa] {O...    35   0.54 
Kwal_56.24064 s56 complement(831165..832592) [1428 bp, 475 aa] {...    35   0.55 
KLTH0H04158g Chr8 (378344..379798) [1455 bp, 484 aa] {ON} simila...    35   0.56 
NCAS0G01210 Chr7 complement(215860..216963) [1104 bp, 367 aa] {O...    35   0.59 
KAFR0H03330 Chr8 complement(635910..637019) [1110 bp, 369 aa] {O...    35   0.60 
AFL091W Chr6 (272431..273867) [1437 bp, 478 aa] {ON} Syntenic ho...    35   0.60 
NCAS0C01030 Chr3 (192001..194043) [2043 bp, 680 aa] {ON} Anc_8.732     35   0.64 
Skud_5.255 Chr5 complement(415109..416686) [1578 bp, 525 aa] {ON...    35   0.64 
Smik_5.268 Chr5 (413820..415397) [1578 bp, 525 aa] {ON} YER123W ...    35   0.66 
TPHA0G01380 Chr7 (279600..281579) [1980 bp, 659 aa] {ON} Anc_8.7...    35   0.67 
YGR188C Chr7 complement(872044..875109) [3066 bp, 1021 aa] {ON} ...    35   0.68 
KAFR0K00880 Chr11 (188439..191069) [2631 bp, 876 aa] {ON} Anc_5....    35   0.72 
CAGL0K02299g Chr11 complement(206161..207777) [1617 bp, 538 aa] ...    35   0.77 
YER123W Chr5 (404813..406387) [1575 bp, 524 aa] {ON}  YCK3Palmit...    35   0.79 
Suva_7.481 Chr7 complement(829537..832644) [3108 bp, 1035 aa] {O...    35   0.81 
TPHA0J02370 Chr10 complement(523628..525016) [1389 bp, 462 aa] {...    35   0.84 
TBLA0B05930 Chr2 (1400163..1402316) [2154 bp, 717 aa] {ON} Anc_2...    35   0.84 
KLLA0F08877g Chr6 (825217..826182) [966 bp, 321 aa] {ON} uniprot...    35   0.89 
Ecym_8392 Chr8 (803292..804806) [1515 bp, 504 aa] {ON} similar t...    35   0.94 
TBLA0A02040 Chr1 complement(493305..495056) [1752 bp, 583 aa] {O...    35   0.96 
AER348C Chr5 complement(1275897..1277774) [1878 bp, 625 aa] {ON}...    35   1.00 
ZYRO0G08866g Chr7 complement(713156..714661) [1506 bp, 501 aa] {...    35   1.0  
NCAS0B04520 Chr2 (821360..822787) [1428 bp, 475 aa] {ON} Anc_8.132     35   1.0  
Skud_7.518 Chr7 complement(847291..850359) [3069 bp, 1022 aa] {O...    35   1.0  
NDAI0K01030 Chr11 (239418..241712) [2295 bp, 764 aa] {ON} Anc_8....    35   1.1  
NCAS0A12870 Chr1 (2539303..2541315) [2013 bp, 670 aa] {ON} Anc_2...    35   1.2  
TBLA0G02780 Chr7 (730835..732529) [1695 bp, 564 aa] {ON} Anc_8.1...    34   1.2  
Skud_14.309 Chr14 complement(566344..568263) [1920 bp, 639 aa] {...    34   1.5  
NDAI0B02430 Chr2 (608926..610590) [1665 bp, 554 aa] {ON} Anc_8.132     34   1.7  
KNAG0J02520 Chr10 (472464..476795) [4332 bp, 1443 aa] {ON} Anc_3...    34   1.8  
KLLA0A06776g Chr1 (612115..614517) [2403 bp, 800 aa] {ON} simila...    34   1.9  
Kpol_538.20 s538 (39404..42382) [2979 bp, 992 aa] {ON} (39404..4...    34   1.9  
ADL053C Chr4 complement(589599..591014) [1416 bp, 471 aa] {ON} S...    33   2.0  
TBLA0D00250 Chr4 (61918..63618) [1701 bp, 566 aa] {ON} Anc_2.105...    33   2.1  
ZYRO0A06182g Chr1 (493846..496062) [2217 bp, 738 aa] {ON} simila...    33   2.4  
Suva_5.243 Chr5 (380441..382012) [1572 bp, 523 aa] {ON} YER123W ...    33   2.4  
KNAG0D02200 Chr4 complement(374609..376075) [1467 bp, 488 aa] {O...    33   2.5  
TBLA0B05310 Chr2 complement(1251914..1253494) [1581 bp, 526 aa] ...    33   2.6  
TPHA0D00430 Chr4 complement(73651..74730) [1080 bp, 359 aa] {ON}...    33   2.8  
Ecym_6239 Chr6 complement(445704..447791) [2088 bp, 695 aa] {ON}...    33   2.9  
Kpol_1002.53 s1002 (150289..151668) [1380 bp, 459 aa] {ON} (1502...    33   3.1  
Kwal_27.11542 s27 complement(841389..843764) [2376 bp, 791 aa] {...    33   3.2  
YPR106W Chr16 (740061..741392) [1332 bp, 443 aa] {ON}  ISR1Predi...    33   3.3  
ZYRO0F09174g Chr6 complement(744109..745638) [1530 bp, 509 aa] {...    33   3.7  
KLTH0E06952g Chr5 complement(639783..641045) [1263 bp, 420 aa] {...    33   3.8  
Skud_15.541 Chr15 (979046..980605) [1560 bp, 519 aa] {ON} YOR374...    33   3.8  
KAFR0B02070 Chr2 (408079..409539) [1461 bp, 486 aa] {ON} Anc_8.1...    33   3.9  
CAGL0G01716g Chr7 complement(155248..156390) [1143 bp, 380 aa] {...    33   4.1  
Kpol_2001.31 s2001 complement(90402..93110) [2709 bp, 902 aa] {O...    33   4.5  
TDEL0F01010 Chr6 complement(178943..180418) [1476 bp, 491 aa] {O...    32   5.2  
Kpol_1064.42 s1064 complement(78573..80207) [1635 bp, 544 aa] {O...    32   5.8  
TPHA0I01240 Chr9 (283537..285210) [1674 bp, 557 aa] {ON} Anc_2.1...    32   6.4  
KNAG0A07560 Chr1 (1186540..1187550) [1011 bp, 336 aa] {ON} Anc_3...    32   6.6  
Kwal_27.12562 s27 (1274883..1279139) [4257 bp, 1418 aa] {ON} YBR...    32   6.7  
TPHA0J03180 Chr10 complement(691886..694882) [2997 bp, 998 aa] {...    32   7.2  
TDEL0B04910 Chr2 complement(862376..863002) [627 bp, 208 aa] {ON...    31   7.3  
KLTH0G18282g Chr7 complement(1576512..1577558) [1047 bp, 348 aa]...    32   8.4  
YOR374W Chr15 (1039840..1041399) [1560 bp, 519 aa] {ON}  ALD4Mit...    32   8.5  
Suva_8.430 Chr8 (777529..779088) [1560 bp, 519 aa] {ON} YER073W ...    32   8.7  
TPHA0D01000 Chr4 (202605..204125) [1521 bp, 506 aa] {ON} Anc_8.1...    32   8.7  
NCAS0F02640 Chr6 complement(535629..536306) [678 bp, 225 aa] {ON...    31   8.9  

>TPHA0M00300 Chr13 (59377..61701) [2325 bp, 774 aa] {ON} Anc_3.162
           YDL028C
          Length = 774

 Score = 1443 bits (3736), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 708/774 (91%), Positives = 708/774 (91%)

Query: 1   MVLNDNTRFSKSGGIRNDTIQTYNNDSDSDEKLTVLPKLSNFGSALISEKNENITRXXXX 60
           MVLNDNTRFSKSGGIRNDTIQTYNNDSDSDEKLTVLPKLSNFGSALISEKNENITR    
Sbjct: 1   MVLNDNTRFSKSGGIRNDTIQTYNNDSDSDEKLTVLPKLSNFGSALISEKNENITRNSLT 60

Query: 61  XXXXXXXXXXXXXXTLTKNNEIGTINSNFNNGQIASPKFKGIKNLIDQEMTVKHNERRKG 120
                         TLTKNNEIGTINSNFNNGQIASPKFKGIKNLIDQEMTVKHNERRKG
Sbjct: 61  NSSISMSSNYNQINTLTKNNEIGTINSNFNNGQIASPKFKGIKNLIDQEMTVKHNERRKG 120

Query: 121 RRIFRKIELNSLGKAKRTNLDYTIAPSHMTEVNYDQYQENDHKTFESMNDMENDIPKYKT 180
           RRIFRKIELNSLGKAKRTNLDYTIAPSHMTEVNYDQYQENDHKTFESMNDMENDIPKYKT
Sbjct: 121 RRIFRKIELNSLGKAKRTNLDYTIAPSHMTEVNYDQYQENDHKTFESMNDMENDIPKYKT 180

Query: 181 TTDSILSNNKSTDNLAGKNSKNHVTXXXXXXXXXXXXXXXNPFTDSNTYNHSNTSLPNTM 240
           TTDSILSNNKSTDNLAGKNSKNHVT               NPFTDSNTYNHSNTSLPNTM
Sbjct: 181 TTDSILSNNKSTDNLAGKNSKNHVTTPSSSFGSTLYSSTTNPFTDSNTYNHSNTSLPNTM 240

Query: 241 IDYNLIEIGDLNPFQVLKKYNLPSTELATISKLYFEKQKEENRKNIMKKRSVSKEGFMTX 300
           IDYNLIEIGDLNPFQVLKKYNLPSTELATISKLYFEKQKEENRKNIMKKRSVSKEGFMT 
Sbjct: 241 IDYNLIEIGDLNPFQVLKKYNLPSTELATISKLYFEKQKEENRKNIMKKRSVSKEGFMTS 300

Query: 301 XXXXXXXXXXXXXXXFHTTTNNRHSSMVSKQDTNAILMNTTSTRSDEKVMKPLNEYEPDR 360
                          FHTTTNNRHSSMVSKQDTNAILMNTTSTRSDEKVMKPLNEYEPDR
Sbjct: 301 ISSNSVSSKISRQSSFHTTTNNRHSSMVSKQDTNAILMNTTSTRSDEKVMKPLNEYEPDR 360

Query: 361 KVLASIDINKNINVNAIEKKRPVEHQYSYEKSKIHISESRESQSSTVEKPHTFQDNKEGQ 420
           KVLASIDINKNINVNAIEKKRPVEHQYSYEKSKIHISESRESQSSTVEKPHTFQDNKEGQ
Sbjct: 361 KVLASIDINKNINVNAIEKKRPVEHQYSYEKSKIHISESRESQSSTVEKPHTFQDNKEGQ 420

Query: 421 KIVKKVEIVEPPTSMTNRKSSKSIVSVNDIEYERIELLGRGGSSKVYKVKNTNNNRVYAL 480
           KIVKKVEIVEPPTSMTNRKSSKSIVSVNDIEYERIELLGRGGSSKVYKVKNTNNNRVYAL
Sbjct: 421 KIVKKVEIVEPPTSMTNRKSSKSIVSVNDIEYERIELLGRGGSSKVYKVKNTNNNRVYAL 480

Query: 481 KRVVFDEFDDTSVDAFKGXXXXXXXXXXXXXXXXXIQYQMDNGVLYLVMECGDHDLSQIL 540
           KRVVFDEFDDTSVDAFKG                 IQYQMDNGVLYLVMECGDHDLSQIL
Sbjct: 481 KRVVFDEFDDTSVDAFKGEIELLKKLENEKRVVKLIQYQMDNGVLYLVMECGDHDLSQIL 540

Query: 541 NQRANMPLDVDFIRYYSREMLKCVKVVHDAGIVHSDLKPANFVLVKGILKIIDFGIANAV 600
           NQRANMPLDVDFIRYYSREMLKCVKVVHDAGIVHSDLKPANFVLVKGILKIIDFGIANAV
Sbjct: 541 NQRANMPLDVDFIRYYSREMLKCVKVVHDAGIVHSDLKPANFVLVKGILKIIDFGIANAV 600

Query: 601 PDHTVNIYRDTQIGTPNYMAPEALVALNEVSNVEKKNRWRVGKPSDIWSCGCIMYQMFYG 660
           PDHTVNIYRDTQIGTPNYMAPEALVALNEVSNVEKKNRWRVGKPSDIWSCGCIMYQMFYG
Sbjct: 601 PDHTVNIYRDTQIGTPNYMAPEALVALNEVSNVEKKNRWRVGKPSDIWSCGCIMYQMFYG 660

Query: 661 RPPYGAFQNQNRLLAIMNPEVKIVFSEKTSKNERVPKSALDTMKACLIRSPEKRWTADEI 720
           RPPYGAFQNQNRLLAIMNPEVKIVFSEKTSKNERVPKSALDTMKACLIRSPEKRWTADEI
Sbjct: 661 RPPYGAFQNQNRLLAIMNPEVKIVFSEKTSKNERVPKSALDTMKACLIRSPEKRWTADEI 720

Query: 721 LDASFLNPVLVTPYIVRDLIRNAVYYGSDQGQVSEDKITELADDVLNRLADFRL 774
           LDASFLNPVLVTPYIVRDLIRNAVYYGSDQGQVSEDKITELADDVLNRLADFRL
Sbjct: 721 LDASFLNPVLVTPYIVRDLIRNAVYYGSDQGQVSEDKITELADDVLNRLADFRL 774

>Kpol_1032.10 s1032 (24479..26854) [2376 bp, 791 aa] {ON}
           (24479..26854) [2376 nt, 792 aa]
          Length = 791

 Score =  647 bits (1669), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 370/826 (44%), Positives = 498/826 (60%), Gaps = 114/826 (13%)

Query: 6   NTRFSKSGGI--RNDTIQTYNNDSDSDEKLTVLPKLSNFGSALISEKNENITRXXXXXXX 63
           N+++S++ G+   ND  +   +DSD DE++T  PKLSNFGSAL++ + ENIT+       
Sbjct: 23  NSKYSRNEGMIEGNDNNKNIQDDSD-DEQITGFPKLSNFGSALLTSEKENITKNKLTNTN 81

Query: 64  XXXXXXXXXX-----XTLTKNNEIGTINSN------------------FNNGQIASPKFK 100
                           TL+ N   G +N+                    + G     +FK
Sbjct: 82  LTLNDDKSLAYDNYSSTLSIN-RAGNVNTTSSMSKANNNYEYNNSSENISTGNSTFQRFK 140

Query: 101 GIKNLIDQEMTVKHNERRKGRRIFRKIELNSLGKAKRTNLDYTIAPSHMTEVNYDQYQEN 160
           G+   I  E+  K+ ERRK RR F + ++              + P+  T +  ++  +N
Sbjct: 141 GLHESIKDELNTKNLERRKTRRFFNRTKMG------------VLGPAMRTNLENEKLGKN 188

Query: 161 D-HKTFESMNDMENDIPKYKTTTDSILSNNKSTDNLAGKNSKNHVTXXXXXXXXXXXXXX 219
             H+T      +E  I KY      I S++    +        H                
Sbjct: 189 SKHET------IEEKINKYDQPAHLISSSSTVASSSYTSYHDTH---------------- 226

Query: 220 XNPFTDSNTYNHSNTSLPNTMIDYNLIEIGDLNPFQVLKKYNLPSTELATISKLYFEKQK 279
                       S      T I+Y+LI+ G+LNP Q +KK NLP+TEL TISKLYFE+Q+
Sbjct: 227 -----------QSINQTSQTTINYDLIDFGELNPVQYIKKNNLPTTELPTISKLYFERQR 275

Query: 280 EENRKNIMKKRSVSKEGFMTXXXXXXXXXXXXXXXXFHTTTNNRHSSMV---SKQDTNAI 336
            E+       R ++ +   +                F+  ++ ++ S     +  DT+A+
Sbjct: 276 AES-------RKIALKKHSSSKELLFSSSSSALKNSFNQISDAQNESKCISNNTGDTDAL 328

Query: 337 LMNTTSTRSDEKVMKPLNEYE------------------------PDRKVLASIDINKNI 372
                S + + +     N Y                           R+ L+SI++N N 
Sbjct: 329 SEPKISDKENSRSTWSRNGYAILKDDYINNLEYYKNPSGYSSSLNKKREALSSINVNTNH 388

Query: 373 NVNAIEKKRPVEHQYSYE--KSKIHISESRES--QSSTVEKPHTFQDNKEGQKIVKKVEI 428
           N +  E      ++ S +  +S+I    +R S  +   VE+ ++   +K G+K   KVEI
Sbjct: 389 NHSYQELGDNKRNKISTKGIESEIEHVAARNSMLEQQKVEQLNSANIHKHGKK---KVEI 445

Query: 429 VEPPTSMTNRKSSKSIVSVNDIEYERIELLGRGGSSKVYKVKNTNNNRVYALKRVVFDEF 488
           +EP ++  NR +SKS+VSVN +EYE+IELLGRGGSSKVYKVKN +NN+++ALKRV+FDEF
Sbjct: 446 IEPKSASANRIASKSVVSVNGVEYEKIELLGRGGSSKVYKVKNVHNNKIFALKRVMFDEF 505

Query: 489 DDTSVDAFKGXXXXXXXXXXXXXXXXXIQYQMDNGVLYLVMECGDHDLSQILNQRANMPL 548
           D++S+D+FKG                 IQ+QM++GVL L+MECGDHDLSQILNQR NMPL
Sbjct: 506 DESSIDSFKGEIELLKKLENEKRVVTLIQHQMESGVLLLIMECGDHDLSQILNQRMNMPL 565

Query: 549 DVDFIRYYSREMLKCVKVVHDAGIVHSDLKPANFVLVKGILKIIDFGIANAVPDHTVNIY 608
           D++FIR+++REMLKCVKVVHDAGIVHSDLKPANFV VKGILKIIDFGIANAVPDHTVNIY
Sbjct: 566 DIEFIRFHAREMLKCVKVVHDAGIVHSDLKPANFVFVKGILKIIDFGIANAVPDHTVNIY 625

Query: 609 RDTQIGTPNYMAPEALVALNEVSNVEKKNRWRVGKPSDIWSCGCIMYQMFYGRPPYGAFQ 668
           R+TQIGTPNYMAPEALVA+N   + +++N+W+VGKPSDIWSCGCI+YQMFYGRPPYG+FQ
Sbjct: 626 RETQIGTPNYMAPEALVAMNSQQDSDQQNKWKVGKPSDIWSCGCILYQMFYGRPPYGSFQ 685

Query: 669 NQNRLLAIMNPEVKIVFSEKTSKNERVPKSALDTMKACLIRSPEKRWTADEILDASFLNP 728
            QNRLLAIMNP VKIVFSEKTS NER+P+SAL+TMKACLIR+P+KRW  D++L+ SF NP
Sbjct: 686 GQNRLLAIMNPNVKIVFSEKTSNNERIPRSALETMKACLIRNPDKRWAVDQVLEGSFFNP 745

Query: 729 VLVTPYIVRDLIRNAVYYGSDQGQVSEDKITELADDVLNRLADFRL 774
           V+VT +I+RDLI+NAV YG+DQ  V+++KITELADDVLNRLADFRL
Sbjct: 746 VMVTSFIIRDLIKNAVNYGADQRYVTDEKITELADDVLNRLADFRL 791

>NCAS0I02080 Chr9 (390551..392875) [2325 bp, 774 aa] {ON} Anc_3.162
          Length = 774

 Score =  586 bits (1510), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 324/695 (46%), Positives = 439/695 (63%), Gaps = 74/695 (10%)

Query: 98  KFKGIKNLIDQEMTVKHNERRKGRRIFRKIELNSLGKAKRTNLDYTIAPSHMTEVNYDQY 157
           K K ++  + +E+T ++ ERR  R  F     N+LG AKR +   T A S  TE   D+Y
Sbjct: 136 KIKSLQQTMKEELTSRYIERRNKR--FLTSRRNNLGPAKRAS---TSAISASTE---DRY 187

Query: 158 QEND-HKTFESMNDMENDIPKYKTTTDS-ILSNNKSTDNLAGK-NSKNHVTXXXXXXXXX 214
           QEND H   E          KY T  DS IL+  K    L+   N +N            
Sbjct: 188 QENDKHSNNE----------KYSTQDDSNILA--KQVGRLSSPLNRQNRA---------- 225

Query: 215 XXXXXXNPFTDSNTYNHSNTSLPNTMIDYNLIEIGDLNPFQVLKKYNLPSTELATISKLY 274
                   F  SN  + +N   P   +DY+ IE G+L PF+ LKK++LP++EL  IS++Y
Sbjct: 226 --------FQSSNG-DDTNMKEP---VDYSSIEFGELTPFEYLKKHDLPTSELPYISRIY 273

Query: 275 FEKQKEENRKNIMKKRSVSKEGFMTXXXXXXXXXXXXXXXXFHTTTN------------- 321
           FEKQK ENR+ +++KR  S +  ++                 + TTN             
Sbjct: 274 FEKQKLENRQTVLRKRRFSSKESLSLGTTSSLAPYSNSK---NNTTNQVSRDLSLPRRKI 330

Query: 322 NRHSSMVSKQ--DTNAILMNTTSTRSDEKVMKPLNEYEPDRKVLASIDINKNINVNAIEK 379
           +  SS +SKQ   +N  L  + S      +     ++E   K+  +  I+ N+N  + ++
Sbjct: 331 SDTSSKISKQILKSNINLSESGSHGFPPDLQSIQRQHESAEKLSRAPLIDLNVNNVSPKR 390

Query: 380 KRPVEHQYSYEKSKIHISESRESQSSTVEKPHTFQDNKEGQKIVKKVEIVEPPTSMTNRK 439
              +   + +  S++++ +  +     V          E Q   KKVEIVEP  S + + 
Sbjct: 391 MDKLRETHKFSDSRLNVQDFSKKTDVVV---------YEKQAPRKKVEIVEPKRSHS-KL 440

Query: 440 SSKSIVSVNDIEYERIELLGRGGSSKVYKVKNTNNNRVYALKRVVFDEFDDTSVDAFKGX 499
           + ++ ++VND EYE+IELLGRGGSS+VYKVKN+  N+V+ALKRV FDEFDD+SVD FKG 
Sbjct: 441 AKRNTITVNDTEYEKIELLGRGGSSRVYKVKNS-QNKVFALKRVSFDEFDDSSVDGFKGE 499

Query: 500 XXXXXXXXXXXXXXXXIQYQMDNGVLYLVMECGDHDLSQILNQRANMPLDVDFIRYYSRE 559
                             YQMD+GVL+L+MECGDHDLSQIL+QR++MPLD+DF+RY++RE
Sbjct: 500 IELLEKLSNESRVVKLFDYQMDSGVLFLIMECGDHDLSQILSQRSDMPLDMDFVRYHARE 559

Query: 560 MLKCVKVVHDAGIVHSDLKPANFVLVKGILKIIDFGIANAVPDHTVNIYRDTQIGTPNYM 619
           +++C+K+VHDAGIVHSDLKPANFV VKGILKIIDFGIANA+PDHTVNIYR+ QIGTPNYM
Sbjct: 560 VVRCIKIVHDAGIVHSDLKPANFVFVKGILKIIDFGIANAIPDHTVNIYRENQIGTPNYM 619

Query: 620 APEALVALNEVSNVEKKNRWRVGKPSDIWSCGCIMYQMFYGRPPYGAFQNQNRLLAIMNP 679
           APEALVA+N  +  +  N+W+VGKPSDIWSCGCI+YQM YGRPPY  FQ QNRLLAIMNP
Sbjct: 620 APEALVAMNYTNENDGGNKWKVGKPSDIWSCGCIIYQMIYGRPPYAGFQGQNRLLAIMNP 679

Query: 680 EVKIVFSEKTSKNERVPKSALDTMKACLIRSPEKRWTADEILDASFLNPVLVTPYIVRDL 739
           +VK++FSEKT+ NE +P+S +D MK CL R PEKRW+ D++L++ F NP++VTP+ ++DL
Sbjct: 680 DVKVIFSEKTANNESIPRSLIDLMKGCLTRDPEKRWSVDQVLESPFFNPIVVTPFFIKDL 739

Query: 740 IRNAVYYGSDQGQVSEDKITELADDVLNRLADFRL 774
           I+NAV YG DQ +VS +KI ELA+DVL RL DF++
Sbjct: 740 IKNAVRYGVDQREVSNEKIEELANDVLGRLTDFKM 774

>TDEL0D04600 Chr4 (843530..845917) [2388 bp, 795 aa] {ON} Anc_3.162
           YDL028C
          Length = 795

 Score =  572 bits (1473), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 297/574 (51%), Positives = 390/574 (67%), Gaps = 49/574 (8%)

Query: 240 MIDYNLIEIGDLNPFQVLKKYNLPSTELATISKLYFEKQKEENRKNIMKKRSVSKEGFMT 299
           ++DY  I+ GD+NP Q LK +NL S+EL  +SK+YFE+Q+EE  +  ++K   S+E    
Sbjct: 232 VLDYKSIDFGDMNPVQYLKLHNLSSSELPKLSKVYFERQREEIHQMALQKSISSREALTN 291

Query: 300 XXXXXXXXXXXXXXXXFHTTTNNRHSSMV-----SKQDTNAILMNTTSTRS--DEKVMKP 352
                                  R SSM         DT+      TS +S     +  P
Sbjct: 292 KVQRSFSSISSSGNSI------RRESSMPLYPRRKLSDTSVSSAAKTSFQSSFSSPLAYP 345

Query: 353 LNEYEPDRKVLAS---IDINKNINVNAIEKKR-PVEHQYSYEKSKIHISESRESQSSTVE 408
              +  D+ V+ S    D  KN+     ++++  +E  +   ++  +I  +R SQ S ++
Sbjct: 346 KKNFLIDQPVVTSKPAADHGKNLTKQYAQREQYTLESSFKKREALANIDINRNSQES-LQ 404

Query: 409 KPHTFQD-----------------NKE--------GQKIVKKVEIVEPPTSMTNRKSSKS 443
           +P  F+                  NKE          +  K+VEI+EP  S    +S K+
Sbjct: 405 QPKRFKPIRTQEQLSESHLPEPYVNKEEYLNREPPKPRATKRVEILEPKPSQG--QSRKN 462

Query: 444 IVSVNDIEYERIELLGRGGSSKVYKVKNTNNNRVYALKRVVFDEFDDTSVDAFKGXXXXX 503
           +V VND+EYE++ELLGRGGSSKVYKV++ +NN VYALKRVVFDEFDD+SV  FKG     
Sbjct: 463 VVKVNDVEYEKVELLGRGGSSKVYKVRDRSNN-VYALKRVVFDEFDDSSVSGFKGEIELL 521

Query: 504 XXXXXXXXXXXXIQYQMDNGVLYLVMECGDHDLSQILNQRANMPLDVDFIRYYSREMLKC 563
                       + ++M++GVLYL+MECGDHDLS+ILN RA MPLD++F+RY++REML+C
Sbjct: 522 KKLENQNRVVQLVDHEMEHGVLYLIMECGDHDLSRILNHRAGMPLDMEFVRYHAREMLRC 581

Query: 564 VKVVHDAGIVHSDLKPANFVLVKGILKIIDFGIANAVPDHTVNIYRDTQIGTPNYMAPEA 623
           VKVVHD+GIVHSDLKPANFV VKGILKIIDFGIANAVPDHTVNIYR+ QIGTPNYMAPEA
Sbjct: 582 VKVVHDSGIVHSDLKPANFVFVKGILKIIDFGIANAVPDHTVNIYRENQIGTPNYMAPEA 641

Query: 624 LVALNEVSNVEK---KNRWRVGKPSDIWSCGCIMYQMFYGRPPYGAFQNQNRLLAIMNPE 680
           LVA+N   + EK   +NRW+VGKPSDIWSCGCI+YQM YGRPPYG FQ QNRLLAIMNP+
Sbjct: 642 LVAMNYTQDDEKYQQQNRWKVGKPSDIWSCGCIIYQMIYGRPPYGGFQGQNRLLAIMNPD 701

Query: 681 VKIVFSEKTSKNERVPKSALDTMKACLIRSPEKRWTADEILDASFLNPVLVTPYIVRDLI 740
           VKI+FS+KTS++E +P+SALDTMKACL R+P+KR T DE+L+++FL P++VTP+ +RDLI
Sbjct: 702 VKIIFSDKTSRDETIPRSALDTMKACLTRNPDKRLTVDEVLESNFLKPLMVTPFFIRDLI 761

Query: 741 RNAVYYGSDQGQVSEDKITELADDVLNRLADFRL 774
           +NAV YG+DQ +VS++K+ ELADDVL+RL+DFRL
Sbjct: 762 KNAVRYGADQKEVSKEKVEELADDVLSRLSDFRL 795

 Score = 36.2 bits (82), Expect = 0.37,   Method: Compositional matrix adjust.
 Identities = 21/40 (52%), Positives = 27/40 (67%), Gaps = 2/40 (5%)

Query: 16 RNDTIQTYNNDSDSDEKLTVLPKLSNFGSALISEKNENIT 55
          R  +   Y +DSD DEK+T  PKLS+FG AL+ EK EN+ 
Sbjct: 14 RKKSHAAYKDDSD-DEKITGPPKLSDFGVALLMEK-ENMA 51

>KLTH0F06468g Chr6 (559256..561769) [2514 bp, 837 aa] {ON} similar
           to uniprot|P54199 Saccharomyces cerevisiae YDL028C MPS1
           Dual-specificity kinase required for spindle pole body
           (SPB) duplication and spindle checkpoint function
           substrates include SPB proteins Spc42p Spc110p and
           Spc98p mitotic exit network protein Mob1p and checkpoint
           protein Mad1p
          Length = 837

 Score =  566 bits (1459), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 299/585 (51%), Positives = 376/585 (64%), Gaps = 54/585 (9%)

Query: 238 NTMIDYNLIEIGDLNPFQVLKKYNLPSTELATISKLYFEKQKEENRKNIMKKRSVSKEGF 297
           +T I+Y+ IE GDLNP+Q LKK+N+P+TEL  IS+LYFE+QK ENRK  ++K   +K+ F
Sbjct: 259 HTSINYDNIEFGDLNPYQYLKKHNIPTTELPNISRLYFERQKGENRKTALRKNIAAKDAF 318

Query: 298 MTXXXXXXXXXXXXXXXXFHTTTNNRHSSMVSKQDTNAILMNTT--------STRSDEKV 349
            T                 H     R  S+  +Q    I  + T        S  S  K 
Sbjct: 319 QTRLTSASLSNSPLLK---HVDLIKREQSIPKRQPRRKISDHATNNDSKAWSSPVSSSKG 375

Query: 350 MK--PLNE---------YE----PDRKVLASI-------DINKNINVNAIEKKR------ 381
           +K  P  +         YE    P+R    SI       +IN N N + ++ KR      
Sbjct: 376 LKTAPSRDGTSPRASEMYENIERPERDTFGSIRRREALSNININSNYHQLQNKRTKYSTE 435

Query: 382 -----------PVEHQYSYEKSKIHISESRESQSSTVEKPHTFQDNKEGQKIVKKVEIVE 430
                      P EH    E+   H  + R S  +  E+ H   +  E  K  + + +  
Sbjct: 436 NLEEARGIHRPPFEHSVQEERFANHGFKHR-SPPAVPERKHV--EIVEPLKTTESIPLKP 492

Query: 431 PPTSMTNRKSSKSIVSVNDIEYERIELLGRGGSSKVYKVKNTNNNRVYALKRVVFDEFDD 490
           P TS  +    K  + VN  EYE++ELLGRGGSSKVYKVKN  NN+VYALKRV FDEFDD
Sbjct: 493 PATSGDSYNRRKPTIYVNGTEYEKLELLGRGGSSKVYKVKNVANNKVYALKRVSFDEFDD 552

Query: 491 TSVDAFKGXXXXXXXXXXXXXXXXXIQYQMDNGVLYLVMECGDHDLSQILNQRANMPLDV 550
           +S++ FKG                 I ++MD+GVLY VMECGDHDLS  L  R+ M LDV
Sbjct: 553 SSIEGFKGEIELLKKLETKPRVVKLIDHEMDHGVLYEVMECGDHDLSHTLALRSGMGLDV 612

Query: 551 DFIRYYSREMLKCVKVVHDAGIVHSDLKPANFVLVKGILKIIDFGIANAVPDHTVNIYRD 610
           +F+R++S+EMLKCVKVVHD+GIVHSDLKPANFV VKGILKIIDFGIANAVP+HTVNIYR+
Sbjct: 613 EFVRFHSQEMLKCVKVVHDSGIVHSDLKPANFVFVKGILKIIDFGIANAVPEHTVNIYRE 672

Query: 611 TQIGTPNYMAPEALVALNEV-SNVEKKNRWRVGKPSDIWSCGCIMYQMFYGRPPYGAFQN 669
           TQIGTPNYMAPEALVA+N       ++NRW+VGKPSDIWSCGCI+YQM YGRPPYG FQ 
Sbjct: 673 TQIGTPNYMAPEALVAMNYTQGQPAEQNRWKVGKPSDIWSCGCIIYQMIYGRPPYGGFQG 732

Query: 670 QNRLLAIMNPEVKIVFSEKTSKNERVPKSALDTMKACLIRSPEKRWTADEILDASFLNPV 729
           QNRLLAIMNPEVKIV+ EKTS  + VPK+A+DTMKACL R+PEKRW+ DE+L+  F+ P+
Sbjct: 733 QNRLLAIMNPEVKIVYPEKTSNGDVVPKTAIDTMKACLERNPEKRWSVDEVLNGPFVKPI 792

Query: 730 LVTPYIVRDLIRNAVYYGSDQGQVSEDKITELADDVLNRLADFRL 774
            VT + +RDLI+N+V YG++Q ++S +KI ELA+DV +RLADFRL
Sbjct: 793 AVTHFFIRDLIKNSVKYGANQREISNEKIEELAEDVWHRLADFRL 837

 Score = 38.1 bits (87), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 19/39 (48%), Positives = 26/39 (66%), Gaps = 1/39 (2%)

Query: 16 RNDTIQTYNNDSDSDEKLTVLPKLSNFGSALISEKNENI 54
          R  ++Q+   D   DE +   PKLSNFGSAL+S+K EN+
Sbjct: 24 RRTSVQSLARDDSDDENMLGPPKLSNFGSALLSDK-ENV 61

>ADR317C Chr4 complement(1263080..1265539) [2460 bp, 819 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDL028C
           (MPS1)
          Length = 819

 Score =  563 bits (1451), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 341/852 (40%), Positives = 463/852 (54%), Gaps = 168/852 (19%)

Query: 24  NNDSDSDEKLTVLPKLSNFGSALISEK-NENITRXXXXXXXXXXXXXXXXXXTLTKNNEI 82
           N+DSD D  L   PKLSNFGSAL+++K NE  T                       +   
Sbjct: 35  NSDSDDDHPLGP-PKLSNFGSALLTDKENETPTYLRRSGTSLQGGNATATSGHTKPSTFT 93

Query: 83  GTIN---------SNFNNGQ-----------------IASPKFKGIKNLIDQEMTVKHNE 116
           GT+N         S+ +  Q                 ++S +++ I+  +  E+  +   
Sbjct: 94  GTMNTEDSHSTLFSSMSKHQPSMTTVDAERTAPGDDGLSSHRYQVIQQSMKDEILSRQGT 153

Query: 117 RRKGRRIFRKIELNSLGKAKR----TNLDYTIAPSHMTEVNYDQYQENDHKTFESMNDME 172
           RR  R I  +  L +LG AKR    TN +++      + +++D+ ++  H+        E
Sbjct: 154 RRSRRFITSR--LATLGPAKRNSTTTNFEFS------SNISHDEPRDVSHQ--------E 197

Query: 173 NDIPKYKTTTDSILSNNKSTDNLAGKNSKNHVTXXXXXXXXXXXXXXXNPFTDSNTYNHS 232
            ++     +   +L+NN     L  +    H                     D  +++ +
Sbjct: 198 GNVSTSSNSNSGVLNNNGYNVFLDTEERARH--------------------DDKESHSAA 237

Query: 233 NTSLPNTMIDYNLIEIGDLNPFQVLKKYNLPSTELATISKLYFEKQKEENRKNIMKKRSV 292
             S    + DY  I  GDLNP+Q LKK+NLP++EL  IS++YFE QK ENR+  ++K  +
Sbjct: 238 RQS---GLSDYGNISFGDLNPYQYLKKHNLPTSELPNISRIYFEMQKRENRRAAVRKNVL 294

Query: 293 SKEGFMTXXXXXXXXXXXXXXXXFH-----TTTNNRHSSMVSKQDTNAILMNTTSTR--- 344
           +  G                           + ++  + +   Q  N+++      R   
Sbjct: 295 NGSGGQVAQLPTNNSAIASTAVALKEANGIASISSGSNKLTPPQAANSMIKRDRQPRRKH 354

Query: 345 -----------------------SDEKVMKPLNE----YEP--------DRKVLASIDIN 369
                                  +D +   P+ +    YEP         R+ L S+D+N
Sbjct: 355 SDASVSSFSKLLSSPISAGAPNYADSQKHTPVQKNSTPYEPLLINQNTKKREALNSLDVN 414

Query: 370 KNINVNAIEKKRPVEHQYSYEKSKIHISESRESQSSTVEKPHTFQDNKEGQKIVKKVEIV 429
            N + + I KK+ V+  + Y K                               VKKVEIV
Sbjct: 415 ANRHPSIITKKQKVDELHDYLK------------------------KAPAAASVKKVEIV 450

Query: 430 EP------------PTS---------MTNRKSSKSIVSVNDIEYERIELLGRGGSSKVYK 468
           EP            P S         +  RK  + +++VN  EYE++ELLGRGGSSKVYK
Sbjct: 451 EPVRDPVITTIPLKPPSAEVPANVHQLPQRK--RQVITVNGSEYEKVELLGRGGSSKVYK 508

Query: 469 VKNTNNNRVYALKRVVFDEFDDTSVDAFKGXXXXXXXXXXXXXXXXXIQYQMDNGVLYLV 528
           V+N++N R+YALKRV FDEFDD S D FKG                 I ++M++GVLY+V
Sbjct: 509 VRNSSN-RIYALKRVSFDEFDDASADGFKGEIELLKKLENQTRVVKLIDHEMNHGVLYVV 567

Query: 529 MECGDHDLSQILNQRANMPLDVDFIRYYSREMLKCVKVVHDAGIVHSDLKPANFVLVKGI 588
           MECGDHDLSQ+L QR++MPLD++F+RY+++EMLKCVKVVHDAGIVHSDLKPANFV VKGI
Sbjct: 568 MECGDHDLSQVLAQRSSMPLDIEFVRYHAQEMLKCVKVVHDAGIVHSDLKPANFVFVKGI 627

Query: 589 LKIIDFGIANAVPDHTVNIYRDTQIGTPNYMAPEALVALNEVSNVEK------KNRWRVG 642
           LKIIDFGIANAVPDHTVNIYRDTQIGTPNYMAPEALVA+N   + ++       NRW+VG
Sbjct: 628 LKIIDFGIANAVPDHTVNIYRDTQIGTPNYMAPEALVAMNYTQDSDQIQQEMHHNRWKVG 687

Query: 643 KPSDIWSCGCIMYQMFYGRPPYGAFQNQNRLLAIMNPEVKIVFSEKTSKNERVPKSALDT 702
           KPSDIWSCGCIMYQM YG+PPYG+FQ QNRLLAIMNPEVKIV+ EKT   + VP++ALDT
Sbjct: 688 KPSDIWSCGCIMYQMIYGKPPYGSFQGQNRLLAIMNPEVKIVYPEKTPTGDFVPRTALDT 747

Query: 703 MKACLIRSPEKRWTADEILDASFLNPVLVTPYIVRDLIRNAVYYGSDQGQVSEDKITELA 762
           +KACL R+PE+RWT DE+L   F+ P+ VT + +RDLI+NAV YGSDQ  VS++K+  LA
Sbjct: 748 IKACLERNPERRWTVDELLRGPFIKPITVTHFFIRDLIKNAVKYGSDQRYVSKEKVENLA 807

Query: 763 DDVLNRLADFRL 774
           DDV +RL+DFRL
Sbjct: 808 DDVWHRLSDFRL 819

>Kwal_33.14167 s33 (554863..557379) [2517 bp, 838 aa] {ON} YDL028C
           (MPS1) - serine/threonine/tyrosine protein kinase (dual
           specificity), able to autophosphorylate as well as act
           on Mad1p. A mutation predicted to abolish kinase
           function eliminates in vitro protein kinase activity and
           behaves like a null mutation in vivo. [contig 105] FULL
          Length = 838

 Score =  560 bits (1444), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 299/604 (49%), Positives = 390/604 (64%), Gaps = 81/604 (13%)

Query: 232 SNTSLPNTMIDYNLIEIGDLNPFQVLKKYNLPSTELATISKLYFEKQKEENRKNIMKKRS 291
           S++   ++ I+Y  +E GDLNP+Q LKKYNLP+TEL  IS++YFE+QK +NRK  ++K  
Sbjct: 255 SHSPFISSTINYEDVEFGDLNPYQYLKKYNLPTTELPNISRIYFERQKGQNRKAALRKSI 314

Query: 292 VSKEGFMTXXXXXXXXXXXXXXXXFHTTTNNRHSSMVS----KQDTNAIL------MNTT 341
            SK+                       TT++ HS  V     ++D +A        ++ +
Sbjct: 315 ASKDAIQNRI----------------ATTSSPHSPPVDADAIRRDNSAFKRQPRRKISES 358

Query: 342 STRSDEKVM---------------KPLNEYEPD-------------------RKVLASID 367
           +T +D K                 +  ++Y+ D                   R+ L++I+
Sbjct: 359 ATSNDPKAWSSPFSGINNPTVASARRTDQYQADEKYSNTEIPDPNAFDSFRRREALSNIN 418

Query: 368 INKNINVNAIEKKRPVEHQYSYEKSKIHISESRESQS--STVEKPHTFQDNKEGQKIVKK 425
           IN + +    + K+P    Y+ ++       S E++S  S  E+P  F+         K 
Sbjct: 419 IN-SYSAAQPQHKKPKYSDYNPQEFGRLPRPSLENRSPISNKEEPQ-FKHRSPPLIPGKH 476

Query: 426 VEIVEP-----------PTS---MTNRKSSKSIVSVNDIEYERIELLGRGGSSKVYKVKN 471
           VEIVEP           P S   +  RK  + +V VN  EYE++ELLGRGG+SKVYKVKN
Sbjct: 477 VEIVEPIRTKESIPLKPPASSDDINGRK--RPVVYVNGTEYEKLELLGRGGTSKVYKVKN 534

Query: 472 TNNNRVYALKRVVFDEFDDTSVDAFKGXXXXXXXXXXXXXXXXXIQYQMDNGVLYLVMEC 531
            NNN+VYALKRV FDEFDD+S+D FKG                 I ++MD+GVLY+VMEC
Sbjct: 535 ANNNKVYALKRVSFDEFDDSSIDGFKGEIELLKKLETQPRVVKLIDHEMDHGVLYVVMEC 594

Query: 532 GDHDLSQILNQRANMPLDVDFIRYYSREMLKCVKVVHDAGIVHSDLKPANFVLVKGILKI 591
           GDHDLSQ L  R+ MPLDV+F+RY+++EMLKCVKVVHDAGIVHSDLKPANFV VKGILKI
Sbjct: 595 GDHDLSQTLAHRSGMPLDVEFVRYHAQEMLKCVKVVHDAGIVHSDLKPANFVFVKGILKI 654

Query: 592 IDFGIANAVPDHTVNIYRDTQIGTPNYMAPEALVALNEVSN-VEKKNRWRVGKPSDIWSC 650
           IDFGIANAVP+HTVNIYR+TQIGTPNYMAPEALVA+N   N   +++RW+VGKPSDIWSC
Sbjct: 655 IDFGIANAVPEHTVNIYRETQIGTPNYMAPEALVAMNYTHNQAPEQSRWKVGKPSDIWSC 714

Query: 651 GCIMYQMFYGRPPYGAFQNQNRLLAIMNPEVKIVFSEKTSKNERVPKSALDTMKACLIRS 710
           GCI+YQM YGRPPYG FQ QNRLLAIMNPEVKIV+ EKTS  + VPK+A+DTMKACL R+
Sbjct: 715 GCIIYQMIYGRPPYGGFQGQNRLLAIMNPEVKIVYPEKTSNGDTVPKTAIDTMKACLERN 774

Query: 711 PEKRWTADEILDASFLNPVLVTPYIVRDLIRNAVYYGSDQGQVSEDKITELADDVLNRLA 770
           P KRWT +E+ + SF+ PV VT + +RDLI N+V YG++Q ++S  K+ ELA+DV +RL 
Sbjct: 775 PNKRWTVEEVANGSFVKPVSVTHFFIRDLIENSVRYGANQKEISSAKVEELAEDVWHRLE 834

Query: 771 DFRL 774
           +FRL
Sbjct: 835 EFRL 838

 Score = 33.1 bits (74), Expect = 3.0,   Method: Compositional matrix adjust.
 Identities = 18/39 (46%), Positives = 23/39 (58%), Gaps = 1/39 (2%)

Query: 16 RNDTIQTYNNDSDSDEKLTVLPKLSNFGSALISEKNENI 54
          R   I +   D   DE +   P LSNFGSAL+S+K EN+
Sbjct: 25 RRPNIHSTARDDSDDENMLGPPTLSNFGSALLSDK-ENV 62

>ZYRO0B04906g Chr2 (395546..398089) [2544 bp, 847 aa] {ON} similar
           to uniprot|P54199 Saccharomyces cerevisiae YDL028C MPS1
           Dual-specificity kinase required for spindle pole body
           (SPB) duplication and spindle checkpoint function
           substrates include SPB proteins Spc42p Spc110p and
           Spc98p mitotic exit network protein Mob1p and checkpoint
           protein Mad1p
          Length = 847

 Score =  549 bits (1414), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 269/437 (61%), Positives = 327/437 (74%), Gaps = 25/437 (5%)

Query: 354 NEYEPDRKVLASIDINKNINVNAIEKKRPVEHQYSYEKS---KIHISESRESQSSTVEKP 410
           N+YEP+ K     + ++N N N  EK   +E   S        IH S  +E++    E P
Sbjct: 420 NDYEPESKRYDLFEDHRNGNNNKDEKPISLERLPSEAPPVAIPIHPSVIQENEFHHREAP 479

Query: 411 HTFQDNKEGQKIVKKVEIVEPPTSMTNRKSS--------KSIVSVNDIEYERIELLGRGG 462
                      +VKKVEIVEP     ++  S        ++  +VND+EYE+IELLGRGG
Sbjct: 480 KP--------PVVKKVEIVEPEKRTDSKGKSSNGEALTRRNATTVNDVEYEKIELLGRGG 531

Query: 463 SSKVYKVKNTNNNRVYALKRVVFDEFDDTSVDAFKGXXXXXXXXXXXXXXXXXIQYQMDN 522
           SSKVYKVK+ NNN++YALKRVVFDEFDD+SV+ FKG                   Y+M++
Sbjct: 532 SSKVYKVKD-NNNKLYALKRVVFDEFDDSSVNGFKGEIELLNKLKDKTRVVKLFDYEMEH 590

Query: 523 GVLYLVMECGDHDLSQILNQRANMPLDVDFIRYYSREMLKCVKVVHDAGIVHSDLKPANF 582
           GVLYL+MECGDHDLSQILNQRA MPLD++F+RY++REMLKCVKVVHDAGIVHSDLKPANF
Sbjct: 591 GVLYLIMECGDHDLSQILNQRAGMPLDIEFVRYHAREMLKCVKVVHDAGIVHSDLKPANF 650

Query: 583 VLVKGILKIIDFGIANAVPDHTVNIYRDTQIGTPNYMAPEALVALNEVSN-----VEKKN 637
           V VKGILKIIDFGIANAVPDHTVNIYR+TQIGTPNYMAPEALVA+N          +++N
Sbjct: 651 VFVKGILKIIDFGIANAVPDHTVNIYRETQIGTPNYMAPEALVAMNYTGQNDGDKYKQQN 710

Query: 638 RWRVGKPSDIWSCGCIMYQMFYGRPPYGAFQNQNRLLAIMNPEVKIVFSEKTSKNERVPK 697
           RW+VGKPSD+WSCGCI+YQM YGRPPYG FQ QNRLLAIMNPEVKI+FSEKT+ +E VP+
Sbjct: 711 RWKVGKPSDVWSCGCIIYQMIYGRPPYGGFQGQNRLLAIMNPEVKIIFSEKTANDEAVPR 770

Query: 698 SALDTMKACLIRSPEKRWTADEILDASFLNPVLVTPYIVRDLIRNAVYYGSDQGQVSEDK 757
           S LDTMKACL+R+P+KR T DE+LD+ FL PV+VTP+ +RDLI+NAV YG+DQ +VS++K
Sbjct: 771 SILDTMKACLLRNPDKRLTVDEVLDSPFLKPVMVTPFFIRDLIKNAVRYGADQKEVSKEK 830

Query: 758 ITELADDVLNRLADFRL 774
           + ELADDVL +LAD RL
Sbjct: 831 VEELADDVLGKLADIRL 847

 Score = 53.9 bits (128), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 22/34 (64%), Positives = 30/34 (88%)

Query: 246 IEIGDLNPFQVLKKYNLPSTELATISKLYFEKQK 279
           +++GDLNP Q LKK++LP++EL  IS+LYFEKQK
Sbjct: 245 VDLGDLNPVQYLKKHDLPTSELPRISRLYFEKQK 278

 Score = 41.6 bits (96), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 23/37 (62%), Positives = 29/37 (78%), Gaps = 2/37 (5%)

Query: 19 TIQTYNNDSDSDEKLTVLPKLSNFGSALISEKN-ENI 54
          T   + +DSD DEK+++ PKLSNFGSAL+SEK  ENI
Sbjct: 38 TKTIFTDDSD-DEKISIPPKLSNFGSALLSEKEKENI 73

>Suva_4.221 Chr4 complement(391492..393789) [2298 bp, 765 aa] {ON}
           YDL028C (REAL)
          Length = 765

 Score =  539 bits (1389), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 273/558 (48%), Positives = 372/558 (66%), Gaps = 34/558 (6%)

Query: 242 DYNLIEIGDLNPFQVLKKYNLPSTELATISKLYFEKQKEENRKNIMKKRSVSKEGFMTXX 301
           DY  I  GDLNP Q +KK+NLP+++L  IS++YF+KQ+EENR+  ++K S  +       
Sbjct: 217 DYESINFGDLNPIQYIKKHNLPTSDLPMISQIYFDKQREENRQAALRKHSSRELLSKNRS 276

Query: 302 XXXXXXXXXXXXXXFHTTTNNRHSSMVSKQ-----------DTNAILMNTTSTRSDEKVM 350
                          H+ T+N +S    K            +   +L     T +   + 
Sbjct: 277 SSTPLSNSYSLVNKDHSITSNSNSQPRRKISTGSSSSKSSIEIRKVLKENIDTDNYSNLK 336

Query: 351 KPLNEY-----------EPDRKVLASIDINKNINVNAIEKKRPVEHQYSYEKSKIHISES 399
            P+N+               R+ L +I IN +   + +++      + S + + IH +E+
Sbjct: 337 SPINKIYRESSRNKDSDSEKREALRNISINTSHADSGLQQDNK-RLKRSLDDAIIHDNEN 395

Query: 400 RESQSSTVEKPHTFQDNKEGQKIVKKVEIVEPPTSMTNRKSSKSIVSVNDIEYERIELLG 459
            ++Q     +P           + KKVEIVEP  S +   +S++I++VND +YE+IELLG
Sbjct: 396 MKNQDVFYHRP------APKPPVTKKVEIVEPIKSAS-LSNSRNIITVNDSQYEKIELLG 448

Query: 460 RGGSSKVYKVKNTNNNRVYALKRVVFDEFDDTSVDAFKGXXXXXXXXXXXXXXXXXIQYQ 519
           RGGSS+VYKVK   N +VYALKRV FD FDD+SVD FKG                 + Y+
Sbjct: 449 RGGSSRVYKVKGAGN-KVYALKRVSFDAFDDSSVDGFKGEIELLEKLKDQKRVIQLLDYE 507

Query: 520 MDNGVLYLVMECGDHDLSQILNQRANMPLDVDFIRYYSREMLKCVKVVHDAGIVHSDLKP 579
           M +G+LYL+MECGDHDLSQILNQR+NM LD +FIR+Y++EML+C+KVVHDAGIVHSDLKP
Sbjct: 508 MGDGLLYLIMECGDHDLSQILNQRSNMSLDFNFIRFYAKEMLQCIKVVHDAGIVHSDLKP 567

Query: 580 ANFVLVKGILKIIDFGIANAVPDHTVNIYRDTQIGTPNYMAPEALVALNEVS---NVEKK 636
           ANFVLVKGILKIIDFGIANAVP+HTVNIYR+TQIGTPNYMAPEALVA+N      N ++ 
Sbjct: 568 ANFVLVKGILKIIDFGIANAVPEHTVNIYRETQIGTPNYMAPEALVAMNYTQTNENRQEG 627

Query: 637 NRWRVGKPSDIWSCGCIMYQMFYGRPPYGAFQNQNRLLAIMNPEVKIVFSEKTSKNERVP 696
           N+W+VG+PSD+WSCGCI+YQM YG+PPYG+FQ QNRLLAIMNP+VKI F + TS NER+P
Sbjct: 628 NKWKVGRPSDMWSCGCIVYQMIYGKPPYGSFQGQNRLLAIMNPDVKIPFPDHTSNNERIP 687

Query: 697 KSALDTMKACLIRSPEKRWTADEILDASFLNPVLVTPYIVRDLIRNAVYYGSDQGQVSED 756
           KSA++ MKACL R+P+KRWT D++L ++FL P +++  I+ DLIRNAV YGS++ Q+S D
Sbjct: 688 KSAIELMKACLYRNPDKRWTVDKVLSSTFLQPFMISGSIMEDLIRNAVRYGSEKPQISHD 747

Query: 757 KITELADDVLNRLADFRL 774
            + ++ + VL + AD+++
Sbjct: 748 DLNDVVETVLRKFADYKI 765

 Score = 32.7 bits (73), Expect = 4.0,   Method: Compositional matrix adjust.
 Identities = 14/19 (73%), Positives = 16/19 (84%)

Query: 30 DEKLTVLPKLSNFGSALIS 48
          DE+ T  PKLSNFGSAL+S
Sbjct: 24 DEEFTTPPKLSNFGSALLS 42

>NDAI0A06620 Chr1 complement(1510218..1512461) [2244 bp, 747 aa]
           {ON} 
          Length = 747

 Score =  538 bits (1387), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 325/810 (40%), Positives = 450/810 (55%), Gaps = 140/810 (17%)

Query: 22  TYNNDSDSDEKLTVLPKLSNFGSALISEKN------------------------------ 51
           TY+ DSD DE L+  PKLS F SAL S K+                              
Sbjct: 21  TYSTDSD-DEPLSDPPKLSTFASALFSVKDSSNQLDFSENYNSTTNGPINKYAGLKNVSA 79

Query: 52  ---ENITRXXXXXXXXXXXXXXXXXXTLTKNNEIGTINSNF----NNGQIASP------- 97
               NIT                    L +   I T N+N     +N ++A         
Sbjct: 80  NESHNITNNATQFDDHSSISTIFAHTNLPRQPSITTTNNNVPGDDDNARLAESYNELEME 139

Query: 98  ----KFKGIKNLIDQEMTVKHNERRKGRRIFRKIELNSLGKAKRTNLDYTIAPSHMTEVN 153
               + K ++  + +E+T ++ ERR  R  F    L  LG AKR       A S ++E  
Sbjct: 140 SNLQRIKVLQQSMKEELTSRYVERRNRR--FLTSRLTRLGPAKR-------ASSAVSE-- 188

Query: 154 YDQYQENDHKTFESMNDMENDIPKYKTTTDSILSNNKSTDNLAGKNSKNHVTXXXXXXXX 213
            D  +  D       N+ ++ +P+Y T   S+L + K    +    ++ ++         
Sbjct: 189 KDILRSID-------NNTQHLLPEYHTPPLSVL-DQKEISTVPESAARGNI--------- 231

Query: 214 XXXXXXXNPFTDSNTYNHSNTSLPNTMIDYNLIEIGDLNPFQVLKKYNLPSTELATISKL 273
                                       DY+ I+ G L PF+ LKK  LP++EL +ISK 
Sbjct: 232 ----------------------------DYSSIDFGRLKPFEYLKKKKLPTSELPSISKA 263

Query: 274 YFEKQKEENRKNIMKKRSVSKEGFMTXXXXXXXXXXXXXXXXFHTTTNNRHSSMVSKQDT 333
           YF+KQKEE+ +N +KKR  +                        +    R  ++  ++ +
Sbjct: 264 YFQKQKEESLQNTLKKRHRT---LNEDPKIGTFNDEGGSSGNIVSKGTPRIPNLPRRKFS 320

Query: 334 NAILMNTTSTRSDEKVMKPLNEYEP----DRKVLASIDINKNINVNAIEKKRPVEHQYSY 389
            A     ++  S    + P ++Y P     R VL S+DIN      A       +H++ Y
Sbjct: 321 QA-----SARPSAPHNLPPTDKYGPIQYSSRDVLTSLDINNQSPSKA-------DHKFGY 368

Query: 390 EKSKIHISESRESQSSTVEKPHTFQDNKEGQKIVKKVEIVEPPTSMTNRKSSKSI-VSVN 448
           +   I I      +  TV+ P      +   K  KKVEI+EP      +K+ K + ++VN
Sbjct: 369 D---IQI-----GKPYTVKTPLNESYKRLSPK--KKVEIIEPFIYAQKKKTGKKLSITVN 418

Query: 449 DIEYERIELLGRGGSSKVYKVKNTNNNRVYALKRVVFDEFDDTSVDAFKGXXXXXXXXXX 508
            I+YE+IELLGRGGSSKVYKVKN + N+++ALKRV FDEFDD+S+  FKG          
Sbjct: 419 GIDYEKIELLGRGGSSKVYKVKN-DQNKIFALKRVSFDEFDDSSIAGFKGEIELLEKLCK 477

Query: 509 XXXXXXXIQYQMDNGVLYLVMECGDHDLSQILNQRANMPLDVDFIRYYSREMLKCVKVVH 568
                    YQM +GVLYL+MECGD+DLSQ+LNQR   PLD+DF+RY+ RE+LKCVK VH
Sbjct: 478 EPRVVRLFDYQMSSGVLYLIMECGDNDLSQVLNQRMGFPLDMDFLRYHVRELLKCVKAVH 537

Query: 569 DAGIVHSDLKPANFVLVKGILKIIDFGIANAVPDHTVNIYRDTQIGTPNYMAPEALVALN 628
           DAGIVHSDLKPANFV +KG+LK+IDFGIAN +PDHTVN+YR++QIGTPNYMAPE L+A N
Sbjct: 538 DAGIVHSDLKPANFVFIKGLLKLIDFGIANVIPDHTVNVYRESQIGTPNYMAPETLIATN 597

Query: 629 ---EVSNVEKK-NRWRVGKPSDIWSCGCIMYQMFYGRPPYGAFQNQNRLLAIMNPEVKIV 684
              E S++ K+ ++W+VGKPSD+WSCGCI+YQM YGRPPY  FQ QNRLLAIMNPEVK++
Sbjct: 598 HSIEQSDLNKEMSKWKVGKPSDVWSCGCIIYQMIYGRPPYAGFQGQNRLLAIMNPEVKVI 657

Query: 685 FSEKTSKNERVPKSALDTMKACLIRSPEKRWTADEILDASFLNPVLVTPYIVRDLIRNAV 744
           FSE+T+K+E++P S +D MKACL+R P KRW+ D++L + F NP++VTP+ ++DLI+NAV
Sbjct: 658 FSERTAKDEKIPTSLIDLMKACLLRDPAKRWSIDKLLCSPFFNPIIVTPFFIKDLIKNAV 717

Query: 745 YYGSDQGQVSEDKITELADDVLNRLADFRL 774
            YG+DQ  V++ KI EL++DVL RL DF++
Sbjct: 718 KYGTDQKTVTDAKIEELSNDVLERLNDFKM 747

>KAFR0F02220 Chr6 (432967..435210) [2244 bp, 747 aa] {ON} Anc_3.162
           YDL028C
          Length = 747

 Score =  534 bits (1375), Expect = e-179,   Method: Compositional matrix adjust.
 Identities = 326/795 (41%), Positives = 446/795 (56%), Gaps = 140/795 (17%)

Query: 37  PKLSNFGSALISEK-NENITRXXXXXXXXXXXXXXXXXXTLTKNNEIG------------ 83
           PKLSNFGSAL++E  N   T                   +L++NN  G            
Sbjct: 36  PKLSNFGSALLTENDNSGTTSRFHTQFRSLNGNSVHSPISLSRNNSYGSYGIAEQSPQTS 95

Query: 84  ----TIN------SNFNNGQIASP--------------KFKGIKNLIDQEMTVKHNERRK 119
               TIN      +   NG   S               K   I+  I  E+T +H  R K
Sbjct: 96  IFATTINNRPISMTTIQNGSADSNVTNNVNDKYESSYNKINKIQQSIKDELTSRHTGRIK 155

Query: 120 GRRIFRKIELNSLGKAKRTNLDYTIAPSHMTEVNYDQYQENDHKTFESMNDMENDIPKYK 179
             R      +N LG AKR +                               ME DIP   
Sbjct: 156 --RFLNTNRMNKLGPAKRAST------------------------------MEVDIPLPA 183

Query: 180 TTTDSILSNNKSTDNLAGKNSKNHVTXXXXXXXXXXXXXXXNPFTDSNTYNHSNTSLPNT 239
            T DS    N S+D  +G+                      N   +   Y++SN      
Sbjct: 184 NTNDSY---NSSSDVFSGQ-----------------AIEEANDIKEVQNYDYSN------ 217

Query: 240 MIDYNLIEIGDLNPFQVLKKYNLPSTELATISKLYFEKQKEENRKNIMKKRSVSKEGFMT 299
                 I  GDLNPFQ L+KYNLP+TEL  ISK+YFE+QKEENR +I+KK + +  G  T
Sbjct: 218 ------INFGDLNPFQFLRKYNLPTTELPNISKIYFERQKEENRLSILKKHTNNNTGAKT 271

Query: 300 XXXXXXXXXXXXXXXXFHTT--TNNRHSSMVSKQDTNAILMNTTSTRSDEKVMKPLNEYE 357
                              T   N  ++ +VS+     +L +T S+R     + P ++  
Sbjct: 272 NGNDIKDFSISKNLTSEDKTDLKNTVNTGLVSR----TLLNSTLSSRKTNSSLSPKSK-- 325

Query: 358 PDRKVLASIDIN--KNINVNAIEKKRPVEHQYSYEKSKIHISESRESQSSTVEKPHTFQD 415
            D     S+D+   K++  N  ++ RP + +    +  + +S +R  +   +++  TF++
Sbjct: 326 -DNNEFNSLDVEEPKHLTSNN-DEIRPNKRR----EPLVDLSTNR--KEPELKRFKTFEE 377

Query: 416 NKEGQKIV--------------KKVEIVEPPTSMTNRKSSKSIVSVNDIEYERIELLGRG 461
           NK+  +I+              K+VEI+EP   M++R+  +++++VN+ EYE+IELLGRG
Sbjct: 378 NKKRDEIINEKENVVQDVPKSMKRVEIMEP--KMSHRQ--RNVINVNETEYEKIELLGRG 433

Query: 462 GSSKVYKVKNTNNNRVYALKRVVFDEFDDTSVDAFKGXXXXXXXXXXXXXXXXXIQYQMD 521
           GSSKVYKVK  +N +V+ALKRVVFDEFDD+S++ FKG                   Y+M+
Sbjct: 434 GSSKVYKVKGPSN-KVFALKRVVFDEFDDSSINGFKGEIKLLNKLRNENRVVKLFDYEMN 492

Query: 522 NGVLYLVMECGDHDLSQILNQR--ANMPLDVDFIRYYSREMLKCVKVVHDAGIVHSDLKP 579
            G+LYL+MECGD DLSQILNQ+   N+P D++FIRYY+REM+KCVKVVHD GIVHSDLKP
Sbjct: 493 QGLLYLIMECGDVDLSQILNQKINLNLPFDIEFIRYYTREMIKCVKVVHDNGIVHSDLKP 552

Query: 580 ANFVLVKGILKIIDFGIANAVPDHTVNIYRDTQIGTPNYMAPEALVALNEVSNVEKKNRW 639
           ANFVLVKG+LKIIDFGIA+AVPDHTVNIYR+TQ GTPNYMAPE L+A+N  +N  K  +W
Sbjct: 553 ANFVLVKGVLKIIDFGIADAVPDHTVNIYRETQTGTPNYMAPETLIAMNYTNNGAKDLKW 612

Query: 640 RVGKPSDIWSCGCIMYQMFYGRPPYGAFQNQNRLLAIMNPEVKIVFSEKTSKNERVPKSA 699
           +VGKPSD+WSCGCI+YQM YG+ PY  FQ Q+R+ AIMN +VKIV+ EKT++ E +PK+ 
Sbjct: 613 KVGKPSDVWSCGCIIYQMIYGKAPYAGFQGQHRIFAIMNSDVKIVYPEKTNEEELIPKTM 672

Query: 700 LDTMKACLIRSPEKRWTADEILDASFLNPVLVTPYIVRDLIRNAVYYGSDQGQVSEDKIT 759
           ++ MK CL R P KRWT D+IL ++FLNP++ +   +RDLI+NA+ +GS Q  VSEDKI 
Sbjct: 673 VELMKNCLRRDPGKRWTVDDILSSTFLNPIVTSQSFIRDLIKNAITFGSQQKIVSEDKIN 732

Query: 760 ELADDVLNRLADFRL 774
           +L +DVL RL +F++
Sbjct: 733 DLTNDVLTRLQEFKM 747

>Skud_4.223 Chr4 complement(395836..398145) [2310 bp, 769 aa] {ON}
           YDL028C (REAL)
          Length = 769

 Score =  526 bits (1356), Expect = e-176,   Method: Compositional matrix adjust.
 Identities = 270/566 (47%), Positives = 378/566 (66%), Gaps = 46/566 (8%)

Query: 241 IDYNLIEIGDLNPFQVLKKYNLPSTELATISKLYFEKQKEENRKNIMKKRSVSKE----- 295
           + Y  I+  DLNP Q +KK+NL +++L  IS++YF++Q+EEN++  ++K S S+E     
Sbjct: 218 MKYESIDFEDLNPIQYIKKHNLSTSDLPIISQIYFDRQREENKQAALRKHS-SRELLSRN 276

Query: 296 -GFMTXXXXXXXXXXXXXXXXFHTTTNNRHSSMVS--------------KQDTNAILMNT 340
               T                F++++  R                    K++ NA  +N+
Sbjct: 277 RSSSTSLSSGNSLANKDASITFNSSSQPRRKVSTGSFSSKSSVEIRKTFKENVNASNINS 336

Query: 341 TSTRSDEKVMKPLNE-YEPD---RKVLASIDINKNINVNAIEK-----KRPVEHQYSYEK 391
            +     K+ K ++   +PD   R+VL +I IN N   N +++     KR ++     E 
Sbjct: 337 PNGPV-HKIYKEISRNKDPDCEKREVLRNISINANHADNILQQENKRLKRSLDDAIINEN 395

Query: 392 SKIHISESRESQSSTVEKPHTFQDNKEGQKIVKKVEIVEPPTSMTNRKSSKSIVSVNDIE 451
             +++            KP           + KKVEIVEP  + T+  S++++++VND +
Sbjct: 396 EDVNVKNQEVFYHRPAPKP----------PVTKKVEIVEPARTATS-SSNRNMITVNDSQ 444

Query: 452 YERIELLGRGGSSKVYKVKNTNNNRVYALKRVVFDEFDDTSVDAFKGXXXXXXXXXXXXX 511
           YE+IELLGRGGSS+VYKVK + N +VYALKRV FD FDD+S+D FKG             
Sbjct: 445 YEKIELLGRGGSSRVYKVKGSGN-KVYALKRVSFDAFDDSSIDGFKGEIELLEKLKDEKR 503

Query: 512 XXXXIQYQMDNGVLYLVMECGDHDLSQILNQRANMPLDVDFIRYYSREMLKCVKVVHDAG 571
               + Y+M +G+LYL+MECGDHDLSQILNQR NM LD +F+R+Y++EML+C+KVVHDAG
Sbjct: 504 VIQLLDYEMGDGLLYLIMECGDHDLSQILNQRGNMSLDFNFVRFYAKEMLQCIKVVHDAG 563

Query: 572 IVHSDLKPANFVLVKGILKIIDFGIANAVPDHTVNIYRDTQIGTPNYMAPEALVALNEVS 631
           IVHSDLKPANFVLVKGILKIIDFGIANAVP+HTVNIYR+TQIGTPNYMAPEALVA+N   
Sbjct: 564 IVHSDLKPANFVLVKGILKIIDFGIANAVPEHTVNIYRETQIGTPNYMAPEALVAMNYTQ 623

Query: 632 NVEKK---NRWRVGKPSDIWSCGCIMYQMFYGRPPYGAFQNQNRLLAIMNPEVKIVFSEK 688
           N + +   N+W+VG+PSD+WSCGCI+YQM YG+PPYG+FQ QNRLLAIMNP+VKI F E 
Sbjct: 624 NNDNRHDGNKWKVGRPSDMWSCGCIVYQMIYGKPPYGSFQGQNRLLAIMNPDVKIPFPEH 683

Query: 689 TSKNERVPKSALDTMKACLIRSPEKRWTADEILDASFLNPVLVTPYIVRDLIRNAVYYGS 748
           TS +E++PKSA++ MKACL R+P+KRWT D++L+++FL P +++  I+ DLIRNAV YGS
Sbjct: 684 TSNDEKIPKSAIELMKACLYRNPDKRWTVDKVLNSTFLQPFMISESIMEDLIRNAVRYGS 743

Query: 749 DQGQVSEDKITELADDVLNRLADFRL 774
           ++ Q+S D + ++ + VL + AD+++
Sbjct: 744 EKPQISHDNLNDVVETVLRKFADYKI 769

 Score = 33.1 bits (74), Expect = 3.7,   Method: Compositional matrix adjust.
 Identities = 14/19 (73%), Positives = 16/19 (84%)

Query: 30 DEKLTVLPKLSNFGSALIS 48
          DE+ T  PKLSNFGSAL+S
Sbjct: 24 DEEFTTPPKLSNFGSALLS 42

>Ecym_5236 Chr5 (486270..488864) [2595 bp, 864 aa] {ON} similar to
           Ashbya gossypii ADR317C
          Length = 864

 Score =  515 bits (1327), Expect = e-171,   Method: Compositional matrix adjust.
 Identities = 241/375 (64%), Positives = 291/375 (77%), Gaps = 24/375 (6%)

Query: 423 VKKVEIVEP------------PTSMTNR-----KSSKSIVSVNDIEYERIELLGRGGSSK 465
           VKKVEI+EP            P S  N      +  + I+ VN  EYE++ELLGRGGSSK
Sbjct: 491 VKKVEIIEPVKDTVITTIPLKPPSTENGSYQTPQRKRQIIQVNGSEYEKVELLGRGGSSK 550

Query: 466 VYKVKNTNNNRVYALKRVVFDEFDDTSVDAFKGXXXXXXXXXXXXXXXXXIQYQMDNGVL 525
           VYKV+++NN ++YALKRV FDEFDDTS+D FKG                 I ++M++GVL
Sbjct: 551 VYKVRSSNN-KIYALKRVSFDEFDDTSIDGFKGEIELLKRLEDQTRVVKLIDHEMNHGVL 609

Query: 526 YLVMECGDHDLSQILNQRANMPLDVDFIRYYSREMLKCVKVVHDAGIVHSDLKPANFVLV 585
           Y+VMECGDHDLSQ+L QRANMP D++F+RY+++EMLKCV+VVHD GIVHSDLKPANFV V
Sbjct: 610 YVVMECGDHDLSQVLAQRANMPFDIEFVRYHAQEMLKCVQVVHDTGIVHSDLKPANFVFV 669

Query: 586 KGILKIIDFGIANAVPDHTVNIYRDTQIGTPNYMAPEALVALN------EVSNVEKKNRW 639
           KGILKIIDFGIANAVPDHTVNIYRDTQIGTPNYMAPEALVA+N      +     ++NRW
Sbjct: 670 KGILKIIDFGIANAVPDHTVNIYRDTQIGTPNYMAPEALVAMNYTPDQGQTEQEIQQNRW 729

Query: 640 RVGKPSDIWSCGCIMYQMFYGRPPYGAFQNQNRLLAIMNPEVKIVFSEKTSKNERVPKSA 699
           +VGKPSDIWSCGCI+YQM YGRPPYG FQ QNRLLAIMNPEVKIV+ EKT+  + VP++A
Sbjct: 730 KVGKPSDIWSCGCIIYQMIYGRPPYGGFQGQNRLLAIMNPEVKIVYPEKTTHGDLVPRTA 789

Query: 700 LDTMKACLIRSPEKRWTADEILDASFLNPVLVTPYIVRDLIRNAVYYGSDQGQVSEDKIT 759
           LDT+KACL R+PE+RWT D++L   F+ PV VT + +RDLI+NAV YGSDQ  VS++K+ 
Sbjct: 790 LDTIKACLERNPERRWTVDDLLRGPFIKPVSVTHFFIRDLIKNAVKYGSDQRYVSKEKVE 849

Query: 760 ELADDVLNRLADFRL 774
           +LADDV NRL+DFRL
Sbjct: 850 DLADDVWNRLSDFRL 864

 Score = 67.0 bits (162), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 29/49 (59%), Positives = 40/49 (81%)

Query: 241 IDYNLIEIGDLNPFQVLKKYNLPSTELATISKLYFEKQKEENRKNIMKK 289
           IDY+ I  GDLNP+Q LKK+NLP++EL  IS++YFE QK+ENR+  ++K
Sbjct: 246 IDYDNISFGDLNPYQYLKKHNLPTSELPNISRIYFEIQKKENRRAAVRK 294

>SAKL0C07348g Chr3 (677348..679933) [2586 bp, 861 aa] {ON} some
           similarities with uniprot|P54199 Saccharomyces
           cerevisiae YDL028C MPS1 Dual-specificity kinase required
           for spindle pole body (SPB) duplication and spindle
           checkpoint function substrates include SPB proteins
           Spc42p Spc110p and Spc98p mitotic exit network protein
           Mob1p and checkpoint protein Mad1p
          Length = 861

 Score =  513 bits (1320), Expect = e-170,   Method: Compositional matrix adjust.
 Identities = 232/347 (66%), Positives = 280/347 (80%), Gaps = 2/347 (0%)

Query: 429 VEPPTSMTNRKSSKSIVSVNDIEYERIELLGRGGSSKVYKVKNTNNNRVYALKRVVFDEF 488
           ++PP S+ +    K  + VN  EYE++ELLGRGGSSKVYKV+ T NN+VYALKRV FDEF
Sbjct: 516 LKPPASLDSHARRKPTIQVNGTEYEKMELLGRGGSSKVYKVR-TPNNKVYALKRVAFDEF 574

Query: 489 DDTSVDAFKGXXXXXXXXXXXXXXXXXIQYQMDNGVLYLVMECGDHDLSQILNQRANMPL 548
           D++SVD FKG                 + Y+M +GVL++VMECGDHDLS IL  RA++PL
Sbjct: 575 DESSVDGFKGEIELLKKLENQPRVVRLVDYEMAHGVLFVVMECGDHDLSSILAHRASLPL 634

Query: 549 DVDFIRYYSREMLKCVKVVHDAGIVHSDLKPANFVLVKGILKIIDFGIANAVPDHTVNIY 608
           D++F+RY+++EML+CVKVVHDA IVHSDLKPANFV VKGILKIIDFGIANAVPDHTVNIY
Sbjct: 635 DIEFVRYHAQEMLRCVKVVHDADIVHSDLKPANFVFVKGILKIIDFGIANAVPDHTVNIY 694

Query: 609 RDTQIGTPNYMAPEALVALNEV-SNVEKKNRWRVGKPSDIWSCGCIMYQMFYGRPPYGAF 667
           R+TQIGTPNYMAPEALVA+N       ++NRW+VGKPSDIWSCGCI+YQM YGRPPYG F
Sbjct: 695 RETQIGTPNYMAPEALVAMNYAQGQPHQQNRWKVGKPSDIWSCGCILYQMIYGRPPYGGF 754

Query: 668 QNQNRLLAIMNPEVKIVFSEKTSKNERVPKSALDTMKACLIRSPEKRWTADEILDASFLN 727
           Q QNRLLAIMNPEVKIV+ EKT   + VP++ALDTMKACL R+P+KR T DE+L+ +F+ 
Sbjct: 755 QGQNRLLAIMNPEVKIVYPEKTPSGDVVPRTALDTMKACLERNPDKRCTVDEVLNGAFIR 814

Query: 728 PVLVTPYIVRDLIRNAVYYGSDQGQVSEDKITELADDVLNRLADFRL 774
           PV VT + VRDLI+NAV YGS+Q +VS +K+ ELADDV NRLA+FRL
Sbjct: 815 PVSVTHFFVRDLIKNAVKYGSEQREVSSEKVEELADDVWNRLAEFRL 861

 Score = 84.0 bits (206), Expect = 8e-16,   Method: Compositional matrix adjust.
 Identities = 60/204 (29%), Positives = 102/204 (50%), Gaps = 46/204 (22%)

Query: 95  ASPKFKGIKNLIDQEMTVKHNERRKGRRIFRKIELNSLGKAKRTNLDYTIAPSHMTEVNY 154
           +S + + +++ + +E++ +H +RR  R +  ++ L  LG AKR +    +A        Y
Sbjct: 159 SSHRLRALQHSLKEELSSRHAKRRNRRFVSSRLGL--LGPAKRASSTAGLA--------Y 208

Query: 155 DQYQENDHKTFESMNDMENDIPKYKTTTDSILSNNKSTDNLAGKNSKNHVTXXXXXXXXX 214
                +D     S++  E ++           S + ST    G N   +V          
Sbjct: 209 TDSGNDD----ASISQQEANV-----------SGSSSTSGFVGNNEGYNV---------- 243

Query: 215 XXXXXXNPFTDSNT---YNHSNTSLPNTMIDYNLIEIGDLNPFQVLKKYNLPSTELATIS 271
                   F +S+T       +TS  +T +DY  ++ GDLNP+Q LKK+NLP++EL  IS
Sbjct: 244 --------FLESHTGAGERQHHTSSKDTGVDYRDVDFGDLNPYQYLKKHNLPTSELPNIS 295

Query: 272 KLYFEKQKEENRKNIMKKRSVSKE 295
           K+YFE+QKEENR+  ++K  V++E
Sbjct: 296 KIYFERQKEENRRTALRKNVVTRE 319

>KLLA0C03828g Chr3 (349187..351568) [2382 bp, 793 aa] {ON} similar
           to uniprot|P54199 Saccharomyces cerevisiae YDL028C MPS1
           Dual-specificity kinase required for spindle pole body
           (SPB) duplication and spindle checkpoint function
           substrates include SPB proteins Spc42p Spc110p and
           Spc98p mitotic exit network protein Mob1p and checkpoint
           protein Mad1p
          Length = 793

 Score =  510 bits (1313), Expect = e-169,   Method: Compositional matrix adjust.
 Identities = 299/719 (41%), Positives = 404/719 (56%), Gaps = 86/719 (11%)

Query: 95  ASPKFKGIKNLIDQEM---TVKHNERRKGRRIFRKIELNSLGKAKRTNLDYTIAPSHMTE 151
            S KFK ++  + +E+   T K + +R  R I  +  L+SLG AKR NL  +      +E
Sbjct: 122 TSQKFKVLQQSMKEELYNSTTKSSNKRNRRFITSR--LSSLGPAKR-NLSTSFNVDSPSE 178

Query: 152 VNYDQYQENDHKTFESMNDMENDIPKYKTTTDSILSNNKSTDNLAGKNSKNHVTXXXXXX 211
              D  Q N     ++ N  + DI    T+  S         N+  +  + H T      
Sbjct: 179 SRVDNSQINSSIINDTSNISQQDIENSHTSNSSNTGYRYHDHNIFLETHRQHST------ 232

Query: 212 XXXXXXXXXNPFTDSNTYNHSNTSLPNTMIDYNLIEIGDLNPFQVLKKYNLPSTELATIS 271
                     P  D N    +N   PN  I+Y  I+ GDLNP+Q LKKYNLPS EL  IS
Sbjct: 233 ----------PSHDENKDPSANLQ-PN--INYENIDFGDLNPYQYLKKYNLPSGELPYIS 279

Query: 272 KLYFEKQKEENRKNIMKKRSVSKEGF---MTXXXXXXXXXXXXXXXXFHTTTNNRHSSMV 328
           K+YFE+QKEENRK +++K +          T                F T   +    + 
Sbjct: 280 KVYFERQKEENRKTVLRKATSGTLALKREFTQYRRTQTARQPRRKHNFGTDKTSLQDPLS 339

Query: 329 SKQDTNAILMNTTSTRSDEKVMKPLNEYEPDRKVLASIDINKNINVNAIEKKRPVEHQYS 388
           S    N ++                 E    R+ L  +D+N     ++ E KRP      
Sbjct: 340 SPLQKNQLVFQEVD-----------RELANKREALKPLDVNNP--SSSQEAKRP-----K 381

Query: 389 YEKSKIHISESRESQSSTVEKPHTFQDNKEGQKIVKKVEIVEPPTSM------------- 435
           YE    H+ E       +  K  +  D+K      KKVEIVEPP S              
Sbjct: 382 YEND--HVPEDYRPPFFSHRKAPSPHDSKP----FKKVEIVEPPKSTVEVIPLKSEGCDV 435

Query: 436 ------------------TNRKSSKSI--VSVNDIEYERIELLGRGGSSKVYKVKNTNNN 475
                             T +++S ++  ++VN   YE++ELLG+GGS KVYKVK++++ 
Sbjct: 436 SSKLNKGDNYLNYNGSFDTKKRTSYAVPTITVNGTAYEKVELLGKGGSGKVYKVKSSDH- 494

Query: 476 RVYALKRVVFDEFDDTSVDAFKGXXXXXXXXXXXXXXXXXIQYQMDNGVLYLVMECGDHD 535
           +VYALKRV FDEFD++S+D FKG                 I Y M  GVL+L+MECG+HD
Sbjct: 495 KVYALKRVSFDEFDESSIDGFKGEIELLKKLENKQRVVKLIDYHMGQGVLFLLMECGEHD 554

Query: 536 LSQILNQRANMPLDVDFIRYYSREMLKCVKVVHDAGIVHSDLKPANFVLVKGILKIIDFG 595
           LSQ+L QR+ +P D +F+RY+ +EM+KCVKVVHDA IVHSDLKPANFV VKG+LKIIDFG
Sbjct: 555 LSQVLTQRSKIPFDTEFVRYHFQEMIKCVKVVHDADIVHSDLKPANFVFVKGMLKIIDFG 614

Query: 596 IANAVPDHTVNIYRDTQIGTPNYMAPEALVALNEVSNVEKKNRWRVGKPSDIWSCGCIMY 655
           IANAVPDHTVNIYRD QIGTPNYMAPE LVA+N   N  ++ +W+VGKPSD+WSCGCI+Y
Sbjct: 615 IANAVPDHTVNIYRDNQIGTPNYMAPETLVAMNFTRNDGEQAKWKVGKPSDVWSCGCILY 674

Query: 656 QMFYGRPPYGAFQNQNRLLAIMNPEVKIVFSEKTSKNERVPKSALDTMKACLIRSPEKRW 715
           QM YG+PPYG FQ  NRL AIMNP+VKI + EK S    +P++ +DT+++CL R+P  R 
Sbjct: 675 QMVYGKPPYGTFQGNNRLYAIMNPDVKIPYPEKDSFGTVIPRTVIDTIRSCLERNPISRV 734

Query: 716 TADEILDASFLNPVLVTPYIVRDLIRNAVYYGSDQGQVSEDKITELADDVLNRLADFRL 774
           T D++L  + +NPV VT + + DLI+NAV YG DQ  V+ +++ EL++DV N+LA+F+L
Sbjct: 735 TIDQLLSGALINPVTVTKFFIHDLIKNAVNYGCDQKHVNNERVEELSEDVWNKLAEFKL 793

>YDL028C Chr4 complement(400997..403291) [2295 bp, 764 aa] {ON}
           MPS1Dual-specificity kinase required for spindle pole
           body (SPB) duplication and spindle checkpoint function;
           substrates include SPB proteins Spc42p, Spc110p, and
           Spc98p, mitotic exit network protein Mob1p, and
           checkpoint protein Mad1p
          Length = 764

 Score =  503 bits (1294), Expect = e-167,   Method: Compositional matrix adjust.
 Identities = 225/356 (63%), Positives = 288/356 (80%), Gaps = 5/356 (1%)

Query: 422 IVKKVEIVEPPTSMTNRKSSKSIVSVNDIEYERIELLGRGGSSKVYKVKNTNNNRVYALK 481
           + KKVEIVEP  S +   ++++I++VND +YE+IELLGRGGSS+VYKVK + N RVYALK
Sbjct: 411 VTKKVEIVEPAKSAS-LSNNRNIITVNDSQYEKIELLGRGGSSRVYKVKGSGN-RVYALK 468

Query: 482 RVVFDEFDDTSVDAFKGXXXXXXXXXXXXXXXXXIQYQMDNGVLYLVMECGDHDLSQILN 541
           RV FD FDD+S+D FKG                 + Y+M +G+LYL+MECGDHDLSQILN
Sbjct: 469 RVSFDAFDDSSIDGFKGEIELLEKLKDQKRVIQLLDYEMGDGLLYLIMECGDHDLSQILN 528

Query: 542 QRANMPLDVDFIRYYSREMLKCVKVVHDAGIVHSDLKPANFVLVKGILKIIDFGIANAVP 601
           QR+ MPLD +F+R+Y++EML C+KVVHDAGIVHSDLKPANFVLVKGILKIIDFGIANAVP
Sbjct: 529 QRSGMPLDFNFVRFYTKEMLLCIKVVHDAGIVHSDLKPANFVLVKGILKIIDFGIANAVP 588

Query: 602 DHTVNIYRDTQIGTPNYMAPEALVALNEVSNVEKK---NRWRVGKPSDIWSCGCIMYQMF 658
           +HTVNIYR+TQIGTPNYMAPEALVA+N   N E +   N+W+VG+PSD+WSCGCI+YQM 
Sbjct: 589 EHTVNIYRETQIGTPNYMAPEALVAMNYTQNSENQHEGNKWKVGRPSDMWSCGCIIYQMI 648

Query: 659 YGRPPYGAFQNQNRLLAIMNPEVKIVFSEKTSKNERVPKSALDTMKACLIRSPEKRWTAD 718
           YG+PPYG+FQ QNRLLAIMNP+VKI F E TS NE++PKSA++ MKACL R+P+KRWT D
Sbjct: 649 YGKPPYGSFQGQNRLLAIMNPDVKIPFPEHTSNNEKIPKSAIELMKACLYRNPDKRWTVD 708

Query: 719 EILDASFLNPVLVTPYIVRDLIRNAVYYGSDQGQVSEDKITELADDVLNRLADFRL 774
           ++L ++FL P +++  I+ DLIRNAV YGS++  +S+D + ++ D VL + AD+++
Sbjct: 709 KVLSSTFLQPFMISGSIMEDLIRNAVRYGSEKPHISQDDLNDVVDTVLRKFADYKI 764

 Score = 32.7 bits (73), Expect = 4.3,   Method: Compositional matrix adjust.
 Identities = 14/19 (73%), Positives = 16/19 (84%)

Query: 30 DEKLTVLPKLSNFGSALIS 48
          DE+ T  PKLSNFGSAL+S
Sbjct: 24 DEEFTTPPKLSNFGSALLS 42

>Smik_4.207 Chr4 complement(381159..383456) [2298 bp, 765 aa] {ON}
           YDL028C (REAL)
          Length = 765

 Score =  498 bits (1283), Expect = e-165,   Method: Compositional matrix adjust.
 Identities = 222/356 (62%), Positives = 289/356 (81%), Gaps = 5/356 (1%)

Query: 422 IVKKVEIVEPPTSMTNRKSSKSIVSVNDIEYERIELLGRGGSSKVYKVKNTNNNRVYALK 481
           + KKVEIVEP  S ++  +++S+++VND +YE+IELLGRGGSS+VYKVK + N ++YALK
Sbjct: 412 VTKKVEIVEPAKSASS-SNNRSMITVNDSQYEKIELLGRGGSSRVYKVKGSGN-KIYALK 469

Query: 482 RVVFDEFDDTSVDAFKGXXXXXXXXXXXXXXXXXIQYQMDNGVLYLVMECGDHDLSQILN 541
           RV FD FDD+SVD FKG                 + Y+M +G+LYL+MECGDHDLSQILN
Sbjct: 470 RVSFDAFDDSSVDGFKGEIELLEKLKDQRRVIQLLDYEMGDGLLYLIMECGDHDLSQILN 529

Query: 542 QRANMPLDVDFIRYYSREMLKCVKVVHDAGIVHSDLKPANFVLVKGILKIIDFGIANAVP 601
           QR+NMPLD +F+R+Y++EML C+KVVHDAGIVHSDLKPANFVLVKGILKIIDFGIANAVP
Sbjct: 530 QRSNMPLDFNFVRFYTKEMLLCIKVVHDAGIVHSDLKPANFVLVKGILKIIDFGIANAVP 589

Query: 602 DHTVNIYRDTQIGTPNYMAPEALVALNEVS---NVEKKNRWRVGKPSDIWSCGCIMYQMF 658
           +HTVNIYR+TQIGTPNYMAPEALVA+N      N  + N+W+VG+PSD+WSCGCI+YQM 
Sbjct: 590 EHTVNIYRETQIGTPNYMAPEALVAMNYTQSSDNQHEGNKWKVGRPSDMWSCGCIIYQMI 649

Query: 659 YGRPPYGAFQNQNRLLAIMNPEVKIVFSEKTSKNERVPKSALDTMKACLIRSPEKRWTAD 718
           YG+PPYG+FQ QNRLLAIMNP+VKI F E TS NE++PKSA++ MKACL R+P+KRWT D
Sbjct: 650 YGKPPYGSFQGQNRLLAIMNPDVKIPFPEYTSNNEKIPKSAIELMKACLYRNPDKRWTVD 709

Query: 719 EILDASFLNPVLVTPYIVRDLIRNAVYYGSDQGQVSEDKITELADDVLNRLADFRL 774
           ++L ++FL P +++  I+ DLI+NAV YGS++ Q+S D + ++ + VL + +D+++
Sbjct: 710 KVLSSTFLQPFMISGSIMEDLIKNAVRYGSEKPQISHDDLNDVVETVLRKFSDYKI 765

 Score = 32.7 bits (73), Expect = 4.3,   Method: Compositional matrix adjust.
 Identities = 14/19 (73%), Positives = 16/19 (84%)

Query: 30 DEKLTVLPKLSNFGSALIS 48
          DE+ T  PKLSNFGSAL+S
Sbjct: 24 DEEFTTPPKLSNFGSALLS 42

>CAGL0K01617g Chr11 complement(143308..145632) [2325 bp, 774 aa]
           {ON} similar to uniprot|P54199 Saccharomyces cerevisiae
           YDL028c Serine/threonine protein kinase
          Length = 774

 Score =  474 bits (1220), Expect = e-156,   Method: Compositional matrix adjust.
 Identities = 231/422 (54%), Positives = 298/422 (70%), Gaps = 31/422 (7%)

Query: 360 RKVLASIDINKNINVNAIEKKRPVEHQYSYEKSKIHISESRESQSSTVEKPHTFQD--NK 417
           R+ L +ID+N N+   AI+          Y++ KI + +S             F    +K
Sbjct: 376 REALQNIDVNSNVRDGAID----------YKRQKIALKDSE------------FDGILDK 413

Query: 418 EGQKIVKKVEIVEPPTSMTNRKSSKSIVSVNDIEYERIELLGRGGSSKVYKVKNTNNNRV 477
           +  + +K+VEIVEPPTS T   S K++VSVN  EYER+ELLGRGGSS VYKV+   N RV
Sbjct: 414 KKYRGIKRVEIVEPPTS-TRPPSRKNVVSVNGTEYERVELLGRGGSSNVYKVRGLKN-RV 471

Query: 478 YALKRVVFDEFDDTSVDAFKGXXXXXXXXXXXXXXXXXIQYQMDNGVLYLVMECGDHDLS 537
           YALK+V FDEFD++SV+ FKG                   ++M +GVLYL+MECGD+DLS
Sbjct: 472 YALKKVSFDEFDESSVEGFKGEISLLKQLQNQNRVVQLYDFEMGSGVLYLLMECGDYDLS 531

Query: 538 QILNQRANMPLDVDFIRYYSREMLKCVKVVHDAGIVHSDLKPANFVLVKGILKIIDFGIA 597
           Q+L+QRAN P D++FIRY++REM+ CVKVVHDAGIVHSDLKPANFV VKGILKIIDFGIA
Sbjct: 532 QVLHQRANQPFDMEFIRYHAREMVTCVKVVHDAGIVHSDLKPANFVFVKGILKIIDFGIA 591

Query: 598 NAVPDHTVNIYRDTQIGTPNYMAPEALVALNEVSN-----VEKKNRWRVGKPSDIWSCGC 652
           NAVPDHTVNIYRD QIGTPNYMAPEALVA N  ++      +K N+W++GKP+DIWSCGC
Sbjct: 592 NAVPDHTVNIYRDMQIGTPNYMAPEALVANNYTADNDGKYDQKTNKWKIGKPADIWSCGC 651

Query: 653 IMYQMFYGRPPYGAFQNQNRLLAIMNPEVKIVFSEKTSKNERVPKSALDTMKACLIRSPE 712
           I+YQM YG+PPY  +Q Q RLL+IM+P VKI + E       +P  AL+ M+ CL+R+PE
Sbjct: 652 IIYQMIYGKPPYAKYQGQERLLSIMDPNVKIEYKEVLPDKTVIPSLALELMQYCLMRNPE 711

Query: 713 KRWTADEILDASFLNPVLVTPYIVRDLIRNAVYYGSDQGQVSEDKITELADDVLNRLADF 772
           +RW+A +ILD+ FLNP++V+   +++LI  AV YG+ +G VS  ++  L D VL RLADF
Sbjct: 712 ERWSALQILDSPFLNPLMVSQDFIKNLITTAVSYGAREGDVSPSRLEALTDSVLARLADF 771

Query: 773 RL 774
           R+
Sbjct: 772 RM 773

 Score = 60.8 bits (146), Expect = 9e-09,   Method: Compositional matrix adjust.
 Identities = 28/47 (59%), Positives = 36/47 (76%)

Query: 242 DYNLIEIGDLNPFQVLKKYNLPSTELATISKLYFEKQKEENRKNIMK 288
           DY+ I I + NP Q +K +NLP++EL+ ISK YFEKQKEENRK  +K
Sbjct: 236 DYSDINIHECNPIQYMKMHNLPTSELSKISKAYFEKQKEENRKKALK 282

>TBLA0F00860 Chr6 (219628..222570) [2943 bp, 980 aa] {ON} Anc_3.162
           YDL028C
          Length = 980

 Score =  480 bits (1236), Expect = e-156,   Method: Compositional matrix adjust.
 Identities = 224/380 (58%), Positives = 286/380 (75%), Gaps = 10/380 (2%)

Query: 402 SQSSTVEKPHTFQD--NKEGQKIVKKVEIVEPPTSMTNRKSSKSIVSVNDIEYERIELLG 459
           SQ      PH        + Q++ KKVEI+EP   + N +  K I+ VN+IEYE++ LLG
Sbjct: 604 SQPPVRPPPHFIPSLSQPQPQQVRKKVEIIEPEAKIHNYQ--KPIIIVNNIEYEKVALLG 661

Query: 460 RGGSSKVYKVKNTNNNRVYALKRVVFDEFDDTSVDAFKGXXXXXXXXXXXXXXXXXIQYQ 519
           RGGSSKVYKVK   N+  YALKRV+FDEFDD+S++ FKG                   Y+
Sbjct: 662 RGGSSKVYKVKGPKNS-YYALKRVLFDEFDDSSIEGFKGEIELLKKLEHEERVVRLFDYK 720

Query: 520 MDNGVLYLVMECGDHDLSQILNQRANMPLDVDFIRYYSREMLKCVKVVHDAGIVHSDLKP 579
           M+NG L+L+MECGD DLS+IL+QR+  PLD++FIRYYSREMLKCV+VVH+  IVHSDLKP
Sbjct: 721 MENGTLHLIMECGDLDLSRILHQRSKQPLDLEFIRYYSREMLKCVQVVHNNDIVHSDLKP 780

Query: 580 ANFVLVKGILKIIDFGIANAVPDHTVNIYRDTQIGTPNYMAPEALVALNEVSNVEKK--- 636
           ANFVLV  +LKIIDFGIANAVPDHTVNIYR+ QIGTPNYMAPEALV++N  SN  +    
Sbjct: 781 ANFVLVGSVLKIIDFGIANAVPDHTVNIYRECQIGTPNYMAPEALVSMNLTSNENENAQK 840

Query: 637 --NRWRVGKPSDIWSCGCIMYQMFYGRPPYGAFQNQNRLLAIMNPEVKIVFSEKTSKNER 694
             NRW+VGKPSD+WSCGCI+YQMFYG+PPYG +Q QNRLLAIMNPEV+I + E T  NE 
Sbjct: 841 PVNRWKVGKPSDVWSCGCILYQMFYGKPPYGHYQGQNRLLAIMNPEVEIKYPEFTPNNEP 900

Query: 695 VPKSALDTMKACLIRSPEKRWTADEILDASFLNPVLVTPYIVRDLIRNAVYYGSDQGQVS 754
           +P+SA+DTMKACL R P KR+T +E+L+  F +P++VTP+ ++DLI+N+V YG D+  +S
Sbjct: 901 IPRSAIDTMKACLYRDPSKRFTIEELLNNPFFSPIMVTPFFLQDLIKNSVRYGIDRKNIS 960

Query: 755 EDKITELADDVLNRLADFRL 774
            +++ +++DDVLNRL +F L
Sbjct: 961 NEELEKMSDDVLNRLREFIL 980

 Score = 65.9 bits (159), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 33/74 (44%), Positives = 50/74 (67%), Gaps = 3/74 (4%)

Query: 221 NPFTDSNTYNHSNTSLPNTMIDYNLIEIGDLNPFQVLKKYNLPSTELATISKLYFEKQKE 280
           N  T SN YNH++  +   + DY+ IE   LNP Q  +K++LP +EL  ++K Y +KQ+E
Sbjct: 301 NDATISNDYNHNSKPI---ISDYSSIEFNGLNPMQYWRKHDLPPSELPKLNKAYLQKQRE 357

Query: 281 ENRKNIMKKRSVSK 294
           ENRK ++K+RS S+
Sbjct: 358 ENRKAVLKQRSTSR 371

>KNAG0K01740 Chr11 (364195..366492) [2298 bp, 765 aa] {ON} Anc_3.162
           YDL028C
          Length = 765

 Score =  441 bits (1134), Expect = e-143,   Method: Compositional matrix adjust.
 Identities = 240/541 (44%), Positives = 337/541 (62%), Gaps = 34/541 (6%)

Query: 241 IDYNLIEIGDLNPFQVLKKYNLPSTELATISKLYFEKQKEENRKNIMKKRSVSKEGFMTX 300
           +DY+ I  GDLNPFQ + KYN+P  EL  ISK+Y EK+KEENR+  ++K S S    ++ 
Sbjct: 252 VDYSNIVFGDLNPFQYVNKYNIPMEELPQISKVYIEKRKEENRRVALRKHSSSSLNVVS- 310

Query: 301 XXXXXXXXXXXXXXXFHTTTNNRHSSMVSKQDTNAILMNTTSTRSDEK-VMKPLNEYEPD 359
                          +     N        +   A L+      SD+     PL    P 
Sbjct: 311 -----------NSSQYWANKGNYDDKSEENEKPVADLLGPAIRHSDQTGTSGPLPPRTP- 358

Query: 360 RKVLASIDINKNINVNAIEKKRPVEHQYSY------EKSKIHISESRESQSSTVEKPHTF 413
                 + +N++ N N ++++ P  +  +Y       K ++  + +   +   ++KP   
Sbjct: 359 ------VQLNES-NHNVMKQELPAHNNENYNVNKLIRKREVLANLNVNQKEPELKKPKNN 411

Query: 414 QDNKEGQKIVKKVEIVEPPTSMTNRKSSKSIVSVNDIEYERIELLGRGGSSKVYKVKNTN 473
            +  +   I+K+VEI EP  S    K + SIV +N+ EYE+IELLG GGSSKVYKV+++ 
Sbjct: 412 LEQLDKPAIIKRVEIQEPKPS----KKNTSIV-INNEEYEKIELLGSGGSSKVYKVRDS- 465

Query: 474 NNRVYALKRVVFDEFDDTSVDAFKGXXXXXXXXXXXXXXXXXIQYQMDNGVLYLVMECGD 533
           + +V+ALKRV  D F+++SV++FKG                   Y +++ VLYL+MECGD
Sbjct: 466 SKKVFALKRVAIDMFEESSVESFKGEIALLEKLKNQERVVQLYNYALESSVLYLIMECGD 525

Query: 534 HDLSQILNQRANMPLDVDFIRYYSREMLKCVKVVHDAGIVHSDLKPANFVLVKGILKIID 593
           +DLS +L +R N PLD +F+RYY+RE+  CVKVVHD GIVHSDLKPANF+ VKG LKIID
Sbjct: 526 YDLSVMLRERLNKPLDTEFVRYYAREISHCVKVVHDVGIVHSDLKPANFIFVKGTLKIID 585

Query: 594 FGIANAVPDHTVNIYRDTQIGTPNYMAPEALVALNEVSNVEKKNRWRVGKPSDIWSCGCI 653
           FGIANAVP+HTVNIYR+TQIGTPNYMAPEALVA+N  +     +RW+VGKPSD+WS GCI
Sbjct: 586 FGIANAVPEHTVNIYRETQIGTPNYMAPEALVAMNYTNGESNVSRWKVGKPSDVWSLGCI 645

Query: 654 MYQMFYGRPPYGAFQNQNRLLAIMNPEVKIVFSEKTSKNERVPKSALDTMKACLIRSPEK 713
           +YQM YG+PPY +FQ  +R+ AI+ P VKI +     +   VP S ++ +K CL R P K
Sbjct: 646 IYQMVYGKPPYASFQGNDRIRAIIKPSVKIEYPS-VKEGVTVPNSIIELIKVCLNRDPNK 704

Query: 714 RWTADEILDASFLNPVLVTPYIVRDLIRNAVYYGSDQGQVSEDKITELADDVLNRLADFR 773
           R   D +L+++FL+P+LV+   VRDL++NAV YG  QG VS   I  LA+DV+ +L+++R
Sbjct: 705 RVDVDGMLNSTFLSPILVSEAFVRDLVKNAVEYGIKQGDVSITTIDALANDVIEKLSEYR 764

Query: 774 L 774
           +
Sbjct: 765 I 765

>NCAS0C03560 Chr3 complement(710551..712476) [1926 bp, 641 aa] {ON}
           Anc_3.162
          Length = 641

 Score =  347 bits (890), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 196/535 (36%), Positives = 305/535 (57%), Gaps = 34/535 (6%)

Query: 247 EIGDLNPFQVLKKYNLPSTELATISKLYFEKQKEENRKNIMKKRSVSKEGFMTXXXXXXX 306
           E+G+LNPFQ LKK NLP+ EL+ ++KLY  ++ +E R         SK+           
Sbjct: 134 ELGELNPFQYLKKNNLPTKELSRLTKLYCNRKLDETR---------SKKTQAIDAHEMNS 184

Query: 307 XXXXXXXXXFHTTTNNRHSSMVSKQDTNAILMNTTSTRSDEKVMKPLNEYEPDRKVLASI 366
                       TT  R     S  D N I+ +    R  +     L      +    S+
Sbjct: 185 SSDQLEKRQRKVTTTTR-----SIYDKNRIIPSNVKNRLKKGTSGKLQSGRIHQPYHLSV 239

Query: 367 DINKNINVNAIEKKRPVEHQYSYEKSKIHISES-----RESQSSTVEKPHTFQDNKEGQK 421
             N+   ++  +++ P  ++ +   SK  +SE      R+  S    K H         +
Sbjct: 240 R-NEQKALSQCQQEMPTANEQAKLISKKLVSERVDYLIRDYNSKIQNKKH---------Q 289

Query: 422 IVKKVEIVEPPTSMTNRKS--SKSIVSVNDIEYERIELLGRGGSSKVYKVKNTNNNRVYA 479
            + K+E    P S+ ++ +  SK    + D E   +ELLG+GGSSKVYKV++    + YA
Sbjct: 290 TIPKIE-APVPQSVPSQANLMSKQWSRITDEELSIVELLGKGGSSKVYKVQD-RTGKYYA 347

Query: 480 LKRVVFDEFDDTSVDAFKGXXXXXXXXXXXXXXXXXIQYQMDNGVLYLVMECGDHDLSQI 539
           LK+++ +E D+      +                  I+Y++D+ ++ ++MECG+ DLS +
Sbjct: 348 LKQILLEELDENLKTDLEREIELLKRLAREERVVKLIEYKIDDRMVQVLMECGNFDLSHV 407

Query: 540 LNQRANMPLDVDFIRYYSREMLKCVKVVHDAGIVHSDLKPANFVLVKGILKIIDFGIANA 599
           L++R N P D++F+R  S+EM++C+K VHD+ IVHSDLKPANF+ VKG LK+IDFGIAN 
Sbjct: 408 LHERVNRPFDINFVRLMSKEMIECIKAVHDSDIVHSDLKPANFIFVKGTLKLIDFGIANK 467

Query: 600 VPDHTVNIYRDTQIGTPNYMAPEALVALNEVSNVEKKNRWRVGKPSDIWSCGCIMYQMFY 659
           + D+T+N+YR+TQ+GTPNYMAPE L++ N  SN      W++GKPSDIWS GCI+YQM Y
Sbjct: 468 IADNTLNVYRNTQMGTPNYMAPETLISQN-YSNNNNNLLWKIGKPSDIWSYGCILYQMTY 526

Query: 660 GRPPYGAFQNQNRLLAIMNPEVKIVFSEKTSKNERVPKSALDTMKACLIRSPEKRWTADE 719
           G PPY +F   +RLLAIMNP ++I +  ++   ++VP+S +  +K CL R P+ R T DE
Sbjct: 527 GHPPYSSFLGHDRLLAIMNPNIQIDYPNESPCGKKVPQSLVALIKTCLNRDPQLRATTDE 586

Query: 720 ILDASFLNPVLVTPYIVRDLIRNAVYYGSDQGQVSEDKITELADDVLNRLADFRL 774
           I   SF NP++++   +  LI NA+ YG +   +++D+I  L+++V+++L+   L
Sbjct: 587 IQHCSFFNPMIISKPFLESLIDNAINYGIENQNITQDRIKLLSNEVVSKLSTLNL 641

>YHR102W Chr8 (316572..319814) [3243 bp, 1080 aa] {ON}  KIC1Protein
           kinase of the PAK/Ste20 family, required for cell
           integrity; physically interacts with Cdc31p (centrin),
           which is a component of the spindle pole body; part of
           the RAM network that regulates cellular polarity and
           morphogenesis
          Length = 1080

 Score =  106 bits (265), Expect = 7e-23,   Method: Compositional matrix adjust.
 Identities = 85/299 (28%), Positives = 138/299 (46%), Gaps = 28/299 (9%)

Query: 452 YERIELLGRGGSSKVYKVKNTNNNRVYALKRVVFDEFDDTSVDAFKGXXXXXXXXXXXXX 511
           ++R E++GRG    VYK  N    RVYA+K +  D   D   D  +              
Sbjct: 23  FKRTEVIGRGKFGVVYKGYNVKTGRVYAIKVLNLDSDSDEVEDVQREIQFLASLKQISNI 82

Query: 512 XXXXIQYQMDNGVLYLVME-CGDHDLSQILNQRANMPLDVDFIRYYSREMLKCVKVVHDA 570
                 Y  D   L+++ME C    L  +L       +D  +I    RE+L  +K +H  
Sbjct: 83  TRYYGSYLKDTS-LWIIMEHCAGGSLRSLLRPGK---IDEKYIGVIMRELLVALKCIHKD 138

Query: 571 GIVHSDLKPANFVLV-KGILKIIDFGIANAVPDHTVNIYRDTQIGTPNYMAPEALVALNE 629
            ++H D+K AN ++  +G +K+ DFG+A  V  +  ++ R T  GTP +MAPE ++   E
Sbjct: 139 NVIHRDIKAANVLITNEGNVKLCDFGVAAQV--NQTSLRRQTMAGTPYWMAPEVIM---E 193

Query: 630 VSNVEKKNRWRVGKPSDIWSCGCIMYQMFYGRPPYGAFQNQNRLLAIMNPEVKIVFSEKT 689
               + K         DIWS G   Y++  G PPY   +    L A+      I+ S+  
Sbjct: 194 GVYYDTK--------VDIWSLGITTYEIATGNPPYCDVE---ALRAMQ----LIIKSKPP 238

Query: 690 SKNERVPKSALDTMKA-CLIRSPEKRWTADEILDASFLNPVLVTPY-IVRDLIRNAVYY 746
              +R   ++L    A CL   P++R +AD++L + F+     TP  I+++LI   + +
Sbjct: 239 RLEDRSYSTSLKEFIALCLDEDPKERLSADDLLKSKFIRAHKATPTSILKELISRYLLF 297

>CAGL0L11550g Chr12 (1232015..1235233) [3219 bp, 1072 aa] {ON}
           similar to uniprot|P38692 Saccharomyces cerevisiae
           YHR102w NRK1 ser/thr protein kinase
          Length = 1072

 Score =  106 bits (265), Expect = 8e-23,   Method: Compositional matrix adjust.
 Identities = 91/325 (28%), Positives = 150/325 (46%), Gaps = 30/325 (9%)

Query: 452 YERIELLGRGGSSKVYKVKNTNNNRVYALKRVVFDEFDDTSVDAFKGXXXXXXXXXXXXX 511
           ++R E++GRG    VYK  +    +VYA+K +  D  +D   D  +              
Sbjct: 16  FKRTEVIGRGKFGIVYKGYHVKTKQVYAIKVLNLDSSEDEVEDVQREIQFLASLKQIPNI 75

Query: 512 XXXXIQYQMDNGVLYLVME-CGDHDLSQILNQRANMPLDVDFIRYYSREMLKCVKVVHDA 570
                 Y +    L+++ME C    L  +L       +D  +I    RE+L  +KV+H  
Sbjct: 76  TRYYGSY-LRGTSLWIIMEYCAGGSLRSLLRPGK---IDEKYIGVIMRELLVALKVIHKD 131

Query: 571 GIVHSDLKPANFVLV-KGILKIIDFGIANAVPDHTVNIYRDTQIGTPNYMAPEALVALNE 629
            ++H D+K AN ++  +G +K+ DFG+A  +  +  ++ R T  GTP +MAPE ++   E
Sbjct: 132 NVIHRDIKAANVLITNEGQVKLCDFGVAAQL--NQTSLRRQTMAGTPYWMAPEVIM---E 186

Query: 630 VSNVEKKNRWRVGKPSDIWSCGCIMYQMFYGRPPYGAFQNQNRLLAIMNPEVKIVFSEKT 689
               + K         DIWS G   Y++  G PPY   +    L A+      I+ S+  
Sbjct: 187 GVYYDTK--------VDIWSLGITAYEIATGNPPYCDVE---ALRAMQ----LIIKSKPP 231

Query: 690 SKNERVPKSALDTMKA-CLIRSPEKRWTADEILDASFLNPVLVTP-YIVRDLIRNAVYYG 747
              ER     L    A CL   P++R +A+E+L   F+     TP  I+++LI   + + 
Sbjct: 232 RLEERNYTPQLKEFIALCLDEDPQERLSAEELLKTKFIKTHKATPTTILKELISRYLLF- 290

Query: 748 SDQGQVSEDKITELADDVLNRLADF 772
            D+ +  +D    LADD+ N  A+ 
Sbjct: 291 RDKNKSYKDS-AYLADDIPNAKAEL 314

>Skud_8.163 Chr8 (290415..293645) [3231 bp, 1076 aa] {ON} YHR102W
           (REAL)
          Length = 1076

 Score =  105 bits (262), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 84/299 (28%), Positives = 136/299 (45%), Gaps = 28/299 (9%)

Query: 452 YERIELLGRGGSSKVYKVKNTNNNRVYALKRVVFDEFDDTSVDAFKGXXXXXXXXXXXXX 511
           ++R E++GRG    VYK  N    RVYA+K +  D   D   D  +              
Sbjct: 23  FKRTEVVGRGKFGVVYKGYNVKTRRVYAIKVLNLDSDSDEVEDVQREIQFLASLKQMPNI 82

Query: 512 XXXXIQYQMDNGVLYLVMECGDHDLSQILNQRANMPLDVDFIRYYSREMLKCVKVVHDAG 571
                 Y  D  +  L+  C    L  +L       +D  +I    RE+L  +K +H   
Sbjct: 83  TRYYGSYLKDTSLWILMEYCAGGSLRSLLRPGK---IDEKYIGVIMRELLVALKCIHKDN 139

Query: 572 IVHSDLKPANFVLV-KGILKIIDFGIANAVPDHTVNIYRDTQIGTPNYMAPEALVALNEV 630
           ++H D+K AN ++  +G +K+ DFG+A  V  +  ++ R T  GTP +MAPE ++   E 
Sbjct: 140 VIHRDIKAANVLITNEGSVKLCDFGVAAQV--NQTSLRRQTMAGTPYWMAPEVIM---EG 194

Query: 631 SNVEKKNRWRVGKPSDIWSCGCIMYQMFYGRPPYGAFQNQNRLLAIMNPEVKIVFSEKTS 690
              + K         DIWS G   Y++  G PPY   +    L A+     +++   K  
Sbjct: 195 VYYDTK--------VDIWSLGITTYEIATGNPPYCDVE---ALRAM-----QLIIKSKPP 238

Query: 691 KNE-RVPKSALDTMKA-CLIRSPEKRWTADEILDASFLNPVLVTPY-IVRDLIRNAVYY 746
           + E R   S+L    A CL   P++R +AD++L + F+     TP  I+++LI   + +
Sbjct: 239 RLEGRSYSSSLKEFIALCLDEDPKERLSADDLLRSKFIKTHRATPTSILKELISRYLLF 297

>Smik_8.180 Chr8 (292993..296214) [3222 bp, 1073 aa] {ON} YHR102W
           (REAL)
          Length = 1073

 Score =  103 bits (258), Expect = 5e-22,   Method: Compositional matrix adjust.
 Identities = 82/300 (27%), Positives = 137/300 (45%), Gaps = 30/300 (10%)

Query: 452 YERIELLGRGGSSKVYKVKNTNNNRVYALKRVVFDEFDDTSVDAFKGXXXXXXXXXXXXX 511
           ++R E++GRG    VYK  N    RVYA+K +  D   D   D  +              
Sbjct: 23  FKRTEVIGRGKFGVVYKGYNVKTRRVYAIKVLNLDSDSDEVEDVQREIQFLASLKQISNI 82

Query: 512 XXXXIQYQMDNGVLYLVME-CGDHDLSQILNQRANMPLDVDFIRYYSREMLKCVKVVHDA 570
                 Y  D   L+++ME C    L  +L       +D  +I    RE+L  +K +H  
Sbjct: 83  TRYYGSYLKDTS-LWIIMEYCAGGSLRSLLRPGK---IDEKYIGVIMRELLVALKCIHKD 138

Query: 571 GIVHSDLKPANFVLV-KGILKIIDFGIANAVPDHTVNIYRDTQIGTPNYMAPEALVALNE 629
            ++H D+K AN ++  +G +K+ DFG+A  V  +  ++ R T  GTP +MAPE ++   E
Sbjct: 139 NVIHRDIKAANVLITNEGNVKLCDFGVAAQV--NQTSLRRQTMAGTPYWMAPEVIM---E 193

Query: 630 VSNVEKKNRWRVGKPSDIWSCGCIMYQMFYGRPPYGAFQNQNRLLAIMNPEVKIVFSEKT 689
               + K         DIWS G   Y++  G PPY   +    L A+     +++   K 
Sbjct: 194 GVYYDTK--------VDIWSLGITTYEIATGNPPYCDVE---ALRAM-----QLIIKSKP 237

Query: 690 SKNE--RVPKSALDTMKACLIRSPEKRWTADEILDASFLNPVLVTPY-IVRDLIRNAVYY 746
            + E      S  + +  CL   P++R +AD++L + F+     TP  I+++L+   + +
Sbjct: 238 PRLEGRSYSPSLKEFIALCLDEDPKERLSADDLLRSKFIKAHRATPTSILKELVSRYLLF 297

>KAFR0D04950 Chr4 (971956..974982) [3027 bp, 1008 aa] {ON} Anc_5.406
           YHR102W
          Length = 1008

 Score =  102 bits (254), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 83/303 (27%), Positives = 136/303 (44%), Gaps = 30/303 (9%)

Query: 449 DIEYERIELLGRGGSSKVYKVKNTNNNRVYALKRVVFDEFDDTSVDAFKGXXXXXXXXXX 508
           + ++ R  ++GRG    VYK  + N   VYA+K +  D  +D   D  K           
Sbjct: 32  NFKFRRTNVIGRGKFGVVYKGYHLNTKHVYAIKVLNLDSDEDEVEDVQKEIQFLASLKQL 91

Query: 509 XXXXXXXIQYQMDNGVLYLVME-CGDHDLSQILNQRANMPLDVDFIRYYSREMLKCVKVV 567
                    Y + N  L+++ME CG   L  +L       +D  +I    RE+L  +K +
Sbjct: 92  PNITRYYGSY-LKNTSLWIIMEYCGGGSLRSLLRPGK---IDEKYIGVIMREILIALKYI 147

Query: 568 HDAGIVHSDLKPANFVLVK-GILKIIDFGIANAVPDHTVNIYRDTQIGTPNYMAPEALVA 626
           H   ++H D+K AN ++   G +K+ DFG+A  +  +     R T  GTP +MAPE ++ 
Sbjct: 148 HKDNVIHRDIKAANVLINNDGSIKLCDFGVAAQL--NQTKSRRQTMAGTPYWMAPEVIM- 204

Query: 627 LNEVSNVEKKNRWRVGKPSDIWSCGCIMYQMFYGRPPYGAFQNQNRLLAIMNPEVKIVFS 686
             E    + K        +DIWS G   Y++  G PPY   +    +        +++  
Sbjct: 205 --EGVYYDTK--------ADIWSTGITAYEVTTGNPPYCDVEALRAM--------QLIAK 246

Query: 687 EKTSKNERVPKSAL--DTMKACLIRSPEKRWTADEILDASFLNPVLVTPY-IVRDLIRNA 743
            K  + E    SAL  + +  CL   P +R TADE+L  +F+      P  I+++LI   
Sbjct: 247 SKPPRLEGRNYSALIKEFIATCLDEDPSERPTADELLKTAFIKTYKPLPTSILKELISRY 306

Query: 744 VYY 746
           + +
Sbjct: 307 LLF 309

>Ecym_1030 Chr1 (56043..57365) [1323 bp, 440 aa] {ON} similar to
           Ashbya gossypii AFR724C
          Length = 440

 Score =  100 bits (248), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 78/292 (26%), Positives = 133/292 (45%), Gaps = 26/292 (8%)

Query: 451 EYERIELLGRGGSSKVYKVKNTNNNRVYALKRVVFDEFDDTSVDAFKGXXXXXXXXXXXX 510
           +YE ++ +GRG    VYK +    N + A+K V  ++ D+  +D                
Sbjct: 19  QYEILQCIGRGNFGDVYKARYLATNEIVAIKVVNLEDTDE-PIDLLAQEIFFLSELRSPY 77

Query: 511 XXXXXIQYQMDNGVLYLVME-CGDHDLSQILNQRANMPLDVDFIRYYSREMLKCVKVVHD 569
                  + +D   +++VME CG    +++L       L  D   +   E+L  +  +H 
Sbjct: 78  ITNYKTAFLVDVS-MWIVMEYCGGGSCAELLKYTPEHKLTEDQCAFIVSEVLVGLDYLHS 136

Query: 570 AGIVHSDLKPANFVLVK-GILKIIDFGIANAVPDHTVNIYRDTQIGTPNYMAPEALVALN 628
              +H D+K AN +L   G +K+ DFG++  +    V   RDT +GTP +MAPE +    
Sbjct: 137 QRKIHRDIKSANILLTDNGHVKLGDFGVSGQM---MVTRKRDTFVGTPFWMAPEVI---- 189

Query: 629 EVSNVEKKNRWRVGKPSDIWSCGCIMYQMFYGRPPYGAFQNQNRLLAIMNPEVKIVFSEK 688
                  +N+    + +DIWS G  + ++  G PP   +     L+AI  P+      + 
Sbjct: 190 ------DRNKKGYNEMADIWSLGITVIELLMGHPPLDKYDAMKALMAI--PK-----RDP 236

Query: 689 TSKNERVPKSALDTMKACLIRSPEKRWTADEILDASFLNPVLVTPYIVRDLI 740
              ++R    A D +  CLI+ P +R TA E+L   F+  V +  Y +RD +
Sbjct: 237 PKLDKRFSSHAKDFVAQCLIKDPSQRPTASELLKHRFVKRVRL--YNLRDQV 286

>Suva_15.297 Chr15 (518854..520850,520945..522172) [3225 bp, 1074
           aa] {ON} YHR102W (REAL)
          Length = 1074

 Score =  102 bits (254), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 82/300 (27%), Positives = 137/300 (45%), Gaps = 30/300 (10%)

Query: 452 YERIELLGRGGSSKVYKVKNTNNNRVYALKRVVFDEFDDTSVDAFKGXXXXXXXXXXXXX 511
           ++R E++GRG    VYK  N    RV+A+K +  D   D   D  +              
Sbjct: 23  FKRTEVIGRGKFGVVYKGYNVKTRRVFAIKVLNLDSDSDEVEDVQREIQFLASLKQIHNI 82

Query: 512 XXXXIQYQMDNGVLYLVME-CGDHDLSQILNQRANMPLDVDFIRYYSREMLKCVKVVHDA 570
                 Y  D   L+++ME C    L  +L       +D  +I    RE+L  +K +H  
Sbjct: 83  TRYYGSYLKDTS-LWIIMEYCAGGSLRSLLRPGK---IDEKYIGVIMREVLVALKCIHKD 138

Query: 571 GIVHSDLKPANFVLV-KGILKIIDFGIANAVPDHTVNIYRDTQIGTPNYMAPEALVALNE 629
            ++H D+K AN ++  +G +K+ DFG+A  V  +  ++ R T  GTP +MAPE ++   E
Sbjct: 139 NVIHRDIKAANVLITNEGNVKLCDFGVAAQV--NQTSLRRQTMAGTPYWMAPEVIM---E 193

Query: 630 VSNVEKKNRWRVGKPSDIWSCGCIMYQMFYGRPPYGAFQNQNRLLAIMNPEVKIVFSEKT 689
               + K         DIWS G   Y++  G PPY   +    L A+     +++   K 
Sbjct: 194 GVYYDTK--------VDIWSLGITTYEIATGNPPYCEVE---ALRAM-----QLIIKSKP 237

Query: 690 SKNE--RVPKSALDTMKACLIRSPEKRWTADEILDASFLNPVLVTPY-IVRDLIRNAVYY 746
            + E      S  + +  CL   P++R +AD++L + F+     TP  I+++LI   + +
Sbjct: 238 PRLEGRSYSPSLKEFIALCLDEDPKERLSADDLLKSKFIKNHKTTPTSILKELISRYLLF 297

>KNAG0B04320 Chr2 complement(821265..824348) [3084 bp, 1027 aa] {ON}
           Anc_5.406 YHR102W
          Length = 1027

 Score =  102 bits (254), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 93/343 (27%), Positives = 149/343 (43%), Gaps = 46/343 (13%)

Query: 452 YERIELLGRGGSSKVYKVKNTNNNRVYALKRVVFDEFDDTSVDAFKGXXXXXXXXXXXXX 511
           + R E++G+G    VYK  N     VYA+K +  D  +D   D  +              
Sbjct: 41  FRRTEVIGKGKFGVVYKGYNLRTKHVYAIKVLNLDSDEDEVEDVQREIQFLASLKQLPNV 100

Query: 512 XXXXIQYQMDNGVLYLVME-CGDHDLSQILNQRANMPLDVDFIRYYSREMLKCVKVVHDA 570
                 Y + N  L+++ME C    L  +L       +D  +I    RE+L  +K +H  
Sbjct: 101 TRYYGSY-LKNTSLWIIMEYCAGGSLRSLLRPGK---IDEKYIGVIMRELLVALKFIHKD 156

Query: 571 GIVHSDLKPANFVLV-KGILKIIDFGIANAVPDHTVNIYRDTQIGTPNYMAPEALVALNE 629
            I+H D+K AN ++  +G +K+ DFG+A  +   T  + R T  GTP +MAPE ++   E
Sbjct: 157 NIIHRDIKAANVLITNEGGVKLCDFGVAAQLNQRT--LRRQTMAGTPYWMAPEVIM---E 211

Query: 630 VSNVEKKNRWRVGKPSDIWSCGCIMYQMFYGRPPYGAFQNQNRLLAIMNPEVKIVFSEKT 689
               + K         DIWS G   Y++  G PPY   +    L A+     +++   K 
Sbjct: 212 GVYYDTK--------VDIWSLGITAYEISTGNPPYCDVE---ALRAM-----QLITKSKP 255

Query: 690 SKNERVPKSAL--DTMKACLIRSPEKRWTADEILDASFLNPVLVTPYIV-RDLIRNAVYY 746
            + E    + L  + +  CL   P +R +ADE+L + F+     TP IV ++LI   + +
Sbjct: 256 PRLEGRNYTPLIKEFIALCLDEDPNERLSADELLKSKFIKAHKTTPTIVLKELITRYLLF 315

Query: 747 ----------GSD------QGQVSEDKITELADDVLNRLADFR 773
                     G D      Q Q     + E +D+  N   DF+
Sbjct: 316 RDKNNRESVIGVDDDNNKRQKQSETPVVAESSDNTENSQLDFK 358

>AFR724C Chr6 complement(1770338..1771660) [1323 bp, 440 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDR523C
           (SPS1)
          Length = 440

 Score = 98.6 bits (244), Expect = 4e-21,   Method: Compositional matrix adjust.
 Identities = 76/292 (26%), Positives = 135/292 (46%), Gaps = 26/292 (8%)

Query: 451 EYERIELLGRGGSSKVYKVKNTNNNRVYALKRVVFDEFDDTSVDAFKGXXXXXXXXXXXX 510
           +YE ++ +GRG    VYK ++  +N + A+K V  ++ D+  +D                
Sbjct: 19  QYEILQCIGRGNFGDVYKARDLTSNEIVAIKVVNLEDTDE-PIDLLAQEIFFLSELRSPY 77

Query: 511 XXXXXIQYQMDNGVLYLVME-CGDHDLSQILNQRANMPLDVDFIRYYSREMLKCVKVVHD 569
                  + +D   +++VME CG    +++L       +  +   +   E+L  +  +H 
Sbjct: 78  ITNYKTAFLVDVS-MWIVMEYCGGGSCAELLKYTPEHKVTEEQCAFIVSEVLIGLDYLHS 136

Query: 570 AGIVHSDLKPANFVLVK-GILKIIDFGIANAVPDHTVNIYRDTQIGTPNYMAPEALVALN 628
              +H D+K AN +L   G +K+ DFG++  +    V   RDT +GTP +MAPE +    
Sbjct: 137 QRKIHRDIKSANILLTDNGHVKLGDFGVSGQM---MVTRKRDTFVGTPFWMAPEVI---- 189

Query: 629 EVSNVEKKNRWRVGKPSDIWSCGCIMYQMFYGRPPYGAFQNQNRLLAIMNPEVKIVFSEK 688
                  +N+    + +DIWS G  + ++  G PP   +     L+AI  P+      + 
Sbjct: 190 ------DRNKQGYNEMADIWSLGITVIELLMGHPPLDKYDAMKALMAI--PK-----RDP 236

Query: 689 TSKNERVPKSALDTMKACLIRSPEKRWTADEILDASFLNPVLVTPYIVRDLI 740
              ++R    A D +  CLI+ P +R TA E+L   F+  V +  Y +RD +
Sbjct: 237 PKLDKRFSSHARDFVAQCLIKDPSQRPTAAELLKHRFVKRVRL--YNLRDQV 286

>NDAI0C01700 Chr3 complement(367077..370139) [3063 bp, 1020 aa] {ON}
           Anc_5.406
          Length = 1020

 Score =  100 bits (248), Expect = 8e-21,   Method: Compositional matrix adjust.
 Identities = 81/300 (27%), Positives = 137/300 (45%), Gaps = 30/300 (10%)

Query: 452 YERIELLGRGGSSKVYKVKNTNNNRVYALKRVVFDEFDDTSVDAFKGXXXXXXXXXXXXX 511
           + R E++GRG    VYK  +    ++YA+K +  D  +D   D  +              
Sbjct: 42  FRRTEVIGRGKFGIVYKGYHVKTKQIYAIKVLNLDSDEDEVEDVQREIQFLASLKQLPNI 101

Query: 512 XXXXIQYQMDNGVLYLVME-CGDHDLSQILNQRANMPLDVDFIRYYSREMLKCVKVVHDA 570
                 Y  D   L+++ME C    L  +L       +D  +I   +RE+L  +K +H  
Sbjct: 102 TRYYGSYLKDTS-LWIIMEYCAGGSLRTLLRPGK---IDEKYIGVITREILIALKYIHKD 157

Query: 571 GIVHSDLKPANFVLV-KGILKIIDFGIANAVPDHTVNIYRDTQIGTPNYMAPEALVALNE 629
            I+H D+K AN ++  +G +K+ DFG+A  +   T    R T  GTP +MAPE ++   E
Sbjct: 158 NIIHRDIKAANVLITNEGSIKLCDFGVAAQLNQSTKR--RQTMAGTPYWMAPEVIM---E 212

Query: 630 VSNVEKKNRWRVGKPSDIWSCGCIMYQMFYGRPPYGAFQNQNRLLAIMNPEVKIVFSEKT 689
               + K         DIWS G   Y++  G PPY   +    L A+     +++   K 
Sbjct: 213 GVYYDTK--------VDIWSLGITTYEIATGNPPYCEIE---ALRAM-----QLITKSKP 256

Query: 690 SKNERVPKSAL--DTMKACLIRSPEKRWTADEILDASFLNPVLVTPY-IVRDLIRNAVYY 746
            + E    S L  + +  CL   P++R +A+++L   F+    +TP  I+++LI   + +
Sbjct: 257 PRLEGRNYSPLLKEFVALCLDEDPKERMSAEDLLKTKFIKAHKLTPVSILKELISRYLLF 316

>NCAS0H01940 Chr8 (374913..377960) [3048 bp, 1015 aa] {ON} Anc_5.406
          Length = 1015

 Score = 99.0 bits (245), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 84/317 (26%), Positives = 141/317 (44%), Gaps = 38/317 (11%)

Query: 452 YERIELLGRGGSSKVYKVKNTNNNRVYALKRVVFDEFDDTSVDAFKGXXXXXXXXXXXXX 511
           + R E++GRG    VYK  +    ++YA+K +  D  +D   D  +              
Sbjct: 37  FRRTEVIGRGKFGIVYKGYHVRTKQIYAIKVLNLDSDEDEVEDVQREVQFLSSLKQIPNI 96

Query: 512 XXXXIQYQMDNGVLYLVME-CGDHDLSQILNQRANMPLDVDFIRYYSREMLKCVKVVHDA 570
                 Y  D   L+++ME C    L  +L       +D  +I    RE+L  +K +H  
Sbjct: 97  TRYYGSYLKDTS-LWIIMEYCAGGSLRSLLRPGK---IDEKYIGVIMRELLVALKYIHKD 152

Query: 571 GIVHSDLKPANFVLV-KGILKIIDFGIANAVPDHTVNIYRDTQIGTPNYMAPEALVALNE 629
            ++H D+K AN ++  +G +K+ DFG+A  +   T  + R T  GTP +MAPE ++   E
Sbjct: 153 NVIHRDIKAANVLITNEGSVKLCDFGVAAQLNQST--LRRQTMAGTPYWMAPEVIM---E 207

Query: 630 VSNVEKKNRWRVGKPSDIWSCGCIMYQMFYGRPPYGAFQNQNRLLAIMNPEVKIVFSEKT 689
               + K         DIWS G   Y++  G PPY   +    L A+     +++   K 
Sbjct: 208 GVYYDTK--------VDIWSLGITAYEIATGNPPYCEVE---ALRAM-----QLITKSKP 251

Query: 690 SKNERVPKSAL--DTMKACLIRSPEKRWTADEILDASFLNPVLVTPY-IVRDLI------ 740
            + E    + L  + +  CL   P++R +A+E+    F+    +TP  I+++LI      
Sbjct: 252 PRLESRSYTPLLKEFIALCLDEDPKERLSAEELSKTKFIKAHKLTPVSILKELISRYLLF 311

Query: 741 --RNAVYYGSDQGQVSE 755
             RN      + G V+E
Sbjct: 312 RDRNKASSKEEDGMVAE 328

>Kpol_2002.46 s2002 (95107..98478) [3372 bp, 1123 aa] {ON}
           (95107..98478) [3372 nt, 1124 aa]
          Length = 1123

 Score = 98.6 bits (244), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 72/243 (29%), Positives = 118/243 (48%), Gaps = 32/243 (13%)

Query: 525 LYLVMECGDH-DLSQILNQRANMPLDVDFIRYYSREMLKCVKVVHDAGIVHSDLKPANFV 583
           LY+V+E  +  +L  +L ++  +P + + IR++ R+++  +   H  GIVH DLKP N +
Sbjct: 104 LYMVLEYAEKGELFNLLVEKGPLP-ENEAIRFF-RQIIIGMSYCHALGIVHRDLKPENIL 161

Query: 584 LVKGI-LKIIDFGIANAVPDHTVNIYRDTQIGTPNYMAPEALVALNEVSNVEKKNRWRVG 642
           L   + +KI DFG+A      T +   +T  G+P+Y APE +  L              G
Sbjct: 162 LDHKLNIKIADFGMAAL---ETEDKLLETSCGSPHYAAPEIVSGLP-----------YHG 207

Query: 643 KPSDIWSCGCIMYQMFYGRPPYGAFQN--QNRLLAIMNPEVKIVFSEKTSKNERVPKSAL 700
             +D+WSCG I++ +  GR P+       +N LL +   E ++        ++ + K A 
Sbjct: 208 LETDVWSCGVILFALLTGRLPFDEEDGNIRNLLLKVQKGEFEM------PGDDEISKEAQ 261

Query: 701 DTMKACLIRSPEKRWTADEILDASFLN--PVLVTPYIVRDLIRNAVYY----GSDQGQVS 754
           D +   L+  PEKR  + EIL    L   P +     +R+L R   Y     G+D G  +
Sbjct: 262 DLLYKILVVDPEKRIKSREILKHPLLQKYPSIKDSKTIRNLPREDTYLNPLIGNDGGDAT 321

Query: 755 EDK 757
            DK
Sbjct: 322 IDK 324

>Kwal_55.21545 s55 complement(882294..884891) [2598 bp, 865 aa] {ON}
           YHR102W (KIC1) - PAK/Ste20 kinase family [contig 128]
           FULL
          Length = 865

 Score = 98.2 bits (243), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 94/345 (27%), Positives = 152/345 (44%), Gaps = 41/345 (11%)

Query: 433 TSMTNRKSSKSIVSVNDIEYERIELLGRGGSSKVYKVKNTNNNRVYALKRVVFDEFDDTS 492
           +S  N  SS+S VS     ++R E++GRG    VYK   T   +V A+K +  D  DD  
Sbjct: 3   SSKANNGSSRSSVST---LFKRTEVIGRGKFGVVYKGYYTKTKQVCAIKVLNLDSADDEV 59

Query: 493 VDAFKGXXXXXXXXXXXXXXXXXIQYQMDNGVLYLVME-CGDHDLSQILNQRANMPLDVD 551
            D  K                    Y +++  L+++ME C    L  +L       +   
Sbjct: 60  EDVQKEIQFLSSLKQVPNITHYYGSY-LNDTKLWVIMEYCAGGSLRTLLRPGK---IGEQ 115

Query: 552 FIRYYSREMLKCVKVVHDAGIVHSDLKPANFVLV-KGILKIIDFGIANAVPDHTVNIYRD 610
           +I    RE+L  +  +H  G++H D+K AN ++   G +K+ DFG+A  +      I R 
Sbjct: 116 YIGVIMRELLTALMHIHKDGVIHRDIKAANVLITNDGHIKLCDFGVAAQL--SQTKIRRQ 173

Query: 611 TQIGTPNYMAPEALVALNEVSNVEKKNRWRVGKPSDIWSCGCIMYQMFYGRPPYGAFQNQ 670
           T  GTP +MAPE ++   E    + K         DIWS G   Y++  G PPY   +  
Sbjct: 174 TMAGTPYWMAPEVIM---EGVYYDTK--------VDIWSLGITAYEIATGNPPYCEVEAL 222

Query: 671 NRLLAIMNPEVKIVFSEKTSKNE-RVPKSALDTMKA-CLIRSPEKRWTADEILDASFLN- 727
             +        +++   K  + E R   SAL  + A CL   P++R +A+++L   F+  
Sbjct: 223 RAM--------QLITKSKPPRLEGRQHSSALKEIIALCLDEDPKERPSAEDLLKTKFIKL 274

Query: 728 ----PVLVTPYIVRDLIRNAVYYGSDQGQVSEDKITELADDVLNR 768
               PV     I+++LI   + +   + Q      + L DD  +R
Sbjct: 275 HKNVPV----SILKELISRYLLHRDKRSQRESVSSSALEDDEPHR 315

>KLTH0F16676g Chr6 complement(1351362..1353998) [2637 bp, 878 aa]
           {ON} weakly similar to uniprot|P38692 Saccharomyces
           cerevisiae YHR102W KIC1 Protein kinase of the PAK/Ste20
           kinase family required for cell integrity possibly
           through regulating 1 6-beta-glucan levels in the wall
           physically interacts with Cdc31p (centrin) which is a
           component of the spindle pole body
          Length = 878

 Score = 97.8 bits (242), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 86/295 (29%), Positives = 130/295 (44%), Gaps = 32/295 (10%)

Query: 436 TNRKSSKSIVSVNDIEYERIELLGRGGSSKVYKVKNTNNNRVYALKRVVFDEFDDTSVDA 495
           TN    KS VS     ++R E++GRG    VYK      NRV A+K +  D  DD   D 
Sbjct: 6   TNAGVPKSSVST---LFKRTEVIGRGKFGIVYKGYYIKTNRVCAIKVLNLDSADDEVEDV 62

Query: 496 FKGXXXXXXXXXXXXXXXXXIQYQMDNGVLYLVME-CGDHDLSQILNQRANMPLDVDFIR 554
            K                    Y ++N  L+++ME C    L  +L       +   +I 
Sbjct: 63  QKEVQFLSSLKQVPNITHYYGSY-LNNTELWVIMEYCAGGSLRTLLRPGK---IGEQYIG 118

Query: 555 YYSREMLKCVKVVHDAGIVHSDLKPANFVLV-KGILKIIDFGIANAVPDHTVNIYRDTQI 613
              RE+L  +  +H  G++H D+K AN ++   G +K+ DFG+A  +      I R T  
Sbjct: 119 VIMRELLIALMHIHKDGVIHRDIKAANVLITNDGHIKLCDFGVAAQL--SQTKIRRQTMA 176

Query: 614 GTPNYMAPEALVALNEVSNVEKKNRWRVGKPSDIWSCGCIMYQMFYGRPPYGAFQNQNRL 673
           GTP +MAPE ++   E    + K         DIWS G   Y++  G PPY   +    +
Sbjct: 177 GTPYWMAPEVIM---EGVYYDTK--------VDIWSLGITAYEIATGNPPYCDVEALRAM 225

Query: 674 LAIMNPEVKIVFSEKTSKNE-RVPKSALDTMKA-CLIRSPEKRWTADEILDASFL 726
                   +++   K  + E R   SAL    A CL   P++R +A+E+L   F+
Sbjct: 226 --------QLITKSKPPRLEGRQHSSALKEFIALCLDEDPKERPSAEELLKTKFI 272

>NDAI0F04520 Chr6 complement(1098426..1099895) [1470 bp, 489 aa]
           {ON} Anc_1.24
          Length = 489

 Score = 96.3 bits (238), Expect = 4e-20,   Method: Compositional matrix adjust.
 Identities = 77/306 (25%), Positives = 139/306 (45%), Gaps = 37/306 (12%)

Query: 432 PTSMTNRKSSKSIVSVNDIEYERIELLGRGGSSKVYKVKNTNNNRVYALKRVVFDEFDDT 491
           P  + N+K   +I S+ D        +GRG    VYK  +     + A+K VV  E  D 
Sbjct: 8   PKDLYNQKRPSTIYSIQD-------CVGRGNFGDVYKAIDKLTGEIVAIK-VVNLESSDE 59

Query: 492 SVDAFKGXXXXXXXXXXXXXXXXXIQYQMDNGVLYLVME-CGDHDLSQILNQRANMPLDV 550
            ++                     I   +++  +++VME CG    S ++    N  L  
Sbjct: 60  DIELI-AQEIFFLAELKSPYITNYITTMLEDVSMWIVMEYCGGGSCSDLIRYHYNEGLHE 118

Query: 551 DFIRYYSREMLKCVKVVHDAGIVHSDLKPANFVLV-KGILKIIDFGIANAVPDHTVNIYR 609
           D + + ++ +L+ ++ +H+   +H D+K AN +L   G++K+ DFG++  +        R
Sbjct: 119 DKVAFITKNVLRGLQYLHEQRKIHRDVKAANVLLTDDGLVKLADFGVSGQLRS---TAKR 175

Query: 610 DTQIGTPNYMAPEALVALNEVSNVEKKNRWRVGKPSDIWSCGCIMYQMFYGRPPYGAFQN 669
           +T +GTP +MAPE +   +   N          + +DIWS G  +Y++  G PPY  +  
Sbjct: 176 NTFVGTPYWMAPEIISNSSHGYN----------EKADIWSLGITVYELLKGCPPYAKYDA 225

Query: 670 QNRLLAIMNPEVK---IVFSEKTSKNERVPKSALDTMKACLIRSPEKRWTADEILDASFL 726
              +  I    ++   + FS+          +A   + ACLI+ P++R TA E+L   F+
Sbjct: 226 GKVMRNIPKKNLQDCMVSFSD----------AAKLFISACLIKDPDERPTATELLQQPFV 275

Query: 727 NPVLVT 732
             + +T
Sbjct: 276 KNIKIT 281

>Kpol_1031.10 s1031 (25064..28447) [3384 bp, 1127 aa] {ON}
           (25064..28447) [3384 nt, 1128 aa]
          Length = 1127

 Score = 97.4 bits (241), Expect = 6e-20,   Method: Compositional matrix adjust.
 Identities = 82/299 (27%), Positives = 138/299 (46%), Gaps = 30/299 (10%)

Query: 453 ERIELLGRGGSSKVYKVKNTNNNRVYALKRVVFDEFDDTSVDAFKGXXXXXXXXXXXXXX 512
           +R E++GRG    VYK  +     VYA+K +  D   D   D  +               
Sbjct: 45  KRTEVIGRGKFGVVYKGYHLKTKHVYAIKVLNLDSDSDEVEDVQREIQFLASLKQVPNIT 104

Query: 513 XXXIQYQMDNGVLYLVME-CGDHDLSQILNQRANMPLDVDFIRYYSREMLKCVKVVHDAG 571
                Y  D   L+++ME C    L  +L  R  M +D  +I    RE+L  ++ +H   
Sbjct: 105 RYYGSYLQDTN-LWIIMEYCAGGSLRTLL--RPGM-IDEKYIGVIMRELLTALQCIHKDN 160

Query: 572 IVHSDLKPANFVLV-KGILKIIDFGIANAVPDHTVNIYRDTQIGTPNYMAPEALVALNEV 630
           ++H D+K AN ++  +G +K+ DFG+A  +  +  ++ R T  GTP +MAPE ++   E 
Sbjct: 161 VIHRDIKAANVLITNEGKVKLCDFGVAAQL--NQTSLRRQTMAGTPYWMAPEVIM---EG 215

Query: 631 SNVEKKNRWRVGKPSDIWSCGCIMYQMFYGRPPYGAFQNQNRLLAIMNPEVKIVFSEKTS 690
              + K         DIWS G   Y++  G PPY   +    L A+     +++   K +
Sbjct: 216 VYYDTK--------VDIWSLGITAYEIATGNPPYCEIE---ALRAM-----QLITKSKPA 259

Query: 691 KNE-RVPKSALDTMKA-CLIRSPEKRWTADEILDASFLNPVLVTP-YIVRDLIRNAVYY 746
           + E R   S L    A CL   P++R +A+E+  + F+     +P  I+++LI   + +
Sbjct: 260 RLEGRQYSSGLKEFIALCLDEDPKERLSAEELQKSKFIKAHKSSPTAILKELISRYLLF 318

>TDEL0A07560 Chr1 complement(1316498..1321225) [4728 bp, 1575 aa] {ON}
            Anc_6.341 YNR031C
          Length = 1575

 Score = 97.4 bits (241), Expect = 6e-20,   Method: Compositional matrix adjust.
 Identities = 85/347 (24%), Positives = 146/347 (42%), Gaps = 58/347 (16%)

Query: 440  SSKSIVSVNDIEYERIELLGRGGSSKVYKVKNTNNNRVYALKRVVFDEFDDTSVDAFKGX 499
            S  S +S   + +++   +G G    VY   N +N  + A+K +     D  ++  F   
Sbjct: 1251 SLASSISNVSMRWQKRNFVGGGTFGTVYSAVNLDNGEILAVKEIKIQ--DANAMKKFFPS 1308

Query: 500  XXXXXXXXXXXXXXXXIQY---QMDNGVLYLVME-CGDHDLSQILNQRANMPLDVDFIRY 555
                            +QY   ++    + + ME C    ++ +L        D    + 
Sbjct: 1309 IKEEMSVLEMLSHPNVVQYYGVEVHRDKVNIFMEYCEGGSMASLLEH--GRIEDEMVTQV 1366

Query: 556  YSREMLKCVKVVHDAGIVHSDLKPANFVL-VKGILKIIDFGIANAVPDHTVN-------- 606
            Y+ E+L+ +  +H +G+VH D+KP N +L   GI+K +DFG A  +  +  +        
Sbjct: 1367 YTLELLEGLAYLHQSGVVHRDIKPENILLDFNGIIKYVDFGAAKKIAKNGTDTRGFARSV 1426

Query: 607  -----------------IYRDTQIGTPNYMAPEALVALNEVSNVEKKNRWRVGKPSDIWS 649
                             +     +GTP YMAPE++            N+ R+G   DIWS
Sbjct: 1427 ASDSSTGSADNTSEQDGLALQDMMGTPMYMAPESITG--------SPNKGRLGA-DDIWS 1477

Query: 650  CGCIMYQMFYGRPPYGAFQNQNRLLAIMNPEVKIVFSEKTSKNERVPKSALDTMKACLIR 709
             GC++ +M  GR P+    N+    AIM   V      +   N+ V  +    ++ CL  
Sbjct: 1478 LGCVILEMITGRRPWAKLDNE---WAIMY-HVAAGHIPQLPSNDEVSSAGKKFLRRCLQE 1533

Query: 710  SPEKRWTADEILDASFLNPVLVTPYIVRDLIRNAVYYGSDQGQVSED 756
            +P KR +A E+         L+ P+IV+  IR+  +  SDQ Q+ +D
Sbjct: 1534 NPFKRASAVEL---------LMDPWIVQ--IRDLAFGPSDQAQIPDD 1569

>Suva_2.687 Chr2 complement(1215095..1218481) [3387 bp, 1128 aa]
           {ON} YCL024W (REAL)
          Length = 1128

 Score = 97.1 bits (240), Expect = 7e-20,   Method: Compositional matrix adjust.
 Identities = 72/227 (31%), Positives = 110/227 (48%), Gaps = 28/227 (12%)

Query: 525 LYLVMECGDH-DLSQILNQRANMPLDVDFIRYYSREMLKCVKVVHDAGIVHSDLKPANFV 583
           LYLV+E  +  +L  +L +R  +P + + IR++ R+++  V   H  GIVH DLKP N +
Sbjct: 106 LYLVLEYAEKGELFNLLVERGPLP-ENEAIRFF-RQIIIGVSYCHALGIVHRDLKPENLL 163

Query: 584 L-VKGILKIIDFGIANAVPDHTVNIYRDTQIGTPNYMAPEALVALNEVSNVEKKNRWRVG 642
           L  K  +KI DFG+A      T     +T  G+P+Y APE       VS +  +     G
Sbjct: 164 LDHKYNIKIADFGMAAL---ETEGKLLETSCGSPHYAAPEI------VSGIPYQ-----G 209

Query: 643 KPSDIWSCGCIMYQMFYGRPPYGAFQNQNR--LLAIMNPEVKIVFSEKTSKNERVPKSAL 700
             SD+WSCG I++ +  GR P+       R  LL +   E ++        ++ + + A 
Sbjct: 210 FASDVWSCGVILFALLTGRLPFDEEDGNIRALLLKVQKGEFEL------PSDDEISREAQ 263

Query: 701 DTMKACLIRSPEKRWTADEILDASFLN--PVLVTPYIVRDLIRNAVY 745
           D +   L   PE+R  A +IL    L   P +     +RDL R   Y
Sbjct: 264 DLISKILTVDPERRIKARDILKHPLLQKYPSIRDSKSIRDLPREDTY 310

>CAGL0L12474g Chr12 complement(1347340..1348248) [909 bp, 302 aa]
           {ON} highly similar to uniprot|P17157 Saccharomyces
           cerevisiae YPL031c cyclin-dependent protein kinase
          Length = 302

 Score = 92.4 bits (228), Expect = 9e-20,   Method: Compositional matrix adjust.
 Identities = 69/250 (27%), Positives = 120/250 (48%), Gaps = 32/250 (12%)

Query: 451 EYERIELLGRGGSSKVYKVKNTNNNRVYALKRVVFDEFDDTSVDAFKGXXXXXXXXXXXX 510
           +++++E LG G  + VYK  N +     ALK V  D  + T   A +             
Sbjct: 5   QFKQLEKLGNGTYATVYKGLNKSTGVYVALKEVKLDSEEGTPSTAIREISLMKELKHDNI 64

Query: 511 XXXXXIQYQMDNGVLYLVMECGDHDLSQILNQR--ANMP--LDVDFIRYYSREMLKCVKV 566
                + +  +   L LV E  D+DL + ++ R   N P  L+++ ++Y+  ++L+ +  
Sbjct: 65  VRLYDVIHTENK--LTLVFEYMDNDLKKYMDSRTVGNAPRGLEMNLVKYFQWQLLEGLAF 122

Query: 567 VHDAGIVHSDLKPANFVLVK-GILKIIDFGIANA--VPDHTVNIYRDTQIGTPNYMAPEA 623
            H+  I+H DLKP N ++ K G LK+ DFG+A A  +P +T +    +++ T  Y AP+ 
Sbjct: 123 CHENKILHRDLKPQNLLITKRGQLKLGDFGLARAFGIPVNTFS----SEVVTLWYRAPDV 178

Query: 624 LVALNEVSNVEKKNRWRVGKPSDIWSCGCIMYQMFYGRPPYGAFQNQNRLLAIMNPEVKI 683
           L+     S              DIWSCGCI+ +M  G+P +    ++ +L        K+
Sbjct: 179 LMGSRTYST-----------SIDIWSCGCILAEMITGKPLFPGTNDEEQL--------KL 219

Query: 684 VFSEKTSKNE 693
           +F +  + NE
Sbjct: 220 IFDKMGTPNE 229

>TDEL0E02180 Chr5 complement(408232..411195) [2964 bp, 987 aa] {ON}
           Anc_5.406 YHR102W
          Length = 987

 Score = 96.3 bits (238), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 78/299 (26%), Positives = 132/299 (44%), Gaps = 28/299 (9%)

Query: 452 YERIELLGRGGSSKVYKVKNTNNNRVYALKRVVFDEFDDTSVDAFKGXXXXXXXXXXXXX 511
           ++R E++GRG    VYK  ++   +V+A+K +  D  +D   D  +              
Sbjct: 26  FKRTEIIGRGKFGVVYKGYHSRTKQVFAIKVLNLDSDEDEVEDVQREVQFLASMKQVPNI 85

Query: 512 XXXXIQYQMDNGVLYLVMECGDHDLSQILNQRANMPLDVDFIRYYSREMLKCVKVVHDAG 571
                 Y  D  +  ++  C    L  +L       +D  +I    RE+L  +K +H   
Sbjct: 86  TQYYGSYLKDTTLWIIIEYCAGGSLRTLLRPGK---IDEKYIGVIMRELLIALKFIHRDN 142

Query: 572 IVHSDLKPANFVLVK-GILKIIDFGIANAVPDHTVNIYRDTQIGTPNYMAPEALVALNEV 630
           ++H DLK AN ++   G +K+ DFG+A  +  +  N  R T  GTP +MAPE ++   E 
Sbjct: 143 VIHRDLKAANVLITNDGQVKLCDFGVAAQL--NQSNSRRHTMAGTPYWMAPEVIM---EG 197

Query: 631 SNVEKKNRWRVGKPSDIWSCGCIMYQMFYGRPPYGAFQNQNRLLAIMNPEVKIVFSEKTS 690
              + K         DIWS G   Y+   G PPY   +    L A+     +++   K  
Sbjct: 198 VYYDTK--------VDIWSLGITTYEAATGNPPYCEVE---ALRAM-----QLITKSKPP 241

Query: 691 KNERVPKSAL--DTMKACLIRSPEKRWTADEILDASFLNPVLVTP-YIVRDLIRNAVYY 746
           + E    S L  + +  CL   P++R +A+E+L   F+     TP  +++ LI   + +
Sbjct: 242 RLEGRSYSPLLKEFIALCLDEDPKERLSAEELLKTKFIKAHKATPTTLLKQLISRYLLF 300

>SAKL0H11638g Chr8 complement(994049..994946,995016..995032) [915
           bp, 304 aa] {ON} highly similar to uniprot|P17157
           Saccharomyces cerevisiae YPL031C PHO85 Cyclin-dependent
           kinase with ten cyclin partners involved in
           environmental stress response in phosphate-rich
           conditions Pho85p-Pho80p complex phosphorylates Pho4p
           which in turn represses PHO5
          Length = 304

 Score = 92.0 bits (227), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 71/251 (28%), Positives = 117/251 (46%), Gaps = 32/251 (12%)

Query: 451 EYERIELLGRGGSSKVYKVKNTNNNRVYALKRVVFDEFDDTSVDAFKGXXXXXXXXXXXX 510
           +++++E LG G  + VYK  N       ALK V  D  + T   A +             
Sbjct: 6   QFKQLEKLGNGTYATVYKGLNKTTGVYVALKEVKLDSEEGTPSTAIREISLMKELKHENI 65

Query: 511 XXXXXIQYQMDNGVLYLVMECGDHDLSQILNQRA--NMP--LDVDFIRYYSREMLKCVKV 566
                + +  +   L LV E  D+DL + ++ RA  N P  L +  ++Y+  ++L+ V  
Sbjct: 66  VRLYDVIHTENK--LTLVFEFMDNDLKKYMDSRAVGNTPQGLALPLVKYFEWQLLQGVAF 123

Query: 567 VHDAGIVHSDLKPANFVLV-KGILKIIDFGIANA--VPDHTVNIYRDTQIGTPNYMAPEA 623
            H+  I+H DLKP N ++  KG LK+ DFG+A A  +P +T +    +++ T  Y AP+ 
Sbjct: 124 CHENRILHRDLKPQNLLINNKGQLKLGDFGLARAFGIPVNTFS----SEVVTLWYRAPDV 179

Query: 624 LVALNEVSNVEKKNRWRVGKPSDIWSCGCIMYQMFYGRPPYGAFQNQNRLLAIMNPEVKI 683
           L+     S              DIWSCGCI+ +M  G+P +    ++ +L        K+
Sbjct: 180 LMGSRTYST-----------SIDIWSCGCILVEMITGKPLFPGTSDEEQL--------KL 220

Query: 684 VFSEKTSKNER 694
           +F    +  ER
Sbjct: 221 IFETMGTPTER 231

>Skud_16.251 Chr16 complement(457106..458006,458108..458124) [918
           bp, 305 aa] {ON} YPL031C (REAL)
          Length = 305

 Score = 92.0 bits (227), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 69/252 (27%), Positives = 120/252 (47%), Gaps = 32/252 (12%)

Query: 451 EYERIELLGRGGSSKVYKVKNTNNNRVYALKRVVFDEFDDTSVDAFKGXXXXXXXXXXXX 510
           +++++E LG G  + VYK  N       ALK V  D  + T   A +             
Sbjct: 6   QFKQLEKLGNGTYATVYKGLNKTTGVYVALKEVKLDSEEGTPSTAIREISLMKELKHENI 65

Query: 511 XXXXXIQYQMDNGVLYLVMECGDHDLSQILNQR--ANMP--LDVDFIRYYSREMLKCVKV 566
                + +  +   L LV E  D+DL + ++ R   N P  L+++ ++Y+  ++L+ +  
Sbjct: 66  VRLYDVIHTENK--LTLVFEFMDNDLKKYMDSRTVGNTPRGLELNLVKYFQWQLLQGLAF 123

Query: 567 VHDAGIVHSDLKPANFVL-VKGILKIIDFGIANA--VPDHTVNIYRDTQIGTPNYMAPEA 623
            H++ I+H DLKP N ++  KG LK+ DFG+A A  +P +T +    +++ T  Y AP+ 
Sbjct: 124 CHESKILHRDLKPQNLLINKKGQLKLGDFGLARAFGIPVNTFS----SEVVTLWYRAPDV 179

Query: 624 LVALNEVSNVEKKNRWRVGKPSDIWSCGCIMYQMFYGRPPYGAFQNQNRLLAIMNPEVKI 683
           L+     S              DIWSCGCI+ +M  G+P +    ++ +L        K+
Sbjct: 180 LMGSRTYST-----------SIDIWSCGCILAEMITGKPLFPGTNDEEQL--------KL 220

Query: 684 VFSEKTSKNERV 695
           +F    + NE +
Sbjct: 221 IFDIMGTPNESL 232

>KAFR0H01530 Chr8 complement(283589..284509) [921 bp, 306 aa] {ON}
           Anc_8.482 YPL031C
          Length = 306

 Score = 91.7 bits (226), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 70/251 (27%), Positives = 116/251 (46%), Gaps = 32/251 (12%)

Query: 451 EYERIELLGRGGSSKVYKVKNTNNNRVYALKRVVFDEFDDTSVDAFKGXXXXXXXXXXXX 510
           +++++E LG G  + VYK  N       ALK V  D  + T   A +             
Sbjct: 6   QFKQLEKLGNGTYATVYKGLNKTTGEFVALKEVKLDSEEGTPSTAIREISLMKELKHENI 65

Query: 511 XXXXXIQYQMDNGVLYLVMECGDHDLSQILNQR--ANMP--LDVDFIRYYSREMLKCVKV 566
                + +  +   L LV E  D DL + ++ R   N P  L++  ++Y+  ++L+ +  
Sbjct: 66  VRLYDVIHTENK--LTLVFEYMDKDLKKYMDSRTVGNAPVGLELHLVKYFQWQLLEGLAF 123

Query: 567 VHDAGIVHSDLKPANFVL-VKGILKIIDFGIANA--VPDHTVNIYRDTQIGTPNYMAPEA 623
            H+  I+H DLKP N ++  KG LKI DFG+A A  +P +T +    +++ T  Y AP+ 
Sbjct: 124 CHENKILHRDLKPQNLLINKKGQLKIGDFGLARAFGIPVNTFS----SEVVTLWYRAPDV 179

Query: 624 LVALNEVSNVEKKNRWRVGKPSDIWSCGCIMYQMFYGRPPYGAFQNQNRLLAIMNPEVKI 683
           L+     S              DIWSCGCI+ +M  G+P +     + +L        K+
Sbjct: 180 LMGSRTYST-----------SIDIWSCGCILAEMITGKPLFPGTNEEEQL--------KL 220

Query: 684 VFSEKTSKNER 694
           +F    + NE+
Sbjct: 221 IFETMGTPNEQ 231

>KLTH0F00946g Chr6 (73412..74950) [1539 bp, 512 aa] {ON} similar to
           uniprot|P08458 Saccharomyces cerevisiae YDR523C SPS1
           dispensable for mitosis involved in middle/late stage of
           meiosis required for spore wall formation
           serine/threonine kinase homologous to Ste20p expressed
           in middle/late meiosis
          Length = 512

 Score = 94.4 bits (233), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 72/278 (25%), Positives = 119/278 (42%), Gaps = 24/278 (8%)

Query: 452 YERIELLGRGGSSKVYKVKNTNNNRVYALKRVVFDEFDDTSVDAFKGXXXXXXXXXXXXX 511
           YE  E +G+G    V++  +     V A+K +  +E  D  +D                 
Sbjct: 39  YEIKECVGKGSFGDVFRATHRQTGEVVAIKIINLEETQD-DIDVL-AQEIYFLSELRAPF 96

Query: 512 XXXXIQYQMDNGVLYLVME-CGDHDLSQILNQRANMPLDVDFIRYYSREMLKCVKVVHDA 570
                +  +++  +++VME CG    + +L       L  + + Y  RE+L  +  +H  
Sbjct: 97  VTTYFKTFVEDVSMWIVMEFCGGGSCADLLKHLPEHRLSENKVAYIIREVLFGLDYLHSQ 156

Query: 571 GIVHSDLKPANFVLV-KGILKIIDFGIANAVPDHTVNIYRDTQIGTPNYMAPEALVALNE 629
             +H D+K AN +L   G +K+ DFG++  +      + R T +GTP +MAPE +   + 
Sbjct: 157 KKIHRDIKAANILLTDDGEVKLGDFGVSGQI---MATLKRTTFVGTPYWMAPEIIAKKDN 213

Query: 630 VSNVEKKNRWRVGKPSDIWSCGCIMYQMFYGRPPYGAFQNQNRLLAIMNPEVKIVFSEKT 689
             N          + +DIWS G    ++  G+PPY        L       V I   +  
Sbjct: 214 GYN----------EKADIWSLGITAIELLTGQPPYAKHDPMKVL-------VNIPLRKPP 256

Query: 690 SKNERVPKSALDTMKACLIRSPEKRWTADEILDASFLN 727
               R   SA D +  CLI+ P+ R +A E+L   FLN
Sbjct: 257 KLQGRFTGSARDFIALCLIKDPDLRPSAAELLGHKFLN 294

>KNAG0F00290 Chr6 (31750..35127) [3378 bp, 1125 aa] {ON} Anc_1.52
           YDR507C
          Length = 1125

 Score = 95.5 bits (236), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 70/230 (30%), Positives = 115/230 (50%), Gaps = 28/230 (12%)

Query: 522 NGVLYLVMECGDH-DLSQILNQRANMPLDVDFIRYYSREMLKCVKVVHDAGIVHSDLKPA 580
           N  LY+V+E  +  +L  +L +R  +P + + IR++ R+++  +   H  GIVH DLKP 
Sbjct: 100 NSNLYMVLEYAEKGELFNLLVERGPLP-ENEAIRFF-RQIIIGISYCHALGIVHRDLKPE 157

Query: 581 NFVL-VKGILKIIDFGIANAVPDHTVNIYRDTQIGTPNYMAPEALVALNEVSNVEKKNRW 639
           N +L  K  +KI DFG+A      T +   +T  G+P+Y APE       VS +      
Sbjct: 158 NLLLDTKYNIKIADFGMAAL---ETEDKLLETSCGSPHYAAPEI------VSGIPYH--- 205

Query: 640 RVGKPSDIWSCGCIMYQMFYGRPPYGAFQN--QNRLLAIMNPEVKIVFSEKTSKNERVPK 697
             G  SD+WSCG I+Y +  GR P+       +N LL +   + ++       +++ + K
Sbjct: 206 --GFASDVWSCGVILYALLTGRLPFDEEDGNIRNLLLKVQAGQFEM------PEDDEISK 257

Query: 698 SALDTMKACLIRSPEKRWTADEILDASFLN--PVLVTPYIVRDLIRNAVY 745
            A + +   L+ +P +R TA +IL    L   P +     +R+L R   Y
Sbjct: 258 EAQNLISKILVVNPAERITARDILKHPLLQKYPSIKDSKSIRNLPREDTY 307

>TDEL0D02650 Chr4 complement(505536..506636) [1101 bp, 366 aa] {ON}
           Anc_4.184 YGR040W
          Length = 366

 Score = 92.0 bits (227), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 51/162 (31%), Positives = 86/162 (53%), Gaps = 21/162 (12%)

Query: 524 VLYLVMECGDHDLSQILNQRANMPLDVDFIRYYSREMLKCVKVVHDAGIVHSDLKPANFV 583
            +YLV E  + DL +I+N  A  PL  D I+Y++ ++L+ +K +H A ++H DLKP+N +
Sbjct: 89  AVYLVQELMETDLQRIINSHAANPLSDDHIQYFTYQILRALKSIHSAQVIHRDLKPSNLL 148

Query: 584 LVKGI-LKIIDFGIANAVPDHTVNIYRDTQIG-------TPNYMAPEALVALNEVSNVEK 635
           L     LK+ DFG++  +   + +  R+T +G       T  Y APE ++   E +    
Sbjct: 149 LNSNCDLKVCDFGLSRCLASSSDS--RETLVGFMTEYVATRWYRAPEIMLTFREYTTA-- 204

Query: 636 KNRWRVGKPSDIWSCGCIMYQMFYGRPPYGAFQNQNRLLAIM 677
                     DIWSCGCI+ ++  G+P +      ++L  I+
Sbjct: 205 ---------MDIWSCGCILAELVSGKPLFPGRDYHHQLWLIL 237

>Kwal_56.22476 s56 complement(145039..147132) [2094 bp, 697 aa] {ON}
           YMR001C (CDC5) - protein kinase which functions at the
           G(sub)2/M boundary [contig 185] FULL
          Length = 697

 Score = 94.4 bits (233), Expect = 4e-19,   Method: Compositional matrix adjust.
 Identities = 80/322 (24%), Positives = 135/322 (41%), Gaps = 35/322 (10%)

Query: 439 KSSKSIVSVNDIEYERIELLGRGGSSKVYKVKNTNNNRVYALKRVVFDEFDDTSVDAFKG 498
           K+  S++     +Y R   LG GG ++ +++K+ +  +++A K V               
Sbjct: 66  KTPPSLIKTRGRDYHRGHFLGEGGFARCFQIKD-DGGKIFAAKTVAKISIKSEKTRKKLL 124

Query: 499 XXXXXXXXXXXXXXXXXIQYQMDNGVLYLVME-CGDHDLSQILNQRANMPLDVDFIRYYS 557
                            +    D+  +Y+++E C +  L  +L +R    L    +R+++
Sbjct: 125 SEIQIHKSMRHTNIVQFVDCFEDDTNVYILLEICPNGSLMDLLKRRKM--LTEPEVRFFT 182

Query: 558 REMLKCVKVVHDAGIVHSDLKPANFVLVKGI-LKIIDFGIANAVPDHTVNIYRDTQIGTP 616
            +++  VK +H   ++H DLK  N    K   LK+ DFG+A  + +     Y  T  GTP
Sbjct: 183 TQIVGAVKYMHSRRVIHRDLKLGNIFFDKHYNLKVGDFGLAAVLANDRERKY--TVCGTP 240

Query: 617 NYMAPEALVALNEVSNVEKKNRWRVGKPSDIWSCGCIMYQMFYGRPPYGAFQNQNRLLAI 676
           NY+APE L   +   + E           DIWSCG ++Y +  G+PP+ A          
Sbjct: 241 NYIAPEVLTGKHTGHSYE----------VDIWSCGVMIYALLIGKPPFQA---------- 280

Query: 677 MNPEVKIVFSEKTSKNERVPK------SALDTMKACLIRSPEKRWTADEILDASFLNPVL 730
              EV I++      +   PK       AL  +K  L   P +R + DEI+D  +   + 
Sbjct: 281 --KEVNIIYERIKCGDFVFPKDKFISPEALVLIKDILSIDPLERPSLDEIIDYVWFRGLF 338

Query: 731 VTPYIVRDLIRNAVYYGSDQGQ 752
            +      L    VY G D  Q
Sbjct: 339 PSRIDASVLTSAPVYEGLDLAQ 360

>KLTH0E11220g Chr5 (1005953..1005969,1006040..1006931) [909 bp, 302
           aa] {ON} highly similar to uniprot|P17157 Saccharomyces
           cerevisiae YPL031C PHO85 Cyclin-dependent kinase with
           ten cyclin partners involved in environmental stress
           response in phosphate-rich conditions Pho85p-Pho80p
           complex phosphorylates Pho4p which in turn represses
           PHO5
          Length = 302

 Score = 90.5 bits (223), Expect = 4e-19,   Method: Compositional matrix adjust.
 Identities = 70/251 (27%), Positives = 116/251 (46%), Gaps = 32/251 (12%)

Query: 451 EYERIELLGRGGSSKVYKVKNTNNNRVYALKRVVFDEFDDTSVDAFKGXXXXXXXXXXXX 510
           +++++E LG G  + VYK  N       ALK V  D  + T   A +             
Sbjct: 6   QFKQLEKLGNGTYATVYKGLNKTTGIYVALKEVKLDSEEGTPSTAVREISLMKELKHENI 65

Query: 511 XXXXXIQYQMDNGVLYLVMECGDHDLSQILNQR--ANMP--LDVDFIRYYSREMLKCVKV 566
                + +  +   L LV E  D+DL + ++ R   N P   ++  ++Y+  ++L+ V  
Sbjct: 66  VRLYDVIHTENK--LTLVFEFMDNDLKKYMDSRIVGNTPYGFEMSLVKYFEWQLLQGVAF 123

Query: 567 VHDAGIVHSDLKPANFVLV-KGILKIIDFGIANA--VPDHTVNIYRDTQIGTPNYMAPEA 623
            H+  I+H DLKP N ++  KG LK+ DFG+A A  +P +T +    +++ T  Y AP+ 
Sbjct: 124 CHENRILHRDLKPQNLLINNKGQLKLGDFGLARAFGIPVNTFS----SEVVTLWYRAPDV 179

Query: 624 LVALNEVSNVEKKNRWRVGKPSDIWSCGCIMYQMFYGRPPYGAFQNQNRLLAIMNPEVKI 683
           L+     S              DIWSCGCI+ +M  GRP +    ++ +L        K+
Sbjct: 180 LMGSRTYST-----------SIDIWSCGCILAEMITGRPLFPGTNDEEQL--------KL 220

Query: 684 VFSEKTSKNER 694
           +F    +  ER
Sbjct: 221 IFETMGTPTER 231

>Kwal_33.13112 s33 (76807..78324) [1518 bp, 505 aa] {ON} YDR523C
           (SPS1) - serine/threonine kinase homologous to Ste20p;
           expressed in middle/late meiosis [contig 123] FULL
          Length = 505

 Score = 93.2 bits (230), Expect = 4e-19,   Method: Compositional matrix adjust.
 Identities = 73/278 (26%), Positives = 124/278 (44%), Gaps = 25/278 (8%)

Query: 452 YERIELLGRGGSSKVYKVKNTNNNRVYALKRVVFDEFDDTSVDAFKGXXXXXXXXXXXXX 511
           Y+  E +G+G    VY+  +     + A+K +  +E  D  +D                 
Sbjct: 36  YDIKECVGKGSFGDVYRAIDKETGEMVAVKIINLEETQD-DIDVLAQEIYFLSELRAPFV 94

Query: 512 XXXXIQYQMDNGVLYLVME-CGDHDLSQILNQRANMPLDVDFIRYYSREMLKCVKVVHDA 570
                 Y +++  +++VME CG    + +L       L  + + Y  RE+L  ++ +H  
Sbjct: 95  TTYYKTY-VEDVSMWIVMEFCGGGSCADLLKHLPEHRLPENKVAYIIREVLYGLEYLHSQ 153

Query: 571 GIVHSDLKPANFVLV-KGILKIIDFGIANAVPDHTVNIYRDTQIGTPNYMAPEALVALNE 629
             +H D+K AN +L  +G +K+ DFG++  +      + R+T +GTP +MAPE +   N 
Sbjct: 154 RKIHRDVKAANILLTDEGEVKLGDFGVSGQI---MATLKRNTFVGTPYWMAPEIIARDNG 210

Query: 630 VSNVEKKNRWRVGKPSDIWSCGCIMYQMFYGRPPYGAFQNQNRLLAIMNPEVKIVFSEKT 689
               EK         +DIWS G    ++  G+PPY  +   + +  +MN    I   +  
Sbjct: 211 YD--EK---------ADIWSLGITAMELLTGQPPYAKY---DPMKVLMN----IPLRKPP 252

Query: 690 SKNERVPKSALDTMKACLIRSPEKRWTADEILDASFLN 727
               R   SA D +  CL + P  R TA ++L   FLN
Sbjct: 253 RLQGRFTSSARDFIALCLTKDPALRPTASDLLSHKFLN 290

>Kpol_499.3 s499 complement(6075..7199) [1125 bp, 374 aa] {ON}
           complement(6075..7199) [1125 nt, 375 aa]
          Length = 374

 Score = 91.7 bits (226), Expect = 4e-19,   Method: Compositional matrix adjust.
 Identities = 50/162 (30%), Positives = 84/162 (51%), Gaps = 19/162 (11%)

Query: 524 VLYLVMECGDHDLSQIL--NQRANMPLDVDFIRYYSREMLKCVKVVHDAGIVHSDLKPAN 581
            +Y+V E  + DL +++  N R N PL  D I+Y++ ++L+ +K +H A ++H DLKP+N
Sbjct: 89  AVYIVQELMETDLQKVIVNNNRKNTPLSDDHIQYFTYQVLRALKSIHSAKVIHRDLKPSN 148

Query: 582 FVLVKGI-LKIIDFGIANAVPD-----HTVNIYRDTQIGTPNYMAPEALVALNEVSNVEK 635
            +L     LKI DFG++  +        T+  +    + T  Y APE ++   E +    
Sbjct: 149 LLLNSNCDLKICDFGLSRCLASSSDSKETLVGFMTEYVATRWYRAPEIMLTFQEYTTA-- 206

Query: 636 KNRWRVGKPSDIWSCGCIMYQMFYGRPPYGAFQNQNRLLAIM 677
                     DIWSCGCI+ +M  G+P +      ++L  I+
Sbjct: 207 ---------MDIWSCGCILAEMVSGKPLFPGRDYHHQLWLIL 239

>NDAI0I00340 Chr9 (65047..70557) [5511 bp, 1836 aa] {ON} Anc_6.341
          Length = 1836

 Score = 94.7 bits (234), Expect = 5e-19,   Method: Compositional matrix adjust.
 Identities = 83/339 (24%), Positives = 141/339 (41%), Gaps = 54/339 (15%)

Query: 450  IEYERIELLGRGGSSKVYKVKNTNNNRVYALKRVVFDEFDDTSVDAFKGXXXXXXXXXXX 509
            + +++   +G G    V+   N +N  + A+K +     D T++                
Sbjct: 1527 MRWQKRNFIGGGTFGTVFSAVNLDNGEILAVKEIRIQ--DSTTMKKIFPLIKEEMTVLEM 1584

Query: 510  XXXXXXIQY---QMDNGVLYLVME-CGDHDLSQILNQRANMPLDVDFIRYYSREMLKCVK 565
                  +QY   ++    + + ME C    L+ +L        D    + Y+ E+L+ + 
Sbjct: 1585 LNHPNIVQYYGVEVHRDKVNIFMEYCEGGSLASLLEH--GRIEDEMVTQIYTLELLEGLA 1642

Query: 566  VVHDAGIVHSDLKPANFVL-VKGILKIIDFGIANAVPDHTVNIYR--------------- 609
             +H AG+VH D+KP N +L   GI+K +DFG A  +  +   I                 
Sbjct: 1643 YLHQAGVVHRDIKPENILLDFNGIIKYVDFGAARKIAKNGTRIPNLNKKNGAEPEVEEDA 1702

Query: 610  -----DTQIGTPNYMAPEALVALNEVSNVEKKNRWRVGKPSDIWSCGCIMYQMFYGRPPY 664
                    +GTP YMAPE++            N  + G   DIWS GC++ +M  GR P+
Sbjct: 1703 DGGKVHDMMGTPMYMAPESITG--------PGNTGKFGS-DDIWSLGCVVLEMVTGRRPW 1753

Query: 665  GAFQNQNRLLAIMNPEVKIVFSEKTSKNERVPKSALDTMKACLIRSPEKRWTADEILDAS 724
                N+    AIM   V    + +    + V  +    ++ CL++ P+ R TA E+    
Sbjct: 1754 ANLDNE---WAIMY-HVAAGHTPQLPNADEVTPAGRAFLQRCLVQDPKSRATAVEL---- 1805

Query: 725  FLNPVLVTPYIVRDLIRNAVYYGSDQGQVSEDKITELAD 763
                 L+ P+IV   IR  + +GS+ G    D  T +A+
Sbjct: 1806 -----LIDPWIVE--IR-EIAFGSNNGGSKSDVDTPIAE 1836

>TBLA0A07150 Chr1 (1776160..1780335) [4176 bp, 1391 aa] {ON}
           Anc_1.52 YDR507C
          Length = 1391

 Score = 94.4 bits (233), Expect = 5e-19,   Method: Compositional matrix adjust.
 Identities = 70/240 (29%), Positives = 114/240 (47%), Gaps = 31/240 (12%)

Query: 525 LYLVMECGDH-DLSQILNQRANMPLDVDFIRYYSREMLKCVKVVHDAGIVHSDLKPANFV 583
           LY+V+E  +  +L  +L +R  +P + + IR++ R+++  +   H  GIVH DLKP N +
Sbjct: 106 LYMVLEYAEKGELFNLLVERGPLP-ENEAIRFF-RQIIIGISYCHALGIVHRDLKPENLL 163

Query: 584 L-VKGILKIIDFGIANAVPDHTVNIYRDTQIGTPNYMAPEALVALNEVSNVEKKNRWRVG 642
           L  K  +KI DFG+A      T +   +T  G+P+Y APE +  L              G
Sbjct: 164 LDHKYNIKIADFGMAAL---ETEDKLLETSCGSPHYAAPEIISGLP-----------YHG 209

Query: 643 KPSDIWSCGCIMYQMFYGRPPYGAFQN--QNRLLAIMNPEVKIVFSEKTSKNERVPKSAL 700
             +D+WSCG I++ +  GR P+       +N LL + + + ++        N+ + + A 
Sbjct: 210 LETDVWSCGIILFALLTGRLPFDEEDGNIRNLLLKVQSGQFEM------PGNDEISREAQ 263

Query: 701 DTMKACLIRSPEKRWTADEILDASFLN--PVLVTPYIVRDLIRNAVY---YGSDQGQVSE 755
           D +   L   P+KR    EIL    +   P +     +R+L R   Y      D G V E
Sbjct: 264 DLISKILTVDPKKRIKTREILKHPLVQKYPSIKDSKTIRNLPREDTYLNPLSDDNGDVCE 323

>SAKL0C00946g Chr3 (84995..86689) [1695 bp, 564 aa] {ON} similar to
           uniprot|Q751V1 Ashbya gossypii AFR724C AFR724Cp and some
           similarites with YDR523C uniprot|P08458 Saccharomyces
           cerevisiae YDR523C SPS1 dispensable for mitosis involved
           in middle/late stage of meiosis required for spore wall
           formation serine/threonine kinase homologous to Ste20p
           expressed in middle/late meiosis
          Length = 564

 Score = 93.2 bits (230), Expect = 5e-19,   Method: Compositional matrix adjust.
 Identities = 82/300 (27%), Positives = 137/300 (45%), Gaps = 26/300 (8%)

Query: 433 TSMTNRKSSKSIVSVNDIEYERIELLGRGGSSKVYKVKNTNNNRVYALKRVVFDEFDDTS 492
           T +TN K+S+         YE  E +G+G    VYK  + +     A+K V  +E DD  
Sbjct: 15  TVITNSKTSRPSNLRPSELYEVQECVGKGNFGDVYKAIDKSTGNTVAIKVVNLEETDD-E 73

Query: 493 VDAFKGXXXXXXXXXXXXXXXXXIQYQMDNGVLYLVME-CGDHDLSQILNQRANMPLDVD 551
           +D                       + +++  +++VME CG    S +L       L  +
Sbjct: 74  IDLLAQEIYFLAELHSPYITNYFSTF-VEDVSMWIVMEYCGGGSCSDLLKCLPRGTLTEE 132

Query: 552 FIRYYSREMLKCVKVVHDAGIVHSDLKPANFVLV-KGILKIIDFGIANAVPDHTVNIYRD 610
            + + +RE+L+ ++ +H    +H D+K AN +L   G +K+ DFG++  +        RD
Sbjct: 133 KVAFITREILRGLEYLHSQRKIHRDIKAANILLTDDGKVKLGDFGVSGQM---MATRRRD 189

Query: 611 TQIGTPNYMAPEALVALNEVSNVEKKNRWRVGKPSDIWSCGCIMYQMFYGRPPYGAFQNQ 670
           T +GTP +MAPE ++A +E    EK         +DIWS G  ++++  G+PP       
Sbjct: 190 TFVGTPFWMAPE-VIARSEQGYNEK---------ADIWSLGITVFELLKGQPPLSQHDPM 239

Query: 671 NRLLAIMNPEVKIVFSEKTSKNE-RVPKSALDTMKACLIRSPEKRWTADEILDASFLNPV 729
             L++I         S +  K E R   +  + +  CL + P KR TA E+L   F+  V
Sbjct: 240 KVLMSIP--------SRRPPKLEDRYSHAIREFVSLCLNKDPAKRPTASELLKHRFIARV 291

>CAGL0K05709g Chr11 complement(556732..560043) [3312 bp, 1103 aa]
           {ON} similar to uniprot|Q12263 Saccharomyces cerevisiae
           YDR507c GIN4
          Length = 1103

 Score = 94.4 bits (233), Expect = 5e-19,   Method: Compositional matrix adjust.
 Identities = 68/230 (29%), Positives = 109/230 (47%), Gaps = 28/230 (12%)

Query: 522 NGVLYLVMECGDH-DLSQILNQRANMPLDVDFIRYYSREMLKCVKVVHDAGIVHSDLKPA 580
           N  LYLV+E  +  +L  +L +R  +P + + +R + R+++  +   H  G+VH DLKP 
Sbjct: 101 NSDLYLVLEYAEKGELFNMLVERGPLP-ENEAVRAF-RQIIIGISYCHSLGVVHRDLKPE 158

Query: 581 NFVLVKGI-LKIIDFGIANAVPDHTVNIYRDTQIGTPNYMAPEALVALNEVSNVEKKNRW 639
           N +L   + +KI DFG+A      + +   +T  G+P+Y APE +  L            
Sbjct: 159 NLLLDNKLNIKIADFGMAAL---ESEDKLLETSCGSPHYAAPEIISGLP----------- 204

Query: 640 RVGKPSDIWSCGCIMYQMFYGRPPYGAFQN--QNRLLAIMNPEVKIVFSEKTSKNERVPK 697
             G  SD+WSCG I++ +  GR P+       +N LL +   E ++        ++ + K
Sbjct: 205 YEGFSSDVWSCGVILFALLTGRLPFDEEDGNIRNLLLKVQKGEFEM------PDDDEITK 258

Query: 698 SALDTMKACLIRSPEKRWTADEILDASFLN--PVLVTPYIVRDLIRNAVY 745
            A D +   L   P KR T  EIL    L   P +     +R+L R   Y
Sbjct: 259 EAQDLLARLLTVDPSKRITIREILKHPLLQKYPSIKDSRSIRNLPREDTY 308

>Suva_16.286 Chr16 complement(495354..496254,496351..496367) [918
           bp, 305 aa] {ON} YPL031C (REAL)
          Length = 305

 Score = 90.1 bits (222), Expect = 6e-19,   Method: Compositional matrix adjust.
 Identities = 66/235 (28%), Positives = 113/235 (48%), Gaps = 24/235 (10%)

Query: 451 EYERIELLGRGGSSKVYKVKNTNNNRVYALKRVVFDEFDDTSVDAFKGXXXXXXXXXXXX 510
           +++++E LG G  + VYK  N       ALK V  D  + T   A +             
Sbjct: 6   QFKQLEKLGNGTYATVYKGLNKTTGVYVALKEVKLDSEEGTPSTAIREISLMKELKHENI 65

Query: 511 XXXXXIQYQMDNGVLYLVMECGDHDLSQILNQR--ANMP--LDVDFIRYYSREMLKCVKV 566
                + +  +   L LV E  D+DL + ++ R   N P  L+++ ++Y+  ++L+ +  
Sbjct: 66  VRLYDVIHTENK--LTLVFEFMDNDLKKYMDSRTVGNTPRGLELNLVKYFQWQLLQGLAF 123

Query: 567 VHDAGIVHSDLKPANFVL-VKGILKIIDFGIANA--VPDHTVNIYRDTQIGTPNYMAPEA 623
            H+  I+H DLKP N ++  KG LK+ DFG+A A  +P +T +    +++ T  Y AP+ 
Sbjct: 124 CHENKILHRDLKPQNLLINKKGQLKLGDFGLARAFGIPVNTFS----SEVVTLWYRAPDV 179

Query: 624 LVALNEVSNVEKKNRWRVGKPSDIWSCGCIMYQMFYGRPPYGAFQNQNRLLAIMN 678
           L+     S              DIWSCGCI+ +M  G+P +    ++ +L  I +
Sbjct: 180 LMGSRTYST-----------SIDIWSCGCILAEMITGKPLFPGTNDEEQLKLIFD 223

>YPL031C Chr16 complement(492018..492918,493021..493037) [918 bp,
           305 aa] {ON}  PHO85Cyclin-dependent kinase, with ten
           cyclin partners; involved in regulating the cellular
           response to nutrient levels and environmental conditions
           and progression through the cell cycle
          Length = 305

 Score = 90.1 bits (222), Expect = 6e-19,   Method: Compositional matrix adjust.
 Identities = 70/256 (27%), Positives = 120/256 (46%), Gaps = 32/256 (12%)

Query: 451 EYERIELLGRGGSSKVYKVKNTNNNRVYALKRVVFDEFDDTSVDAFKGXXXXXXXXXXXX 510
           +++++E LG G  + VYK  N       ALK V  D  + T   A +             
Sbjct: 6   QFKQLEKLGNGTYATVYKGLNKTTGVYVALKEVKLDSEEGTPSTAIREISLMKELKHENI 65

Query: 511 XXXXXIQYQMDNGVLYLVMECGDHDLSQILNQR--ANMP--LDVDFIRYYSREMLKCVKV 566
                + +  +   L LV E  D+DL + ++ R   N P  L+++ ++Y+  ++L+ +  
Sbjct: 66  VRLYDVIHTENK--LTLVFEFMDNDLKKYMDSRTVGNTPRGLELNLVKYFQWQLLQGLAF 123

Query: 567 VHDAGIVHSDLKPANFVLVK-GILKIIDFGIANA--VPDHTVNIYRDTQIGTPNYMAPEA 623
            H+  I+H DLKP N ++ K G LK+ DFG+A A  +P +T +    +++ T  Y AP+ 
Sbjct: 124 CHENKILHRDLKPQNLLINKRGQLKLGDFGLARAFGIPVNTFS----SEVVTLWYRAPDV 179

Query: 624 LVALNEVSNVEKKNRWRVGKPSDIWSCGCIMYQMFYGRPPYGAFQNQNRLLAIMNPEVKI 683
           L+     S              DIWSCGCI+ +M  G+P +    ++ +L        K+
Sbjct: 180 LMGSRTYST-----------SIDIWSCGCILAEMITGKPLFPGTNDEEQL--------KL 220

Query: 684 VFSEKTSKNERVPKSA 699
           +F    + NE +  S 
Sbjct: 221 IFDIMGTPNESLWPSV 236

>TPHA0H01630 Chr8 (371333..374443) [3111 bp, 1036 aa] {ON} Anc_5.406
           YHR102W
          Length = 1036

 Score = 94.0 bits (232), Expect = 6e-19,   Method: Compositional matrix adjust.
 Identities = 77/300 (25%), Positives = 137/300 (45%), Gaps = 30/300 (10%)

Query: 452 YERIELLGRGGSSKVYKVKNTNNNRVYALKRVVFDEFDDTSVDAFKGXXXXXXXXXXXXX 511
           + R E++GRG    VYK  +    +VYA+K +  D   D   D  +              
Sbjct: 46  FRRTEVIGRGKFGVVYKGYHVKTQQVYAIKVLNLDSESDEVEDVQREVQFLSSLKQFPNI 105

Query: 512 XXXXIQYQMDNGVLYLVME-CGDHDLSQILNQRANMPLDVDFIRYYSREMLKCVKVVHDA 570
                 Y  D   L+++M+ C    +  +L       +D  +I    RE+L  ++ +H  
Sbjct: 106 IRYFGSYLKDTN-LWIIMDYCAGGSIRTLLRPGK---IDEKYIGIIMREILIALQYIHKD 161

Query: 571 GIVHSDLKPANFVLV-KGILKIIDFGIANAVPDHTVNIYRDTQIGTPNYMAPEALVALNE 629
            ++H D+K AN ++  +G +K+ DFG+A  +  +   + R T  GTP +MAPE ++   E
Sbjct: 162 NVIHRDIKAANVLVTNEGKVKLCDFGVAAQL--NQTKLRRQTMAGTPYWMAPEVIM---E 216

Query: 630 VSNVEKKNRWRVGKPSDIWSCGCIMYQMFYGRPPYGAFQNQNRLLAIMNPEVKIVFSEKT 689
            +  + K        +DIWS G   Y++  G PPY   +    L A+     +++   K 
Sbjct: 217 GAYYDTK--------ADIWSLGITAYEIATGNPPYCEIE---ALRAM-----QLITKSKP 260

Query: 690 SKNE-RVPKSALDTMKA-CLIRSPEKRWTADEILDASFLNPVLVTP-YIVRDLIRNAVYY 746
           ++ E R   ++L    A CL   P++R +A+E+    F+      P  I+++LI   + +
Sbjct: 261 ARLEGRSYSTSLKEFIALCLDEDPKERLSAEELQKTKFIKSQRAVPTTILKELISRYLLF 320

>TBLA0H01330 Chr8 complement(297718..299163) [1446 bp, 481 aa] {ON}
           Anc_8.302 YLR113W
          Length = 481

 Score = 92.4 bits (228), Expect = 7e-19,   Method: Compositional matrix adjust.
 Identities = 72/229 (31%), Positives = 108/229 (47%), Gaps = 45/229 (19%)

Query: 525 LYLVMECGDHDLSQILNQRANMPLDVDFIRYYSREMLKCVKVVHDAGIVHSDLKPANFVL 584
           +Y V E    DL ++L  R   PL+  F++Y+  ++L+ +K VH AG++H DLKP+N ++
Sbjct: 96  IYFVTELQGTDLHRLLQTR---PLEKQFVQYFLYQILRGLKYVHSAGVIHRDLKPSNILI 152

Query: 585 VKGI-LKIIDFGIANAVPDHTVNIYRDTQIGTPNYMAPEALVALNEVSNVEKKNRW-RVG 642
            +   LKI DFG+A  + D  +  Y    + T  Y APE ++             W +  
Sbjct: 153 NENCDLKICDFGLAR-IQDPQMTGY----VSTRYYRAPEIMLT------------WQKYD 195

Query: 643 KPSDIWSCGCIMYQMFYGRPPYGA------FQNQNRLLAIMNPEV-KIVFSEKTSK---- 691
              DIWS GCI  +M  G+P +        F     LL    P+V   + SE T K    
Sbjct: 196 TEVDIWSAGCIFVEMIEGKPLFPGKDHVHQFSIITDLLGSPPPDVINTICSENTLKFVTS 255

Query: 692 ---------NER---VPKSALDTMKACLIRSPEKRWTADEILDASFLNP 728
                    NER   +   A+D ++  LI  P+KR TA + L   +L P
Sbjct: 256 LPHRNPVPFNERFNTLENDAIDLLEKMLIFDPKKRITASDALAHPYLAP 304

>TDEL0B01540 Chr2 complement(272561..273458,273562..273578) [915 bp,
           304 aa] {ON} Anc_8.482 YPL031C
          Length = 304

 Score = 90.1 bits (222), Expect = 7e-19,   Method: Compositional matrix adjust.
 Identities = 69/250 (27%), Positives = 118/250 (47%), Gaps = 32/250 (12%)

Query: 451 EYERIELLGRGGSSKVYKVKNTNNNRVYALKRVVFDEFDDTSVDAFKGXXXXXXXXXXXX 510
           +++++E LG G  + VYK  N       ALK V  D  + T   A +             
Sbjct: 6   QFKQLEKLGNGTYATVYKGLNKTTGVYVALKEVKLDSEEGTPSTAIREISLMKELKHENI 65

Query: 511 XXXXXIQYQMDNGVLYLVMECGDHDLSQILNQR--ANMP--LDVDFIRYYSREMLKCVKV 566
                + +  +   L LV E  D+DL + ++ R   N P  L++  ++Y+  ++L+ V  
Sbjct: 66  VRLYDVIHTENK--LTLVFEYMDNDLKKYMDSRTVGNNPQGLELSLVKYFHWQLLEGVSF 123

Query: 567 VHDAGIVHSDLKPANFVL-VKGILKIIDFGIANA--VPDHTVNIYRDTQIGTPNYMAPEA 623
            H++ I+H DLKP N ++  KG LK+ DFG+A A  +P +T +    +++ T  Y AP+ 
Sbjct: 124 CHESKILHRDLKPQNLLINNKGQLKLGDFGLARAFGIPVNTFS----SEVVTLWYRAPDV 179

Query: 624 LVALNEVSNVEKKNRWRVGKPSDIWSCGCIMYQMFYGRPPYGAFQNQNRLLAIMNPEVKI 683
           L+     S              D+WSCGCI+ +M  G+P +    ++ +L        K+
Sbjct: 180 LMGSRTYST-----------SIDMWSCGCILAEMITGKPLFPGTNDEEQL--------KL 220

Query: 684 VFSEKTSKNE 693
           +F    + NE
Sbjct: 221 IFEIMGTPNE 230

>TBLA0A03570 Chr1 (892930..895857) [2928 bp, 975 aa] {ON} Anc_5.406
           YHR102W
          Length = 975

 Score = 93.6 bits (231), Expect = 7e-19,   Method: Compositional matrix adjust.
 Identities = 76/294 (25%), Positives = 134/294 (45%), Gaps = 31/294 (10%)

Query: 437 NRKSSKSIVSVNDI--EYERIELLGRGGSSKVYKVKNTNNNRVYALKRVVFDEFDDTSVD 494
           N+ ++  I++  D+   + R E++GRG    VYK  +     VYA+K +  +   D   D
Sbjct: 25  NKSNTTDILNSKDVCRSFRRTEIIGRGKFGVVYKGYHMKTKGVYAIKVLSLESDLDEVAD 84

Query: 495 AFKGXXXXXXXXXXXXXXXXXIQYQMDNGVLYLVME-CGDHDLSQILNQRANMPLDVDFI 553
             +                    Y  D   L+++ME C    +  +L       +D  +I
Sbjct: 85  IQREIQFLVSLKQVPNITRYYASYLKDTS-LWIIMEYCAGGSVRTLLRPGK---IDEKYI 140

Query: 554 RYYSREMLKCVKVVHDAGIVHSDLKPANFVLV-KGILKIIDFGIANAVPDHTVNIYRDTQ 612
               RE+L  +  +H   ++H D+K AN ++  +G +K+ DFG+A  +  +T  + R T 
Sbjct: 141 AVIMRELLVALHYIHKDNVIHRDIKAANLLITNEGNVKLCDFGVAAQLNQNT--MRRQTM 198

Query: 613 IGTPNYMAPEALVALNEVSNVEKKNRWRVGKPSDIWSCGCIMYQMFYGRPPYGAFQNQNR 672
            GTP +MAPE ++   E  + + K        +DIWS G   Y++  G PP+   +    
Sbjct: 199 AGTPYWMAPEVIM---EGISYDTK--------ADIWSVGITAYEIATGNPPFCEME---A 244

Query: 673 LLAIMNPEVKIVFSEKTSKNERVPKSAL--DTMKACLIRSPEKRWTADEILDAS 724
           L A+     +++   K ++ E      L  + +  CL   P++R TAD++L  S
Sbjct: 245 LRAM-----QVISKSKPARLEGKNHDPLLKEFIAMCLDEDPQERPTADKLLHES 293

>SAKL0H16038g Chr8 complement(1401627..1402931) [1305 bp, 434 aa]
           {ON} highly similar to uniprot|P32485 Saccharomyces
           cerevisiae YLR113W HOG1 Mitogen-activated protein kinase
           involved in osmoregulation via three independent
           osmosensors mediates the recruitment and activation of
           RNA Pol II at Hot1p-dependent promoters localization
           regulated by Ptp2p and Ptp3p
          Length = 434

 Score = 91.7 bits (226), Expect = 8e-19,   Method: Compositional matrix adjust.
 Identities = 72/228 (31%), Positives = 113/228 (49%), Gaps = 43/228 (18%)

Query: 525 LYLVMECGDHDLSQILNQRANMPLDVDFIRYYSREMLKCVKVVHDAGIVHSDLKPANFVL 584
           +Y V E    DL ++L  R   PL+  F++Y+  ++L+ +K VH AG++H DLKP+N ++
Sbjct: 96  IYFVTELQGTDLHRLLQTR---PLEKQFVQYFLYQILRGLKYVHSAGVIHRDLKPSNILI 152

Query: 585 VKGI-LKIIDFGIANAVPDHTVNIYRDTQIGTPNYMAPEALVALNEVSNVEKKNRWRVGK 643
            +   LKI DFG+A  + D  +  Y    + T  Y APE ++   +  NVE         
Sbjct: 153 NENCDLKICDFGLAR-IQDPQMTGY----VSTRYYRAPEIMLTWQKY-NVE--------- 197

Query: 644 PSDIWSCGCIMYQMFYGRPPYGAFQNQNRLLAIMN-----PE-----------VKIVFS- 686
             DIWS GCI  +M  G+P +    + ++   I +     PE           +K V S 
Sbjct: 198 -VDIWSAGCIFAEMIEGKPLFPGKDHVHQFSIITDLLGSPPEDVINTICSENTLKFVTSL 256

Query: 687 ---EKTSKNER---VPKSALDTMKACLIRSPEKRWTADEILDASFLNP 728
              E  S +ER   V   A+D ++  L+  P+KR TA + L   +L+P
Sbjct: 257 PHREPVSFSERFKNVEPEAVDLLEKMLVFDPKKRITAADALAHPYLSP 304

>YDR507C Chr4 complement(1462358..1465786) [3429 bp, 1142 aa] {ON}
           GIN4Protein kinase involved in bud growth and assembly
           of the septin ring, proposed to have kinase-dependent
           and kinase-independent activities; undergoes
           autophosphorylation; similar to Kcc4p and Hsl1p
          Length = 1142

 Score = 93.6 bits (231), Expect = 8e-19,   Method: Compositional matrix adjust.
 Identities = 70/227 (30%), Positives = 109/227 (48%), Gaps = 28/227 (12%)

Query: 525 LYLVMECGDH-DLSQILNQRANMPLDVDFIRYYSREMLKCVKVVHDAGIVHSDLKPANFV 583
           LYLV+E  +  +L  +L +R  +P + + IR++ R+++  V   H  GIVH DLKP N +
Sbjct: 106 LYLVLEYAEKGELFNLLVERGPLP-EHEAIRFF-RQIIIGVSYCHALGIVHRDLKPENLL 163

Query: 584 L-VKGILKIIDFGIANAVPDHTVNIYRDTQIGTPNYMAPEALVALNEVSNVEKKNRWRVG 642
           L  K  +KI DFG+A      T     +T  G+P+Y APE       VS +  +     G
Sbjct: 164 LDHKYNIKIADFGMAAL---ETEGKLLETSCGSPHYAAPEI------VSGIPYQ-----G 209

Query: 643 KPSDIWSCGCIMYQMFYGRPPYGAFQNQNR--LLAIMNPEVKIVFSEKTSKNERVPKSAL 700
             SD+WSCG I++ +  GR P+       R  LL +   E ++        ++ + + A 
Sbjct: 210 FASDVWSCGVILFALLTGRLPFDEEDGNIRTLLLKVQKGEFEM------PSDDEISREAQ 263

Query: 701 DTMKACLIRSPEKRWTADEILDASFLN--PVLVTPYIVRDLIRNAVY 745
           D ++  L   PE+R    +IL    L   P +     +R L R   Y
Sbjct: 264 DLIRKILTVDPERRIKTRDILKHPLLQKYPSIRDSKSIRGLPREDTY 310

>KNAG0D00390 Chr4 (53459..58429) [4971 bp, 1656 aa] {ON} Anc_6.341
            YNR031C
          Length = 1656

 Score = 93.6 bits (231), Expect = 9e-19,   Method: Compositional matrix adjust.
 Identities = 83/314 (26%), Positives = 137/314 (43%), Gaps = 44/314 (14%)

Query: 440  SSKSIVSVNDIEYERIELLGRGGSSKVYKVKNTNNNRVYALKRVVFDEFDDTSVDAFKGX 499
            S  S +S   I +++ + +G G    VY   N +N  + A+K +     D  +++     
Sbjct: 1346 SLASSISNVSIRWQKRKYVGGGTFGSVYSAVNLDNGDILAVKEIKIQ--DSKAMEKIFPS 1403

Query: 500  XXXXXXXXXXXXXXXXIQY---QMDNGVLYLVME-CGDHDLSQILNQRANMPLDVDFIRY 555
                            IQY   ++    + + ME C    L+ +L        D    + 
Sbjct: 1404 VKEEMSVMEMLNHPNIIQYYGVEVHRDKVNIFMEYCEGGSLASLLEH--GRIEDEMVTQV 1461

Query: 556  YSREMLKCVKVVHDAGIVHSDLKPANFVL-VKGILKIIDFGIANAVPDHTVNI------- 607
            Y+ E+L+ +  +H++GIVH D+KP N +L   GI+K +DFG A  +  +   I       
Sbjct: 1462 YTLELLEGLAYLHESGIVHRDIKPENILLDFNGIIKYVDFGAARKIASNETKIRTAGSGS 1521

Query: 608  ----------YRDTQIGTPNYMAPEALVALNEVSNVEKKNRWRVGKPSDIWSCGCIMYQM 657
                       RD  IGTP YMAPE       ++  + K  + V    D+WS GC++ +M
Sbjct: 1522 SPGTSSSTDNLRD-MIGTPMYMAPET------ITGSKTKGSFGV---DDVWSLGCVVLEM 1571

Query: 658  FYGRPPYGAFQNQNRLLAIMNPEVKIVFSEKTSKNERVPKSALDTMKACLIRSPEKRWTA 717
              GR P+    N+    AIM         +  +K+E + ++     K CL+  P KR TA
Sbjct: 1572 VTGRRPWSNLDNE---WAIMYHVAAGHIPQLPAKDE-ISEAGAKFFKRCLVYDPNKRATA 1627

Query: 718  DEILDASFLNPVLV 731
             E+L    ++P +V
Sbjct: 1628 VELL----MDPWIV 1637

>Smik_4.789 Chr4 complement(1385209..1388619) [3411 bp, 1136 aa]
           {ON} YDR507C (REAL)
          Length = 1136

 Score = 93.6 bits (231), Expect = 9e-19,   Method: Compositional matrix adjust.
 Identities = 71/230 (30%), Positives = 109/230 (47%), Gaps = 28/230 (12%)

Query: 522 NGVLYLVMECGDH-DLSQILNQRANMPLDVDFIRYYSREMLKCVKVVHDAGIVHSDLKPA 580
           N  LYLV+E  +  +L  +L +R  +P + + IR++ R+++  V   H  GIVH DLKP 
Sbjct: 103 NADLYLVLEYAEKGELFNLLVERGPLP-ENEAIRFF-RQIIIGVSYCHALGIVHRDLKPE 160

Query: 581 NFVL-VKGILKIIDFGIANAVPDHTVNIYRDTQIGTPNYMAPEALVALNEVSNVEKKNRW 639
           N +L  K  +KI DFG+A      T     +T  G+P+Y APE       VS +  +   
Sbjct: 161 NLLLDHKYNIKIADFGMAAL---ETEGKLLETSCGSPHYAAPEI------VSGIPYQ--- 208

Query: 640 RVGKPSDIWSCGCIMYQMFYGRPPYGAFQNQNR--LLAIMNPEVKIVFSEKTSKNERVPK 697
             G  SD+WSCG I++ +  GR P+       R  LL +   E ++        ++ + +
Sbjct: 209 --GFASDVWSCGVILFALLTGRLPFDEEDGNIRTLLLKVQKGEFEL------PSDDEISR 260

Query: 698 SALDTMKACLIRSPEKRWTADEILDASFLN--PVLVTPYIVRDLIRNAVY 745
            A D +   L   PE+R    +IL    L   P +     +R L R   Y
Sbjct: 261 EAQDLISRILTVDPERRIKTRDILKHPLLQKYPSIKDSKSIRGLPREDTY 310

>KLTH0D03454g Chr4 (327039..331340) [4302 bp, 1433 aa] {ON} similar to
            uniprot|Q01389 Saccharomyces cerevisiae YJL095W BCK1
            Mitogen-activated protein (MAP) kinase kinase kinase
            acting in the protein kinase C signaling pathway which
            controls cell integrity upon activation by Pkc1p
            phosphorylates downstream kinases Mkk1p and Mkk2p
          Length = 1433

 Score = 93.6 bits (231), Expect = 9e-19,   Method: Compositional matrix adjust.
 Identities = 87/318 (27%), Positives = 135/318 (42%), Gaps = 44/318 (13%)

Query: 426  VEIVEPPTSMTNRKSSKSIVSVNDIEYERIELLGRGGSSKVYKVKNTNNNRVYALKRVVF 485
            VE+ +  T   N KS  S     +  + + E++G+G    VY   N     + A+K+V  
Sbjct: 1121 VEVTDKKTVAIN-KSKNSNGEYKEFAWIKGEIIGKGSFGSVYLGLNVTTGEMMAVKQVEV 1179

Query: 486  DEF---DDTSVDAFKGXXXXXXXXXXXXXXXXXIQYQMDNGVLYLVMECGDHDLSQILNQ 542
              +   D+T++   +                        N V YL  E  +H  S  L  
Sbjct: 1180 PRYGSQDETTLSVLEALKSEVSTLKDLDHV---------NIVQYLGFENKNHVYSLFLEY 1230

Query: 543  RANMPL----------DVDFIRYYSREMLKCVKVVHDAGIVHSDLKPANFVL-VKGILKI 591
             A   +          D D IR+ + ++L+ +  +H  GI+H D+K  N +L V GI KI
Sbjct: 1231 VAGGSVGSLIRLFGRFDEDLIRFLAVQVLRGLAYLHSKGILHRDMKADNLLLDVDGICKI 1290

Query: 592  IDFGIANAVPDHTVNIYRDTQI---GTPNYMAPEALVALNEVSNVEKKNRWRVGKPSDIW 648
             DFGI+      + NIY ++ +   GT  +MAPE          V+ K  +      DIW
Sbjct: 1291 SDFGISK----KSNNIYSNSDMTMRGTVFWMAPEM---------VDTKQGYSAK--VDIW 1335

Query: 649  SCGCIMYQMFYGRPPYGAFQNQNRLLAIMNPEVKIVFSEKTSKNERVPKSALDTMKACLI 708
            S GC++ +MF G+ P+  F+    +  I   +      E T K   +   A   + AC  
Sbjct: 1336 SLGCVVLEMFAGKRPWSNFEVVAAMFKIGKFKSAPPIPEDTQK--LLSAEAKSFLDACFE 1393

Query: 709  RSPEKRWTADEILDASFL 726
              PEKR TAD++L   F 
Sbjct: 1394 IDPEKRPTADDLLSHPFC 1411

>NCAS0C02470 Chr3 complement(460460..461378,461483..461499) [936 bp,
           311 aa] {ON} Anc_8.482
          Length = 311

 Score = 89.4 bits (220), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 66/234 (28%), Positives = 112/234 (47%), Gaps = 24/234 (10%)

Query: 451 EYERIELLGRGGSSKVYKVKNTNNNRVYALKRVVFDEFDDTSVDAFKGXXXXXXXXXXXX 510
           +++++E LG G  + VYK  N       ALK V  D  + T   A +             
Sbjct: 6   QFKQLEKLGNGTYATVYKGLNKTTGAYVALKEVKLDSEEGTPSTAIREISLMKELKHENI 65

Query: 511 XXXXXIQYQMDNGVLYLVMECGDHDLSQILNQR--ANMP--LDVDFIRYYSREMLKCVKV 566
                + +  +   L LV E  D+DL + ++ R   N P  L+++ ++Y+  ++L+ +  
Sbjct: 66  VRLYDVIHTENK--LTLVFEYMDNDLKKYMDSRTVGNSPRGLELNLVKYFQWQLLEGLAF 123

Query: 567 VHDAGIVHSDLKPANFVL-VKGILKIIDFGIANA--VPDHTVNIYRDTQIGTPNYMAPEA 623
            H+  I+H DLKP N ++  KG LK+ DFG+A A  +P +T +    +++ T  Y AP+ 
Sbjct: 124 CHENKILHRDLKPQNLLINKKGALKLGDFGLARAFGIPVNTFS----SEVVTLWYRAPDV 179

Query: 624 LVALNEVSNVEKKNRWRVGKPSDIWSCGCIMYQMFYGRPPYGAFQNQNRLLAIM 677
           L+     S              DIWSCGCI+ +M  G+P +    ++ +L  I 
Sbjct: 180 LMGSRTYSTS-----------IDIWSCGCILAEMITGKPLFPGSNDEEQLKLIF 222

>KLLA0D11990g Chr4 complement(1022895..1023792,1023928..1023944)
           [915 bp, 304 aa] {ON} highly similar to uniprot|P17157
           Saccharomyces cerevisiae YPL031C PHO85 Cyclin-dependent
           kinase with ten cyclin partners involved in
           environmental stress response in phosphate-rich
           conditions Pho85p-Pho80p complex phosphorylates Pho4p
           which in turn represses PHO5
          Length = 304

 Score = 89.0 bits (219), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 84/332 (25%), Positives = 154/332 (46%), Gaps = 59/332 (17%)

Query: 451 EYERIELLGRGGSSKVYKVKNTNNNRVYALKRVVFDEFDDTSVDAFKGXXXXXXXXXXXX 510
           +++++E +G G  + VYK  N       ALK V  D  + T   A +             
Sbjct: 6   QFKQLEKVGNGTYATVYKGLNKTTGVYVALKEVKLDSEEGTPSTAIREISLMKELKHDNI 65

Query: 511 XXXXXIQYQMDNGVLYLVMECGDHDLSQILNQR----ANMPLDVDFIRYYSREMLKCVKV 566
                + +  +   L LV E  D+DL + ++ R    ++  L++D ++Y+  ++L+ V  
Sbjct: 66  VRLFDVIHTENK--LTLVFEFMDNDLKKFMDNRNKGNSHKGLEMDLVKYFQWQLLQGVAF 123

Query: 567 VHDAGIVHSDLKPANFVL-VKGILKIIDFGIANA--VPDHTVNIYRDTQIGTPNYMAPEA 623
            H+  I+H DLKP N ++  +G LK+ DFG+A A  +P +T +    +++ T  Y AP+ 
Sbjct: 124 CHENRILHRDLKPQNLLINNRGQLKLGDFGLARAFGIPVNTFS----SEVVTLWYRAPDV 179

Query: 624 LV-ALNEVSNVEKKNRWRVGKPSDIWSCGCIMYQMFYGRPPYGAFQNQNRLLAIMNPEVK 682
           L+ + N  +++            DIWSCGCI+ +M  G+P +    ++ +L        K
Sbjct: 180 LMGSRNYCTSI------------DIWSCGCILAEMIMGKPLFPGSNDEEQL--------K 219

Query: 683 IVFSEKTSKNERVPKSALDTMKACLIRSPEKRWTADEILDASFLNPVLVTPYIVRDLIRN 742
           ++F               DTM   +    E+ W   ++   +  NP L+ P++ RDL + 
Sbjct: 220 LIF---------------DTMGTPV----EQTWP--QVTQLAKYNP-LLPPHMPRDLKQ- 256

Query: 743 AVYYGSDQGQVSEDKITELADDVLNRLADFRL 774
                ++  +V +D + +L   +L    D RL
Sbjct: 257 --LLQNNTEEVLDDNVVDLLHGLLQLNPDARL 286

>NCAS0A00280 Chr1 (40406..42013) [1608 bp, 535 aa] {ON} Anc_1.24
          Length = 535

 Score = 91.7 bits (226), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 79/310 (25%), Positives = 144/310 (46%), Gaps = 33/310 (10%)

Query: 456 ELLGRGGSSKVYKVKNTNNNRVYALKRVVFDEFDDTSVDAFKGXXXXXXXXXXXXXXXXX 515
           E +GRG    VY+  +   N+V A+K VV  E  +  ++                     
Sbjct: 26  ECVGRGNFGDVYRAIDRTTNKVVAIK-VVDLENTNERLEVL-AQEIFFLAELKSPYIINY 83

Query: 516 IQYQMDNGVLYLVME-CGDHDLSQILNQRANMPLDVDFIRYYSREMLKCVKVVHDAGIVH 574
           I   +++  +++VME CG    S +L    N  L    + Y +RE+LK ++ +H+   +H
Sbjct: 84  ITTLLEDASMWIVMEYCGGGSCSDLLKYYFNNGLPEKKVAYITREILKGLQYLHEQKKIH 143

Query: 575 SDLKPANFVLV-KGILKIIDFGIANAVPDHTVNIYRDTQIGTPNYMAPEALVALNEVSNV 633
            D+K AN +L  +G +K+ DFG++  +      + R T +GTP +MAPE  VA   +   
Sbjct: 144 RDIKAANILLTEEGHVKLGDFGVSGQLKS---TLRRGTIVGTPYWMAPE--VASQNIEGY 198

Query: 634 EKKNRWRVGKPSDIWSCGCIMYQMFYGRPPYGAFQNQNRLLAIMNPEVKIVFSEKTSKNE 693
           ++K         DIWS G  ++++  G PP          L  ++P ++++ +       
Sbjct: 199 DEK--------IDIWSLGITVFELLKGVPP----------LVKLDP-IRVLANLSRKSAP 239

Query: 694 RVPKSALDTMKA----CLIRSPEKRWTADEILDASFLNPVLVTPYIVR-DLIRNAVYYGS 748
           R+  +  D  K+    CLI++P +R  A ++L   F+  + VT      +L++    Y  
Sbjct: 240 RLQGAYSDAAKSFVALCLIKNPNERPAAVDLLKFPFVRFITVTNLKHEIELVKEYKRYPK 299

Query: 749 DQGQVSEDKI 758
             G + +D++
Sbjct: 300 SPGHMMQDRL 309

>AGL242C Chr7 complement(246896..247790,247838..247854) [912 bp, 303
           aa] {ON} Syntenic homolog of Saccharomyces cerevisiae
           YPL031C (PHO85); 1-intron
          Length = 303

 Score = 89.0 bits (219), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 65/228 (28%), Positives = 108/228 (47%), Gaps = 24/228 (10%)

Query: 444 IVSVNDIEYERIELLGRGGSSKVYKVKNTNNNRVYALKRVVFDEFDDTSVDAFKGXXXXX 503
           + S + I ++++E LG G  + VYK  N       ALK V  D  + T   A +      
Sbjct: 1   MTSTSHIRFKQLERLGNGTYATVYKGLNKTTGLYVALKEVKLDSEEGTPSTAIREISLMK 60

Query: 504 XXXXXXXXXXXXIQYQMDNGVLYLVMECGDHDLSQILNQRAN--MP--LDVDFIRYYSRE 559
                       + +  +   L LV E  D+DL + ++ R +  MP  L++  ++Y+  +
Sbjct: 61  ELKHENIVRLYDVIHTENK--LTLVFEFMDNDLKKFMDSRLDREMPRGLELSLVKYFQWQ 118

Query: 560 MLKCVKVVHDAGIVHSDLKPANFVL-VKGILKIIDFGIANA--VPDHTVNIYRDTQIGTP 616
           +L+ V   H+  I+H DLKP N ++  KG LK+ DFG+A A  +P +T +    +++ T 
Sbjct: 119 LLQGVAFCHENRILHRDLKPQNLLINNKGQLKLGDFGLARAFGIPVNTFS----SEVVTL 174

Query: 617 NYMAPEALVALNEVSNVEKKNRWRVGKPSDIWSCGCIMYQMFYGRPPY 664
            Y AP+ L+                    DIWSCGCI+ +M  G+  +
Sbjct: 175 WYRAPDVLMGSRTYCT-----------SIDIWSCGCILAEMIMGKALF 211

>SAKL0C09174g Chr3 complement(833618..836833) [3216 bp, 1071 aa]
           {ON} similar to uniprot|Q12236 YOL100W Saccharomyces
           cerevisiae YOL100W PKH2 Serine/threonine protein kinase
           involved in sphingolipid-mediated signaling pathway that
           controls endocytosis
          Length = 1071

 Score = 92.8 bits (229), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 86/339 (25%), Positives = 148/339 (43%), Gaps = 42/339 (12%)

Query: 402 SQSSTVEKPHTFQDNKEGQKIVKKVEIVEPPTSMTNRKSSKSIVSVNDIEYERIELLGRG 461
           S + T++K H     +   KIVK  E+  P T +T    ++ I+     +++  E+LG G
Sbjct: 138 SMNETLKKRHEEWAERGAAKIVK--EVTNPATGVT----TQHIIKKGIKDFKFGEILGDG 191

Query: 462 GSSKVYKVKNTNNNRVYALKRV----VFDEFDDTSVDAFKGXXXXXXXXXXXXXXXXXIQ 517
             S V    + ++ + YA+K +    +  +     V+  K                   Q
Sbjct: 192 SYSTVMLATSNDSGKKYAVKVLNKEYLIRQKKVKYVNIEKNTLQRLNNSRGVIKLYFTFQ 251

Query: 518 YQMDNGVLYLVME-CGDHDLSQILNQRANMPLDVDFIRYYSREMLKCVKVVHDAGIVHSD 576
              D   LY ++E   + D   ++ +  +  L+ +  RYY  +ML  +  +H  G+VH D
Sbjct: 252 ---DEASLYFLLEYAPNGDFLSVMKKFGS--LNEECCRYYGAQMLDAIDFIHKNGVVHRD 306

Query: 577 LKPANFVLVKGI-LKIIDFGIANAV---PDHTVNIYRDTQ--IGTPNYMAPEALVALNEV 630
           +KP N +L + + +K+ DFG A  +        N+ + ++  +GT  Y++PE L      
Sbjct: 307 IKPENILLDEHMKVKLTDFGTAKLLDRDEKSGYNLLKKSRSFVGTAEYVSPELL------ 360

Query: 631 SNVEKKNRWRVGKPSDIWSCGCIMYQMFYGRPPYGAFQNQNRLLAIMNPEVKIVFSEKTS 690
                 N   V    DIW+ GCI+YQM  G+PP+ A         +M  +V+  F+    
Sbjct: 361 ------NDNCVNYKCDIWAFGCILYQMIAGKPPFKATNEYLTFQKVM--KVQYAFTAG-- 410

Query: 691 KNERVPKSALDTMKACLIRSPEKRWTADEILDASFLNPV 729
                P    D +K  L++SPE R  A ++    F   V
Sbjct: 411 ----FPLVIRDLVKQLLVKSPEARLNASQVKSHHFFKSV 445

>KLTH0C10912g Chr3 (898372..900465) [2094 bp, 697 aa] {ON} highly
           similar to uniprot|P32562 Saccharomyces cerevisiae
           YMR001C
          Length = 697

 Score = 92.0 bits (227), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 78/316 (24%), Positives = 136/316 (43%), Gaps = 36/316 (11%)

Query: 439 KSSKSIVSVNDIEYERIELLGRGGSSKVYKVKNTNNNRVYALKRVVFDEFDDTSVDAFKG 498
           K+  S++     +Y R   LG GG ++ +++K+ ++ +++A K V               
Sbjct: 66  KTPPSLIKTRGRDYHRGHFLGEGGFARCFQIKD-DSGKIFAAKTVAKISIKSEKTRKKLL 124

Query: 499 XXXXXXXXXXXXXXXXXIQYQMDNGVLYLVME-CGDHDLSQILNQRANMPLDVDFIRYYS 557
                            I    D+  +Y+++E C +  L  +L +R    L    +R+++
Sbjct: 125 SEIQIHKSMRHFNIVQFIDCFEDDTNVYILLEICPNGSLMDLLKRRK--VLTEPEVRFFT 182

Query: 558 REMLKCVKVVHDAGIVHSDLKPANFVLVKGI-LKIIDFGIANAVPDHTVNIYRDTQIGTP 616
            +++  VK +H   ++H DLK  N    K   LKI DFG+A  + +     Y  T  GTP
Sbjct: 183 TQIVGAVKYMHSRRVIHRDLKLGNIFFDKHYNLKIGDFGLAAVLANDRERKY--TVCGTP 240

Query: 617 NYMAPEALVALNEVSNVEKKNRWRVGKPSDIWSCGCIMYQMFYGRPPYGAFQNQNRLLAI 676
           NY+APE L   +   + E           DIWSCG ++Y +  G+PP+ A          
Sbjct: 241 NYIAPEVLTGKHTGHSYE----------VDIWSCGVMIYALLIGKPPFQA---------- 280

Query: 677 MNPEVKIVFSEKTSKNERVPK------SALDTMKACLIRSPEKRWTADEILDASFLNPVL 730
              EV I++      +   P+       AL  ++  L   P +R + DEI+D  +   + 
Sbjct: 281 --KEVNIIYERIKCGDYVFPRDKCISQEALTLIRDILSIDPLERPSLDEIIDYVWFRGIF 338

Query: 731 VTPYIVRDLIRNAVYY 746
             P I   ++ +A  Y
Sbjct: 339 -PPRIDASVLSSAPSY 353

>SAKL0G01848g Chr7 (154547..157204) [2658 bp, 885 aa] {ON} weakly
           similar to uniprot|P38692 Saccharomyces cerevisiae
           YHR102W KIC1 Protein kinase of the PAK/Ste20 kinase
           family required for cell integrity possibly through
           regulating 1 6-beta-glucan levels in the wall physically
           interacts with Cdc31p (centrin) which is a component of
           the spindle pole body
          Length = 885

 Score = 92.4 bits (228), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 82/318 (25%), Positives = 138/318 (43%), Gaps = 31/318 (9%)

Query: 452 YERIELLGRGGSSKVYKVKNTNNNRVYALKRVVFDEFDDTSVDAFKGXXXXXXXXXXXXX 511
           Y+R E++GRG    VYK  +    ++ A+K +  D  +D   D  K              
Sbjct: 26  YKRTEVIGRGKFGVVYKGYHIRTKQICAIKVLNLDTSEDEVEDVQKEIQFLSSLKQVPNI 85

Query: 512 XXXXIQYQMDNGVLYLVME-CGDHDLSQILNQRANMPLDVDFIRYYSREMLKCVKVVHDA 570
                 Y  D   L+++ME C    L  +L       +D  +I    RE+L  +  +H  
Sbjct: 86  THYYGSYLYDTK-LWIIMEYCAGGSLRTLLRPGK---IDEKYIGVIMRELLVALLYIHKD 141

Query: 571 GIVHSDLKPANFVLVK-GILKIIDFGIANAVPDHTVNIYRDTQIGTPNYMAPEALVALNE 629
            ++H D+K AN ++   G +K+ DFG+A  +     N+ R T  GTP +MAPE ++   E
Sbjct: 142 NVIHRDIKAANVLITNDGRVKLCDFGVAAQLTQS--NVRRQTMAGTPYWMAPEVIM---E 196

Query: 630 VSNVEKKNRWRVGKPSDIWSCGCIMYQMFYGRPPYGAFQNQNRLLAIMNPEVKIVFSEKT 689
               + K         DIWS G   Y++  G PPY   +    +        +++   K 
Sbjct: 197 GVYYDTK--------VDIWSLGITTYEITTGNPPYCDVEALRAM--------QLITKSKP 240

Query: 690 SKNERVPKSAL--DTMKACLIRSPEKRWTADEILDASFLNPVLVTPY-IVRDLIRNAVYY 746
            + E    S L  + +  CL   P++R  A+++L   F+     +P  I+++LI   + +
Sbjct: 241 PRLEGRQYSPLLKEFIALCLDEDPKERLAAEDLLKTRFIKTHKSSPTSILKELITRYLLH 300

Query: 747 GSDQGQVSEDKITELADD 764
             D+    E  +  L DD
Sbjct: 301 -RDKNINRESAMANLEDD 317

>KNAG0A02310 Chr1 complement(216545..217453) [909 bp, 302 aa] {ON}
           Anc_8.482 YPL031C
          Length = 302

 Score = 88.6 bits (218), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 69/250 (27%), Positives = 117/250 (46%), Gaps = 32/250 (12%)

Query: 451 EYERIELLGRGGSSKVYKVKNTNNNRVYALKRVVFDEFDDTSVDAFKGXXXXXXXXXXXX 510
           +++++E LG G  + VYK  N       ALK V  D  + T   A +             
Sbjct: 6   QFKQLEKLGNGTYATVYKGLNKTTGVYVALKEVKLDSEEGTPSTAIREISLMKELKHDNI 65

Query: 511 XXXXXIQYQMDNGVLYLVMECGDHDLSQILNQR--ANMP--LDVDFIRYYSREMLKCVKV 566
                + +  +   L LV E  D+DL + ++ R   N P  L++  ++Y+  ++L+ +  
Sbjct: 66  VRLYDVIHTENK--LTLVFEYMDNDLKKYMDSRIVGNTPRGLELHLVKYFQWQLLEGLAF 123

Query: 567 VHDAGIVHSDLKPANFVL-VKGILKIIDFGIANA--VPDHTVNIYRDTQIGTPNYMAPEA 623
            H+  I+H DLKP N ++  KG LK+ DFG+A A  +P +T +    +++ T  Y AP+ 
Sbjct: 124 CHENKILHRDLKPQNLLINKKGQLKLGDFGLARAFGIPVNTFS----SEVVTLWYRAPDV 179

Query: 624 LVALNEVSNVEKKNRWRVGKPSDIWSCGCIMYQMFYGRPPYGAFQNQNRLLAIMNPEVKI 683
           L+     S              DIWSCGCI+ +M  G+P +    ++ +L        K+
Sbjct: 180 LMGSRTYST-----------SIDIWSCGCILAEMITGKPLFLGSNDEEQL--------KL 220

Query: 684 VFSEKTSKNE 693
           +F    + NE
Sbjct: 221 IFDTMGTPNE 230

>YDR490C Chr4 complement(1431968..1434268) [2301 bp, 766 aa] {ON}
           PKH1Serine/threonine protein kinase involved in
           sphingolipid-mediated signaling pathway that controls
           endocytosis; activates Ypk1p and Ykr2p, components of
           signaling cascade required for maintenance of cell wall
           integrity; redundant with Pkh2p
          Length = 766

 Score = 92.0 bits (227), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 83/333 (24%), Positives = 144/333 (43%), Gaps = 62/333 (18%)

Query: 421 KIVKKVEIVEPPTSMTNRKSSKSIVSVNDIEYERIELLGRGGSSKVYKVKNTNNNRVYAL 480
           KIVK  ++V+P T     + +K +V +   +++  E LG G  S V      ++ + YA+
Sbjct: 100 KIVK--DVVDPATG----ELTKHVVKMGIKDFKFGEQLGDGSYSSVVLATARDSGKKYAV 153

Query: 481 K-----------RVVFDEFDDTSVDAFKGXXXXXXXXXXXXXXXXXIQYQMDNGVLYLVM 529
           K           +V +   +  ++    G                   +Q D   LY ++
Sbjct: 154 KVLSKEYLIRQKKVKYVTVEKLALQKLNGTKGIFKLF---------FTFQ-DEASLYFLL 203

Query: 530 ECGDH-DLSQILNQRANMPLDVDFIRYYSREMLKCVKVVHDAGIVHSDLKPANFVLVKGI 588
           E   H D   ++ +  +  L+    RYY+ +++  V  +H+ GI+H D+KP N +L K +
Sbjct: 204 EYAPHGDFLGLIKKYGS--LNETCARYYASQIIDAVDSLHNIGIIHRDIKPENILLDKNM 261

Query: 589 -LKIIDFGIANAVPDHTVN---------IYRDTQ--IGTPNYMAPEALVALNEVSNVEKK 636
            +K+ DFG A  +P+   N         +Y  ++  +GT  Y++PE L            
Sbjct: 262 KVKLTDFGTAKILPEEPSNTADGKPYFDLYAKSKSFVGTAEYVSPELL------------ 309

Query: 637 NRWRVGKPSDIWSCGCIMYQMFYGRPPYGAFQNQNRLLAIMNPEVKIVFSEKTSKNERVP 696
           N        DIW+ GCI+YQM  G+PP+ A         +M  +++  F+         P
Sbjct: 310 NDNYTDSRCDIWAFGCILYQMLAGKPPFKAANEYLTFQKVM--KIQYAFTAG------FP 361

Query: 697 KSALDTMKACLIRSPEKRWTADEILDASFLNPV 729
           +   D +K  L+R P  R T  +I    F + V
Sbjct: 362 QIVKDLVKKLLVRDPNDRLTIKQIKAHLFFHEV 394

>CAGL0K04169g Chr11 (384567..385763) [1197 bp, 398 aa] {ON} similar
           to uniprot|P14681 Saccharomyces cerevisiae YGR040w KSS1
          Length = 398

 Score = 90.1 bits (222), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 68/234 (29%), Positives = 108/234 (46%), Gaps = 45/234 (19%)

Query: 525 LYLVMECGDHDLSQILNQRANMPLDVDFIRYYSREMLKCVKVVHDAGIVHSDLKPANFVL 584
           +YLV E  + DLS+IL       L VD I+Y+  ++L+ +K +H A ++H DLKP+N +L
Sbjct: 112 IYLVQELMETDLSRILASSNT--LTVDHIQYFLYQILRALKAIHSAKVIHRDLKPSNILL 169

Query: 585 VKGI-LKIIDFGIANAV-PDHTVNIYRDTQIG-------TPNYMAPEALVALNEVSNVEK 635
                LKI DFG+A    PD   +      +G       T  Y APE ++   + S    
Sbjct: 170 NSNCDLKICDFGLARTYDPDDDASTMNGNNVGFLTEYVATRWYRAPEIMLNFQDYSTA-- 227

Query: 636 KNRWRVGKPSDIWSCGCIMYQMFYGRPPYGAFQNQNRLLAIMN------PEVKIVFSEKT 689
                     DIWSCGC++ +M + +P +      ++LL I++      PE     +   
Sbjct: 228 ---------IDIWSCGCVLAEMLFRKPIFPGKDYHHQLLLILDTLGTPSPEDIEAINYGR 278

Query: 690 SKN-----ERVPKS------------ALDTMKACLIRSPEKRWTADEILDASFL 726
           +K         PK              LD +   +I +P++R TA++ L+  FL
Sbjct: 279 AKEYILSLPHFPKKDWSQLLGTDNEMLLDILDKLMIFNPKRRITAEQALEHPFL 332

>Skud_4.764 Chr4 complement(1351725..1353995) [2271 bp, 756 aa] {ON}
           YDR490C (REAL)
          Length = 756

 Score = 92.0 bits (227), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 63/222 (28%), Positives = 103/222 (46%), Gaps = 35/222 (15%)

Query: 521 DNGVLYLVMECGDH-DLSQILNQRANMPLDVDFIRYYSREMLKCVKVVHDAGIVHSDLKP 579
           D   LY ++E   H D   ++ +  +  L+    RYY+ +++  V  +H  GI+H D+KP
Sbjct: 195 DEASLYFLLEYASHGDFLGLIKKYGS--LNEKCARYYASQIIDAVDSLHAIGIIHRDIKP 252

Query: 580 ANFVLVKGI-LKIIDFGIANAVPDHTVN---------IYRDTQ--IGTPNYMAPEALVAL 627
            N +L K + +K+ DFG A  +P+   N         +Y  ++  +GT  Y++PE L   
Sbjct: 253 ENILLDKDMKVKLTDFGTAKILPEQPSNNADGKPCFDLYARSKSFVGTAEYVSPELL--- 309

Query: 628 NEVSNVEKKNRWRVGKPSDIWSCGCIMYQMFYGRPPYGAFQNQNRLLAIMNPEVKIVFSE 687
                    N        DIW+ GCI+YQM  G+PP+ A         +M  +++  F+ 
Sbjct: 310 ---------NDSYTDSRCDIWAFGCILYQMVAGKPPFKAANEYLTFQKVM--KIQYAFTA 358

Query: 688 KTSKNERVPKSALDTMKACLIRSPEKRWTADEILDASFLNPV 729
                   P  A D +K  L+R P  R T ++I    F + V
Sbjct: 359 G------FPLIAKDLVKKLLVREPNDRLTVEQIKAHVFFHGV 394

>NDAI0D04050 Chr4 (952438..953538) [1101 bp, 366 aa] {ON} Anc_4.184
          Length = 366

 Score = 89.4 bits (220), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 67/237 (28%), Positives = 112/237 (47%), Gaps = 49/237 (20%)

Query: 525 LYLVMECGDHDLSQILNQRANMPLDVDFIRYYSREMLKCVKVVHDAGIVHSDLKPANFVL 584
           +YLV E  + DL +I+    N PL  D I+Y++ ++L+ +K +H A ++H DLKP+N +L
Sbjct: 90  VYLVQELMETDLQKIIMNSNNNPLSDDHIQYFTYQILRALKAIHSAQVIHRDLKPSNLLL 149

Query: 585 VKGI-LKIIDFGIANAVPDHTVNIYRDTQIG-------TPNYMAPEALVALNEVSNVEKK 636
                LK+ DFG++  +   + +  R+T +G       T  Y APE ++   E +     
Sbjct: 150 NSNCDLKVCDFGLSRCLTSSSDS--RETLVGFMTEYVATRWYRAPEIMLTFQEYTTA--- 204

Query: 637 NRWRVGKPSDIWSCGCIMYQMFYGRPPYGAFQNQNRLLAIM----NPEVKIVFSEKTSKN 692
                    DIWS GCI+ +M  GRP +      ++L  I+     P ++  F++  SK 
Sbjct: 205 --------MDIWSVGCILAEMVSGRPLFPGRDYHHQLWLILEVLGTPSLE-DFAQIKSKR 255

Query: 693 ER-----VPKSA------------------LDTMKACLIRSPEKRWTADEILDASFL 726
            +     +P  +                  LD +   L+ +P KR TA E L+  +L
Sbjct: 256 AKEYISNLPMRSPMPWVNVLNTQRNLNPDMLDLLTKMLLFNPNKRITAAEALNHPYL 312

>Smik_4.767 Chr4 complement(1353354..1355630) [2277 bp, 758 aa] {ON}
           YDR490C (REAL)
          Length = 758

 Score = 91.7 bits (226), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 60/222 (27%), Positives = 102/222 (45%), Gaps = 35/222 (15%)

Query: 521 DNGVLYLVMECGDH-DLSQILNQRANMPLDVDFIRYYSREMLKCVKVVHDAGIVHSDLKP 579
           D   LY ++E   H D   ++ +  +  L+    RYY+ +++  V  +H  GI+H D+KP
Sbjct: 195 DEASLYFLLEYAPHGDFLGLIKKYGS--LNEICARYYASQIIDAVDSLHSIGIIHRDIKP 252

Query: 580 ANFVLVKGI-LKIIDFGIANAVPDHTVN---------IYRDTQ--IGTPNYMAPEALVAL 627
            N +L K + +K+ DFG A  +P+   N         +Y  ++  +GT  Y++PE L   
Sbjct: 253 ENILLDKDMKVKLTDFGTAKILPEQPSNAADGKPCFDLYAKSKSFVGTAEYVSPELL--- 309

Query: 628 NEVSNVEKKNRWRVGKPSDIWSCGCIMYQMFYGRPPYGAFQNQNRLLAIMNPEVKIVFSE 687
                    N        DIW+ GCI+YQM  G+PP+ A         +M  +++  F+ 
Sbjct: 310 ---------NDSYTDSRCDIWAFGCILYQMLAGKPPFKAANEYLTFQKVM--KIQYAFTA 358

Query: 688 KTSKNERVPKSALDTMKACLIRSPEKRWTADEILDASFLNPV 729
                   P+   D +K  L+R P  R   ++I    F + +
Sbjct: 359 G------FPQIVKDLVKKLLVRDPNDRLAIEQIKAHVFFDKI 394

>KNAG0D03980 Chr4 (721049..722170) [1122 bp, 373 aa] {ON} Anc_4.184
           YGR040W
          Length = 373

 Score = 89.4 bits (220), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 66/236 (27%), Positives = 107/236 (45%), Gaps = 48/236 (20%)

Query: 525 LYLVMECGDHDLSQILNQRANMPLDVDFIRYYSREMLKCVKVVHDAGIVHSDLKPANFVL 584
           +Y+V E  + DL ++L   A   L  D I+Y+  + L+ +K +H AG++H D+KP+N +L
Sbjct: 90  VYIVQELMETDLHRVL---AAQRLSDDHIQYFVYQTLRALKAIHSAGVIHRDIKPSNLLL 146

Query: 585 VKGI-LKIIDFGIANAVPDHTVNIYRDTQIG-------TPNYMAPEALVALNEVSNVEKK 636
                LK+ DFG+A  +   + +  R+T  G       T  Y APE +++  E +     
Sbjct: 147 NSNCDLKVCDFGLARCLQSSSAS--RETMFGFMTEYVATRWYRAPEIMLSFQEYTTA--- 201

Query: 637 NRWRVGKPSDIWSCGCIMYQMFYGRPPYGAFQNQNRL---LAIMNPEVKIVFSEKTSKNE 693
                    DIWS GCI+ +M  GRP +      ++L   L I+       F +  S+  
Sbjct: 202 --------MDIWSVGCILAEMLLGRPLFPGRDYHHQLWLILEILGTPHPADFDQIKSRRA 253

Query: 694 R---------------------VPKSALDTMKACLIRSPEKRWTADEILDASFLNP 728
           R                     +  S LD +   L  +P+ R TA E L+ ++L P
Sbjct: 254 REYIAGMPLRQRKPWDLVFSRPIDTSLLDLLTRMLTFNPDNRITAHEALEHAYLAP 309

>SAKL0B04488g Chr2 (395136..396242) [1107 bp, 368 aa] {ON} highly
           similar to uniprot|P14681 Saccharomyces cerevisiae
           YGR040W KSS1 Mitogen-activated protein kinase (MAPK)
           involved in signal transduction pathways that control
           filamentous growth and pheromone response
          Length = 368

 Score = 89.0 bits (219), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 63/236 (26%), Positives = 103/236 (43%), Gaps = 44/236 (18%)

Query: 524 VLYLVMECGDHDLSQIL---NQRANMPLDVDFIRYYSREMLKCVKVVHDAGIVHSDLKPA 580
            +YLV E  + DL +I+   N  +  PL  D I+Y+  +ML+ +K +H A ++H DLKP+
Sbjct: 89  AVYLVQELMETDLHRIIANSNGHSGTPLSDDHIQYFVYQMLRALKAMHSAQVIHRDLKPS 148

Query: 581 NFVLVKGI-LKIIDFGIANAVPDHT-----VNIYRDTQIGTPNYMAPEALVALNEVSNVE 634
           N +L     LK+ DFG+A  +   +     +  +    + T  Y APE ++   E +   
Sbjct: 149 NLLLNSNCDLKVCDFGLARCLASSSNSRENLVGFMTEYVATRWYRAPEIMLTFQEYTTA- 207

Query: 635 KKNRWRVGKPSDIWSCGCIMYQMFYGRPPYGAFQNQNRLLAIM----------------- 677
                      DIWSCGCI+ +M  G+P +      ++L  I+                 
Sbjct: 208 ----------MDIWSCGCILAEMITGKPLFPGRDYHHQLWLILEVLGTPSYQDFEQIKSK 257

Query: 678 -------NPEVKIVFSEKTSKNERVPKSALDTMKACLIRSPEKRWTADEILDASFL 726
                  N  ++     K    + V   A+D +   L  +P+KR  A E L   +L
Sbjct: 258 RAKEYIANLPLRPRVPWKIVLGQHVNPDAIDLLDKMLTFNPDKRIGASEALKHPYL 313

>CAGL0I07513g Chr9 (722045..725275) [3231 bp, 1076 aa] {ON} similar
           to uniprot|Q12236 Saccharomyces cerevisiae YOL100w PKH2
          Length = 1076

 Score = 91.7 bits (226), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 61/216 (28%), Positives = 100/216 (46%), Gaps = 33/216 (15%)

Query: 521 DNGVLYLVME-CGDHDLSQILNQRANMPLDVDFIRYYSREMLKCVKVVHDAGIVHSDLKP 579
           D   LY ++E   + D   ++ +  +  L  D  RYYS +++  +K +H  GI+H D+KP
Sbjct: 252 DESSLYFLLEYAPNGDFLSVMKKYGS--LSEDCTRYYSAQIIDGIKYLHSKGIIHRDIKP 309

Query: 580 ANFVLVKGI-LKIIDFGIANAV---------PDHTVNIYRDTQIGTPNYMAPEALVALNE 629
            N +L K + +KI DFG A  +         P+  +     + +GT  Y++PE L     
Sbjct: 310 ENILLDKDMKVKITDFGTAKILEPKNEDEDNPEFNLLTRSKSFVGTAEYVSPELL----- 364

Query: 630 VSNVEKKNRWRVGKPSDIWSCGCIMYQMFYGRPPYGAFQNQNRLLAIMNPEVKIVFSEKT 689
                  N   V    DIW+ GC+++QM  G+PP+ A         +M  +V+  F+   
Sbjct: 365 -------NDSYVDARCDIWAFGCMVFQMIAGKPPFKATNEYLTFQKVM--KVQYAFTAG- 414

Query: 690 SKNERVPKSALDTMKACLIRSPEKRWTADEILDASF 725
                 P    D +K  L++ PE+R T  +I    F
Sbjct: 415 -----FPVVVRDLVKRILLKVPEQRLTIPQIEKHHF 445

>Ecym_2499 Chr2 complement(976395..981020) [4626 bp, 1541 aa] {ON}
            similar to Ashbya gossypii AER264C
          Length = 1541

 Score = 92.0 bits (227), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 82/313 (26%), Positives = 134/313 (42%), Gaps = 43/313 (13%)

Query: 450  IEYERIELLGRGGSSKVYKVKNTNNNRVYALKRVVFDEFDDTSVDAFKGXXXXXXXXXXX 509
            I +++   +G G    VY   N +   + A+K + F   D  S+                
Sbjct: 1242 IRWQKRSFIGGGSFGSVYSAVNLDTGDILAVKEIRFH--DRKSMRQVFPSIKDEMTVLEM 1299

Query: 510  XXXXXXIQY---QMDNGVLYLVME-CGDHDLSQILNQRANMPLDVDFIRYYSREMLKCVK 565
                  +QY   ++    + + ME C    L+ +L        D    + YS ++L+ + 
Sbjct: 1300 LNHPNIVQYYGVEVHRDRVNIFMEYCEGGSLASLLEH--GRIEDEMVTQVYSLQLLEGLA 1357

Query: 566  VVHDAGIVHSDLKPANFVL-VKGILKIIDFGIANAVPDHTVNIYR--------DTQIGTP 616
             +H++G+ H D+KP N +L   GI+K +DFG A  +  +   +          D  IGTP
Sbjct: 1358 YLHESGVHHRDIKPENILLDFNGIIKYVDFGAAKLIATNGSKVLTEDNGRDSTDKMIGTP 1417

Query: 617  NYMAPEALVALNEVSNVEKKNRWRVGKPSDIWSCGCIMYQMFYGRPPYGAFQNQNRLLAI 676
             YM+PE++ A             + G   DIWS GC++ +M  GR P+    NQ    AI
Sbjct: 1418 MYMSPESISA---------SGYGKFGS-DDIWSLGCVVLEMVTGRRPWANLDNQ---WAI 1464

Query: 677  MNPEVKIVFSEKTSKNERVPKSALDTMKACLIRSPEKRWTADEILDASFLNPVLVTPYIV 736
            M            +K+E  P + +  +  CLI+ P  R +A E+         L+ P+IV
Sbjct: 1465 MYQVAAGQIPSFPTKHEMSP-TGIKFLSRCLIQDPNMRSSAVEL---------LMDPWIV 1514

Query: 737  RDLIRNAVYYGSD 749
               IRN + +G D
Sbjct: 1515 E--IRN-IAFGED 1524

>Kpol_2002.24 s2002 (48405..49868) [1464 bp, 487 aa] {ON}
           (48405..49868) [1464 nt, 488 aa]
          Length = 487

 Score = 90.1 bits (222), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 77/281 (27%), Positives = 130/281 (46%), Gaps = 32/281 (11%)

Query: 452 YERIELLGRGGSSKVYKVKNTNNNRVYALKRVVFDEFDDTSVDAFKGXXXXXXXXXXXXX 511
           Y   E +GRG    VYK  +  N  + A+K VV  E  +  +D                 
Sbjct: 15  YSIQECVGRGNFGDVYKAFDKTNGAIVAVK-VVNLEHTEEDIDLL-AQEIFFLAELRSPY 72

Query: 512 XXXXIQYQMDNGVLYLVME-CGDHDLSQILNQRANMPLDVDFIRYYSREMLKCVKVVHDA 570
               I   +++  +++VME CG    S ++       L  + + + +RE+LK +K +HD 
Sbjct: 73  ITNYITTMIEDVSMWIVMEYCGGGACSDLIKTVYINGLPENKVGFITREVLKGLKYLHDQ 132

Query: 571 GIVHSDLKPANFVLV-KGILKIIDFGIANAVPDHTVNIYRDTQIGTPNYMAPEALVALNE 629
             +H D+K AN +L  +G +K+ DFG++  +      + R T +GTP +MAPE    +N+
Sbjct: 133 KKIHRDIKAANILLTDEGKVKLGDFGVSGQI---RATMKRGTFVGTPYWMAPE---VVNK 186

Query: 630 VSNVEKKNRWRVGKPSDIWSCGCIMYQMFYGRPPYGAFQNQNRLLAIMNPEVKIVFSEKT 689
            SN          + +DIWS G  +Y++  G PP          L+  +P +K++ S   
Sbjct: 187 ESN-------GYNEKADIWSLGITVYELLKGLPP----------LSKCDP-MKVMVSLPR 228

Query: 690 SKNERVPKSALDTMK----ACLIRSPEKRWTADEILDASFL 726
            K  ++     D  K    ACL++ P  R +A+ +L   F+
Sbjct: 229 RKPPKLHGQYSDVAKGFVAACLVKDPNLRPSAEMLLTNEFV 269

>ABL034W Chr2 (333432..337709) [4278 bp, 1425 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YKL101W (HSL1)
          Length = 1425

 Score = 91.7 bits (226), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 65/210 (30%), Positives = 104/210 (49%), Gaps = 31/210 (14%)

Query: 525 LYLVME-CGDHDLSQILNQRANMPLDVDFIRYYSREMLKCVKVVHDAGIVHSDLKPANFV 583
           LYLV+E     +L   L  R  +P + + I Y+ +++++ V   H+  I H DLKP N +
Sbjct: 139 LYLVLEYVEGGELFDYLIARGKLP-EQEAIHYF-KQIVQGVSYCHNFNICHRDLKPENLL 196

Query: 584 LVKG--ILKIIDFGIANAVPDHTVNIYRDTQIGTPNYMAPEALVALNEVSNVEKKNRWRV 641
           L K    +KI DFG+A      T N   +T  G+P+Y +PE ++            ++  
Sbjct: 197 LDKKNKTVKIADFGMAAL---ETTNRLLETSCGSPHYASPEIVMG----------QKYH- 242

Query: 642 GKPSDIWSCGCIMYQMFYGRPPYGAFQNQNRLLAIMNPEVKIVFSEKTSKNERVPKSALD 701
           G PSD+WSCG I++ +  G  P+     +  LL + +   ++           V K A D
Sbjct: 243 GSPSDVWSCGIILFALLTGHLPFNDDNVRKLLLKVQHGRYQMP--------SNVSKEAKD 294

Query: 702 TMKACLIRSPEKRWTADEILDASFLNPVLV 731
            +   L+  PEKR T D+IL+    +P+LV
Sbjct: 295 LISKILVVDPEKRITVDKILE----HPLLV 320

>KAFR0B02980 Chr2 (623470..624804) [1335 bp, 444 aa] {ON} Anc_8.302
           YLR113W
          Length = 444

 Score = 89.7 bits (221), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 71/228 (31%), Positives = 110/228 (48%), Gaps = 43/228 (18%)

Query: 525 LYLVMECGDHDLSQILNQRANMPLDVDFIRYYSREMLKCVKVVHDAGIVHSDLKPANFVL 584
           +Y V E    DL ++L  R   PL+  F++Y+  ++L+ +K VH AG++H DLKP+N ++
Sbjct: 96  IYFVTELQGTDLHRLLETR---PLEKQFVQYFLYQILRGLKYVHSAGVIHRDLKPSNILI 152

Query: 585 VKGI-LKIIDFGIANAVPDHTVNIYRDTQIGTPNYMAPEALVALNEVSNVEKKNRWRVGK 643
            +   LKI DFG+A  + D  +  Y    + T  Y APE ++   +  NVE         
Sbjct: 153 NENCDLKICDFGLAR-IQDPQMTGY----VSTRYYRAPEIMLTWQKY-NVE--------- 197

Query: 644 PSDIWSCGCIMYQMFYGRPPYGAFQNQNRLLAIMN-----PE--VKIVFSEKTSK----- 691
             DIWS GCI  +M  G+P +    + ++   I +     PE  +  + SE T K     
Sbjct: 198 -VDIWSAGCIFAEMIEGKPLFPGKDHVHQFSIITDLLGSPPEDVINTICSENTLKFVTSL 256

Query: 692 --------NER---VPKSALDTMKACLIRSPEKRWTADEILDASFLNP 728
                   +ER   V    +D +   L+  P+KR TA E L   +L P
Sbjct: 257 PHRDPIPFSERFKNVEPDTVDLLAKMLVFEPKKRITAAEALAHPYLAP 304

>Skud_3.146 Chr3 complement(227229..231233) [4005 bp, 1334 aa] {ON}
            YCR073C (REAL)
          Length = 1334

 Score = 91.7 bits (226), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 64/217 (29%), Positives = 105/217 (48%), Gaps = 42/217 (19%)

Query: 556  YSREMLKCVKVVHDAGIVHSDLKPANFVL-VKGILKIIDFGIANAVPDHTVNIYR----- 609
            Y+ E+L+ +  +H +G+VH D+KP N +L   GI+K +DFG A  V + +    +     
Sbjct: 1138 YTLELLEGLVYLHKSGVVHRDIKPENILLDFNGIIKYVDFGTARTVVESSTRALQKAATG 1197

Query: 610  ------------DTQIGTPNYMAPEALVALNEVSNVEKKNRWRVGKPSDIWSCGCIMYQM 657
                        +  +GTP YMAPEA+      S V+ K    +G   D+W+ GC++ +M
Sbjct: 1198 DLQEAEPETKPVNCMMGTPMYMAPEAISG----STVKGK----LG-ADDVWALGCVVLEM 1248

Query: 658  FYGRPPYGAFQNQNRLLAIMNPEVKIVFSEKTSKNERVPKSALDTMKACLIRSPEKRWTA 717
              GR P+    N+    AIM         +  S +E  P +    ++ CL++ P  R TA
Sbjct: 1249 ATGRRPWSNLDNE---WAIMYHVAAGHVPQLPSTDEMTP-AGRAFLERCLVQDPSMRATA 1304

Query: 718  DEILDASFLNPVLVTPYIVRDLIRNAVYYGSDQGQVS 754
             E+         LV P+++   IR   + GSD+ ++S
Sbjct: 1305 TEL---------LVDPWMMH--IREIAFGGSDKDKIS 1330

>NCAS0C04940 Chr3 (1006185..1009535) [3351 bp, 1116 aa] {ON}
           Anc_3.92
          Length = 1116

 Score = 91.7 bits (226), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 62/214 (28%), Positives = 103/214 (48%), Gaps = 30/214 (14%)

Query: 521 DNGVLYLVME-CGDHDLSQILNQRANMPLDVDFIRYYSREMLKCVKVVHDAGIVHSDLKP 579
           D   LY ++E   + DL  ++ +  +  L+ +   YY  +++  +K +H  GI+H D+KP
Sbjct: 244 DEASLYFLLEYAPNGDLLSLMKKFGS--LNEECCCYYGAQIIDAIKFMHSKGIIHRDIKP 301

Query: 580 ANFVLVKGI-LKIIDFGIA----NAVPDHTVNIYRDTQ--IGTPNYMAPEALVALNEVSN 632
            N +L K + +KI DFG A    N  P  + ++   ++  +GT  Y++PE L        
Sbjct: 302 ENILLDKDMKVKITDFGTAKILDNKPPGTSYDLLTRSKSFVGTAEYVSPELL-------- 353

Query: 633 VEKKNRWRVGKPSDIWSCGCIMYQMFYGRPPYGAFQNQNRLLAIMNPEVKIVFSEKTSKN 692
               N       SDIW+ GCI++QM  G+PP+ A         +M  +V+  F+      
Sbjct: 354 ----NDNYTDARSDIWAFGCIVFQMIAGKPPFKATNEYLTFQKVM--KVQYAFTAG---- 403

Query: 693 ERVPKSALDTMKACLIRSPEKRWTADEILDASFL 726
              P    D +K  LI++PE+R T + I    F 
Sbjct: 404 --FPTVVRDLVKRILIKAPEQRLTIEAIEKHHFF 435

>Kpol_1007.17 s1007 (32671..32687,32861..33767) [924 bp, 307 aa]
           {ON} (32671..32687,32861..33767) [924 nt, 308 aa]
          Length = 307

 Score = 87.4 bits (215), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 64/235 (27%), Positives = 110/235 (46%), Gaps = 24/235 (10%)

Query: 451 EYERIELLGRGGSSKVYKVKNTNNNRVYALKRVVFDEFDDTSVDAFKGXXXXXXXXXXXX 510
           +++++E LG G  + VYK  N       ALK V  D  + T   A +             
Sbjct: 6   QFKQLEKLGNGTYATVYKGLNKTTGVYVALKEVKLDSEEGTPSTAIREISLMKELKHDNI 65

Query: 511 XXXXXIQYQMDNGVLYLVMECGDHDLSQILNQR--ANMP--LDVDFIRYYSREMLKCVKV 566
                + +  +   L LV E  D DL + ++ R   N P  L++  ++Y+  ++ + +  
Sbjct: 66  VRLYDVIHTENK--LTLVFEYMDKDLKKYMDSRTTGNSPQGLELSLVKYFQWQLFEGISF 123

Query: 567 VHDAGIVHSDLKPANFVLV-KGILKIIDFGIANA--VPDHTVNIYRDTQIGTPNYMAPEA 623
            H+  I+H DLKP N ++  KG LK+ DFG+A A  +P +T +    +++ T  Y AP+ 
Sbjct: 124 CHENKILHRDLKPQNLLINNKGQLKLGDFGLARAFGIPVNTFS----SEVVTLWYRAPDV 179

Query: 624 LVALNEVSNVEKKNRWRVGKPSDIWSCGCIMYQMFYGRPPYGAFQNQNRLLAIMN 678
           L+     S              D+WSCGCI+ +M  G+P +    ++ +L  I +
Sbjct: 180 LMGSRSYST-----------SIDMWSCGCILAEMLTGKPLFPGTNDEEQLKLIFD 223

>TPHA0A01630 Chr1 complement(328040..329347) [1308 bp, 435 aa] {ON}
           Anc_8.302 YLR113W
          Length = 435

 Score = 89.4 bits (220), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 70/228 (30%), Positives = 110/228 (48%), Gaps = 43/228 (18%)

Query: 525 LYLVMECGDHDLSQILNQRANMPLDVDFIRYYSREMLKCVKVVHDAGIVHSDLKPANFVL 584
           +Y V E    DL ++L  R   PL+  F++Y+  ++L+ +K VH AG++H DLKP+N ++
Sbjct: 96  IYFVTELQGTDLHRLLQTR---PLEKQFVQYFLYQILRGLKYVHSAGVIHRDLKPSNILI 152

Query: 585 VKGI-LKIIDFGIANAVPDHTVNIYRDTQIGTPNYMAPEALVALNEVSNVEKKNRWRVGK 643
            +   LKI DFG+A  + D  +  Y    + T  Y APE ++   +  +VE         
Sbjct: 153 NENCDLKICDFGLAR-IQDPQMTGY----VSTRYYRAPEIMLTWQKY-DVE--------- 197

Query: 644 PSDIWSCGCIMYQMFYGRPPYGAFQNQNRLLAIM-------NPEVKIVFSEKTSK----- 691
             DIWS GCI  +M  G+P +    + ++   I        N  +  + SE T K     
Sbjct: 198 -VDIWSAGCIFAEMIEGKPLFPGKDHVHQFSIITDLLGSPPNDVIDTICSENTLKFVTSL 256

Query: 692 --NERVPKS---------ALDTMKACLIRSPEKRWTADEILDASFLNP 728
              + VP S         A+D ++  L+  P+KR TA   L  S+L P
Sbjct: 257 PHRDPVPFSERFKTVEPDAVDLLEKMLVFDPKKRLTAANALAHSYLAP 304

>AER264C Chr5 complement(1120017..1124468) [4452 bp, 1483 aa] {ON}
            Syntenic homolog of Saccharomyces cerevisiae YCR073C
            (SSK22) and YNR031C (SSK2)
          Length = 1483

 Score = 91.3 bits (225), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 74/285 (25%), Positives = 135/285 (47%), Gaps = 32/285 (11%)

Query: 450  IEYERIELLGRGGSSKVYKVKNTNNNRVYALKRVVFDEFDDTSVDAFKGXXXXXXXXXXX 509
            I++++   +G G    VY   N +   + A+K + F+  D  ++                
Sbjct: 1189 IKWQKRSFIGGGSFGSVYSAVNLDTGDILAVKEIKFN--DRKTIKQVFPSIRDEMTVLEM 1246

Query: 510  XXXXXXIQY---QMDNGVLYLVME-CGDHDLSQILNQRANMPLDVDFI-RYYSREMLKCV 564
                  +QY   ++    + + ME C    L+ +L   A+  ++ + + + YS +ML+ +
Sbjct: 1247 LNHPNVVQYYGVEVHRDRVNIFMEYCEGGSLASLL---AHGRIEDEMVTQVYSLQMLEGL 1303

Query: 565  KVVHDAGIVHSDLKPANFVL-VKGILKIIDFGIANAVPDHT---VNIYRDTQ----IGTP 616
              +H++G+ H D+KP N +L   GI+K +DFG A  +  +    +N+ +  +    IGTP
Sbjct: 1304 AYLHESGVDHRDIKPENILLDFNGIIKYVDFGAAKVLASNGSKKLNLEQHMEGEKMIGTP 1363

Query: 617  NYMAPEALVALNEVSNVEKKNRWRVGKPSDIWSCGCIMYQMFYGRPPYGAFQNQNRLLAI 676
             YM+PEA         +      + G   DIWS GC++ +M  GR P+    NQ  ++  
Sbjct: 1364 MYMSPEA---------ISGTGYGKFGS-DDIWSLGCVILEMVTGRRPWANLDNQWAIIYQ 1413

Query: 677  MNPEVKIVFSEKTSKNERVPKSALDTMKACLIRSPEKRWTADEIL 721
            +      +F    SKNE + ++ +  +  CLI+ P +R TA E+L
Sbjct: 1414 VAAGQIPMFP---SKNE-MSQAGIKFLSRCLIQDPNQRSTAVELL 1454

>TPHA0C01780 Chr3 complement(407048..407965) [918 bp, 305 aa] {ON}
           Anc_8.482 YPL031C
          Length = 305

 Score = 87.4 bits (215), Expect = 5e-18,   Method: Compositional matrix adjust.
 Identities = 76/291 (26%), Positives = 132/291 (45%), Gaps = 31/291 (10%)

Query: 445 VSVNDIEYERIELLGRGGSSKVYKVKNTNNNRVYALKRVVFDEFDDTSVDAFKGXXXXXX 504
           +S +  +++++E LG G  + VYK  N       ALK V  D  + T   A +       
Sbjct: 1   MSSSSSQFKQLEKLGNGTYATVYKGLNKTTGIFVALKEVKLDSEEGTPSTAIREISLMKE 60

Query: 505 XXXXXXXXXXXIQYQMDNGVLYLVMECGDHDLSQILNQR----ANMPLDVDFIRYYSREM 560
                      + +  +   L LV E  D DL   ++ R    +   L++  ++Y+  ++
Sbjct: 61  LKHENIVRLYDVIHTENK--LTLVFEYMDKDLKNYMDSRTSGNSTRGLELSLVKYFQWQL 118

Query: 561 LKCVKVVHDAGIVHSDLKPANFVLV-KGILKIIDFGIANA--VPDHTVNIYRDTQIGTPN 617
            + V   H+  I+H DLKP N ++  KG LK+ DFG+A A  +P +T +    T++ T  
Sbjct: 119 FEGVTFCHENKILHRDLKPQNLLINNKGQLKLGDFGLARAFGIPVNTFS----TEVVTLW 174

Query: 618 YMAPEALVALNEVSNVEKKNRWRVGKPSDIWSCGCIMYQMFYGRPPYGAFQNQNRL---L 674
           Y AP+ L+     S              D+WSCGCI+ +M  G+P +    ++ +L    
Sbjct: 175 YRAPDVLMGSRSYST-----------SIDMWSCGCILAEMITGKPLFPGTNDEEQLKLIF 223

Query: 675 AIMNPEVKIVFSEKTS---KNERVPKSALDTMKACLIRSPEKRWTADEILD 722
            IM    + ++   TS    N  +PK     +K  L+++  K    D+++D
Sbjct: 224 DIMGTPDEQLWPAVTSLPKYNRNLPKKEPKDLKK-LLQAHTKEIVDDQVID 273

>ZYRO0A06446g Chr1 complement(513126..515957) [2832 bp, 943 aa] {ON}
           weakly similar to uniprot|P38692 Saccharomyces
           cerevisiae YHR102W KIC1 Protein kinase of the PAK/Ste20
           kinase family required for cell integrity possibly
           through regulating 1 6-beta-glucan levels in the wall
           physically interacts with Cdc31p (centrin) which is a
           component of the spindle pole body
          Length = 943

 Score = 90.9 bits (224), Expect = 5e-18,   Method: Compositional matrix adjust.
 Identities = 75/292 (25%), Positives = 130/292 (44%), Gaps = 31/292 (10%)

Query: 438 RKSSKSIVSVNDIEYERIELLGRGGSSKVYKVKNTNNNRVYALKRVVFDEFDDTSVDAFK 497
           R  ++ + SV    ++R E++G G    VYK  +    +VYA+K +  D  +D   D  +
Sbjct: 19  RPDNQDVTSV----FKRTEVIGTGKFGVVYKGHHARTKQVYAIKVLNLDSDEDEVEDVQR 74

Query: 498 GXXXXXXXXXXXXXXXXXIQYQMDNGVLYLVMECGDHDLSQILNQRANMPLDVDFIRYYS 557
                               Y  D  +  ++  C    L  +L       +D  +I    
Sbjct: 75  EVQFLASMKQTPNITHYYGSYLKDTTLWIIIEYCAGGSLRTLLRPGK---IDEKYIGIIM 131

Query: 558 REMLKCVKVVHDAGIVHSDLKPANFVLV-KGILKIIDFGIANAVPDHTVNIYRDTQIGTP 616
           RE+L  +K +H   ++H D+K AN ++  +G +K+ DFG+A  +  +  ++ R T  GTP
Sbjct: 132 REVLIALKYIHKDNVIHRDIKAANVLITNEGHVKLCDFGVAAQL--NQSSLKRQTMAGTP 189

Query: 617 NYMAPEALVALNEVSNVEKKNRWRVGKPSDIWSCGCIMYQMFYGRPPYGAFQNQNRLLAI 676
            +MAPE  V +  VS   K          DIWS G   Y++  G PPY   +    L A+
Sbjct: 190 YWMAPE--VIMEGVSYDTK---------VDIWSLGITTYEIATGNPPYCDVE---ALRAM 235

Query: 677 MNPEVKIVFSEKTSKNERVPKSAL--DTMKACLIRSPEKRWTADEILDASFL 726
                +++   K  + E    S +  + +  CL   P++R +AD++L +  +
Sbjct: 236 -----QLITKSKPPRLEGRHYSPMLKEFIALCLDEDPKERLSADDLLKSKLI 282

>KLLA0A02497g Chr1 (218592..219680) [1089 bp, 362 aa] {ON} highly
           similar to uniprot|P14681 Saccharomyces cerevisiae
           YGR040W KSS1 Mitogen-activated protein kinase (MAPK)
           involved in signal transduction pathways that control
           filamentous growth and pheromone response
          Length = 362

 Score = 88.6 bits (218), Expect = 5e-18,   Method: Compositional matrix adjust.
 Identities = 67/235 (28%), Positives = 112/235 (47%), Gaps = 50/235 (21%)

Query: 525 LYLVMECGDHDLSQILNQRANMPLDVDFIRYYSREMLKCVKVVHDAGIVHSDLKPANFVL 584
           +YLV E  + DL +I+NQ+    L  D I+Y+  ++L+ +K +H A ++H DLKP+N +L
Sbjct: 90  VYLVQELMETDLQKIINQQN---LSEDHIQYFVYQILRALKSLHSAQVIHRDLKPSNLLL 146

Query: 585 VKGI-LKIIDFGIANAVPDHTVNIYRDTQIG-------TPNYMAPEALVALNEVSNVEKK 636
                LK+ DFG+A  +     +  R+  +G       T  Y APE +++  E +     
Sbjct: 147 NSNCDLKVCDFGLARCLASSDQS--RENMVGFMTEYVATRWYRAPEIMLSFQEYTTA--- 201

Query: 637 NRWRVGKPSDIWSCGCIMYQMFYGRPPYGAFQNQNRLLAIM----NPEVKIVFSEKTSK- 691
                    DIWSCGCI+ +M  G+P +      ++L  I+    +P ++  F +  SK 
Sbjct: 202 --------MDIWSCGCILAEMIMGKPLFPGKDYHHQLWIILEVLGSPTLE-DFEQIKSKR 252

Query: 692 --------------------NERVPKSALDTMKACLIRSPEKRWTADEILDASFL 726
                               N+ V   A+D +   L  +P+KR +A E L+  +L
Sbjct: 253 AKEYISQLPMKKGIPWANVLNKEVNPLAIDLLSKMLTFNPDKRISAVEALEHPYL 307

>Suva_2.703 Chr2 complement(1238496..1239953) [1458 bp, 485 aa] {ON}
           YDR523C (REAL)
          Length = 485

 Score = 89.7 bits (221), Expect = 5e-18,   Method: Compositional matrix adjust.
 Identities = 73/280 (26%), Positives = 127/280 (45%), Gaps = 30/280 (10%)

Query: 458 LGRGGSSKVYKVKNTNNNRVYALKRVVFDEFDDTSVDAFKGXXXXXXXXXXXXXXXXXIQ 517
           +GRG    VYK  +     + A+K VV  E  D  ++                     I 
Sbjct: 19  IGRGNFGDVYKAMDRTTQEIVAIK-VVNLEHSDEDIELL-AQEIFFLAELKSPLITNYIT 76

Query: 518 YQMDNGVLYLVME-CGDHDLSQILNQRANMPLDVDFIRYYSREMLKCVKVVHDAGIVHSD 576
             +++  +++VME CG    S +L +     L  + + +   ++   +K +H+   +H D
Sbjct: 77  TMLEDVSMWIVMEYCGGGSCSDLLKRNYVNGLPEEKVSFIIHQVTLGLKYLHEQRKIHRD 136

Query: 577 LKPANFVL-VKGILKIIDFGIANAVPDHTVNIYRDTQIGTPNYMAPEALVALNEVSNVEK 635
           +K AN +L  +G++K+ DFG++  +      + RDT +GTP +MAPE  V   EV    +
Sbjct: 137 IKAANILLNEEGMVKLGDFGVSGHI---RSTMKRDTFVGTPYWMAPE--VVCCEVDGYNE 191

Query: 636 KNRWRVGKPSDIWSCGCIMYQMFYGRPP---YGAFQNQNRLLAIMNPEVKIVFSEKTSKN 692
           K        +DIWS G   Y++  G PP   Y   +    L     P+++  FSE     
Sbjct: 192 K--------ADIWSLGITTYELLKGLPPLSKYDPMKVMTNLPKRKPPKLQGSFSE----- 238

Query: 693 ERVPKSALDTMKACLIRSPEKRWTADEILDASFLNPVLVT 732
                +A + +  CL+++P  R +A ++L   F+  V +T
Sbjct: 239 -----AAKEFVAGCLVKAPADRPSAYDLLSFDFIRNVTIT 273

>Smik_3.173 Chr3 complement(242285..246307) [4023 bp, 1340 aa] {ON}
            YCR073C (REAL)
          Length = 1340

 Score = 90.9 bits (224), Expect = 6e-18,   Method: Compositional matrix adjust.
 Identities = 80/323 (24%), Positives = 141/323 (43%), Gaps = 46/323 (14%)

Query: 450  IEYERIELLGRGGSSKVYKVKNTNNNRVYALKRVVFDEFDDTSVDAFKGXXXXXXXXXXX 509
            + +++   +G G   KVY   N  N  + A+K +  +  D  ++                
Sbjct: 1031 MRWQKRSFIGGGAFGKVYSAINLENGEILAVKEI--NIHDTNTMKKVFPLIKEEMTVLEM 1088

Query: 510  XXXXXXIQY---QMDNGVLYLVME-CGDHDLSQILNQRANMPLDVDFIRYYSREMLKCVK 565
                  +QY   ++    + + ME C    L+  L     +  D    + Y+ E+L+ + 
Sbjct: 1089 LNHPNIVQYYGVEVHRDKVNIFMEYCEGGSLASCLLDHGRIE-DEMVTQVYTLELLEGLA 1147

Query: 566  VVHDAGIVHSDLKPANFVL-VKGILKIIDFGIANAVPDHTVNIYR--------------D 610
             +H +G+VH D+KP N +L   GI+K +DFG A  V + +    +              +
Sbjct: 1148 YLHRSGVVHRDIKPENILLDFNGIIKYVDFGTARTVVESSTRALQNETSQEIEAEPNPIN 1207

Query: 611  TQIGTPNYMAPEALVALNEVSNVEKKNRWRVGKPSDIWSCGCIMYQMFYGRPPYGAFQNQ 670
              +GTP YMAPEA+      S ++ K    +G   DIW+ GC++ +M  GR P+    N+
Sbjct: 1208 GMMGTPMYMAPEAISG----SAIKGK----LGA-DDIWALGCVVLEMATGRRPWSNLDNE 1258

Query: 671  NRLLAIMNPEVKIVFSEKTSKNERVPKSALDTMKACLIRSPEKRWTADEILDASFLNPVL 730
                AIM         +  SK+E  P +    ++ CL++ P +R TA E+         L
Sbjct: 1259 ---WAIMYHVAAGYIPQLPSKDEITP-AGRAFLERCLVQDPTRRATAVEL---------L 1305

Query: 731  VTPYIVRDLIRNAVYYGSDQGQV 753
              P++++  IR   +  S + Q+
Sbjct: 1306 TDPWMIQ--IREVAFGDSGKDQI 1326

>KLLA0F20053g Chr6 (1867209..1868543) [1335 bp, 444 aa] {ON} highly
           similar to uniprot|P32485 Saccharomyces cerevisiae
           YLR113W HOG1 Mitogen-activated protein kinase involved
           in osmoregulation
          Length = 444

 Score = 89.4 bits (220), Expect = 6e-18,   Method: Compositional matrix adjust.
 Identities = 70/228 (30%), Positives = 113/228 (49%), Gaps = 43/228 (18%)

Query: 525 LYLVMECGDHDLSQILNQRANMPLDVDFIRYYSREMLKCVKVVHDAGIVHSDLKPANFVL 584
           +Y V E    DL ++L  R   PL+  F++Y+  ++L+ +K VH AG++H DLKP+N ++
Sbjct: 95  IYFVTELQGTDLHRLLQTR---PLEKQFVQYFLYQILRGLKYVHSAGVIHRDLKPSNILI 151

Query: 585 VKGI-LKIIDFGIANAVPDHTVNIYRDTQIGTPNYMAPEALVALNEVSNVEKKNRWRVGK 643
            +   LKI DFG+A  + D  +  Y    + T  Y APE ++   +  NVE         
Sbjct: 152 NENCDLKICDFGLAR-IQDPQMTGY----VSTRYYRAPEIMLTWQKY-NVE--------- 196

Query: 644 PSDIWSCGCIMYQMFYGRPPYGAFQNQNRLLAIMN-----PE--VKIVFSEKTSK----- 691
             DIWS GCI  +M  G+P +    + ++   I +     P+  +  + SE T K     
Sbjct: 197 -VDIWSAGCIFAEMIEGKPLFPGKDHVHQFSIITDLLGSPPKDVIDTICSENTLKFVTSL 255

Query: 692 --NERVPKS---------ALDTMKACLIRSPEKRWTADEILDASFLNP 728
              + VP S         A+D ++  L+  P+KR TA + L   +L+P
Sbjct: 256 PHRDPVPFSSRFQNLEPDAIDLLEKMLVFDPKKRITAADALAHPYLSP 303

>ZYRO0A12826g Chr1 (1014651..1015751) [1101 bp, 366 aa] {ON} highly
           similar to uniprot|P14681 Saccharomyces cerevisiae
           YGR040W KSS1 Mitogen-activated protein kinase (MAPK)
           involved in signal transduction pathways that control
           filamentous growth and pheromone response
          Length = 366

 Score = 88.2 bits (217), Expect = 6e-18,   Method: Compositional matrix adjust.
 Identities = 49/161 (30%), Positives = 86/161 (53%), Gaps = 21/161 (13%)

Query: 525 LYLVMECGDHDLSQILNQRANMPLDVDFIRYYSREMLKCVKVVHDAGIVHSDLKPANFVL 584
           +YLV E  + DL +I++  +  PL  D I+Y++ ++L+ +K +H A ++H DLKP+N +L
Sbjct: 90  VYLVQELMETDLQRIISNISTNPLSDDHIQYFTYQILRALKSIHSAQVIHRDLKPSNLLL 149

Query: 585 VKGI-LKIIDFGIANAVPDHTVNIYRDTQIG-------TPNYMAPEALVALNEVSNVEKK 636
                LK+ DFG++  +   + +  R+T +G       T  Y APE ++   E +     
Sbjct: 150 NSNCDLKVCDFGLSRCLASSSDS--RETLVGFMTEYVATRWYRAPEIMLTFQEYTTA--- 204

Query: 637 NRWRVGKPSDIWSCGCIMYQMFYGRPPYGAFQNQNRLLAIM 677
                    DIWSCGCI+ ++  G+P +      ++L  I+
Sbjct: 205 --------MDIWSCGCILAELVSGKPLFPGRDYHHQLWLIL 237

>Kwal_23.6325 s23 complement(1533223..1537851) [4629 bp, 1542 aa] {ON}
            YNR031C (SSK2) - A MAP kinase kinase kinase; activator of
            Pbs2p [contig 17] FULL
          Length = 1542

 Score = 90.9 bits (224), Expect = 6e-18,   Method: Compositional matrix adjust.
 Identities = 80/308 (25%), Positives = 137/308 (44%), Gaps = 37/308 (12%)

Query: 439  KSSKSIVSVNDIEYERIELLGRGGSSKVYKVKNTNNNRVYALKRVVFDEFDDTSVDAFKG 498
            +S  S +S   I +++ + +G G    V+   N +   + A+K +     D  S+     
Sbjct: 1236 QSLASSLSNVSIRWQKRQFVGGGAFGTVFSAVNLDTGEILAVKEIKIQ--DRKSMKQVFP 1293

Query: 499  XXXXXXXXXXXXXXXXXIQY---QMDNGVLYLVME-CGDHDLSQILNQRANMPLDVDFIR 554
                             +QY   ++    + L ME C    L+Q+L        D    +
Sbjct: 1294 AIKEEMSVLEMLNHPNVVQYYGVEVHRDKVNLFMEYCEGGSLAQLLEH--GRIEDEMVTQ 1351

Query: 555  YYSREMLKCVKVVHDAGIVHSDLKPANFVL-VKGILKIIDFGIANAV-------PDHTVN 606
             Y+ +ML+ +  +H + +VH D+KP N +L   G++K +DFG A ++       P+    
Sbjct: 1352 IYALQMLEGLAYLHQSSVVHRDIKPENILLDFNGVIKYVDFGAARSLAANGTKAPNVGAE 1411

Query: 607  IYRD---TQIGTPNYMAPEALVALNEVSNVEKKNRWRVGKPSDIWSCGCIMYQMFYGRPP 663
               D   + +GTP YM+PE++          KK ++  G   DIWS GC++ +M  GR P
Sbjct: 1412 GKADGVNSMMGTPMYMSPESITG-------AKKGKFGSG---DIWSLGCVILEMVTGRRP 1461

Query: 664  YGAFQNQNRLLAIMNPEVKIVFSEKTSKNERVPKSALDTMKACLIRSPEKRWTADEILDA 723
            +    N+    AIM         +  +K E  P+  +D +  CL + P KR TA E+L  
Sbjct: 1462 WFNLDNE---WAIMYHVAAGHVPQLPTKEELSPQ-GIDFLLRCLKQDPNKRSTAMELL-- 1515

Query: 724  SFLNPVLV 731
              L+P ++
Sbjct: 1516 --LHPWMI 1521

>CAGL0K02673g Chr11 complement(241338..244085) [2748 bp, 915 aa]
           {ON} similar to uniprot|Q03497 Saccharomyces cerevisiae
           YHL007c STE20 Serine/threonine-protein kinase
          Length = 915

 Score = 90.5 bits (223), Expect = 7e-18,   Method: Compositional matrix adjust.
 Identities = 65/216 (30%), Positives = 105/216 (48%), Gaps = 30/216 (13%)

Query: 516 IQYQMDNGVLYLVMECGDHDLSQILNQRANMPLDVDFIRYYSREMLKCVKVVHDAGIVHS 575
           I   +  G L++VME  +     + +   +  L    I    RE LK ++ +H  G++H 
Sbjct: 681 IDSYLAKGDLWIVMEYMEG--GSLTDVVTHCLLSEGQIGAVCRETLKGLQFLHSKGVLHR 738

Query: 576 DLKPANFVL-VKGILKIIDFGIANAVPDHTVNIYRDTQIGTPNYMAPEALVALNEVSNVE 634
           D+K  N +L +KG +K+ DFG    + ++  N+ R T +GTP +MAPE +          
Sbjct: 739 DIKSDNILLSLKGNIKLTDFGFCAQINEN--NLKRTTMVGTPYWMAPEVV---------- 786

Query: 635 KKNRWRVGKPSDIWSCGCIMYQMFYGRPPYGAFQNQNRLLAIMNPEVKIVFSEKTSKNER 694
             +R   G   DIWS G ++ +M  G PPY    N+  L A+      ++ +  T K  +
Sbjct: 787 --SRKEYGPKVDIWSLGIMIIEMIEGEPPY---LNETPLRALY-----LIATNGTPK-LK 835

Query: 695 VPKSALDTMKA----CLIRSPEKRWTADEILDASFL 726
            P++  DT+      CL   P +R TA E+LD  F+
Sbjct: 836 EPEALSDTLTKFLDWCLKVDPSERATATELLDDPFI 871

>NDAI0A00660 Chr1 (121773..124841) [3069 bp, 1022 aa] {ON} Anc_1.52
          Length = 1022

 Score = 90.5 bits (223), Expect = 7e-18,   Method: Compositional matrix adjust.
 Identities = 68/230 (29%), Positives = 112/230 (48%), Gaps = 28/230 (12%)

Query: 522 NGVLYLVMECGDH-DLSQILNQRANMPLDVDFIRYYSREMLKCVKVVHDAGIVHSDLKPA 580
           N  LY+++E  +  +L  +L +R  +P + + IR++ R+++  +   H  GIVH DLKP 
Sbjct: 102 NSKLYMILEYAEKGELFNLLVERGPLP-EKEAIRFF-RQIIIGISYCHALGIVHRDLKPE 159

Query: 581 NFVLVKGI-LKIIDFGIANAVPDHTVNIYRDTQIGTPNYMAPEALVALNEVSNVEKKNRW 639
           N +L   + +KI DFG+A      T +   +T  G+P+Y APE       VS V      
Sbjct: 160 NLLLDHKLNIKIADFGMAAL---ETKDKMLETSCGSPHYAAPEI------VSGVPYH--- 207

Query: 640 RVGKPSDIWSCGCIMYQMFYGRPPYGAFQN--QNRLLAIMNPEVKIVFSEKTSKNERVPK 697
             G  SD+WSCG I++ +  GR P+       +N LL + + E ++        ++ + K
Sbjct: 208 --GFQSDVWSCGVILFALLTGRLPFDEEDGNIRNLLLKVQSGEYEM------PDDDEISK 259

Query: 698 SALDTMKACLIRSPEKRWTADEILDASFLN--PVLVTPYIVRDLIRNAVY 745
            A D +   L   PE+R    +IL    L   P +     +++L R   Y
Sbjct: 260 EAQDLIGRILTVDPEQRIKTRDILKHPLLQKYPSIKDSRSIKNLPREDTY 309

>ACL104C Chr3 complement(157357..160200) [2844 bp, 947 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YHR102W
           (KIC1)
          Length = 947

 Score = 90.5 bits (223), Expect = 7e-18,   Method: Compositional matrix adjust.
 Identities = 73/279 (26%), Positives = 124/279 (44%), Gaps = 29/279 (10%)

Query: 452 YERIELLGRGGSSKVYKVKNTNNNRVYALKRVVFDEFDDTSVDAFKGXXXXXXXXXXXXX 511
           ++R E++GRG    VYK  +    +VYA+K +  D  +D   D  K              
Sbjct: 25  FKRTEVIGRGKFGVVYKAYHAKTKQVYAVKVLNLDCPEDEVEDVQKEIQFLASLKQVPNI 84

Query: 512 XXXXIQYQMDNGVLYLVME-CGDHDLSQILNQRANMPLDVDFIRYYSREMLKCVKVVHDA 570
                 Y  D   L+++ME C    L  +L       +D  ++    R++L  +  +H  
Sbjct: 85  TRYYGSYLYDTK-LWVIMEYCAGGSLRTLLRPGK---IDEKYLGVIVRKLLIALVYIHKD 140

Query: 571 GIVHSDLKPANFVLV-KGILKIIDFGIANAVPDHTVNIYRDTQIGTPNYMAPEALVALNE 629
            ++H D+K AN ++  +G +K+ DFG+A  +     N  R T  GTP +MAPE +     
Sbjct: 141 NVIHRDIKAANVLITNEGHVKLCDFGVAAQL--TAANHKRQTMAGTPYWMAPEVI----- 193

Query: 630 VSNVEKKNRWRVGKPSDIWSCGCIMYQMFYGRPPYGAFQNQNRLLAIMNPEVKIVFSEKT 689
           +  V    +      +DIWS G   Y++  G PPY   +    +        +++   K 
Sbjct: 194 MEGVYYNTK------ADIWSLGITAYEIATGNPPYCDVEALRAM--------QLITKSKP 239

Query: 690 SKNERVPKSAL--DTMKACLIRSPEKRWTADEILDASFL 726
            + E    S L  + +  CL   PE+R TA+++L + F+
Sbjct: 240 PRLEGRNYSPLLKEFIALCLDEDPEERPTAEDLLSSKFV 278

>Skud_4.783 Chr4 complement(1382552..1385959) [3408 bp, 1135 aa]
           {ON} YDR507C (REAL)
          Length = 1135

 Score = 90.5 bits (223), Expect = 7e-18,   Method: Compositional matrix adjust.
 Identities = 70/227 (30%), Positives = 109/227 (48%), Gaps = 28/227 (12%)

Query: 525 LYLVMECGDH-DLSQILNQRANMPLDVDFIRYYSREMLKCVKVVHDAGIVHSDLKPANFV 583
           LYLV+E  +  +L  +L +R  +P + + IR++ R+++  V   H  GIVH DLKP N +
Sbjct: 106 LYLVLEYAEKGELFNLLVERGPLP-ENEAIRFF-RQIIIGVSYCHALGIVHRDLKPENLL 163

Query: 584 L-VKGILKIIDFGIANAVPDHTVNIYRDTQIGTPNYMAPEALVALNEVSNVEKKNRWRVG 642
           L  K  +KI DFG+A      T     +T  G+P+Y APE       VS +  +     G
Sbjct: 164 LDHKYNIKIADFGMAAL---ETEGKLLETSCGSPHYAAPEI------VSGIPYQ-----G 209

Query: 643 KPSDIWSCGCIMYQMFYGRPPYGAFQNQNR--LLAIMNPEVKIVFSEKTSKNERVPKSAL 700
             SD+WSCG I++ +  GR P+       R  LL +   + ++        ++ V + A 
Sbjct: 210 FASDVWSCGVILFALLTGRLPFDEEDGNIRTLLLKVQKGQFEL------PSDDEVSREAQ 263

Query: 701 DTMKACLIRSPEKRWTADEILDASFLN--PVLVTPYIVRDLIRNAVY 745
           D +   L   P++R  A +IL    L   P +     +R L R   Y
Sbjct: 264 DLICKILTVDPKRRIKARDILKHPLLQKYPSIRDSKSIRGLPREDTY 310

>KAFR0D03390 Chr4 (667896..670292) [2397 bp, 798 aa] {ON} Anc_2.496
           YHL007C
          Length = 798

 Score = 90.1 bits (222), Expect = 8e-18,   Method: Compositional matrix adjust.
 Identities = 75/307 (24%), Positives = 132/307 (42%), Gaps = 29/307 (9%)

Query: 451 EYERIELLGRGGSSKVYKVKNTNNNRVYALKRVVFDEFDDTSVDAFKGXXXXXXXXXXXX 510
           +Y  +  +G+G S  VY      +N + A+K++   + +                     
Sbjct: 516 QYANLTKIGQGASGGVYTANQVKSNELVAIKQM---DLEKQPKKELILNEIIVMKESRHN 572

Query: 511 XXXXXIQYQMDNGVLYLVMECGDHDLSQILNQRANMPLDVDFIRYYSREMLKCVKVVHDA 570
                I   +  G L++VME  +     + +   +  L    I    RE L+ +K +H  
Sbjct: 573 NVVNFINAHLSKGNLWIVMEYMEG--GSLTDVVTHCLLSEGQIGAVCRETLEGLKFLHSK 630

Query: 571 GIVHSDLKPANFVL-VKGILKIIDFGIANAVPDHTVNIYRDTQIGTPNYMAPEALVALNE 629
           G++H D+K  N +L +KG +K+ DFG    + D  +++ R T +GTP +MAPE +     
Sbjct: 631 GVIHRDIKSDNVLLSMKGDIKLTDFGFCAQIND--IDLNRTTMVGTPYWMAPEVV----- 683

Query: 630 VSNVEKKNRWRVGKPSDIWSCGCIMYQMFYGRPPYGAFQNQNRLLAIMNPEVKIVFSEKT 689
                  +R   G   DIWS G ++ +M  G PPY    N+  L A+    +    + K 
Sbjct: 684 -------SRKEYGPKVDIWSLGIMIIEMIEGEPPY---LNEAPLKALY--LIATNGTPKL 731

Query: 690 SKNERVPKSALDTMKACLIRSPEKRWTADEILDASFL----NPVLVTPYIVRDLIRNAVY 745
            + E +     + +  CL   PE+R +A E+L   F+     P +    +VR  + N + 
Sbjct: 732 KEPENLSDVFSNFLDRCLRVEPEERASAIELLADEFVVACAEPTISLAPLVRLSLANKLS 791

Query: 746 YGSDQGQ 752
            G  + +
Sbjct: 792 EGGSESR 798

>Kpol_463.8 s463 complement(18696..23039) [4344 bp, 1447 aa] {ON}
            complement(18696..23039) [4344 nt, 1448 aa]
          Length = 1447

 Score = 90.5 bits (223), Expect = 8e-18,   Method: Compositional matrix adjust.
 Identities = 80/299 (26%), Positives = 135/299 (45%), Gaps = 33/299 (11%)

Query: 439  KSSKSIVSVNDIEYERIELLGRGGSSKVYKVKNTNNNRVYALKRVVFDEF---DDT---S 492
            KS  S    N+  + + E++G+G    V+   N     + A+K+V   ++   ++T   +
Sbjct: 1127 KSKNSKGEYNEFAWMKGEMIGKGSFGAVFLAMNITTGEMMAVKQVEVPKYGLQNETVVNT 1186

Query: 493  VDAFKGXXXXXXXXXXXXXXXXXIQYQMDNGVLYLVME--CGDHDLSQILNQRANMPLDV 550
            VDA +                  + ++  NG+  L +E   G    S I   R     D 
Sbjct: 1187 VDALR-LEVSTLKDLDHLNIVQYLGFEAKNGIYSLFLEYVAGGSVGSLI---RMYGRFDD 1242

Query: 551  DFIRYYSREMLKCVKVVHDAGIVHSDLKPANFVLVK-GILKIIDFGIANAVPDHTVNIYR 609
              IR+ + ++L+ +  +H  GI+H D+K  N +L + G+ KI DFGI+    D    IY 
Sbjct: 1243 ILIRHLTIQVLQGLSYLHSRGILHRDMKADNLLLDQDGVCKISDFGISRKSND----IYS 1298

Query: 610  DTQI---GTPNYMAPEALVALNEVSNVEKKNRWRVGKPSDIWSCGCIMYQMFYGRPPYGA 666
            ++++   GT  +MAPE          V+ K  +      DIWS GCI+ +MF G+ P+  
Sbjct: 1299 NSEMTMKGTVFWMAPEM---------VDTKQGYSAK--VDIWSLGCIVLEMFAGKRPWSN 1347

Query: 667  FQNQNRLLAIMNPEVKIVFSEKTSKNERVPKSALDTMKACLIRSPEKRWTADEILDASF 725
            F+    +  I   +      E T     + ++A + +  C    PEKR TAD++L   F
Sbjct: 1348 FEVVAAMFKIGQAKSAPPIPEDTL--PLISENAKEFLDCCFEIDPEKRPTADKLLSHPF 1404

>KAFR0D04100 Chr4 complement(809681..813034) [3354 bp, 1117 aa] {ON}
           Anc_1.52 YDR507C
          Length = 1117

 Score = 90.5 bits (223), Expect = 9e-18,   Method: Compositional matrix adjust.
 Identities = 71/231 (30%), Positives = 112/231 (48%), Gaps = 30/231 (12%)

Query: 522 NGVLYLVMECGDH-DLSQILNQRANMPL-DVDFIRYYSREMLKCVKVVHDAGIVHSDLKP 579
           N  LY+V+E  +  +L  +L ++   PL + + IR++ R+++  +   H  GIVH DLKP
Sbjct: 99  NSNLYMVLEYAEKGELFNLLVEKG--PLQEQEAIRFF-RQIIIGISYCHALGIVHRDLKP 155

Query: 580 ANFVL-VKGILKIIDFGIANAVPDHTVNIYRDTQIGTPNYMAPEALVALNEVSNVEKKNR 638
            N +L  K  +KI DFG+A      T +   +T  G+P+Y APE       VS +     
Sbjct: 156 ENLLLDHKYNIKIADFGMAAL---ETEDKLLETSCGSPHYAAPEI------VSGIPYH-- 204

Query: 639 WRVGKPSDIWSCGCIMYQMFYGRPPYGAFQN--QNRLLAIMNPEVKIVFSEKTSKNERVP 696
              G  SD+WSCG I++ +  GR P+       +N LL + + E ++        ++ + 
Sbjct: 205 ---GFASDVWSCGVILFALLTGRLPFDEEDGNIRNLLLKVQSGEFEM------PSDDEIS 255

Query: 697 KSALDTMKACLIRSPEKRWTADEILDASFLN--PVLVTPYIVRDLIRNAVY 745
             A D +   L   PEKR  A +IL    L   P +     +R+L R   Y
Sbjct: 256 HEAQDLLAKILTVDPEKRIRARDILKHPLLQKYPSIKDSKSIRNLPREDTY 306

>Kwal_56.22693 s56 complement(239982..242936) [2955 bp, 984 aa] {ON}
           YDR490C (PKH1) - Ser/Thr protein kinase [contig 184]
           FULL
          Length = 984

 Score = 90.1 bits (222), Expect = 9e-18,   Method: Compositional matrix adjust.
 Identities = 88/336 (26%), Positives = 144/336 (42%), Gaps = 43/336 (12%)

Query: 406 TVEKPHTFQDNKEGQKIVKKVEIVEPPTSMTNRKSSKSIVSVNDIEYERIELLGRGGSSK 465
            + K H    N+   KIVK  E++ P T +  R   K    + D  +   E+LG G  S 
Sbjct: 118 AMRKRHDEWANRGAAKIVK--EVLNPETGVMARHVIKK--GIKDFRFG--EVLGDGSYST 171

Query: 466 VYKVKNTNNNRVYALKRV----VFDEFDDTSVDAFKGXXXXXXXXXXXXXXXXXIQYQMD 521
           V   ++ ++ + YA+K +    +  +     V+  K                   Q   D
Sbjct: 172 VMLARSNDSGKKYAVKVLNKEYLIRQKKVKYVNIEKNTLQRLNDGRGVIKLYFTFQ---D 228

Query: 522 NGVLYLVME-CGDHDLSQILNQRANMPLDVDFIRYYSREMLKCVKVVHDAGIVHSDLKPA 580
              LY ++E   + D   ++ +  +  L  +   YYS ++L  +  +H  GIVH D+KP 
Sbjct: 229 EASLYFLLEYAPNGDFLSVIKKFGS--LSQECAVYYSAQILDAIDYLHHKGIVHRDIKPE 286

Query: 581 NFVLVKGI-LKIIDFGIANAVPD----HTVNIYRDTQ--IGTPNYMAPEALVALNEVSNV 633
           N +L K + +K+ DFG A  +       T N+   ++  +GT  Y++PE L         
Sbjct: 287 NILLDKDMKVKLTDFGTARILEKDETTQTFNLLERSKSFVGTAEYVSPELL--------- 337

Query: 634 EKKNRWRVGKPSDIWSCGCIMYQMFYGRPPYGAFQNQNRLLAIMNPEVKIVFSEKTSKNE 693
              N   V    DIW+ GCI++QM  G+PP+ A         +M  +V+  F+       
Sbjct: 338 ---NDNYVDYKCDIWAFGCILFQMIAGKPPFKATNEYLTFQKVM--KVQYAFTAG----- 387

Query: 694 RVPKSALDTMKACLIRSPEKRWTADEILDASFLNPV 729
             P    D +K  L++SPE+R  A +I    F   V
Sbjct: 388 -FPLVIRDLIKKILVKSPEQRLDASQIKKHHFFKDV 422

>KAFR0E01040 Chr5 complement(214744..216252) [1509 bp, 502 aa] {ON}
           Anc_3.229 YBR028C
          Length = 502

 Score = 89.0 bits (219), Expect = 9e-18,   Method: Compositional matrix adjust.
 Identities = 85/302 (28%), Positives = 135/302 (44%), Gaps = 57/302 (18%)

Query: 451 EYERIELLGRGGSSKVYKVKNTNNNRVYALKR------------VVFDEFDDTSVDAF-- 496
           +++ I +LG+G  SKV  VK+ ++N++YA+K+            V  D  D T++     
Sbjct: 113 DFKPIRVLGKGAYSKVVLVKDHHSNKLYAMKQLKKAEILINEKEVREDSEDPTTLQKRIE 172

Query: 497 KGXXXXXXXXXXXXXXXXXIQYQM-DNGVLYLVME-CGDHDLSQILNQRANMPLDVDFIR 554
           +                  + Y   D+  LYL+++     +L   L +R    LD D + 
Sbjct: 173 RTFAERIILSKLEHPNVVKLFYSFHDHSKLYLILQYIPGGELFFHLKERGT--LDEDTVA 230

Query: 555 YYSREMLKCVKVVHDAGIVHSDLKPANFVLV-KGILKIIDFGIANAVPDHTV-------- 605
           +Y+ E+   +K +HD GIV+ DLKP N +L  +G L + DFG++    D+          
Sbjct: 231 FYAAEISVALKFLHDNGIVYRDLKPENCLLSQRGHLVLTDFGLSKEAVDNVSDNESTELN 290

Query: 606 ---NIYR-DTQIGTPNYMAPEALVALNEVSNVEKKNRWRVGKPSDIWSCGCIMYQMFYGR 661
              +IY   + IGTP Y APE L  L               K  D +S GC+++ M  G+
Sbjct: 291 SPEDIYTLHSIIGTPEYAAPEILQGLP------------YNKNCDWYSLGCLLFDMLVGK 338

Query: 662 PPYGAFQNQNRLLAIMNPEVKIVFSEKTSKNERVPKSALDTMK----ACLIRSPEKRWTA 717
           PPY    ++     I+N   KI   +K  +  R+P    D MK      L +   KRW  
Sbjct: 339 PPYTGTNHK----VILN---KI---QKDKQGPRIPFYLSDGMKDMLNWLLKKDKTKRWDV 388

Query: 718 DE 719
           D+
Sbjct: 389 DK 390

>Ecym_2531 Chr2 (1034031..1034047,1034135..1035023) [906 bp, 301 aa]
           {ON} similar to Ashbya gossypii AGL242C 1-intron
          Length = 301

 Score = 86.7 bits (213), Expect = 9e-18,   Method: Compositional matrix adjust.
 Identities = 69/256 (26%), Positives = 118/256 (46%), Gaps = 32/256 (12%)

Query: 451 EYERIELLGRGGSSKVYKVKNTNNNRVYALKRVVFDEFDDTSVDAFKGXXXXXXXXXXXX 510
           +++++E LG G  + VYK  N       ALK V  D  + T   A +             
Sbjct: 6   QFKQLEKLGNGTYATVYKGLNKTTGLYVALKEVKLDSEEGTPSTAIREISLMKELKHENI 65

Query: 511 XXXXXIQYQMDNGVLYLVMECGDHDLSQILNQRAN--MP--LDVDFIRYYSREMLKCVKV 566
                + +  +   L LV E  D+DL + ++ R +  MP  L++  ++Y+  ++L+ V  
Sbjct: 66  VRLYDVIHTENK--LTLVFEFMDNDLKKFMDSRVDREMPRGLELSLVKYFQWQLLQGVAF 123

Query: 567 VHDAGIVHSDLKPANFVL-VKGILKIIDFGIANA--VPDHTVNIYRDTQIGTPNYMAPEA 623
            H+  I+H DLKP N ++  KG LK+ DFG+A A  +P +T +    +++ T  Y AP+ 
Sbjct: 124 CHENRILHRDLKPQNLLINNKGQLKLGDFGLARAFGIPVNTFS----SEVVTLWYRAPDV 179

Query: 624 LVALNEVSNVEKKNRWRVGKPSDIWSCGCIMYQMFYGRPPYGAFQNQNRLLAIMNPEVKI 683
           L+                    DIWSCGCI+ +M  G+     F   N      + ++K+
Sbjct: 180 LMGSRSYCT-----------SIDIWSCGCILAEMIMGK---ALFPGTND-----DEQLKL 220

Query: 684 VFSEKTSKNERVPKSA 699
           +F    +  E++   A
Sbjct: 221 IFETLGTPTEQMWPGA 236

>Kpol_543.55 s543 (126256..127533) [1278 bp, 425 aa] {ON}
           (126256..127533) [1278 nt, 426 aa]
          Length = 425

 Score = 88.2 bits (217), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 69/228 (30%), Positives = 113/228 (49%), Gaps = 43/228 (18%)

Query: 525 LYLVMECGDHDLSQILNQRANMPLDVDFIRYYSREMLKCVKVVHDAGIVHSDLKPANFVL 584
           +Y V E    DL ++L  R   PL+  F++Y+  ++L+ +K VH AG++H DLKP+N ++
Sbjct: 96  IYFVTELQGTDLHRLLQTR---PLEKQFVQYFLYQILRGLKYVHSAGVIHRDLKPSNILI 152

Query: 585 VKGI-LKIIDFGIANAVPDHTVNIYRDTQIGTPNYMAPEALVALNEVSNVEKKNRWRVGK 643
            +   LKI DFG+A  + D  +  Y    + T  Y APE ++   +  +VE         
Sbjct: 153 NENCDLKICDFGLAR-IQDPQMTGY----VSTRYYRAPEIMLTWQKY-DVE--------- 197

Query: 644 PSDIWSCGCIMYQMFYGRPPYGAFQNQNRLLAIMN-----PE--VKIVFSEKTSK----- 691
             DIWS GCI  +M  G+P +    + ++   I +     P   +  + SE T K     
Sbjct: 198 -VDIWSAGCIFAEMIEGKPLFPGKDHVHQFSIITDLLGSPPSDVINTICSENTLKFVTSL 256

Query: 692 --------NER---VPKSALDTMKACLIRSPEKRWTADEILDASFLNP 728
                   +ER   V   A+D ++  L+  P+KR TA ++L   +L+P
Sbjct: 257 PHRDPVPFSERFKAVEPEAVDLLEKMLVFDPKKRITAADVLVHPYLSP 304

>TDEL0C06490 Chr3 complement(1191461..1194922) [3462 bp, 1153 aa]
           {ON} Anc_1.52 YDR507C
          Length = 1153

 Score = 90.1 bits (222), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 75/254 (29%), Positives = 122/254 (48%), Gaps = 32/254 (12%)

Query: 522 NGVLYLVMECGDH-DLSQILNQRANMPLDVDFIRYYSREMLKCVKVVHDAGIVHSDLKPA 580
           N  LY+V+E     +L  +L +R  +P + + IR++ R+++  +   H  GIVH DLKP 
Sbjct: 104 NSNLYMVLEYAQKGELFNLLVERGPLP-EKEAIRFF-RQIVIGISYCHALGIVHRDLKPE 161

Query: 581 NFVL-VKGILKIIDFGIANAVPDHTVNIYRDTQIGTPNYMAPEALVALNEVSNVEKKNRW 639
           N +L  K  +KI DFG+A      T +   +T  G+P+Y APE       VS +      
Sbjct: 162 NLLLDHKFNIKIADFGMAAL---ETEDKLLETSCGSPHYAAPEI------VSGIPYH--- 209

Query: 640 RVGKPSDIWSCGCIMYQMFYGRPPYGAFQN--QNRLLAIMNPEVKIVFSEKTSKNERVPK 697
             G  SD+WSCG I++ +  GR P+       +N LL + +   ++   ++ S +     
Sbjct: 210 --GFASDVWSCGVILFALLTGRLPFDDEDGNIRNLLLQVQSGRYEMPGDDEISPD----- 262

Query: 698 SALDTMKACLIRSPEKRWTADEILDASFLN--PVLVTPYIVRDLIRNAVYYGSDQGQVSE 755
            A D +   L   PE+R  A +IL    L   P +     +R+L R   Y       +SE
Sbjct: 263 -AQDLIARILTVDPEQRIKARDILKHPLLQKYPSINDSKSIRNLPREDTYLHP----LSE 317

Query: 756 DKITELADDVLNRL 769
            +  E+ +++L  L
Sbjct: 318 GESAEIDENILQNL 331

>TPHA0E03850 Chr5 complement(810694..812142) [1449 bp, 482 aa] {ON}
           Anc_1.24 YDR523C
          Length = 482

 Score = 88.6 bits (218), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 71/278 (25%), Positives = 124/278 (44%), Gaps = 30/278 (10%)

Query: 456 ELLGRGGSSKVYKVKNTNNNRVYALKRVVFDEFDDTSVDAFKGXXXXXXXXXXXXXXXXX 515
           + +GRG    VYK  + N ++V A+K +V  E  D  ++                     
Sbjct: 19  DCVGRGNFGDVYKAIDKNESKVVAIK-IVNLENTDEDIELLT-QEIFFLSELKSPFITNY 76

Query: 516 IQYQMDNGVLYLVME-CGDHDLSQILNQRANMPLDVDFIRYYSREMLKCVKVVHDAGIVH 574
           I    ++  +++VME CG    + ++    +  +    + Y  R+ +K +K +HD   +H
Sbjct: 77  ITTLTEDVTMWIVMEYCGGGSCADLIKMVYSKGIPESKVSYILRDTVKGLKYLHDQKKIH 136

Query: 575 SDLKPANFVLVK-GILKIIDFGIANAVPDHTVNIYRDTQIGTPNYMAPEALVALNEVSNV 633
            D+K AN +L   G +K+ DFG++  +      + R T +GTP +MAPE +         
Sbjct: 137 RDIKAANILLTDCGKVKLGDFGVSGQI---RATMKRGTFVGTPYWMAPEVI--------- 184

Query: 634 EKKNRWRVGKPSDIWSCGCIMYQMFYGRPPYGAFQNQNRLLAIMN---PEVKIVFSEKTS 690
             K      + +DIWS G   Y++  G PP   +     +L I     P++   +SEK  
Sbjct: 185 -NKQCKGYNEKADIWSLGITAYELLKGVPPLSKYDPFKVMLNIPKRKPPKLHGQYSEK-- 241

Query: 691 KNERVPKSALDTMKACLIRSPEKRWTADEILDASFLNP 728
                   A   +  CLI+ P++R + + +L+  FL P
Sbjct: 242 --------AKYFVSLCLIKDPKQRPSIEALLETDFLLP 271

>CAGL0M11748g Chr13 (1168856..1170199) [1344 bp, 447 aa] {ON} highly
           similar to uniprot|P32485 Saccharomyces cerevisiae
           YLR113w HOG1
          Length = 447

 Score = 88.2 bits (217), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 70/228 (30%), Positives = 111/228 (48%), Gaps = 43/228 (18%)

Query: 525 LYLVMECGDHDLSQILNQRANMPLDVDFIRYYSREMLKCVKVVHDAGIVHSDLKPANFVL 584
           +Y V E    DL ++L  R   PL+  F++Y+  ++L+ +K VH AG+VH DLKP+N ++
Sbjct: 96  IYFVTELQGTDLHRLLQTR---PLEKQFVQYFHYQILRGLKYVHSAGVVHRDLKPSNILI 152

Query: 585 VKGI-LKIIDFGIANAVPDHTVNIYRDTQIGTPNYMAPEALVALNEVSNVEKKNRWRVGK 643
            +   LKI DFG+A  + D  +  Y    + T  Y APE ++   +  +VE         
Sbjct: 153 NENCDLKICDFGLAR-IQDPQMTGY----VSTRYYRAPEIMLTWQKY-DVE--------- 197

Query: 644 PSDIWSCGCIMYQMFYGRPPYGAFQNQNRLLAIMN-----PE--VKIVFSEKTSK----- 691
             DIWS GCI  +M  G+P +    + ++   I +     P   +  + SE T K     
Sbjct: 198 -VDIWSAGCIFAEMIEGKPLFPGKDHVHQFSIITDLLGSPPSDVIDTICSENTLKFVTSL 256

Query: 692 --------NER---VPKSALDTMKACLIRSPEKRWTADEILDASFLNP 728
                   +ER   V   A+D ++  L+  P+KR TA + L   +L P
Sbjct: 257 PHRDPIPFSERFKTVEPDAVDLLEKMLVFDPKKRITAADALAHPYLAP 304

>Ecym_6145 Chr6 complement(266766..267863) [1098 bp, 365 aa] {ON}
           similar to Ashbya gossypii ACL191C
          Length = 365

 Score = 87.0 bits (214), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 67/243 (27%), Positives = 113/243 (46%), Gaps = 50/243 (20%)

Query: 518 YQMDNGVLYLVMECGDHDLSQILNQRANMPLDVDFIRYYSREMLKCVKVVHDAGIVHSDL 577
           YQ  + V YLV E  + DL +I++Q  N  L  D I+Y++ ++L+ +K +H A ++H DL
Sbjct: 84  YQEFDAV-YLVQELMETDLQRIISQTNNF-LSDDHIQYFTYQILRALKSLHSAQVIHRDL 141

Query: 578 KPANFVLVKGI-LKIIDFGIANAVPDHTVNIYRDTQIG-------TPNYMAPEALVALNE 629
           KP+N +L     LK+ DFG++  +     +  R+  +G       T  Y APE +++  E
Sbjct: 142 KPSNLLLNSSCDLKLCDFGLSRCLASSDRS--RENMVGFMTEYVATRWYRAPEIMLSFQE 199

Query: 630 VSNVEKKNRWRVGKPSDIWSCGCIMYQMFYGRPPYGAFQNQNRLLAIMN----------- 678
            +              DIWSCGCI+ +M  G+P +      ++L  I+            
Sbjct: 200 YTTA-----------MDIWSCGCILAEMISGKPLFPGRDYHHQLWVILEILGTPSYEDFA 248

Query: 679 ---------------PEVKIVFSEKTSKNERVPKSALDTMKACLIRSPEKRWTADEILDA 723
                            +KI ++     N+  P  A+D +   L  +P+KR +A+E L  
Sbjct: 249 QIKSKRAKAYILNLPMRLKIPWNVALGTNDINP-LAMDLLDKMLTFNPDKRISAEEALKH 307

Query: 724 SFL 726
            +L
Sbjct: 308 PYL 310

>Kwal_56.23841 s56 (732202..733500) [1299 bp, 432 aa] {ON} YLR113W
           (HOG1) - mitogen-activated protein kinase (MAP kinase)
           [contig 171] FULL
          Length = 432

 Score = 87.8 bits (216), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 70/228 (30%), Positives = 110/228 (48%), Gaps = 43/228 (18%)

Query: 525 LYLVMECGDHDLSQILNQRANMPLDVDFIRYYSREMLKCVKVVHDAGIVHSDLKPANFVL 584
           +Y V E    DL ++L  R   PL+  F++Y+  ++L+ +K VH AG++H DLKP+N ++
Sbjct: 96  IYFVTELQGTDLHRLLQTR---PLEKQFVQYFLYQILRGLKYVHSAGVIHRDLKPSNILI 152

Query: 585 VKGI-LKIIDFGIANAVPDHTVNIYRDTQIGTPNYMAPEALVALNEVSNVEKKNRWRVGK 643
            +   LKI DFG+A  + D  +  Y    + T  Y APE ++   +  NVE         
Sbjct: 153 NENCDLKICDFGLAR-IQDPQMTGY----VSTRYYRAPEIMLTWQKY-NVE--------- 197

Query: 644 PSDIWSCGCIMYQMFYGRPPYGAFQNQNRLLAIMN-----PE--VKIVFSEKTSK----- 691
             DIWS GCI  +M  G+P +    + ++   I +     PE  +  + S  T K     
Sbjct: 198 -VDIWSAGCIFAEMIEGKPLFPGKDHVHQFSIITDLLGSPPEDVINTICSVNTLKFVTSL 256

Query: 692 --------NER---VPKSALDTMKACLIRSPEKRWTADEILDASFLNP 728
                   +ER   V   A+D ++  L+  P KR TA + L   +L P
Sbjct: 257 PHRDPVPFSERFKNVEPDAVDLLEKMLVFDPNKRITAADALSHPYLAP 304

>YDR523C Chr4 complement(1485566..1487038) [1473 bp, 490 aa] {ON}
           SPS1Putative protein serine/threonine kinase expressed
           at the end of meiosis and localized to the prospore
           membrane, required for correct localization of enzymes
           involved in spore wall synthesis
          Length = 490

 Score = 88.6 bits (218), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 73/280 (26%), Positives = 126/280 (45%), Gaps = 30/280 (10%)

Query: 458 LGRGGSSKVYKVKNTNNNRVYALKRVVFDEFDDTSVDAFKGXXXXXXXXXXXXXXXXXIQ 517
           +GRG    VYK  +     + A+K VV  E  D  ++                     I 
Sbjct: 24  IGRGNFGDVYKAVDRVTQEIVAIK-VVNLEHSDEDIELL-AQEIFFLAELKSPLITNYIA 81

Query: 518 YQMDNGVLYLVME-CGDHDLSQILNQRANMPLDVDFIRYYSREMLKCVKVVHDAGIVHSD 576
             +++  +++VME CG    S +L +     L  + + +   E+   +K +H+   +H D
Sbjct: 82  TMLEDVSMWIVMEYCGGGSCSDLLKRSYVNGLPEEKVSFIIHEVTLGLKYLHEQRKIHRD 141

Query: 577 LKPANFVL-VKGILKIIDFGIANAVPDHTVNIYRDTQIGTPNYMAPEALVALNEVSNVEK 635
           +K AN +L  +G++K+ DFG++  +      + RDT +GTP +MAPE  V   EV    +
Sbjct: 142 IKAANILLNEEGMVKLGDFGVSGHIRS---TLKRDTFVGTPYWMAPE--VVCCEVDGYNE 196

Query: 636 KNRWRVGKPSDIWSCGCIMYQMFYGRPP---YGAFQNQNRLLAIMNPEVKIVFSEKTSKN 692
           K        +DIWS G   Y++  G PP   Y   +    L     P+++  FS+     
Sbjct: 197 K--------ADIWSLGITTYELLKGLPPLSKYDPMKVMTNLPKRKPPKLQGPFSD----- 243

Query: 693 ERVPKSALDTMKACLIRSPEKRWTADEILDASFLNPVLVT 732
                +A D +  CL+++P  R +A  +L   F+  + +T
Sbjct: 244 -----AAKDFVAGCLVKTPADRPSAYNLLSFEFVKNITIT 278

>Skud_2.141 Chr2 complement(264097..265677) [1581 bp, 526 aa] {ON}
           YBR028C (REAL)
          Length = 526

 Score = 88.6 bits (218), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 85/335 (25%), Positives = 139/335 (41%), Gaps = 78/335 (23%)

Query: 432 PTSMTNRKSSKSIVSVNDIEYERIELLGRGGSSKVYKVKNTNNNRVYALKRVVFDEF--- 488
           P +M +   S++ +S N  +++ + +LG+G   KV  VK+TN +++YA+K++   E    
Sbjct: 109 PQNMNSSNISENGLSRNLCDFKPVRVLGQGAYGKVILVKDTNTSKLYAMKQLQKAEILIS 168

Query: 489 ----------------DDTSVDAFKGXXXXXXXXXXXXXXXXXIQYQ---------MDNG 523
                           DD   D   G                 I++           DN 
Sbjct: 169 PTVADSKKEEEENNSSDDNDTD--NGLSKRLERTFAERSILSEIEHPNIVKLFYSFHDNS 226

Query: 524 VLYLVME-CGDHDLSQILNQRANMPLDVDFIRYYSREMLKCVKVVHDAGIVHSDLKPANF 582
            LYL+++     +L   L +     LD   + +Y+ E+   +K +H  G+V+ DLKP N 
Sbjct: 227 KLYLLLQYIPGGELFYHLKEHGT--LDETTVSFYAAEISCALKFLHSKGVVYRDLKPENC 284

Query: 583 VL-VKGILKIIDFGIANAV----------PDHTVNIYRDTQIGTPNYMAPEALVALNEVS 631
           +L  +G L + DFG++             P++   +Y  + IGTP Y APE L+      
Sbjct: 285 LLNQRGHLVLTDFGLSKKSAHDSMADEEDPENVKALY--SIIGTPEYCAPEILLGKAYTQ 342

Query: 632 NVEKKNRWRVGKPSDIWSCGCIMYQMFYGRPPYGAFQNQNRLLAIMNPEVKIVFSEKTSK 691
           N             D +S GC++Y M  G+PPY      N    I+N         K  +
Sbjct: 343 NC------------DWYSLGCLLYDMLVGKPPYTG----NNHKVIIN---------KIQQ 377

Query: 692 NERVPKSAL-------DTMKACLIRSPEKRWTADE 719
           N++ PK          D + A L +   KRW  D+
Sbjct: 378 NKQGPKIPFYLSEGMKDILNALLKKETSKRWNVDK 412

>KLTH0A06776g Chr1 complement(562932..567503) [4572 bp, 1523 aa] {ON}
            similar to uniprot|P53599 Saccharomyces cerevisiae
            YNR031C SSK2 Suppressor of Sensor Kinase (SLN1) A MAP
            kinase kinase kinase activator of Pbs2p
          Length = 1523

 Score = 89.7 bits (221), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 80/332 (24%), Positives = 145/332 (43%), Gaps = 44/332 (13%)

Query: 439  KSSKSIVSVNDIEYERIELLGRGGSSKVYKVKNTNNNRVYALKRVVFDEFDDTSVDAFKG 498
            +S  S +S   I +++   +G G    V+   N +   + A+K +     D  ++     
Sbjct: 1220 QSLASSLSNVSIRWQKRHFIGGGAFGTVFSAVNLDTGEILAVKEIKIQ--DRNTMKQVFP 1277

Query: 499  XXXXXXXXXXXXXXXXXIQY---QMDNGVLYLVME-CGDHDLSQILNQRANMPLDVDFIR 554
                             +QY   ++    + L ME C    L+Q+L        D    +
Sbjct: 1278 AIKEEMSVLEMLNHPNVVQYYGVEVHRDKVNLFMEYCEGGSLAQLLEH--GRIEDEMVTQ 1335

Query: 555  YYSREMLKCVKVVHDAGIVHSDLKPANFVL-VKGILKIIDFGIANAVPDHTVNIYRD--- 610
             Y+ +ML+ +  +H + +VH D+KP N +L   G++K +DFG A ++  +   +  +   
Sbjct: 1336 VYALQMLEGLAYLHQSSVVHRDIKPENILLDFNGVIKYVDFGAARSLAANGTKVANNGSE 1395

Query: 611  -------TQIGTPNYMAPEALVALNEVSNVEKKNRWRVGKPSDIWSCGCIMYQMFYGRPP 663
                   + +GTP YM+PE++          KK ++     SDIWS GC++ +M  GR P
Sbjct: 1396 GKTDGVNSMMGTPMYMSPESVTG-------AKKGKF---GSSDIWSLGCVILEMATGRRP 1445

Query: 664  YGAFQNQNRLLAIMNPEVKIVFSEKTSKNERVPKSALDTMKACLIRSPEKRWTADEILDA 723
            +    N+    AIM         +  S++E  P+   D +  CL + P+KR TA E+   
Sbjct: 1446 WFNLDNE---WAIMYHVAAGHVPQLPSRDEISPQGT-DFLLKCLKQDPDKRATAMEL--- 1498

Query: 724  SFLNPVLVTPYIVRDLIRNAVYYGSDQGQVSE 755
                  LV P+++   IR   +   ++ + S+
Sbjct: 1499 ------LVHPWMIE--IRKLAFGDGEEAESSQ 1522

>Suva_10.202 Chr10 (380079..381386) [1308 bp, 435 aa] {ON} YLR113W
           (REAL)
          Length = 435

 Score = 87.8 bits (216), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 69/228 (30%), Positives = 112/228 (49%), Gaps = 43/228 (18%)

Query: 525 LYLVMECGDHDLSQILNQRANMPLDVDFIRYYSREMLKCVKVVHDAGIVHSDLKPANFVL 584
           +Y V E    DL ++L  R   PL+  F++Y+  ++L+ +K VH AG++H DLKP+N ++
Sbjct: 96  IYFVTELQGTDLHRLLQTR---PLEKQFVQYFLYQILRGLKYVHSAGVIHRDLKPSNILI 152

Query: 585 VKGI-LKIIDFGIANAVPDHTVNIYRDTQIGTPNYMAPEALVALNEVSNVEKKNRWRVGK 643
            +   LKI DFG+A  + D  +  Y    + T  Y APE ++   +  +VE         
Sbjct: 153 NENCDLKICDFGLAR-IQDPQMTGY----VSTRYYRAPEIMLTWQKY-DVE--------- 197

Query: 644 PSDIWSCGCIMYQMFYGRPPYGAFQNQNRLLAIMN-----PE--VKIVFSEKTSK----- 691
             DIWS GCI  +M  G+P +    + ++   I +     P+  +  + SE T K     
Sbjct: 198 -VDIWSAGCIFAEMIEGKPLFPGKDHVHQFSIITDLLGSPPKDVINTICSENTLKFVTSL 256

Query: 692 --------NER---VPKSALDTMKACLIRSPEKRWTADEILDASFLNP 728
                   +ER   V   A+D ++  L+  P+KR TA + L   +L P
Sbjct: 257 PHRDPISFSERFKTVEPDAVDLLEKMLVFDPKKRVTAADALAHPYLAP 304

>Smik_4.803 Chr4 complement(1408345..1409817) [1473 bp, 490 aa] {ON}
           YDR523C (REAL)
          Length = 490

 Score = 88.2 bits (217), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 73/280 (26%), Positives = 126/280 (45%), Gaps = 30/280 (10%)

Query: 458 LGRGGSSKVYKVKNTNNNRVYALKRVVFDEFDDTSVDAFKGXXXXXXXXXXXXXXXXXIQ 517
           +GRG    VYK  +     + A+K VV  E  D  ++                     I 
Sbjct: 24  IGRGNFGDVYKAMDRVTQEIVAIK-VVNLEHSDEDIELL-AQEIFFLAELKSPLITNYIT 81

Query: 518 YQMDNGVLYLVME-CGDHDLSQILNQRANMPLDVDFIRYYSREMLKCVKVVHDAGIVHSD 576
             +++  +++VME CG    S +L +     L  + + +   ++   +K +H+   +H D
Sbjct: 82  TMLEDVSMWIVMEYCGGGSCSDLLKRSYVNGLPEEKVSFIIHQVTLGLKYLHEQRKIHRD 141

Query: 577 LKPANFVL-VKGILKIIDFGIANAVPDHTVNIYRDTQIGTPNYMAPEALVALNEVSNVEK 635
           +K AN +L  +G++K+ DFG++  +        RDT +GTP +MAPE  V   EV    +
Sbjct: 142 IKAANILLNEEGMVKLGDFGVSGHIRS---TFKRDTFVGTPYWMAPE--VVCCEVDGYNE 196

Query: 636 KNRWRVGKPSDIWSCGCIMYQMFYGRPP---YGAFQNQNRLLAIMNPEVKIVFSEKTSKN 692
           K        +DIWS G   Y++  G PP   Y   +    L     P+++  FSE     
Sbjct: 197 K--------ADIWSLGITTYELLKGLPPLSKYDPMKVMTNLPKRKPPKLQGPFSE----- 243

Query: 693 ERVPKSALDTMKACLIRSPEKRWTADEILDASFLNPVLVT 732
                +A + +  CL+++P  R +A ++L   F+  + VT
Sbjct: 244 -----AAKEFVAGCLVKTPADRPSAYDLLSFEFIKNITVT 278

>NCAS0D04600 Chr4 (875553..880604) [5052 bp, 1683 aa] {ON} Anc_6.341
          Length = 1683

 Score = 89.7 bits (221), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 81/344 (23%), Positives = 138/344 (40%), Gaps = 68/344 (19%)

Query: 440  SSKSIVSVNDIEYERIELLGRGGSSKVYKVKNTNNNRVYALKRVVFDEFDDTSVDAFKGX 499
            S  S +S   I +++   +G G    VY   N +N  + A+K +     D  ++      
Sbjct: 1349 SLASSISNLSIRWQKRNFIGGGTFGTVYSAVNLDNGEILAVKEIKIQ--DSKTMKKIFPL 1406

Query: 500  XXXXXXXXXXXXXXXXIQY---QMDNGVLYLVME-CGDHDLSQILNQRANMPLDVDFIRY 555
                            +QY   ++    + + ME C    ++ +L        D    + 
Sbjct: 1407 VKEEMTVLEMLNHPNIVQYYGVEVHRDKVNIFMEYCEGGSMASLLEH--GRIEDEMVTQV 1464

Query: 556  YSREMLKCVKVVHDAGIVHSDLKPANFVL-VKGILKIIDFGIANAVPDHTVNIYR----- 609
            Y+ E+L+ +  +H AG+VH D+KP N +L   GI+K +DFG A  +  +   +       
Sbjct: 1465 YTLELLEGLAYLHQAGVVHRDIKPENILLDFNGIIKYVDFGAARKIAKNGTKVTNINSKS 1524

Query: 610  ------------------DTQIGTPNYMAPEALVALNEVSNVEKKNRWRVGKPSDIWSCG 651
                                 +GTP YMAPE++           KN+ + G   DIWS G
Sbjct: 1525 KDDDEPDEKDTEGGANSVHDMLGTPMYMAPESITGY--------KNKTKFGS-DDIWSFG 1575

Query: 652  CIMYQMFYGRPPYGAFQNQNRLLAIMNPEVKIVFSEKTSKNERVP------KSALDTMKA 705
            C++ +M  GR P+    N          E  I++     +  ++P       +    ++ 
Sbjct: 1576 CVVLEMITGRRPWANLDN----------EWAIIYHVAAGQTPQLPYPNEVSPAGRRFLQR 1625

Query: 706  CLIRSPEKRWTADEILDASFLNPVLVTPYIVRDLIRNAVYYGSD 749
            CL++ P KR TA E+         L+ P+IV   IR A +  S+
Sbjct: 1626 CLVQDPIKRATAVEL---------LMDPWIVE--IREAAFGPSE 1658

>TPHA0G03200 Chr7 (683296..687900) [4605 bp, 1534 aa] {ON} Anc_2.479
           YKL101W
          Length = 1534

 Score = 89.7 bits (221), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 61/213 (28%), Positives = 106/213 (49%), Gaps = 32/213 (15%)

Query: 525 LYLVMECGDH-DLSQILNQRANMPLDVDFIRYYSREMLKCVKVVHDAGIVHSDLKPANFV 583
           LYLV+E  D  +L   L  +  +  +++ +RY+ +++++ V+  H   I H DLKP N +
Sbjct: 235 LYLVLEYVDGGELFDYLVSKGKLT-ELEAVRYF-KQIIRGVQYCHSFNICHRDLKPENLL 292

Query: 584 LVKG--ILKIIDFGIANAVPDHTVNIYRDTQIGTPNYMAPEALVALNEVSNVEKKNRWRV 641
           L K   ++KI DFG+A        N    T  G+P+Y +PE  + + +  N         
Sbjct: 293 LDKKRKLIKIADFGMAAL---QVSNTLLKTSCGSPHYASPE--IVMGKTYN--------- 338

Query: 642 GKPSDIWSCGCIMYQMFYGRPPYGAFQNQNRLLAIMNPEVKIVFSEKTSKNERVPKSALD 701
           G PSD+WSCG I++ +  G  P+     +  L+ + N   ++           + K A D
Sbjct: 339 GGPSDVWSCGIILFALLTGHLPFNDDSIKKLLIKVQNGRYQMP--------NYLSKDAKD 390

Query: 702 TMKACLIRSPEKRWTADEILDASFLNPVLVTPY 734
            +   L+ +P+ R T ++IL+    +P L+T Y
Sbjct: 391 LISRILLVNPKARLTTEQILE----HP-LITKY 418

>NDAI0G02700 Chr7 complement(618268..619611) [1344 bp, 447 aa] {ON}
           Anc_8.302
          Length = 447

 Score = 87.8 bits (216), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 65/228 (28%), Positives = 108/228 (47%), Gaps = 43/228 (18%)

Query: 525 LYLVMECGDHDLSQILNQRANMPLDVDFIRYYSREMLKCVKVVHDAGIVHSDLKPANFVL 584
           +Y V E    DL ++L  R   PL+  F++Y+  ++L+ +K VH AG++H DLKP+N ++
Sbjct: 96  IYFVTELQGTDLHRLLQTR---PLEKQFVQYFLYQILRGLKYVHSAGVIHRDLKPSNILI 152

Query: 585 VKGI-LKIIDFGIANAVPDHTVNIYRDTQIGTPNYMAPEALVALNEVSNVEKKNRWRVGK 643
            +   LKI DFG+A  + D  +  Y    + T  Y APE ++   +  +VE         
Sbjct: 153 NENCDLKICDFGLAR-IQDPQMTGY----VSTRYYRAPEIMLTWQKY-DVE--------- 197

Query: 644 PSDIWSCGCIMYQMFYGRPPYGAFQNQNRLLAIMN----PEVKIV----------FSEKT 689
             DIWS GCI  +M  G+P +    + ++   I +    P   ++          F    
Sbjct: 198 -VDIWSAGCIFAEMIEGKPLFPGKDHVHQFSIITDLLGSPPADVINTIGSENTLKFVTSL 256

Query: 690 SKNERVPKS---------ALDTMKACLIRSPEKRWTADEILDASFLNP 728
              + +P S         A+D ++  L+  P+KR TA + L   +L P
Sbjct: 257 PHRDPIPFSQRFKTVEPDAVDLLEKMLVFEPKKRVTAAQALTHPYLAP 304

>KNAG0G02300 Chr7 (528489..529748) [1260 bp, 419 aa] {ON} Anc_8.302
           YLR113W
          Length = 419

 Score = 87.4 bits (215), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 69/228 (30%), Positives = 110/228 (48%), Gaps = 43/228 (18%)

Query: 525 LYLVMECGDHDLSQILNQRANMPLDVDFIRYYSREMLKCVKVVHDAGIVHSDLKPANFVL 584
           +Y V E    DL ++L  R   PL+  F++Y+  ++L+ +K VH AG++H DLKP+N ++
Sbjct: 96  IYFVTELQGTDLHRLLQTR---PLEKQFVQYFLYQILRGLKYVHSAGVIHRDLKPSNILI 152

Query: 585 VKGI-LKIIDFGIANAVPDHTVNIYRDTQIGTPNYMAPEALVALNEVSNVEKKNRWRVGK 643
            +   LKI DFG+A  + D  +  Y    + T  Y APE ++   +  +VE         
Sbjct: 153 NENCDLKICDFGLAR-IQDPQMTGY----VSTRYYRAPEIMLTWQKY-DVE--------- 197

Query: 644 PSDIWSCGCIMYQMFYGRPPYGAFQNQNRLLAIMN-----PE--VKIVFSEKTSK----- 691
             DIWS GCI  +M  G+P +    + ++   I +     PE  +  + SE T K     
Sbjct: 198 -VDIWSAGCIFAEMIEGKPLFPGKDHVHQFSIITDLLGSPPEDVINTICSENTLKFVTSL 256

Query: 692 --NERVP---------KSALDTMKACLIRSPEKRWTADEILDASFLNP 728
              + VP           A+D +   L+  P+KR T+ E L   +L P
Sbjct: 257 PHRDPVPFHDRFKTVEPDAVDLLAKMLVFDPKKRITSAEALAHPYLAP 304

>Skud_12.181 Chr12 (354407..355702) [1296 bp, 431 aa] {ON} YLR113W
           (REAL)
          Length = 431

 Score = 87.4 bits (215), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 69/228 (30%), Positives = 112/228 (49%), Gaps = 43/228 (18%)

Query: 525 LYLVMECGDHDLSQILNQRANMPLDVDFIRYYSREMLKCVKVVHDAGIVHSDLKPANFVL 584
           +Y V E    DL ++L  R   PL+  F++Y+  ++L+ +K VH AG++H DLKP+N ++
Sbjct: 96  IYFVTELQGTDLHRLLQTR---PLEKQFVQYFLYQILRGLKYVHSAGVIHRDLKPSNILI 152

Query: 585 VKGI-LKIIDFGIANAVPDHTVNIYRDTQIGTPNYMAPEALVALNEVSNVEKKNRWRVGK 643
            +   LKI DFG+A  + D  +  Y    + T  Y APE ++   +  +VE         
Sbjct: 153 NENCDLKICDFGLAR-IQDPQMTGY----VSTRYYRAPEIMLTWQKY-DVE--------- 197

Query: 644 PSDIWSCGCIMYQMFYGRPPYGAFQNQNRLLAIMN-----PE--VKIVFSEKTSK----- 691
             DIWS GCI  +M  G+P +    + ++   I +     P+  +  + SE T K     
Sbjct: 198 -VDIWSAGCIFAEMIEGKPLFPGKDHVHQFSIITDLLGSPPKDVINTICSENTLKFVTSL 256

Query: 692 --------NER---VPKSALDTMKACLIRSPEKRWTADEILDASFLNP 728
                   +ER   V   A+D ++  L+  P+KR TA + L   +L P
Sbjct: 257 PHRDPISFSERFKTVEPDAVDLLEKMLVFDPKKRVTAADALAHPYLAP 304

>KLTH0G12738g Chr7 complement(1085500..1086804) [1305 bp, 434 aa]
           {ON} highly similar to uniprot|P32485 Saccharomyces
           cerevisiae YLR113W HOG1 Mitogen-activated protein kinase
           involved in osmoregulation via three independent
           osmosensors mediates the recruitment and activation of
           RNA Pol II at Hot1p-dependent promoters localization
           regulated by Ptp2p and Ptp3p
          Length = 434

 Score = 87.4 bits (215), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 70/228 (30%), Positives = 110/228 (48%), Gaps = 43/228 (18%)

Query: 525 LYLVMECGDHDLSQILNQRANMPLDVDFIRYYSREMLKCVKVVHDAGIVHSDLKPANFVL 584
           +Y V E    DL ++L  R   PL+  F++Y+  ++L+ +K VH AG++H DLKP+N ++
Sbjct: 96  IYFVTELQGTDLHRLLQTR---PLEKQFVQYFLYQILRGLKYVHSAGVIHRDLKPSNILI 152

Query: 585 VKGI-LKIIDFGIANAVPDHTVNIYRDTQIGTPNYMAPEALVALNEVSNVEKKNRWRVGK 643
            +   LKI DFG+A  + D  +  Y    + T  Y APE ++   +  NVE         
Sbjct: 153 NENCDLKICDFGLAR-IQDPQMTGY----VSTRYYRAPEIMLTWQKY-NVE--------- 197

Query: 644 PSDIWSCGCIMYQMFYGRPPYGAFQNQNRLLAIMN-----PE-----------VKIVFS- 686
             DIWS GCI  +M  G+P +    + ++   I +     PE           +K V S 
Sbjct: 198 -VDIWSAGCIFAEMIEGKPLFPGKDHVHQFSIITDLLGSPPEDVINTICSVNTLKFVTSL 256

Query: 687 ---EKTSKNER---VPKSALDTMKACLIRSPEKRWTADEILDASFLNP 728
              +    +ER   V   A+D ++  L+  P KR TA + L   +L P
Sbjct: 257 PHRDPVPFSERFKNVEPDAVDLLEKMLVFDPNKRITAADALSHPYLAP 304

>TBLA0C02940 Chr3 complement(706091..711022) [4932 bp, 1643 aa] {ON}
            Anc_1.271 YJL095W
          Length = 1643

 Score = 89.4 bits (220), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 77/289 (26%), Positives = 125/289 (43%), Gaps = 33/289 (11%)

Query: 449  DIEYERIELLGRGGSSKVYKVKNTNNNRVYALKRVVFDEFDD------TSVDAFKGXXXX 502
            +  + + EL+G+G    VY   N     + A+K+V   EF        ++V+A +     
Sbjct: 1335 EFAWVKGELIGKGSFGSVYLSLNVTTGEMMAVKQVEVPEFGSQNEAIVSTVEALRSEVTL 1394

Query: 503  XXXXXXXXXXXXXIQYQMDNGVLYLVME--CGDHDLSQILNQRANMPLDVDFIRYYSREM 560
                         + ++  N +  L +E   G    S I   R     D   IR+ + ++
Sbjct: 1395 LKDLDHINIVQY-LGFEKKNNIYSLFLEYVAGGSIGSLI---RMYGRFDESLIRHSTTQI 1450

Query: 561  LKCVKVVHDAGIVHSDLKPANFVL-VKGILKIIDFGIANAVPDHTVNIYRDTQI---GTP 616
            L  +  +H  GI+H D+K  N +L  +GI KI DFGI+    D    IY ++++   GT 
Sbjct: 1451 LAGLSYLHSKGILHRDMKADNILLDGEGICKISDFGISRKSKD----IYSNSEMTMRGTV 1506

Query: 617  NYMAPEALVALNEVSNVEKKNRWRVGKPSDIWSCGCIMYQMFYGRPPYGAFQNQNRLLAI 676
             +MAPE          V+ K  +      DIWS GCI+ +MF G+ P+   +    +  I
Sbjct: 1507 FWMAPEM---------VDTKQGYSAK--VDIWSLGCIILEMFAGKRPWSNLEVVAAMFKI 1555

Query: 677  MNPEVKIVFSEKTSKNERVPKSALDTMKACLIRSPEKRWTADEILDASF 725
               +      E T     + +   D +  C    PEKR TA+++LD  F
Sbjct: 1556 GQSKSAPPIPEDTL--PLISQDGRDFLDDCFKIDPEKRPTAEQMLDHLF 1602

>Smik_12.173 Chr12 (351727..353034) [1308 bp, 435 aa] {ON} YLR113W
           (REAL)
          Length = 435

 Score = 87.4 bits (215), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 69/228 (30%), Positives = 112/228 (49%), Gaps = 43/228 (18%)

Query: 525 LYLVMECGDHDLSQILNQRANMPLDVDFIRYYSREMLKCVKVVHDAGIVHSDLKPANFVL 584
           +Y V E    DL ++L  R   PL+  F++Y+  ++L+ +K VH AG++H DLKP+N ++
Sbjct: 96  IYFVTELQGTDLHRLLQTR---PLEKQFVQYFLYQILRGLKYVHSAGVIHRDLKPSNILI 152

Query: 585 VKGI-LKIIDFGIANAVPDHTVNIYRDTQIGTPNYMAPEALVALNEVSNVEKKNRWRVGK 643
            +   LKI DFG+A  + D  +  Y    + T  Y APE ++   +  +VE         
Sbjct: 153 NENCDLKICDFGLAR-IQDPQMTGY----VSTRYYRAPEIMLTWQKY-DVE--------- 197

Query: 644 PSDIWSCGCIMYQMFYGRPPYGAFQNQNRLLAIMN-----PE--VKIVFSEKTSK----- 691
             DIWS GCI  +M  G+P +    + ++   I +     P+  +  + SE T K     
Sbjct: 198 -VDIWSAGCIFAEMIEGKPLFPGKDHVHQFSIITDLLGSPPKDVINTICSENTLKFVTSL 256

Query: 692 --------NER---VPKSALDTMKACLIRSPEKRWTADEILDASFLNP 728
                   +ER   V   A+D ++  L+  P+KR TA + L   +L P
Sbjct: 257 PHRDPISFSERFKTVEPDAVDLLEKMLVFDPKKRITAADALAHPYLAP 304

>Suva_3.110 Chr3 complement(160016..164146) [4131 bp, 1376 aa] {ON}
            YNR031C (REAL)
          Length = 1376

 Score = 89.0 bits (219), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 65/219 (29%), Positives = 105/219 (47%), Gaps = 44/219 (20%)

Query: 556  YSREMLKCVKVVHDAGIVHSDLKPANFVL-VKGILKIIDFGIA--------NAVPDHTVN 606
            Y+ E+L+ +  +H +G+VH D+KP N +L   GI+K +DFG A         A+ + T+N
Sbjct: 1178 YTLELLEGLTYLHQSGVVHRDIKPENILLDFNGIIKYVDFGTARTFVETSTRAMRNATIN 1237

Query: 607  I-----------YRDTQIGTPNYMAPEALVALNEVSNVEKKNRWRVGKPSDIWSCGCIMY 655
                        Y D  +GTP YMAPE       +S    K   ++G   D+W+ GC++ 
Sbjct: 1238 DLDLPESEPETNYMDGMMGTPMYMAPET------ISGSAAKG--KLG-ADDVWALGCVVL 1288

Query: 656  QMFYGRPPYGAFQNQNRLLAIMNPEVKIVFSEKTSKNERVPKSALDTMKACLIRSPEKRW 715
            +M  GR P+    N+    AIM         +  +K+E V       ++ CL++ P  R 
Sbjct: 1289 EMVTGRRPWSNLDNE---WAIMYHVAAGHIPQFPNKDE-VTSKGRAFLERCLVQDPASRA 1344

Query: 716  TADEILDASFLNPVLVTPYIVRDLIRNAVYYGSDQGQVS 754
            +A E+         L+ P++ +  IR+  +   DQ QVS
Sbjct: 1345 SAVEL---------LIDPWMAQ--IRDIAFGNPDQDQVS 1372

>KLLA0C08525g Chr3 (744554..749209) [4656 bp, 1551 aa] {ON} similar to
            uniprot|P53599 Saccharomyces cerevisiae YNR031C SSK2
            Suppressor of Sensor Kinase (SLN1) A MAP kinase kinase
            kinase activator of Pbs2p
          Length = 1551

 Score = 89.0 bits (219), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 83/324 (25%), Positives = 137/324 (42%), Gaps = 44/324 (13%)

Query: 439  KSSKSIVSVNDIEYERIELLGRGGSSKVYKVKNTNNNRVYALKRVVFDEFDDTSVDAFKG 498
            KS  S +S   I +++   +G G    VY   N +   + A+K +     D  S+     
Sbjct: 1246 KSLASSISNLSIRWQKRSFIGSGSFGTVYSAVNLDTGDILAVKEIKIQ--DAKSMKQIFP 1303

Query: 499  XXXXXXXXXXXXXXXXXIQY---QMDNGVLYLVME-CGDHDLSQILNQRANMPLDVDFIR 554
                             +QY   ++    + + ME C    L+ +L        D    +
Sbjct: 1304 SLKEEMRVMEILNHPNIVQYYGVEVHRDKVNIFMEFCEGSSLASLLEH--GRIEDEMVTQ 1361

Query: 555  YYSREMLKCVKVVHDAGIVHSDLKPANFVLVK-GILKIIDFGIANAVP-DHTVNIYRDT- 611
             Y+ ++L+ +  +H +G+VH D+KP N +L + G++K +DFG A  +  + +  I  D  
Sbjct: 1362 VYTLQLLEGLACLHQSGVVHRDIKPENILLDRNGVIKYVDFGAAKLIAKNGSKRISLDAN 1421

Query: 612  --------QIGTPNYMAPEALVALNEVSNVEKKNRWRVGKPSDIWSCGCIMYQMFYGRPP 663
                     IGTP YMAPE          V  +   + G   DIWS GC++ +M  GR P
Sbjct: 1422 NKSTGGKDMIGTPMYMAPET---------VTGQGHGKFGS-DDIWSLGCVVLEMVTGRRP 1471

Query: 664  YGAFQNQNRLLAIMNPEVKIVFSEKTSKNERVPKSALDTMKACLIRSPEKRWTADEILDA 723
            +    N+    AIM         +  +K+E +  +    +  CLI+   KR TA E+   
Sbjct: 1472 WANLDNE---WAIMYHVAAGHLPQFPTKSE-ISSAGRKFISRCLIQDANKRATAMEL--- 1524

Query: 724  SFLNPVLVTPYIVRDLIRNAVYYG 747
                  L+ P+I +  IRN  + G
Sbjct: 1525 ------LLDPWISQ--IRNIAFGG 1540

>TBLA0I01150 Chr9 complement(235187..240424) [5238 bp, 1745 aa] {ON}
           Anc_2.479 YKL101W
          Length = 1745

 Score = 89.0 bits (219), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 63/206 (30%), Positives = 102/206 (49%), Gaps = 29/206 (14%)

Query: 525 LYLVMECGDH-DLSQILNQRANMPLDVDFIRYYSREMLKCVKVVHDAGIVHSDLKPANFV 583
           LYLV+E  D  +L   L  R  +P + + + Y+ +++++ V   H   I H DLKP N +
Sbjct: 174 LYLVLEYVDGGELFDYLVSRGKLP-EREAVHYF-KQIIQGVAYCHAFNICHRDLKPENLL 231

Query: 584 LVKG--ILKIIDFGIAN-AVPDHTVNIYRDTQIGTPNYMAPEALVALNEVSNVEKKNRWR 640
           L K   I+KI DFG+A   V D  ++    T  G+P+Y +PE ++            +  
Sbjct: 232 LDKKNKIIKIADFGMAALEVSDKLLS----TSCGSPHYASPEIVMG-----------KSY 276

Query: 641 VGKPSDIWSCGCIMYQMFYGRPPYGAFQNQNRLLAIMNPEVKIVFSEKTSKNERVPKSAL 700
            G P+D+WSCG I++ +  G  P+    N  +LL  +   V  + S+       +   A 
Sbjct: 277 HGSPTDVWSCGIILFALLTGHLPFN-HDNIKKLLLKVQSGVYHMPSD-------LSPDAK 328

Query: 701 DTMKACLIRSPEKRWTADEILDASFL 726
           D +   L+  P+KR T  EIL+ S +
Sbjct: 329 DLISKILVVDPDKRLTTTEILNHSLI 354

>NDAI0A03870 Chr1 (867910..870597) [2688 bp, 895 aa] {ON} Anc_2.496
          Length = 895

 Score = 88.6 bits (218), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 75/284 (26%), Positives = 129/284 (45%), Gaps = 33/284 (11%)

Query: 451 EYERIELLGRGGSSKVYKVKNTNNNRVYALKRVVFDEFDDTSVDAFKGXXXXXXXXXXXX 510
           +Y  +  +GRGGS+ VY       N   A+K++     +                     
Sbjct: 612 KYANLVKIGRGGSALVYTAYEVGTNLSVAIKQI---NLEKQPRKQLILNEIIVMKKSQHP 668

Query: 511 XXXXXIQYQMDNGVLYLVMECGDH-DLSQILNQRANMPLDVDFIRYYSREMLKCVKVVHD 569
                I   + +G L+++ME  +   L+ ++ +     L    I    RE+LK +  +H 
Sbjct: 669 NIVNFIDSYLVDGKLWVIMEYMEAGSLTDVVTRCI---LREGQIGAVCREVLKGLVFLHS 725

Query: 570 AGIVHSDLKPANFVL-VKGILKIIDFGIANAVPDHTVNIYRDTQIGTPNYMAPEALVALN 628
            G++H D+K  N +L + G +K+ DFG    + D  +++ R+T +GTP +MAPE      
Sbjct: 726 KGVIHRDIKSDNVLLSMDGDIKLTDFGFCAQLND--IHLKRNTMVGTPYWMAPEI----- 778

Query: 629 EVSNVEKKNRWRVGKPSDIWSCGCIMYQMFYGRPPYGAFQNQNRLLAIMNPEVKIVFSEK 688
               VEKK+        DIWS G ++ +M  G PPY    N+  L A+      ++ +  
Sbjct: 779 ----VEKKHYC---PKVDIWSLGVMIIEMIEGEPPY---LNEPPLRALY-----LIATNG 823

Query: 689 TSK---NERVPKSALDTMKACLIRSPEKRWTADEILDASFLNPV 729
           T K    E++ ++  + +  CL   PE R TA E+L+  F+  +
Sbjct: 824 TPKLKDPEKLSETLSEFINCCLFVDPELRKTAAELLNHRFITEI 867

>KLTH0C09548g Chr3 (792218..795199) [2982 bp, 993 aa] {ON} similar
           to uniprot|Q12236 YOL100W Saccharomyces cerevisiae
           YOL100W PKH2 Serine/threonine protein kinase involved in
           sphingolipid-mediated signaling pathway that controls
           endocytosis
          Length = 993

 Score = 88.6 bits (218), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 83/306 (27%), Positives = 136/306 (44%), Gaps = 43/306 (14%)

Query: 421 KIVKKVEIVEPPTSMTNRKSSKSIVSVNDIEYERIELLGRGGSSKVYKVKNTNNNRVYAL 480
           KIVK  E+V P T +T R   K    + D ++   E+LG G  S V   ++ ++ + YA+
Sbjct: 138 KIVK--EVVNPETGVTARHVIKK--GIKDFKFG--EVLGDGSYSTVMLARSIDSGKKYAV 191

Query: 481 KRV----VFDEFDDTSVDAFKGXXXXXXXXXXXXXXXXXIQYQMDNGVLYLVME-CGDHD 535
           K +    +  +     V+  K                   Q   D   LY ++E   + D
Sbjct: 192 KVLNKEYLIRQKKVKYVNIEKNTLQRLNDGRGIIKLYFTFQ---DEASLYFLLEYAPNGD 248

Query: 536 LSQILNQRANMPLDVDFIRYYSREMLKCVKVVHDAGIVHSDLKPANFVLVKGI-LKIIDF 594
              ++ +  +  L+ D   YYS ++L  +  +H  G++H D+KP N +L K + +K+ DF
Sbjct: 249 FLSVIKKYGS--LNQDCSVYYSAQILDAIDYLHQKGVIHRDIKPENILLDKDMKVKLTDF 306

Query: 595 GIANAV-PDHTVNIY-----RDTQIGTPNYMAPEALVALNEVSNVEKKNRWRVGKPSDIW 648
           G A  V  D T   Y       + +GT  Y++PE L            N   V    DIW
Sbjct: 307 GTAKLVEKDETTQTYNLLERSKSFVGTAEYVSPELL------------NDNYVDYKCDIW 354

Query: 649 SCGCIMYQMFYGRPPYGAFQNQNRLLAIMNPEVKIVFSEKTSKNERVPKSALDTMKACLI 708
           + GCI++QM  G+PP+ A         +M  +V+  F+         P    D +K  L+
Sbjct: 355 AFGCILFQMIAGKPPFKATNEYLTFQKVM--KVQYAFTAG------FPLIIRDLIKQILV 406

Query: 709 RSPEKR 714
           ++PE+R
Sbjct: 407 KNPEQR 412

>AGR048C Chr7 complement(807464..808825) [1362 bp, 453 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YLR113W
           (HOG1)
          Length = 453

 Score = 87.0 bits (214), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 69/228 (30%), Positives = 111/228 (48%), Gaps = 43/228 (18%)

Query: 525 LYLVMECGDHDLSQILNQRANMPLDVDFIRYYSREMLKCVKVVHDAGIVHSDLKPANFVL 584
           +Y V E    DL ++L  R   PL+  F++Y+  ++L+ +K VH AG++H DLKP+N ++
Sbjct: 102 IYFVTELQGTDLHRLLQTR---PLEKQFLQYFLYQILRGLKYVHSAGVIHRDLKPSNILI 158

Query: 585 VKGI-LKIIDFGIANAVPDHTVNIYRDTQIGTPNYMAPEALVALNEVSNVEKKNRWRVGK 643
            +   LKI DFG+A  + D  +  Y    + T  Y APE ++   +  NVE         
Sbjct: 159 NENCDLKICDFGLAR-IQDPQMTGY----VSTRYYRAPEIMLTWQKY-NVE--------- 203

Query: 644 PSDIWSCGCIMYQMFYGRPPYGAFQNQNRLLAIMN-----PE--VKIVFSEKTSK----- 691
             DIWS GCI  +M  G+P +    + ++   I +     P+  +  + SE T K     
Sbjct: 204 -VDIWSAGCIFAEMIEGKPLFPGKDHVHQFSIITDLLGSPPKDVIDTICSENTLKFVTSL 262

Query: 692 --NERVP---------KSALDTMKACLIRSPEKRWTADEILDASFLNP 728
              + VP           A+D ++  L+  P+KR TA + L   +L P
Sbjct: 263 PHRDPVPFTERFKNLKPDAVDLLEKMLVFDPKKRITAGDALTHPYLAP 310

>KAFR0A01760 Chr1 complement(363462..366119) [2658 bp, 885 aa] {ON}
           Anc_2.496 YHL007C
          Length = 885

 Score = 88.6 bits (218), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 70/275 (25%), Positives = 120/275 (43%), Gaps = 35/275 (12%)

Query: 458 LGRGGSSKVYKVKNTNNNRVYALKRVVFDEFDDTSVDAFKGXXXXXXXXXXXXXXXXXIQ 517
           +G+G S  VY   + N     A+K++ F++     +                      I 
Sbjct: 571 IGQGASGGVYTATDVNTEASVAIKKMNFEKQPKKELIV---NEILVMKASRHENIVNFID 627

Query: 518 YQMDNGVLYLVME-CGDHDLSQILNQRANMPLDVDFIRYYSREMLKCVKVVHDAGIVHSD 576
               NG L+++ME      L+ ++       L    I   +RE L  ++ +H  G++H D
Sbjct: 628 SYFLNGNLWVIMEYMKGGSLTDVVTHCI---LTEQQISTVTRETLNGLRFLHSKGVIHRD 684

Query: 577 LKPANFVL-VKGILKIIDFGIANAVPDHTVNIYRDTQIGTPNYMAPEALVALNEVSNVEK 635
           +K  N +L + G +K+ DFG    +  + +N+ R T +GTP +MAPE +           
Sbjct: 685 IKSDNVLLSLSGDIKLTDFGFCAQI--NEINLKRTTMVGTPYWMAPEVV----------- 731

Query: 636 KNRWRVGKPSDIWSCGCIMYQMFYGRPPYGAFQNQNRLLAIMNPEVKIVFSEKTSKNERV 695
            +R   G   DIWS G ++ +M  G PPY    N+  L A+       + +   +   + 
Sbjct: 732 -SRKEYGPKVDIWSLGIMIIEMIEGEPPY---LNETPLRALY------LIATNGTPELKD 781

Query: 696 PKSALDTMKA----CLIRSPEKRWTADEILDASFL 726
           P S  + +KA    CL   P +R +A E+L+  F+
Sbjct: 782 PDSLSECLKAFLDWCLKVDPHERASATELLNDRFI 816

>Smik_2.146 Chr2 complement(275270..276850) [1581 bp, 526 aa] {ON}
           YBR028C (REAL)
          Length = 526

 Score = 87.4 bits (215), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 83/339 (24%), Positives = 142/339 (41%), Gaps = 70/339 (20%)

Query: 432 PTSMTNRKSSKSIVSVNDIEYERIELLGRGGSSKVYKVKNTNNNRVYALKRVVFDEF--D 489
           P  M +    ++ +S N  +++ + +LG+G   KV  VK+TN +++YA+K++   E    
Sbjct: 109 PQDMISSNKKENELSRNLHDFKPVRVLGQGAYGKVLLVKDTNTSKLYAMKQLQKAEILIS 168

Query: 490 DTSVDAFK---------------GXXXXXXXXXXXXXXXXXIQYQ---------MDNGVL 525
            T+ ++ K               G                 I++           DN  L
Sbjct: 169 PTATESKKEDEENNSCDNNDNDNGLSKRLERTFAERSILSEIEHPNIVKLFYSFHDNSKL 228

Query: 526 YLVME-CGDHDLSQILNQRANMPLDVDFIRYYSREMLKCVKVVHDAGIVHSDLKPANFVL 584
           YL+++     +L   L +     LD   + +Y+ E+   ++ +H  G+V+ DLKP N +L
Sbjct: 229 YLLLQYIPGGELFYHLKEHGT--LDETTVSFYAAEISCALRFLHTKGVVYRDLKPENCLL 286

Query: 585 -VKGILKIIDFGIANAVPDHTVNIYRDTQ--------IGTPNYMAPEALVALNEVSNVEK 635
             +G L + DFG++    + +V    D +        IGTP Y APE L+      N   
Sbjct: 287 NQRGHLVLTDFGLSKKSANDSVVDEEDPENVNALYSIIGTPEYCAPEILLGRAYTQNC-- 344

Query: 636 KNRWRVGKPSDIWSCGCIMYQMFYGRPPYGAFQNQNRLLAIMNPEVKIVFSEKTSKNERV 695
                     D +S GC++Y M  G+PPY    ++     I+N         K  +N++ 
Sbjct: 345 ----------DWYSLGCLLYDMLVGKPPYTGSNHK----VIIN---------KIQQNKQG 381

Query: 696 PKSAL-------DTMKACLIRSPEKRWTADEILDASFLN 727
           PK          D + A L R   KRW  D+    + +N
Sbjct: 382 PKIPFYLSEGMKDILNALLKRETSKRWNVDKYWTKTGIN 420

>NCAS0A05370 Chr1 complement(1061671..1066197) [4527 bp, 1508 aa] {ON}
            
          Length = 1508

 Score = 88.6 bits (218), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 87/337 (25%), Positives = 146/337 (43%), Gaps = 55/337 (16%)

Query: 440  SSKSIVSVNDIEYERIELLGRGGSSKVYKVKNTNNNRVYALKRVVFDEFDDTSVDAFKGX 499
            S  S VS   I +++ + +G G   +VY   N +   V A+K +     D  S++     
Sbjct: 1196 SLASSVSNVSIRWQKRKFVGGGTFGEVYSAVNLDTGEVLAVKEIKIQ--DSKSMEKIFPS 1253

Query: 500  XXXXXXXXXXXXXXXXIQY---QMDNGVLYLVME-CGDHDLSQILNQRANMPLDVDFIRY 555
                            +QY   ++    + + ME C    L+ +L        D    + 
Sbjct: 1254 IKEEMNVLEMLSHPNIVQYYGVEVHRDRVNIFMEYCEGGSLASLLEH--GRIEDEMVTQV 1311

Query: 556  YSREMLKCVKVVHDAGIVHSDLKPANFVL-VKGILKIIDFGIANAV------------PD 602
            Y+ ++L+ +  +H++GIVH D+KP N +L   GI+K +DFG A  +            PD
Sbjct: 1312 YTLQLLEGLAYLHESGIVHRDIKPENILLDFNGIIKYVDFGAARKIAKNGTRVVTREMPD 1371

Query: 603  HT---------VNIYRDTQIGTPNYMAPEALVALNEVSNVEKKNRWRVGKPSDIWSCGCI 653
                        N + D  IGTP YMAPEA      ++   KK    +G   DIW+ GC+
Sbjct: 1372 ENDDENGKVVGRNNFNDI-IGTPMYMAPEA------ITGSPKKG--HLG-ADDIWALGCV 1421

Query: 654  MYQMFYGRPPYGAFQNQNRLLAIMNPEVKIVFSEKTSKNERVPKSALDTMKACLIRSPEK 713
            + +M  G+ P+    N+    AIM   V      +   N+ V  + +  +K CL ++P +
Sbjct: 1422 VLEMITGKRPWANLDNE---WAIMY-HVAAGQIPQLPTNDEVSPAGMHFLKRCLKQNPAQ 1477

Query: 714  RWTADEILDASFLNPVLVTPYIVRDLIRNAVYYGSDQ 750
            R +A E+         L+ P+I+   IR+  +   +Q
Sbjct: 1478 RASAVEL---------LMDPWIIE--IRDLAFASDEQ 1503

>NCAS0C03380 Chr3 complement(664012..665310) [1299 bp, 432 aa] {ON} 
          Length = 432

 Score = 86.7 bits (213), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 70/228 (30%), Positives = 110/228 (48%), Gaps = 43/228 (18%)

Query: 525 LYLVMECGDHDLSQILNQRANMPLDVDFIRYYSREMLKCVKVVHDAGIVHSDLKPANFVL 584
           +Y V E    DL ++L  R   PL+  F++Y+  ++L+ +K VH  G++H DLKP+N ++
Sbjct: 96  IYFVTELQGTDLHRLLQTR---PLEKQFVQYFLYQILRGLKYVHSVGVIHRDLKPSNILI 152

Query: 585 VKGI-LKIIDFGIANAVPDHTVNIYRDTQIGTPNYMAPEALVALNEVSNVEKKNRWRVGK 643
            +   LKI DFG+A  + D  +  Y    + T  Y APE ++   +  +VE         
Sbjct: 153 NENCDLKICDFGLAR-IQDPQMTGY----VSTRYYRAPEIMLTWQKY-DVE--------- 197

Query: 644 PSDIWSCGCIMYQMFYGRPPYGAFQNQNRLLAIMN-----PE--VKIVFSEKTSK----- 691
             DIWS GCI  +M  G+P +    + ++   I +     PE  +  + SE T K     
Sbjct: 198 -VDIWSAGCIFAEMIEGKPLFPGKDHVHQFSIITDLLGSPPEDVINTICSENTLKFVTSL 256

Query: 692 --------NER---VPKSALDTMKACLIRSPEKRWTADEILDASFLNP 728
                   +ER   V   A+D +   L+  P+KR TA E L   +L P
Sbjct: 257 PHRDPIPFSERFKTVEPDAVDLLGKMLVFDPKKRVTAAEALAHPYLAP 304

>Ecym_4266 Chr4 complement(564935..566329) [1395 bp, 464 aa] {ON}
           similar to Ashbya gossypii AGR048C
          Length = 464

 Score = 87.0 bits (214), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 69/228 (30%), Positives = 111/228 (48%), Gaps = 43/228 (18%)

Query: 525 LYLVMECGDHDLSQILNQRANMPLDVDFIRYYSREMLKCVKVVHDAGIVHSDLKPANFVL 584
           +Y V E    DL ++L  R   PL+  F++Y+  ++L+ +K VH AG++H DLKP+N ++
Sbjct: 96  IYFVTELQGTDLHRLLQTR---PLEKQFLQYFLYQILRGLKYVHSAGVIHRDLKPSNILI 152

Query: 585 VKGI-LKIIDFGIANAVPDHTVNIYRDTQIGTPNYMAPEALVALNEVSNVEKKNRWRVGK 643
            +   LKI DFG+A  + D  +  Y    + T  Y APE ++   +  NVE         
Sbjct: 153 NENCDLKICDFGLAR-IQDPQMTGY----VSTRYYRAPEIMLTWQKY-NVE--------- 197

Query: 644 PSDIWSCGCIMYQMFYGRPPYGAFQNQNRLLAIMN-----PE--VKIVFSEKTSK----- 691
             DIWS GCI  +M  G+P +    + ++   I +     P+  +  + SE T K     
Sbjct: 198 -VDIWSAGCIFAEMIEGKPLFPGKDHVHQFSIITDLLGSPPKDVIDTICSENTLKFVTSL 256

Query: 692 --NERVP---------KSALDTMKACLIRSPEKRWTADEILDASFLNP 728
              + VP           A+D ++  L+  P+KR TA + L   +L P
Sbjct: 257 PHRDPVPFTERFKNLKPDAVDLLEKMLVFDPKKRITAADALAHPYLAP 304

>KLLA0C04191g Chr3 (384198..386591) [2394 bp, 797 aa] {ON} weakly
           similar to uniprot|P27636 Saccharomyces cerevisiae
           YAR019C CDC15 Protein kinase of the Mitotic Exit Network
           that is localized to the spindle pole bodies at late
           anaphase promotes mitotic exit by directly switching on
           the kinase activity of Dbf2p
          Length = 797

 Score = 88.2 bits (217), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 74/285 (25%), Positives = 123/285 (43%), Gaps = 43/285 (15%)

Query: 452 YERIELLGRGGSSKVYKVKNTNNNRVYALKRVVFDEFDDTSVDAFKGXXXXXXXXXXXXX 511
           Y   +++GRG    VY+      N+  A+K++ F++  + +    +              
Sbjct: 10  YALKQVIGRGAYGVVYRAVKRGTNKPCAIKQIEFEDESELNEHMLEIDLLKNLRHQNIVE 69

Query: 512 XXXXIQYQMDNGVLYLVME-CGDHDLSQILNQRANMPLDVDFIRYYSREMLKCVKVVHDA 570
               IQ   +   LY+++E C    L  IL      PL  D    Y  + L  ++ +H+ 
Sbjct: 70  YRGFIQKAHE---LYIILEYCARGSLRDILKHG---PLLEDDTVNYVTQTLYGLQYLHEQ 123

Query: 571 GIVHSDLKPANFVLVK-GILKIIDFGIANAVPDHTVNIYRDTQIGTPNYMAPEALVALNE 629
           G++H D+K AN +L + GI+K+ DFG++       +N    T  G+PN+MAPE +     
Sbjct: 124 GVIHRDIKAANLLLTEEGIVKLADFGVST-----RINRMAMTYAGSPNWMAPEVMTG-QG 177

Query: 630 VSNVEKKNRWRVGKPSDIWSCGCIMYQMFYGRPPYGAFQNQNRLLAIMNPEVKIVFSEKT 689
            S V           SDIWS G  + ++  G PP+    N++   AI+N           
Sbjct: 178 ASTV-----------SDIWSLGATVVELLTGNPPFHNLVNESACYAIVN----------- 215

Query: 690 SKNERVPKSAL-----DTMKACLIRSPEKRWTADEILDASFLNPV 729
              E +P   L     D +  C  ++  KR TA E+L   +L  +
Sbjct: 216 --EEYIPPLTLSAECKDFLSRCFQKNMFKRATAQELLAHIWLKKI 258

>Sklu_YGOB_Anc_2.496 Chr5 (185447..187306) [1860 bp, 619 aa] {ON}
           ANNOTATED BY YGOB -
          Length = 619

 Score = 87.8 bits (216), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 77/286 (26%), Positives = 125/286 (43%), Gaps = 43/286 (15%)

Query: 452 YERIELLGRGGSSKVYKVKNTNNNRVYALKRVVFD-----EFDDTSVDAFKGXXXXXXXX 506
           Y  +  +G+G S  VY       N   A+K++  +     E     +   KG        
Sbjct: 329 YRNLIKIGQGASGGVYTAYELGTNASVAIKQMNLEKQPKKELIINEILVMKGSKHSNIVN 388

Query: 507 XXXXXXXXXIQYQMDNGVLYLVMECGDHDLSQILNQRANMPLDVDFIRYYSREMLKCVKV 566
                    I   +  G L++VME    +   + +   +  L    I    RE LK ++ 
Sbjct: 389 F--------IDSYLLKGDLWVVMEY--MEGGSLTDVVTHCILTEGQIGAVCRETLKGLQF 438

Query: 567 VHDAGIVHSDLKPANFVL-VKGILKIIDFGIANAVPDHTVNIYRDTQIGTPNYMAPEALV 625
           +H  G++H D+K  N +L + G +K+ DFG    +  + VN+ R T +GTP +MAPE + 
Sbjct: 439 LHSKGVIHRDIKSDNILLSMNGDIKLTDFGFCAQI--NEVNLKRTTMVGTPYWMAPEVV- 495

Query: 626 ALNEVSNVEKKNRWRVGKPSDIWSCGCIMYQMFYGRPPYGAFQNQNRLLAIMNPEVKIVF 685
                      +R   G   DIWS G ++ +M  G PPY    N+  L A+      ++ 
Sbjct: 496 -----------SRKEYGPKVDIWSLGIMIIEMIEGEPPY---LNETPLRALY-----LIA 536

Query: 686 SEKTSKNERVPKSALDTMKA----CLIRSPEKRWTADEILDASFLN 727
           +  T K  + P++  DT+K     CL   PE R  A E+L  +F++
Sbjct: 537 TNGTPK-LKDPENLSDTLKEFLGWCLKVDPEDRANAAELLSGTFIS 581

>TDEL0F04290 Chr6 (801456..802739) [1284 bp, 427 aa] {ON} Anc_8.302
           YLR113W
          Length = 427

 Score = 86.7 bits (213), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 70/228 (30%), Positives = 111/228 (48%), Gaps = 43/228 (18%)

Query: 525 LYLVMECGDHDLSQILNQRANMPLDVDFIRYYSREMLKCVKVVHDAGIVHSDLKPANFVL 584
           +Y V E    DL ++L  R   PL+  F++Y+  ++L+ +K VH AG++H DLKP+N ++
Sbjct: 96  IYFVTELQGTDLHRLLQTR---PLEKQFVQYFLYQILRGLKYVHSAGVIHRDLKPSNILI 152

Query: 585 VKGI-LKIIDFGIANAVPDHTVNIYRDTQIGTPNYMAPEALVALNEVSNVEKKNRWRVGK 643
            +   LKI DFG+A  + D  +  Y    + T  Y APE ++   +  +VE         
Sbjct: 153 NENCDLKICDFGLAR-IQDPQMTGY----VSTRYYRAPEIMLTWQKY-DVE--------- 197

Query: 644 PSDIWSCGCIMYQMFYGRPPYGAFQNQNRLLAIMN-----PE--VKIVFSEKTSK----- 691
             DIWS GCI  +M  G+P +    + ++   I +     PE  +  + SE T K     
Sbjct: 198 -VDIWSAGCIFAEMTEGKPLFPGKDHVHQFSIITDLLGSPPEDVINTICSENTLKFVTSL 256

Query: 692 --------NER---VPKSALDTMKACLIRSPEKRWTADEILDASFLNP 728
                    ER   V   A+D ++  L+  P+KR TA + L   +L P
Sbjct: 257 PHRDPVPFRERFKTVEPEAVDLLEKMLVFDPKKRITAADALVHPYLAP 304

>NCAS0D02100 Chr4 (385878..388058) [2181 bp, 726 aa] {ON} Anc_6.31
          Length = 726

 Score = 87.8 bits (216), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 75/324 (23%), Positives = 140/324 (43%), Gaps = 50/324 (15%)

Query: 439 KSSKSIVSVNDIEYERIELLGRGGSSKVYKVKNTNNNRVYALKRVVFDEFDDTSVDAFKG 498
           K+  S++     +Y R   LG GG ++ +++K+  + +++A K V               
Sbjct: 79  KTPPSLIKTRGRDYRRGHFLGEGGFARCFQIKD-ESGKIFAAKTVAKISIKTEKTKKKLL 137

Query: 499 XXXXXXXXXXXXXXXXXIQYQMDNGVLYLVME-CGDHDLSQILNQRANMPLDVDFIRYYS 557
                            +    D+  +Y+++E C +  L  ++ +R    L    +R+++
Sbjct: 138 SEIQIHKSMKHPNIVHFVDCFEDDTNVYILLEICSNGSLMDLMKKRKT--LTEPEVRFFT 195

Query: 558 REMLKCVKVVHDAGIVHSDLKPANFVLVKGI-LKIIDFGIANAVPDHTVNIYRDTQIGTP 616
            ++   VK +H   ++H DLK  N    K   LK+ DFG+A  + ++    Y  T  GTP
Sbjct: 196 TQICGAVKYMHSRRVIHRDLKLGNIFFDKDYNLKVGDFGLAAVLANNRERKY--TVCGTP 253

Query: 617 NYMAPEALVALNEVSNVEKKNRWRVGKPSDIWSCGCIMYQMFYGRPPYGAFQNQNRLLAI 676
           NY+APE L+  +   + E           DIWS G ++Y +  G+PP+ A          
Sbjct: 254 NYIAPEVLMGKHAGHSFE----------VDIWSIGVMIYALLVGKPPFQA---------- 293

Query: 677 MNPEVKIVFSEKTSKNERVPKSALDTMKACLIRSPEKRWTADE----ILDASFLNPVLVT 732
              +V +++               D +KAC    P+ ++ + E    I D   ++PV   
Sbjct: 294 --KDVNVIY---------------DRIKACQYGYPKDKYVSSEAKTLIADILCVDPV-ER 335

Query: 733 PYIVRDLIRNAVYYGSDQGQVSED 756
           P I R++I +  + G    +++ED
Sbjct: 336 PSI-REIIDDVWFRGIFPPKITED 358

>TPHA0E03640 Chr5 complement(769962..773375) [3414 bp, 1137 aa] {ON}
           Anc_1.52 YDR507C
          Length = 1137

 Score = 88.2 bits (217), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 70/231 (30%), Positives = 111/231 (48%), Gaps = 30/231 (12%)

Query: 522 NGVLYLVMECGDH-DLSQILNQRANMPL-DVDFIRYYSREMLKCVKVVHDAGIVHSDLKP 579
           N  LY+V+E  +  +L  +L ++   PL + + +R++ R+++  +   H  GIVH DLKP
Sbjct: 115 NNNLYMVLEYAEKGELFNLLVEKG--PLAENEAVRFF-RQIIIGMSYCHALGIVHRDLKP 171

Query: 580 ANFVL-VKGILKIIDFGIANAVPDHTVNIYRDTQIGTPNYMAPEALVALNEVSNVEKKNR 638
            N +L  K  +KI DFG+A      T +   +T  G+P+Y APE +  L           
Sbjct: 172 ENILLDHKSNIKIADFGMAAL---ETEDKLLETSCGSPHYAAPEIVSGLP---------- 218

Query: 639 WRVGKPSDIWSCGCIMYQMFYGRPPYGAFQN--QNRLLAIMNPEVKIVFSEKTSKNERVP 696
              G  +DIWSCG I++ +  GR P+       +N LL +   E ++  S++ S      
Sbjct: 219 -YNGLETDIWSCGVILFALLTGRLPFDEEDGNIRNLLLKVQKGEFEMPGSDELS------ 271

Query: 697 KSALDTMKACLIRSPEKRWTADEILDASFLN--PVLVTPYIVRDLIRNAVY 745
             A D +   L  +P++R    EIL    L   P +     +RDL R   Y
Sbjct: 272 LEAQDLIGKILTVNPKQRIKTREILKHPLLQKYPNIKDSKTIRDLPREDTY 322

>ACL191C Chr3 complement(26475..27572) [1098 bp, 365 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YGR040W
           (KSS1)
          Length = 365

 Score = 85.5 bits (210), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 53/168 (31%), Positives = 88/168 (52%), Gaps = 23/168 (13%)

Query: 518 YQMDNGVLYLVMECGDHDLSQILNQRANMPLDVDFIRYYSREMLKCVKVVHDAGIVHSDL 577
           YQ D   +YLV E  + DL +I++Q  N  L  D I+Y++ ++L+ +K +H A ++H DL
Sbjct: 84  YQ-DFEAVYLVQELMETDLQRIISQ-PNSFLSDDHIQYFTYQILRALKSLHSAQVIHRDL 141

Query: 578 KPANFVLVKGI-LKIIDFGIANAVPDHTVNIYRDTQIG-------TPNYMAPEALVALNE 629
           KP+N +L     LK+ DFG++  +     +  R+  +G       T  Y APE +++  E
Sbjct: 142 KPSNLLLNSSCDLKLCDFGLSRCLASSDRS--RENMVGFMTEYVATRWYRAPEIMLSFQE 199

Query: 630 VSNVEKKNRWRVGKPSDIWSCGCIMYQMFYGRPPYGAFQNQNRLLAIM 677
            +              DIWSCGCI+ +M  G+P +      ++L  I+
Sbjct: 200 YTTA-----------MDIWSCGCILAEMISGKPLFPGRDYHHQLWIIL 236

>ZYRO0F08074g Chr6 (654009..654025,654107..655004) [915 bp, 304 aa]
           {ON} highly similar to uniprot|P17157 Saccharomyces
           cerevisiae YPL031C PHO85 Cyclin-dependent kinase with
           ten cyclin partners involved in environmental stress
           response in phosphate-rich conditions Pho85p-Pho80p
           complex phosphorylates Pho4p which in turn represses
           PHO5
          Length = 304

 Score = 84.3 bits (207), Expect = 5e-17,   Method: Compositional matrix adjust.
 Identities = 67/250 (26%), Positives = 117/250 (46%), Gaps = 32/250 (12%)

Query: 451 EYERIELLGRGGSSKVYKVKNTNNNRVYALKRVVFDEFDDTSVDAFKGXXXXXXXXXXXX 510
           +++++E LG G  + VYK  N       ALK V  D  + T   A +             
Sbjct: 6   QFKQLEKLGNGTYATVYKGLNKTTGVYVALKEVKLDSEEGTPSTAIREISLMKELKHDNV 65

Query: 511 XXXXXIQYQMDNGVLYLVMECGDHDLSQILNQR--ANMP--LDVDFIRYYSREMLKCVKV 566
                + +  +   L LV E  D+DL + ++ R   N P  L+++ ++Y+  ++++    
Sbjct: 66  VRLYDVIHTENK--LTLVFEYMDNDLKKYMDSRTVGNNPQGLELNLVKYFQWQLMEGAAF 123

Query: 567 VHDAGIVHSDLKPANFVLV-KGILKIIDFGIANA--VPDHTVNIYRDTQIGTPNYMAPEA 623
            H+  I+H DLKP N ++  KG LK+ DFG+A A  +P +T +    +++ T  Y AP+ 
Sbjct: 124 CHENKILHRDLKPQNLLINNKGQLKLGDFGLARAFGIPVNTFS----SEVVTLWYRAPDV 179

Query: 624 LVALNEVSNVEKKNRWRVGKPSDIWSCGCIMYQMFYGRPPYGAFQNQNRLLAIMNPEVKI 683
           L+     S              D+WSCGCI+ +M  G+P +    ++ +L        K+
Sbjct: 180 LMGSRTYST-----------SIDMWSCGCILAEMVTGKPLFPGTNDEEQL--------KL 220

Query: 684 VFSEKTSKNE 693
           +F    + NE
Sbjct: 221 IFDIMGTPNE 230

>TBLA0I00280 Chr9 (42870..46820) [3951 bp, 1316 aa] {ON} Anc_2.496
            YHL007C
          Length = 1316

 Score = 88.2 bits (217), Expect = 5e-17,   Method: Compositional matrix adjust.
 Identities = 75/286 (26%), Positives = 123/286 (43%), Gaps = 39/286 (13%)

Query: 452  YERIELLGRGGSSKVYKVKNTNNNRVYALKRVVFDEFDDTSVDAFKGXXXXXXXXXXXXX 511
            Y  +  +G+G S  VY       N   A+K++  ++   T +                  
Sbjct: 1027 YRNLVKIGQGASGGVYTAYEVGTNASVAVKQMNLEKQPKTELII---NEIIVMKESKHKN 1083

Query: 512  XXXXIQYQMDNGVLYLVMECGDH-DLSQILNQRANMPLDVDFIRYYSREMLKCVKVVHDA 570
                I   +  G L++VME  +   L+ ++       L    I    RE L  +K +H  
Sbjct: 1084 IVNFIDSYLLKGDLWVVMEYMEGGSLTDVVTHCI---LTEGQIGAVCRETLNGLKFLHSK 1140

Query: 571  GIVHSDLKPANFVL-VKGILKIIDFGIANAVPDHTVNIYRDTQIGTPNYMAPEALVALNE 629
            G++H D+K  N +L ++G +K+ DFG    +  + V++ R T +GTP +MAPE +     
Sbjct: 1141 GVIHRDIKSDNILLSMQGDIKLTDFGFCAQI--NEVHLKRTTMVGTPYWMAPEVV----- 1193

Query: 630  VSNVEKKNRWRVGKPSDIWSCGCIMYQMFYGRPPYGAFQNQNRLLAIM------NPEVKI 683
                   +R   G   DIWS G ++ +M  G PPY    N+  L A+        PE+K 
Sbjct: 1194 -------SRKEYGPKVDIWSLGIMIIEMIEGEPPY---LNETPLRALYLIATNGTPELK- 1242

Query: 684  VFSEKTSKNERVPKSALDTMKACLIRSPEKRWTADEILDASFLNPV 729
                   + E++     + + ACL   PE R TA E+L+   +  V
Sbjct: 1243 -------EPEKLSSILHNFLDACLKVDPEVRATATELLETELITEV 1281

>Ecym_3586 Chr3 complement(1112070..1115303) [3234 bp, 1077 aa] {ON}
           similar to Ashbya gossypii AFR335C
          Length = 1077

 Score = 87.8 bits (216), Expect = 5e-17,   Method: Compositional matrix adjust.
 Identities = 58/208 (27%), Positives = 98/208 (47%), Gaps = 30/208 (14%)

Query: 521 DNGVLYLVME-CGDHDLSQILNQRANMPLDVDFIRYYSREMLKCVKVVHDAGIVHSDLKP 579
           D   LY ++E   + D   I+ +  +  L+ +  RYY  ++L  +  +H  GI+H D+KP
Sbjct: 274 DEANLYFLLEYAPNGDFLSIMKKYGS--LNEECARYYGAQILNGIYFLHRHGIIHRDIKP 331

Query: 580 ANFVLVKGI-LKIIDFGIA------NAVPDHTVNIYRDTQIGTPNYMAPEALVALNEVSN 632
            N +L K + +K+ DFG A      +   ++ +     + +GT  Y++PE L        
Sbjct: 332 ENILLDKSMKVKLTDFGTAKLLNRKDGTEEYDLTTRSKSFVGTAEYVSPELL-------- 383

Query: 633 VEKKNRWRVGKPSDIWSCGCIMYQMFYGRPPYGAFQNQNRLLAIMNPEVKIVFSEKTSKN 692
               + W V    DIW+ GCI++QM  G+PP+ A         +M  +V+  F+      
Sbjct: 384 ---NDSW-VDHKCDIWAFGCILFQMIAGKPPFKATNEYLTFQKVM--KVQYAFTAG---- 433

Query: 693 ERVPKSALDTMKACLIRSPEKRWTADEI 720
              P    D +K  L++ PE R T  +I
Sbjct: 434 --FPMVVRDLVKQILVKKPEHRLTIPQI 459

>ZYRO0A03894g Chr1 (307915..309273) [1359 bp, 452 aa] {ON} similar
           to uniprot|P38070 Saccharomyces cerevisiae YBR028C
           Hypothetical ORF
          Length = 452

 Score = 86.3 bits (212), Expect = 5e-17,   Method: Compositional matrix adjust.
 Identities = 82/289 (28%), Positives = 128/289 (44%), Gaps = 45/289 (15%)

Query: 451 EYERIELLGRGGSSKVYKVKNTNNNRVYALKR-------VVFDEFDDTSVDAFKGXXXXX 503
           +++ + +LG+G   KV  VK+   +++YA+K+       +  DE  D S    +      
Sbjct: 78  DFKPVRVLGKGAYGKVVLVKDERTSKLYAMKQLQKAEIIIENDESQDVSKRVERIFAERT 137

Query: 504 XXXXXXXXXXXXIQYQM-DNGVLYLVME-CGDHDLSQILNQRANMPLDVDFIRYYSREML 561
                       + Y   DN  LYL+++     +L   L +R    LD D   +Y+ E+ 
Sbjct: 138 ILSQLDHPNVVKLFYTFHDNSRLYLLLQYIPGGELFYHLKERGT--LDEDTAAFYAAEIS 195

Query: 562 KCVKVVHDAGIVHSDLKPANFVL-VKGILKIIDFGIANAVPD--HTVNIYRDTQ-----I 613
             +K +H+ GIV+ DLKP N +L   G L + DFG++    D  ++++   D       I
Sbjct: 196 CALKFLHEKGIVYRDLKPENCLLDADGHLVLTDFGLSKKSVDDNNSLSAPEDVSVLHSII 255

Query: 614 GTPNYMAPEALVALNEVSNVEKKNRWRVGKPSDIWSCGCIMYQMFYGRPPYGAFQNQNRL 673
           GTP Y APE L       N             D +S GC++Y M  G+PPY    ++   
Sbjct: 256 GTPEYCAPEILKGEPYTRNC------------DWYSLGCLVYDMLVGKPPYTGVNHK--- 300

Query: 674 LAIMNPEVKIVFSEKTSKNERVPKSALDTMK----ACLIRSPEKRWTAD 718
             I+N   KI   +K  +  R+P    D MK    A L +   KRW  D
Sbjct: 301 -VILN---KI---QKEKQGPRLPYYLSDGMKDWLGALLKKDCNKRWDVD 342

>KLLA0F11143g Chr6 complement(1026129..1028570) [2442 bp, 813 aa]
           {ON} similar to uniprot|P22216 Saccharomyces cerevisiae
           YPL153C RAD53 Protein kinase required for cell-cycle
           arrest in response to DNA damage activated by trans
           autophosphorylation when interacting with
           hyperphosphorylated Rad9p
          Length = 813

 Score = 87.4 bits (215), Expect = 6e-17,   Method: Compositional matrix adjust.
 Identities = 83/327 (25%), Positives = 144/327 (44%), Gaps = 38/327 (11%)

Query: 423 VKKVEIVEPPTSMTNRKSSKSIVSVNDIEYERIE--------LLGRGGSSKVYKVKNTNN 474
           +K++ +++  TS  +   SK  +S+   E + I         ++G+G  + V K    + 
Sbjct: 155 LKELNMMKDVTSPASSSKSKYQISMGHTELKGIHKYYSISDSIVGQGAFATVKKAVERST 214

Query: 475 NRVYALK----RVVFDEFDDT--SVDAFKGXXXXXXXXXXXXXXXXXIQYQMDNGVLYLV 528
            + +A+K    R V D+FD     +D  +                    +  DN   Y++
Sbjct: 215 GKTFAVKIIHKRKVMDKFDGVKRELDVLQKLNHPRIVKLK--------DFFEDNDNYYML 266

Query: 529 ME-CGDHDLSQILNQRANMPLDVDFIRYYSREMLKCVKVVHDAGIVHSDLKPANFVLVKG 587
           ME     DL   +     +  D    R  +R++L+ VK +HD GI H DLKP N ++ + 
Sbjct: 267 MEFVSGGDLMDFVAAHGTVGEDAG--REITRQVLEAVKYMHDQGISHRDLKPDNIMIEQD 324

Query: 588 ---ILKIIDFGIANAVPDHTVNIYRDTQIGTPNYMAPEALVALNEVSNVEKKNRWRVGKP 644
              ++KI DFG+A        N + +T  GT  Y+APE +   N     +K NR      
Sbjct: 325 DPVLIKITDFGLAKV---QNQNTFLNTFCGTLAYVAPEVIDGKNA---EDKTNRDLYSSL 378

Query: 645 SDIWSCGCIMYQMFYGRPPYGAFQNQNRLLAIMNPEVKIVFSEKTSKNERVPKSALDTMK 704
            D+WS GC++Y +  G  P+   Q+QN L   +    +  + E   K+ R+ + A + + 
Sbjct: 379 VDMWSIGCLVYVILTGHLPFSG-QSQNELFKQIK---RGSYHEGPLKDYRISEEARNFID 434

Query: 705 ACLIRSPEKRWTADEILDASFLNPVLV 731
             L   P++R  A + L   ++    V
Sbjct: 435 CLLNVDPKERMNAGKALQHPWMKMAYV 461

>KLLA0F14190g Chr6 (1311121..1315137) [4017 bp, 1338 aa] {ON}
            uniprot|O60030 Kluyveromyces lactis BCK1 MAP kinase
            kinase kinase
          Length = 1338

 Score = 87.8 bits (216), Expect = 6e-17,   Method: Compositional matrix adjust.
 Identities = 84/314 (26%), Positives = 134/314 (42%), Gaps = 32/314 (10%)

Query: 423  VKKVEIVEPPTSMTNRKSSKSIVSVNDIEYERIELLGRGGSSKVYKVKNTNNNRVYALKR 482
             K VEI +  T   N KS  S     +  + + E++G+G    VY   N     + A+K+
Sbjct: 1010 TKVVEITDKRTISIN-KSRNSRGEYKEFAWIKGEIIGKGSFGAVYLALNVTTGEMLAVKQ 1068

Query: 483  VVFDEFD--DTSVDAFKGXXXXXXXXXXXXXXXXXIQY---QMDNGVLYLVME--CGDHD 535
            V   EF   D S  +                    +QY   +  NG+  L +E   G   
Sbjct: 1069 VTVPEFSSQDESAISMVEALKSEVSTLKDLNHVNIVQYLGFEEKNGIYSLFLEYVAGGSV 1128

Query: 536  LSQILNQRANMPLDVDFIRYYSREMLKCVKVVHDAGIVHSDLKPANFVLVK-GILKIIDF 594
             S I   R     D   IR+ ++++L+ +  +H  GI+H D+K  N +L   G+ KI DF
Sbjct: 1129 GSLI---RMYGRFDDQLIRHLTKQVLEGLAYLHSKGILHRDMKADNLLLDNDGVCKISDF 1185

Query: 595  GIANAVPDHTVNIYRDTQI---GTPNYMAPEALVALNEVSNVEKKNRWRVGKPSDIWSCG 651
            GI+      + NIY ++ +   GT  +MAPE +   +  S        +V    DIWS G
Sbjct: 1186 GISR----KSNNIYSNSDMTMRGTVFWMAPEMVDTAHGYSA-------KV----DIWSLG 1230

Query: 652  CIMYQMFYGRPPYGAFQNQNRLLAIMNPEVKIVFSEKTSKNERVPKSALDTMKACLIRSP 711
            C++ +MF G+ P+  F+    +  I   +      + T   + V  +    +  C    P
Sbjct: 1231 CVVLEMFAGKRPWSNFEVVAAMFQIGKSKTAPPIPDDT--KDLVSPAGQSFLDQCFEIDP 1288

Query: 712  EKRWTADEILDASF 725
            E R TAD ++   F
Sbjct: 1289 EMRPTADSLVGHPF 1302

>TPHA0M01840 Chr13 complement(380953..385818) [4866 bp, 1621 aa] {ON}
            Anc_6.341 YNR031C
          Length = 1621

 Score = 87.8 bits (216), Expect = 6e-17,   Method: Compositional matrix adjust.
 Identities = 83/332 (25%), Positives = 140/332 (42%), Gaps = 54/332 (16%)

Query: 450  IEYERIELLGRGGSSKVYKVKNTNNNRVYALKRVVFDEFDDTSVDAFKGXXXXXXXXXXX 509
            I++++ + +G G    V+   N  N  + A+K +     D  ++                
Sbjct: 1305 IKWQKRQFVGSGTFGTVFSAVNLGNGEILAVKEIKIQ--DAKAMKKVFPLIKDEMSVLEM 1362

Query: 510  XXXXXXIQY---QMDNGVLYLVME-CGDHDLSQILNQRANMPLDVDFIRYYSREMLKCVK 565
                  +QY   ++    + L ME C    L+ +L        D    + YS E+L+ + 
Sbjct: 1363 LNHPNIVQYYGIEVHRDKVNLFMEFCEGGSLAGLLEH--GRIEDEMVTQMYSLELLEGLV 1420

Query: 566  VVHDAGIVHSDLKPANFVL-VKGILKIIDFGIA--------------NAVPDHTVNIYRD 610
             +H +GIVH D+KP N +L   GI+K +DFG A              +++ D+   I   
Sbjct: 1421 YLHQSGIVHRDIKPENILLDFNGIIKFVDFGAARKIAENNTKVEGQNDSISDNEGTIEDA 1480

Query: 611  TQ-------IGTPNYMAPEALVALNEVSNVEKKNRWRVGKPSDIWSCGCIMYQMFYGRPP 663
            T        +GTP YMAPE +      S V+ +         D+WS GC++ +M  G+ P
Sbjct: 1481 TSSKGVHNIVGTPMYMAPETITG----SAVKGQ-----FGADDVWSLGCVILEMITGKRP 1531

Query: 664  YGAFQNQNRLLAIMNPEVKIVFSEKTSKNERVPKSALDTMKACLIRSPEKRWTADEILDA 723
            +    N+    AIM            +KNE + K+    +K  +++ P+KR TA E+   
Sbjct: 1532 WAHLDNE---WAIMYHVAAGHIPPFPNKNE-LSKAGFTFLKRAIVQKPDKRATAVEL--- 1584

Query: 724  SFLNPVLVTPYIVRDLIRNAVYYGSDQGQVSE 755
                  L  P+IV   IR   +  +D  Q ++
Sbjct: 1585 ------LTHPWIVE--IRELAFGSADSEQSAD 1608

>TDEL0C06780 Chr3 complement(1236767..1238173) [1407 bp, 468 aa]
           {ON} Anc_1.24 YDR523C
          Length = 468

 Score = 86.3 bits (212), Expect = 6e-17,   Method: Compositional matrix adjust.
 Identities = 69/277 (24%), Positives = 127/277 (45%), Gaps = 24/277 (8%)

Query: 452 YERIELLGRGGSSKVYKVKNTNNNRVYALKRVVFDEFDDTSVDAFKGXXXXXXXXXXXXX 511
           Y   + +GRG    VYK     + +V A+K VV  E  D  ++                 
Sbjct: 17  YSIKQCVGRGNFGDVYKACEKVSGKVVAVK-VVNLEHTDEDINLL-AQEIFFLAELKSPY 74

Query: 512 XXXXIQYQMDNGVLYLVME-CGDHDLSQILNQRANMPLDVDFIRYYSREMLKCVKVVHDA 570
               I    ++  ++++ME CG    + +L    N  L      Y +RE+LK ++ +H+ 
Sbjct: 75  ITNYITTMTEDVSMWIIMEYCGGGSCADLLRNIYNCGLPESKSAYITREVLKGLEYLHEQ 134

Query: 571 GIVHSDLKPANFVLV-KGILKIIDFGIANAVPDHTVNIYRDTQIGTPNYMAPEALVALNE 629
             +H D+K AN +L  +G +K+ DFG++  +      + R T +GTP +MAPE       
Sbjct: 135 KKIHRDIKAANILLTDEGKVKLGDFGVSGQI---RATLKRGTFVGTPFWMAPE------- 184

Query: 630 VSNVEKKNRWRVGKPSDIWSCGCIMYQMFYGRPPYGAFQNQNRLLAIMNPEVKIVFSEKT 689
              V  K+     + +DIWS G  +Y++  G PP         ++ +   +  ++    +
Sbjct: 185 ---VVSKDSDGYDEKADIWSLGITVYELLKGSPPLYKCDPMKVMVNLPKRKPPVLHGHYS 241

Query: 690 SKNERVPKSALDTMKACLIRSPEKRWTADEILDASFL 726
           S       +A   + +CL+++P+ R +A E+L++ F+
Sbjct: 242 S-------AAKHFVASCLVKNPKNRPSAVELLNSEFV 271

>NDAI0C02680 Chr3 complement(621951..624203) [2253 bp, 750 aa] {ON}
           Anc_6.31
          Length = 750

 Score = 87.0 bits (214), Expect = 6e-17,   Method: Compositional matrix adjust.
 Identities = 79/324 (24%), Positives = 139/324 (42%), Gaps = 50/324 (15%)

Query: 439 KSSKSIVSVNDIEYERIELLGRGGSSKVYKVKNTNNNRVYALKRVVFDEFDDTSVDAFKG 498
           K+  S++     +Y R   LG GG ++ +++K+  + +++A K V               
Sbjct: 82  KTPPSLIKTRGRDYRREHFLGEGGFARCFQIKD-ESGKIFAAKTVAKISIKSEKTKRKLL 140

Query: 499 XXXXXXXXXXXXXXXXXIQYQMDNGVLYLVME-CGDHDLSQILNQRANMPLDVDFIRYYS 557
                            I    D+  +Y+++E C +  L  +L +R +  L    +R+++
Sbjct: 141 SEIQIHKSMKHSNIVQFIDCFEDDANVYILLEICPNGSLMDLLKKRKS--LTEPEVRFFT 198

Query: 558 REMLKCVKVVHDAGIVHSDLKPANFVLVKGI-LKIIDFGIANAVPDHTVNIYRDTQIGTP 616
            ++   +K +H   I+H DLK  N    K   LK+ DFG+A  + +     Y  T  GTP
Sbjct: 199 TQICGAIKYLHSRRIIHRDLKLGNIFFDKDYNLKVGDFGLAAVLANDRERKY--TVCGTP 256

Query: 617 NYMAPEALVALNEVSNVEKKNRWRVGKPSDIWSCGCIMYQMFYGRPPYGAFQNQNRLLAI 676
           NY+APE L+  +   + E           DIWS G ++Y +  G+PP+ A          
Sbjct: 257 NYIAPEVLMGKHSGHSFE----------VDIWSIGVMIYALLVGKPPFQA---------- 296

Query: 677 MNPEVKIVFSEKTSKNERVPKSALDTMKACLIRSPEKRWTADE----ILDASFLNPVLVT 732
              +V +++       ER+        K C    P+ ++ + E    I D   LNP L  
Sbjct: 297 --KDVNVIY-------ERI--------KLCKYGYPKDKYVSKEAEILIHDILSLNP-LQR 338

Query: 733 PYIVRDLIRNAVYYGSDQGQVSED 756
           P I+ D+I +  + G    ++S D
Sbjct: 339 PTII-DIIDDVWFRGVFPARISPD 361

>AFR205C Chr6 complement(805580..806953) [1374 bp, 457 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YKL139W
           (CTK1)
          Length = 457

 Score = 85.9 bits (211), Expect = 6e-17,   Method: Compositional matrix adjust.
 Identities = 67/260 (25%), Positives = 122/260 (46%), Gaps = 33/260 (12%)

Query: 413 FQDNKEGQKIVKKVE------IVEPPTSMTNRKSSKSIVS-VNDIE--YERIELLGRGGS 463
           FQ ++   K  ++V       +  PP    + +   +I++  + +E  Y+RI  +G G  
Sbjct: 74  FQPHRALPKAPRQVSRYNNGNLPAPPAGPASLRVPATIITHTHSVESSYQRITQVGEGTY 133

Query: 464 SKVYKVKNTNNNRVYALKRVVFD-EFDDTSVDAFKGXXXXXXXXXXXXXXXXXIQYQMDN 522
            KVYK +N   N++ ALK++  + E D   + + +                  I  +   
Sbjct: 134 GKVYKCRNIYTNKLVALKKLRLETERDGFPITSIREIKLLQHCQHENVSTIAEIMCEAQK 193

Query: 523 GVLYLVMECGDHDLSQILNQRANMPLDVDFIRYYSREMLKCVKVVHDAGIVHSDLKPANF 582
            V Y++ E  D+DLS +L  +     D +  ++  R++LK ++ +H+  I+H D+K +N 
Sbjct: 194 TV-YMIFEYADNDLSGLLMNKEIHFSDAN-CKHLFRQLLKGMEYLHECRILHRDIKGSNI 251

Query: 583 VLV-KGILKIIDFGIANAV---PDHTVNIYRDTQIGTPNYMAPEALVALNEVSNVEKKNR 638
           ++  +G LKI DFG+A  +   PD+T       ++ T  Y  PE L+             
Sbjct: 252 LIDNRGNLKITDFGLARKMKQEPDYT------NRVITLWYRPPELLLGTT---------- 295

Query: 639 WRVGKPSDIWSCGCIMYQMF 658
            R G   D+W CGC++ ++F
Sbjct: 296 -RYGTEVDMWGCGCLLVELF 314

>Skud_4.797 Chr4 complement(1405618..1407075) [1458 bp, 485 aa] {ON}
           YDR523C (REAL)
          Length = 485

 Score = 86.3 bits (212), Expect = 7e-17,   Method: Compositional matrix adjust.
 Identities = 72/280 (25%), Positives = 126/280 (45%), Gaps = 30/280 (10%)

Query: 458 LGRGGSSKVYKVKNTNNNRVYALKRVVFDEFDDTSVDAFKGXXXXXXXXXXXXXXXXXIQ 517
           +GRG    VYK  +     + A+K VV  E  D  ++                     I 
Sbjct: 19  IGRGNFGDVYKAMDRTTQEIVAIK-VVNLEHSDEDIELL-AQEIFFLAELKSPLITNYIT 76

Query: 518 YQMDNGVLYLVME-CGDHDLSQILNQRANMPLDVDFIRYYSREMLKCVKVVHDAGIVHSD 576
             +++  +++VME CG    S +L +     L  + + +   ++   +K +H+   +H D
Sbjct: 77  TMLEDVSMWIVMEYCGGGSCSDLLKRNYVNGLPEEKVSFIIHQVTLGLKYLHEQRKIHRD 136

Query: 577 LKPANFVL-VKGILKIIDFGIANAVPDHTVNIYRDTQIGTPNYMAPEALVALNEVSNVEK 635
           +K AN +L  +G++K+ DFG++  +      + RDT +GTP +MAPE  V   EV    +
Sbjct: 137 IKAANILLNEEGMVKLGDFGVSGHL---RSTMKRDTFVGTPYWMAPE--VVCCEVDGYNE 191

Query: 636 KNRWRVGKPSDIWSCGCIMYQMFYGRPP---YGAFQNQNRLLAIMNPEVKIVFSEKTSKN 692
           K        +DIWS G   Y++  G PP   Y   +    L     P+++  FS+     
Sbjct: 192 K--------ADIWSLGITTYELLKGLPPLSKYDPMKVMTNLPKRKPPKLQGSFSD----- 238

Query: 693 ERVPKSALDTMKACLIRSPEKRWTADEILDASFLNPVLVT 732
                +A + +  CL++ P  R +A ++L   F+  V +T
Sbjct: 239 -----AAKEFVAGCLVKVPADRPSAYDLLSFEFIKNVTIT 273

>Suva_2.666 Chr2 complement(1183839..1186133) [2295 bp, 764 aa] {ON}
           YDR490C (REAL)
          Length = 764

 Score = 87.0 bits (214), Expect = 7e-17,   Method: Compositional matrix adjust.
 Identities = 59/222 (26%), Positives = 100/222 (45%), Gaps = 35/222 (15%)

Query: 521 DNGVLYLVMECGDH-DLSQILNQRANMPLDVDFIRYYSREMLKCVKVVHDAGIVHSDLKP 579
           D   LY ++E   H D   ++ +  +  L+    RYY+ +++  V  +H  GI+H D+KP
Sbjct: 194 DEASLYFLLEYAPHGDFLALIKKYGS--LNEQCARYYASQIIDAVDSLHTIGIIHRDIKP 251

Query: 580 ANFVLVKGI-LKIIDFGIANAVPDHT-----------VNIYRDTQIGTPNYMAPEALVAL 627
            N +L K + +K+ DFG A  +P+             +N    + +GT  Y++PE L   
Sbjct: 252 ENILLDKDMKVKLTDFGTAKILPEEPSNDADGKPCFDLNARSKSFVGTAEYVSPELL--- 308

Query: 628 NEVSNVEKKNRWRVGKPSDIWSCGCIMYQMFYGRPPYGAFQNQNRLLAIMNPEVKIVFSE 687
                    N        DIW+ GCI++QM  G+PP+ A         +M  +++  F+ 
Sbjct: 309 ---------NDSYTDSRCDIWAFGCILFQMVAGKPPFKASNEYLTFQKVM--KIQYAFTA 357

Query: 688 KTSKNERVPKSALDTMKACLIRSPEKRWTADEILDASFLNPV 729
                   P+   D +K  L++ P  R T ++I    F   V
Sbjct: 358 G------FPQIIKDLVKKLLVKEPNDRLTIEQIKAHIFFQTV 393

>AFR696C Chr6 complement(1722130..1725558) [3429 bp, 1142 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDR507C
           (GIN4) and YCL024W (KCC4)
          Length = 1142

 Score = 87.4 bits (215), Expect = 7e-17,   Method: Compositional matrix adjust.
 Identities = 68/227 (29%), Positives = 109/227 (48%), Gaps = 28/227 (12%)

Query: 525 LYLVMECGDH-DLSQILNQRANMPLDVDFIRYYSREMLKCVKVVHDAGIVHSDLKPANFV 583
           LY+V+E  +  +L  +L QR  +P + + +R++ R+++  +   H  GIVH DLKP N +
Sbjct: 103 LYMVLEYVEKGELFNLLVQRGPLP-ENEAVRFF-RQIIIGISYCHALGIVHRDLKPENLL 160

Query: 584 L-VKGILKIIDFGIANAVPDHTVNIYRDTQIGTPNYMAPEALVALNEVSNVEKKNRWRVG 642
           L  K  +K+ DFG+A      + +   +T  G+P+Y APE +  L              G
Sbjct: 161 LDHKFNIKLADFGMAAL---ESKDKLLETSCGSPHYAAPEIVSGLP-----------YHG 206

Query: 643 KPSDIWSCGCIMYQMFYGRPPYGAFQN--QNRLLAIMNPEVKIVFSEKTSKNERVPKSAL 700
             SD+WSCG I+Y +  GR P+       +N LL + + + +I   ++ S   R      
Sbjct: 207 FESDVWSCGVILYALLTGRLPFDEEDGNIRNLLLKVQSGKYEIPGEDEISPEAR------ 260

Query: 701 DTMKACLIRSPEKRWTADEILDASFLN--PVLVTPYIVRDLIRNAVY 745
           D +   L   PE+R    EIL    L   P +     +R+L R   Y
Sbjct: 261 DLIVQILTVEPEQRIKTREILKHPLLQKYPSIKDSKSIRNLPREDTY 307

>ZYRO0D06182g Chr4 complement(529121..530416) [1296 bp, 431 aa] {ON}
           uniprot|O93982 Zygosaccharomyces rouxii HOG1 Mitogen-
           activated protein kinase HOG1
          Length = 431

 Score = 85.5 bits (210), Expect = 8e-17,   Method: Compositional matrix adjust.
 Identities = 69/228 (30%), Positives = 110/228 (48%), Gaps = 43/228 (18%)

Query: 525 LYLVMECGDHDLSQILNQRANMPLDVDFIRYYSREMLKCVKVVHDAGIVHSDLKPANFVL 584
           +Y V E    DL ++L  R   PL+  F++Y+  ++L+ +K VH AG++H DLKP+N ++
Sbjct: 96  IYFVTELQGTDLHRLLQTR---PLEKQFVQYFLYQILRGLKYVHSAGVIHRDLKPSNILI 152

Query: 585 VKGI-LKIIDFGIANAVPDHTVNIYRDTQIGTPNYMAPEALVALNEVSNVEKKNRWRVGK 643
            +   LKI DFG+A  + D  +  Y    + T  Y APE ++   +  +VE         
Sbjct: 153 NENCDLKICDFGLAR-IQDPQMTGY----VSTRYYRAPEIMLTWQKY-DVE--------- 197

Query: 644 PSDIWSCGCIMYQMFYGRPPYGAFQNQNRLLAIMN-----PE--VKIVFSEKTSK----- 691
             DIWS GCI  +M  G+P +    + ++   I +     P   +  + SE T K     
Sbjct: 198 -VDIWSAGCIFSEMIEGKPLFPGKDHVHQFSIITDLLGSPPRDVINTICSENTLKFVTSL 256

Query: 692 --------NER---VPKSALDTMKACLIRSPEKRWTADEILDASFLNP 728
                    ER   V   A+D ++  L+  P+KR TA + L   +L P
Sbjct: 257 PHRDPVPFQERFKTVEPDAVDLLERMLVFDPKKRITAADALVHPYLAP 304

>TBLA0B01630 Chr2 (360963..364850) [3888 bp, 1295 aa] {ON} Anc_3.177
           YAR019C
          Length = 1295

 Score = 87.4 bits (215), Expect = 8e-17,   Method: Compositional matrix adjust.
 Identities = 81/305 (26%), Positives = 138/305 (45%), Gaps = 51/305 (16%)

Query: 437 NRKSSKSIVSVNDIEYERIELLGRGGSSKVYKVKNTNNNRVYALKRVVFD---EFDD--T 491
           NR  S   V+    +Y  I ++G+G    VYK  N   N+V A+K+V +D   E +D  +
Sbjct: 66  NRTESTEFVT--KAQYGLINVIGKGSFGVVYKAVNRQTNQVIAIKQVNYDNDEELNDIMS 123

Query: 492 SVDAFKGXXXXXXXXXXXXXXXXXIQYQMDNGVLYLVME-CGDHDLSQILNQRANMPLDV 550
            ++  K                    +   +  LY+++E C    L  +++    +P + 
Sbjct: 124 EINLLKNLNHKHIVKYHG--------FMQKSDTLYILLEYCAHGSLKNLISSSKGIP-EK 174

Query: 551 DFIRYYSREMLKCVKVVHDAGIVHSDLKPANFVLVK-GILKIIDFGIANAVPDHTVNIYR 609
           D  +Y  + +   V  +H  G++H D+K AN +L K   +K+ DFG++  V + T+ +  
Sbjct: 175 DAQQYIIQTLYGLV-YLHAQGVIHRDIKAANILLDKDNTVKLADFGVSTRVGNATMAM-- 231

Query: 610 DTQIGTPNYMAPEALVALNEVSNVEKKNRWRVGKPSDIWSCGCIMYQMFYGRPPYGAFQN 669
            T  G+ N+MAPE L            N+      SDIWS G  + ++  G PP+    +
Sbjct: 232 -TLAGSLNWMAPEIL-----------GNK-GASTLSDIWSLGATVVELITGNPPFHNLVD 278

Query: 670 QNRLLAIMN-----PEVKIVFSEKTSKNERVPKSALDTMKACLIRSPEKRWTADEILDAS 724
            N   AI N     PE    FSE          +A+D +  C  ++  +R TA ++L+  
Sbjct: 279 INIYYAIENDNYIPPEG--AFSE----------TAIDFLNLCFKKNMYRRPTAQQLLNHK 326

Query: 725 FLNPV 729
           +L P+
Sbjct: 327 WLQPM 331

>Suva_7.325 Chr7 (550760..551866) [1107 bp, 368 aa] {ON} YGR040W
           (REAL)
          Length = 368

 Score = 84.7 bits (208), Expect = 8e-17,   Method: Compositional matrix adjust.
 Identities = 49/164 (29%), Positives = 86/164 (52%), Gaps = 23/164 (14%)

Query: 524 VLYLVMECGDHDLSQILNQR--ANMPLDVDFIRYYSREMLKCVKVVHDAGIVHSDLKPAN 581
            +YLV E  + DL +++N +   +  L  D I+Y++ ++L+ +K +H A ++H D+KP+N
Sbjct: 89  AVYLVEELMETDLQKVINNQNSGSSTLSDDHIQYFTYQILRALKSIHSAQVIHRDIKPSN 148

Query: 582 FVLVKGI-LKIIDFGIANAVPDHTVNIYRDTQIG-------TPNYMAPEALVALNEVSNV 633
            +L     LK+ DFG+A  +   + +  R+T +G       T  Y APE ++   E +  
Sbjct: 149 LLLNSNCDLKVCDFGLARCLASSSDS--RETLVGFMTEYVATRWYRAPEIMLTFQEYTTA 206

Query: 634 EKKNRWRVGKPSDIWSCGCIMYQMFYGRPPYGAFQNQNRLLAIM 677
                       DIWSCGCI+ +M  G+P +      ++L  I+
Sbjct: 207 -----------MDIWSCGCILAEMLSGKPLFPGRDYHHQLWLIL 239

>KLLA0F24618g Chr6 complement(2288943..2290613) [1671 bp, 556 aa]
           {ON} similar to uniprot|P38070 Saccharomyces cerevisiae
           YBR028C Hypothetical ORF
          Length = 556

 Score = 86.3 bits (212), Expect = 8e-17,   Method: Compositional matrix adjust.
 Identities = 81/292 (27%), Positives = 126/292 (43%), Gaps = 51/292 (17%)

Query: 455 IELLGRGGSSKVYKVKNTNNNRVYALKRVVFDEF----DDTSVDAFKGXXXXXXXXXXXX 510
           I  LG G   KV  VK++ ++++YA+K++   E     D    DA               
Sbjct: 173 IRCLGEGAYGKVLLVKDSLSSKLYAMKQLKKAEILISEDSIEKDANTTVEKRIERTFAER 232

Query: 511 XXXXXIQYQ---------MDNGVLYLVME-CGDHDLSQILNQRANMPLDVDFIRYYSREM 560
                +++           DN  LYLV++     +L   L ++    LD   + +Y+ E+
Sbjct: 233 TILSQLEHPNIVKLFYSFHDNHKLYLVLQYIPGGELFYHLKEQGT--LDEGTVAFYAAEL 290

Query: 561 LKCVKVVHDAGIVHSDLKPANFVL-VKGILKIIDFGIAN-------AVPDHTVNIYR-DT 611
              +K +H  GIV+ DLKP N +L  +G L + DFG++        A P+   N+ +  +
Sbjct: 291 SCALKFLHSKGIVYRDLKPENCLLNERGHLVLTDFGLSKKSVFDDAATPEEGENVNQLYS 350

Query: 612 QIGTPNYMAPEALVALNEVSNVEKKNRWRVGKPSDIWSCGCIMYQMFYGRPPYGAFQNQN 671
            IGTP Y APE L       N             D +S GC++Y M  G+PP+    ++ 
Sbjct: 351 IIGTPEYCAPEILAGEPYTQNC------------DWYSLGCLVYDMLIGKPPFTGVNHK- 397

Query: 672 RLLAIMNPEVKIVFSEKTSKNERVPKSALDTMK----ACLIRSPEKRWTADE 719
               I+N     +  EKT    R+P    D  K    A L + P KRW  D+
Sbjct: 398 ---IILNK----IKQEKT--GARIPSYLSDGFKDYLGALLRKDPTKRWDVDK 440

>Ecym_5505 Chr5 (1027605..1030616) [3012 bp, 1003 aa] {ON} similar
           to Ashbya gossypii ACL104C
          Length = 1003

 Score = 87.0 bits (214), Expect = 8e-17,   Method: Compositional matrix adjust.
 Identities = 72/274 (26%), Positives = 118/274 (43%), Gaps = 29/274 (10%)

Query: 452 YERIELLGRGGSSKVYKVKNTNNNRVYALKRVVFDEFDDTSVDAFKGXXXXXXXXXXXXX 511
           + R E++GRG    VYK  +    +VYA+K +  D  +D   D  K              
Sbjct: 23  FRRTEIVGRGKFGVVYKAYHVKTKQVYAIKVLNLDCPEDEVEDVQKEVQFLSSLKQVPNI 82

Query: 512 XXXXIQYQMDNGVLYLVME-CGDHDLSQILNQRANMPLDVDFIRYYSREMLKCVKVVHDA 570
                 +  +   L+++ME C    L  +L       +D  ++    R +L  +  +H  
Sbjct: 83  TQYYGSFLYETK-LWVIMEYCAGGSLRTLLRPGK---IDEKYLGVIVRNLLVALLYIHKD 138

Query: 571 GIVHSDLKPANFVLVKGI-LKIIDFGIANAVPDHTVNIYRDTQIGTPNYMAPEALVALNE 629
            ++H D+K AN ++  G  +K+ DFG+A  +   T N  R T  GTP +MAPE +     
Sbjct: 139 NVIHRDIKAANVLITNGGHVKLCDFGVAAQL--TTANHKRQTMAGTPYWMAPEVI----- 191

Query: 630 VSNVEKKNRWRVGKPSDIWSCGCIMYQMFYGRPPYGAFQNQNRLLAIMNPEVKIVFSEKT 689
           +  V    +      +DIWS G   Y++  G PPY   +    +        +++   K 
Sbjct: 192 MEGVYYNTK------ADIWSLGITTYEIATGNPPYCDVEALRAM--------QLITKSKP 237

Query: 690 SKNERVPKSAL--DTMKACLIRSPEKRWTADEIL 721
            + E    S L  + +  CL   PE R TA+E+L
Sbjct: 238 PRLEGRNYSPLLKEFIALCLDEDPEARPTAEELL 271

>Skud_7.337 Chr7 (562750..563856) [1107 bp, 368 aa] {ON} YGR040W
           (REAL)
          Length = 368

 Score = 84.7 bits (208), Expect = 8e-17,   Method: Compositional matrix adjust.
 Identities = 50/163 (30%), Positives = 86/163 (52%), Gaps = 23/163 (14%)

Query: 525 LYLVMECGDHDLSQILNQRAN--MPLDVDFIRYYSREMLKCVKVVHDAGIVHSDLKPANF 582
           +YLV E  + DL +++N + N    L  D I+Y++ ++L+ +K +H A ++H D+KP+N 
Sbjct: 90  VYLVEELMETDLQKVINNQNNGSSTLSDDHIQYFTYQILRALKSIHSAQVIHRDIKPSNL 149

Query: 583 VLVKGI-LKIIDFGIANAVPDHTVNIYRDTQIG-------TPNYMAPEALVALNEVSNVE 634
           +L     LK+ DFG+A  +   + +  R+T +G       T  Y APE ++   E +   
Sbjct: 150 LLNSNCDLKVCDFGLARCLASSSDS--RETLVGFMTEYVATRWYRAPEIMLTFQEYTTA- 206

Query: 635 KKNRWRVGKPSDIWSCGCIMYQMFYGRPPYGAFQNQNRLLAIM 677
                      DIWSCGCI+ +M  G+P +      ++L  I+
Sbjct: 207 ----------MDIWSCGCILAEMVSGKPLFPGRDYHHQLWLIL 239

>KNAG0J01700 Chr10 (309962..312424) [2463 bp, 820 aa] {ON} 
          Length = 820

 Score = 86.7 bits (213), Expect = 9e-17,   Method: Compositional matrix adjust.
 Identities = 82/304 (26%), Positives = 127/304 (41%), Gaps = 54/304 (17%)

Query: 456 ELLGRGGSSKVYKVKNTNNNRVYALKRV-----------------VFDEFDDTSVDAFKG 498
           E++G+G  + V K   T   R YA+K +                 V  + D  S+   KG
Sbjct: 206 EVVGQGAFATVKKAIETATGRTYAVKIINKRKVMGNLDGVTRELTVLQKLDHPSIVTLKG 265

Query: 499 XXXXXXXXXXXXXXXXXIQYQMDNGVLYLVME-CGDHDLSQILNQRANMPLDVDFIRYYS 557
                              +  D    Y+VME     DL   +   A+ P+  D  R  +
Sbjct: 266 -------------------FYEDKDNYYMVMEFVSGGDLMDFVA--AHGPVGEDAGREIT 304

Query: 558 REMLKCVKVVHDAGIVHSDLKPANFVLVKG----ILKIIDFGIANAVPDHTVNIYRDTQI 613
           R++L+ VK +H  GI H DLKP N +L+K     ++KI DFG+A  + +H    + +T  
Sbjct: 305 RQILEAVKYIHSVGISHRDLKPDN-ILIKQDDPVLVKITDFGLAK-MQEH--GAFMNTFC 360

Query: 614 GTPNYMAPEALVALNEVSN--VEKKNRWRVGKPSDIWSCGCIMYQMFYGRPPYGAFQNQN 671
           GT  Y+APE +    + S   V K  R       D+WS GC++Y +  G  P+     Q 
Sbjct: 361 GTLAYVAPEVVNGRQQTSEPAVPKGERSHYSSLVDMWSMGCLVYVILTGHLPFSGSTPQQ 420

Query: 672 RLLAIMNPEVKIVFSEKTSKNERVPKSALDTMKACLIRSPEKRWTADEILDASFLN-PVL 730
               I     K  + E   K+ R+   A D +   L   P  R +A   L+  ++    L
Sbjct: 421 LYEQIG----KASYHEVPLKDCRISDQARDFIDCLLQVDPNNRLSAARALEHPWIQMAYL 476

Query: 731 VTPY 734
            +P+
Sbjct: 477 GSPF 480

>NDAI0K02100 Chr11 complement(469575..472304) [2730 bp, 909 aa] {ON}
           Anc_2.496
          Length = 909

 Score = 86.7 bits (213), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 88/342 (25%), Positives = 144/342 (42%), Gaps = 65/342 (19%)

Query: 399 SRESQSSTVEKPHTFQDNKEGQKIVKKVEIVEP--PTSMTNRKSSKSIVSVNDIEYERIE 456
           SRE+     EK    ++N++ Q   K  EI  P  P+ +                Y  + 
Sbjct: 588 SREASRHVSEKKRIERENRKRQLYAKLAEICSPGDPSKL----------------YTNLV 631

Query: 457 LLGRGGSSKVYKVKNTNNNRVYALKRVVFD-----EFDDTSVDAFKGXXXXXXXXXXXXX 511
            +G+G S  VY   + + N   A+K++  +     E     +   KG             
Sbjct: 632 KIGQGASGGVYIANDVSTNESIAIKQMNLEKQPKKELIINEILVMKGSKHPNIVNF---- 687

Query: 512 XXXXIQYQMDNGVLYLVMECGDHDLSQILNQRANMPLDVDFIRYYSREMLKCVKVVHDAG 571
               I   + +G L+++ME  +     + +   +  L    I    RE L  ++ +H  G
Sbjct: 688 ----IDSYLLDGDLWVIMEYMEG--GSLTDVVTHCILTEGQIGAVCRETLSGLQFLHSKG 741

Query: 572 IVHSDLKPANFVL-VKGILKIIDFGIANAVPDHTVNIYRDTQIGTPNYMAPEALVALNEV 630
           ++H D+K  N +L + G +K+ DFG    V + T+   R T +GTP +MAPE +      
Sbjct: 742 VLHRDIKSDNILLSINGNIKLTDFGFCAQVNETTLK--RTTMVGTPYWMAPEVV------ 793

Query: 631 SNVEKKNRWRVGKPSDIWSCGCIMYQMFYGRPPYGAFQNQNRLLAIM------NPEVKIV 684
                 +R   G   DIWS G ++ +M  G PPY    N+  L A+        PE+K  
Sbjct: 794 ------SRKEYGPKVDIWSLGIMIIEMIEGEPPY---LNETPLRALYLIATNGTPELK-- 842

Query: 685 FSEKTSKNERVPKSALDTMKACLIRSPEKRWTADEILDASFL 726
              +  K   V K  LD    CL  +P++R +A E+L+  F+
Sbjct: 843 ---EREKLSDVLKHFLD---WCLSVNPDQRASATELLEDVFI 878

>SAKL0C01716g Chr3 (143880..147527) [3648 bp, 1215 aa] {ON} similar
           to uniprot|Q12263 Saccharomyces cerevisiae YDR507C
          Length = 1215

 Score = 87.0 bits (214), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 71/239 (29%), Positives = 111/239 (46%), Gaps = 29/239 (12%)

Query: 525 LYLVME-CGDHDLSQILNQRANMPLDVDFIRYYSREMLKCVKVVHDAGIVHSDLKPANFV 583
           LY+V+E     +L  +L +R  +P + + +R++ R+++  +   H  GIVH DLKP N +
Sbjct: 114 LYMVLEYVEKGELFNLLVERGPLP-ENEAVRFF-RQIIIGISYCHALGIVHRDLKPENLL 171

Query: 584 L-VKGILKIIDFGIANAVPDHTVNIYRDTQIGTPNYMAPEALVALNEVSNVEKKNRWRVG 642
           L  K  +KI DFG+A      + +   +T  G+P+Y APE +  L              G
Sbjct: 172 LDHKFNIKIADFGMAAL---ESKDKLLETSCGSPHYAAPEIVSGLP-----------YHG 217

Query: 643 KPSDIWSCGCIMYQMFYGRPPYGAFQNQNR--LLAIMNPEVKIVFSEKTSKNERVPKSAL 700
             SD+WSCG I+Y +  GR P+       R  LL + + E ++        N+ +   A 
Sbjct: 218 FESDVWSCGVILYALLTGRLPFDEDNGNIRSLLLKVQSGEYEM------PGNDEISSEAQ 271

Query: 701 DTMKACLIRSPEKRWTADEILDASFLN--PVLVTPYIVRDLIRNAVYYGS-DQGQVSED 756
           D +   L   P++R    EIL    L   P +     +R+L R   Y    D G  S D
Sbjct: 272 DLIAKILTVDPDRRIKTREILKHPLLQKYPSIKDSKSIRNLPREDTYLNPLDHGDGSID 330

>SAKL0E04092g Chr5 complement(326532..327901,327970..327982) [1383
           bp, 460 aa] {ON} similar to uniprot|Q03957 Saccharomyces
           cerevisiae YKL139W CTK1 Catalytic (alpha) subunit of
           C-terminal domain kinase I (CTDK-I) which phosphorylates
           the C- terminal repeated domain of the RNA polymerase II
           large subunit (Rpo21p) to affect both transcription and
           pre-mRNA 3' end processing
          Length = 460

 Score = 85.5 bits (210), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 80/331 (24%), Positives = 143/331 (43%), Gaps = 65/331 (19%)

Query: 431 PPTSMTNRKSSKSIVSVNDIEYERIELLGRGGSSKVYKVKNTNNNRVYALKRVVFD-EFD 489
           PPT++   + S S+       YER+  +G G   KVYK KN +  ++ ALKR+  + E +
Sbjct: 118 PPTAIITTERSSSV-------YERVLQVGEGTYGKVYKAKNLHVGKLVALKRLRLEGERE 170

Query: 490 DTSVDAFKGXXXXXXXXXXXXXXXXXIQYQMDNGVLYLVMECGDHDLSQIL--NQRANMP 547
              + + +                  I  +    V Y++ E  D+DLS IL  N+ +  P
Sbjct: 171 GFPITSIREIKLLQSFNHPNVSTLSEIMVEGTKTV-YMIFEYADNDLSGILLNNEISLSP 229

Query: 548 LDVDFIRYYSREMLKCVKVVHDAGIVHSDLKPANFVLV-KGILKIIDFGIANAVPDHTVN 606
            +   I    +++L+ ++ +H   I+H D+K +N ++  +G LKI DFG+A  + D    
Sbjct: 230 ANCKHI---FKQLLEGIQYLHSRRILHRDIKGSNILIDNRGQLKITDFGLARRMKDE--- 283

Query: 607 IYRD--TQIGTPNYMAPEALVALNEVSNVEKKNRWRVGKPSDIWSCGCIMYQMFYGRPPY 664
             RD   ++ T  Y  PE L+   + ++             D+W CGC++ ++F+     
Sbjct: 284 --RDYTNRVITLWYRPPELLMGTTKYAS-----------EVDMWGCGCLLVELFH---KL 327

Query: 665 GAFQNQNRL------LAIMN-------------PEVKIVFSEKTSKNER---------VP 696
             FQ  N L       ++M              P   ++  ++ +K E          +P
Sbjct: 328 AIFQGTNELEQLQAIFSVMGTPTVEEWPNIFNMPWFFMMIPQQETKFESSFEQKFASLLP 387

Query: 697 K-SALDTMKACLIRSPEKRWTADEILDASFL 726
                +  K  L+   +KRW+A E L + + 
Sbjct: 388 SHHCFELAKGLLLYDQDKRWSAAEALRSEYF 418

>TBLA0I02400 Chr9 complement(548975..554167) [5193 bp, 1730 aa] {ON}
            Anc_6.341 YNR031C
          Length = 1730

 Score = 87.0 bits (214), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 61/197 (30%), Positives = 93/197 (47%), Gaps = 44/197 (22%)

Query: 556  YSREMLKCVKVVHDAGIVHSDLKPANFVL-VKGILKIIDFGIANAVP-DHT--VNIYRDT 611
            Y+ E+L+ +  +H +GIVH D+KP N +L   GI+K +DFG A  +  DHT   +  +D 
Sbjct: 1513 YTLELLEGLSYLHQSGIVHRDIKPENILLDFNGIIKYVDFGAARKIAKDHTRIASFSKDG 1572

Query: 612  Q---------------------------IGTPNYMAPEALVALNEVSNVEKKNRWRVGKP 644
            +                           +GTP YMAPEA      +S    KN++     
Sbjct: 1573 KDNKESKKIDDTLLETEEAGVGTGLYDMVGTPMYMAPEA------ISGSPNKNKF---GS 1623

Query: 645  SDIWSCGCIMYQMFYGRPPYGAFQNQNRLLAIMNPEVKIVFSEKTSKNERVPKSALDTMK 704
             D+WS GC++ +M  GR P+    N+    AIM   V    S +    + V  +  + +K
Sbjct: 1624 DDVWSLGCVVLEMITGRRPWANLDNE---WAIMY-HVAAGHSPQLPSKDEVSTNGNNFLK 1679

Query: 705  ACLIRSPEKRWTADEIL 721
             CL + P KR TA ++L
Sbjct: 1680 RCLQQDPYKRATAVDLL 1696

>TPHA0I00920 Chr9 (204753..209057) [4305 bp, 1434 aa] {ON} Anc_1.271
            YJL095W
          Length = 1434

 Score = 86.7 bits (213), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 75/299 (25%), Positives = 132/299 (44%), Gaps = 33/299 (11%)

Query: 439  KSSKSIVSVNDIEYERIELLGRGGSSKVYKVKNTNNNRVYALKRVVFDEFDDTS------ 492
            KS  S    N+  + + E++G+G    V+   N     + A+K++    +   S      
Sbjct: 1122 KSKNSRGEYNEFAWMKGEMIGKGSFGAVFLSLNITTGEMMAVKQIEVPSYGSQSETMLNT 1181

Query: 493  VDAFKGXXXXXXXXXXXXXXXXXIQYQMDNGVLYLVME--CGDHDLSQILNQRANMPLDV 550
            V+A K                  + ++M + +  L +E   G    S I   R     D 
Sbjct: 1182 VEAMKSEVSTLKDLDHLNIVQY-LGFEMKHNIYSLFLEYVAGGSVGSLI---RMYGRFDD 1237

Query: 551  DFIRYYSREMLKCVKVVHDAGIVHSDLKPANFVLVK-GILKIIDFGIANAVPDHTVNIYR 609
              IR+ + ++L+ +  +H  GI+H D+K  N +L + GI KI DFGI+    D    IY 
Sbjct: 1238 KLIRHLTNQVLEGLSYLHSQGILHRDMKADNLLLDQDGICKISDFGISKKSED----IYS 1293

Query: 610  DTQI---GTPNYMAPEALVALNEVSNVEKKNRWRVGKPSDIWSCGCIMYQMFYGRPPYGA 666
            ++++   GT  +MAPE +V   +  N +           DIWS GC++ +MF G+ P+  
Sbjct: 1294 NSEMTMRGTVFWMAPE-MVDTKQGYNAK----------VDIWSLGCVVLEMFAGKRPWSN 1342

Query: 667  FQNQNRLLAIMNPEVKIVFSEKTSKNERVPKSALDTMKACLIRSPEKRWTADEILDASF 725
            F+    +  I   +      E T   + +  +A + +  C    P++R TA ++L+  F
Sbjct: 1343 FEVVTAMYKIGQSKSAPPIPEDT--KDLISPTAKNFLNQCFHIDPKERPTAGQLLEHPF 1399

>TPHA0J00630 Chr10 (139476..140600) [1125 bp, 374 aa] {ON} Anc_4.184
           YGR040W
          Length = 374

 Score = 84.3 bits (207), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 62/238 (26%), Positives = 110/238 (46%), Gaps = 46/238 (19%)

Query: 524 VLYLVMECGDHDLSQIL--NQRANMPLDVDFIRYYSREMLKCVKVVHDAGIVHSDLKPAN 581
            +Y+V E  + DL +++  N   N  L  D I+Y+  ++L+ +K +H A ++H DLKP+N
Sbjct: 89  AVYIVQELMETDLHKVVTNNNLKNTSLSDDHIQYFIYQILRALKSIHSAQVIHRDLKPSN 148

Query: 582 FVLVKGI-LKIIDFGIANAVPDH-----TVNIYRDTQIGTPNYMAPEALVALNEVSNVEK 635
            +L     LKI DFG++  +        T+  +    + T  Y APE ++   E +    
Sbjct: 149 ILLNSNCDLKICDFGLSRCLASSNNSKATLVGFMTEYVATRWYRAPEIMLTFQEYTTA-- 206

Query: 636 KNRWRVGKPSDIWSCGCIMYQMFYGRPPYGAFQNQNRLLAIMN----------PEVK--- 682
                     DIWSCGCI+ +M  G+P +      ++L  I++           ++K   
Sbjct: 207 ---------MDIWSCGCILAEMVSGKPLFPGRDYHHQLWLILDVLGTQSYEDFVQIKSKR 257

Query: 683 -------IVFSEKTSKNERVPK-------SALDTMKACLIRSPEKRWTADEILDASFL 726
                  + +S K S ++ + K         LD +   L  +P KR +A+E L+  ++
Sbjct: 258 AKEYISSLPYSNKMSWDKILGKDMDSLNPQMLDLLDKMLTFNPNKRISAEEALEHPYM 315

>YOL100W Chr15 (129237..132482) [3246 bp, 1081 aa] {ON}
           PKH2Serine/threonine protein kinase involved in
           sphingolipid-mediated signaling pathway that controls
           endocytosis; activates Ypk1p and Ykr2p, components of
           signaling cascade required for maintenance of cell wall
           integrity; redundant with Pkh1p
          Length = 1081

 Score = 86.7 bits (213), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 67/258 (25%), Positives = 115/258 (44%), Gaps = 48/258 (18%)

Query: 521 DNGVLYLVME-CGDHDLSQILNQRANMPLDVDFIRYYSREMLKCVKVVHDAGIVHSDLKP 579
           D   LY ++E   + D   ++ +  +  LD    RYY+ +++  +  +H  GI+H D+KP
Sbjct: 249 DESSLYFLLEYAPNGDFLSLMKKYGS--LDETCARYYAAQIIDAIDYLHSNGIIHRDIKP 306

Query: 580 ANFVLVKGILKI--IDFGIA-------NAV--PDHTVNIYRDTQIGTPNYMAPEALVALN 628
            N +L+ G +KI   DFG A       N+V  P++ ++    + +GT  Y++PE L    
Sbjct: 307 EN-ILLDGEMKIKLTDFGTAKLLNPTNNSVSKPEYDLSTRSKSFVGTAEYVSPELL---- 361

Query: 629 EVSNVEKKNRWRVGKPSDIWSCGCIMYQMFYGRPPYGAFQNQNRLLAIMNPEVKIVFSEK 688
                   N        DIW+ GCI++QM  G+PP+ A         +M  +V+  F+  
Sbjct: 362 --------NDSFTDYRCDIWAFGCILFQMIAGKPPFKATNEYLTFQKVM--KVQYAFTPG 411

Query: 689 TSKNERVPKSALDTMKACLIRSPEKRWTADEILDASFL-------------NPVLVTPYI 735
                  P    D +K  L+++ ++R T  +I +  F               P  + PY 
Sbjct: 412 ------FPLIIRDLVKKILVKNLDRRLTISQIKEHHFFKDLNFKDGSVWSKTPPEIKPYK 465

Query: 736 VRDLIRNAVYYGSDQGQV 753
           +      A+  GSD+  V
Sbjct: 466 INAKSMQAMPSGSDRKLV 483

>KAFR0C04590 Chr3 complement(917915..922321) [4407 bp, 1468 aa] {ON}
            Anc_6.341 YNR031C
          Length = 1468

 Score = 86.7 bits (213), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 85/324 (26%), Positives = 140/324 (43%), Gaps = 53/324 (16%)

Query: 440  SSKSIVSVNDIEYERIELLGRGGSSKVYKVKNTNNNRVYALKRVVFDEFDDTSVDAFKGX 499
            S  S +S   I +++ + +G G    V+   N +N  + A+K +     D+ S++ F   
Sbjct: 1145 SLASSISNVSIRWQKRKYIGGGTFGAVFSAVNLDNGEILAVKEIKIQ--DNKSMEKFFPL 1202

Query: 500  XXXXXXXXXXXXXXXXIQY---QMDNGVLYLVME-CGDHDLSQILNQRANMPLDVDFIRY 555
                            +QY   ++    + + ME C    L+ +L        D    + 
Sbjct: 1203 IKDEMNVLEMLNHPNVVQYYGVEVHRDRVNIFMEYCEGGSLATLLEH--GRIEDELVTQM 1260

Query: 556  YSREMLKCVKVVHDAGIVHSDLKPANFVL-VKGILKIIDFGIAN-AVPDHT---VNIYRD 610
            Y+ ++L+ +  +H++GI+H D+KP N +L   GI+K +DFG +  AV + T    +I + 
Sbjct: 1261 YTLQLLEGLAYLHESGIIHRDIKPENILLDYNGIIKYVDFGASKRAVKNSTRWAASIGKG 1320

Query: 611  TQ------------------IGTPNYMAPEALVALNEVSNVEKKNRWRVGKPSDIWSCGC 652
            +                   IGTP YMAPEA+      S  E     R G  SDIWS GC
Sbjct: 1321 SISSHSSSEGDSNSGKLQDLIGTPMYMAPEAITG----STTEG----RFGS-SDIWSLGC 1371

Query: 653  IMYQMFYGRPPYGAFQNQNRLLAIMNPEVKIVFSEKTSKNERVPKSALDTMKACLIRSPE 712
            +  +M  G+ P+    N+  +L      V    S +     +V  +    +K CL+ S  
Sbjct: 1372 VTLEMITGKRPWYNLDNEWAILY----HVVAGQSPRFPNKNKVSSAGRKFLKRCLVHSAS 1427

Query: 713  KRWTADEILDASFLNPVLVTPYIV 736
            KR TA E+         L+ P+IV
Sbjct: 1428 KRATAFEL---------LMEPWIV 1442

>NDAI0G05470 Chr7 (1340175..1344842) [4668 bp, 1555 aa] {ON} Anc_1.271
          Length = 1555

 Score = 86.7 bits (213), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 84/314 (26%), Positives = 131/314 (41%), Gaps = 59/314 (18%)

Query: 442  KSIVSVN----------DIEYERIELLGRGGSSKVYKVKNTNNNRVYALKRVVF------ 485
            K +VS+N          +  + + E++G+G    VY   N     + A+K+V        
Sbjct: 1234 KQMVSINKSKNSKGEYKEFAWMKGEMIGKGSFGAVYLCLNVTTGEMMAVKQVEVPKYSSQ 1293

Query: 486  DEFDDTSVDAFKGXXXXXXXXXXXXXXXXXIQYQMDNGVLYLVMECGDHDLSQILNQRAN 545
            DE   ++VDA K                        N V YL  E  D+  S  L   A 
Sbjct: 1294 DEAIMSTVDAIKSEVSTLKDLDHL------------NIVQYLGFENKDNIYSLFLEYVAG 1341

Query: 546  MPL----------DVDFIRYYSREMLKCVKVVHDAGIVHSDLKPANFVLVK-GILKIIDF 594
              +          D   IR+ + ++L+ +  +H  GI+H D+K  N +L + G+ KI DF
Sbjct: 1342 GSVGSLIRIYGRFDEPLIRHLNIQVLRGLAYLHARGILHRDMKADNLLLDQDGVCKISDF 1401

Query: 595  GIANAVPDHTVNIYRDTQI---GTPNYMAPEALVALNEVSNVEKKNRWRVGKPSDIWSCG 651
            GI+    D    IY ++ +   GT  +MAPE          V+ K  +      DIWS G
Sbjct: 1402 GISRKSKD----IYSNSDMTMRGTVFWMAPEM---------VDTKQGYSAK--VDIWSLG 1446

Query: 652  CIMYQMFYGRPPYGAFQNQNRLLAIMNPEVKIVFSEKTSKNERVPKSALDTMKACLIRSP 711
            CI+ +MF G+ P+  F+    +  I   +      E T     +     + + AC    P
Sbjct: 1447 CIVLEMFAGKRPWSNFEVVAAMFKIGKSKSAPPIPEDTL--PLISAEGREFLDACFEIDP 1504

Query: 712  EKRWTADEILDASF 725
            +KR TADE+L  +F
Sbjct: 1505 DKRPTADELLYHTF 1518

>KLLA0B13607g Chr2 (1191592..1194561) [2970 bp, 989 aa] {ON} similar
           to uniprot|Q03497 Saccharomyces cerevisiae YHL007C STE20
           Signal transducing kinase of the PAK (p21- activated
           kinase) family involved in pheromone response and
           pseudohyphal/invasive growth pathways activated by
           Cdc42p binds Ste4p at a GBB motif present in
           noncatalytic domains of PAK kinases
          Length = 989

 Score = 86.3 bits (212), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 76/285 (26%), Positives = 124/285 (43%), Gaps = 43/285 (15%)

Query: 452 YERIELLGRGGSSKVYKVKNTNNNRVYALKRVVFD-----EFDDTSVDAFKGXXXXXXXX 506
           Y+ +  +G+G S  VY       N   A+K++  +     E     +   KG        
Sbjct: 698 YKNLIKIGQGASGGVYTAYELGTNASVAIKQMNLEKQPKKELIVNEILVMKGSKHNNIVN 757

Query: 507 XXXXXXXXXIQYQMDNGVLYLVMECGDHDLSQILNQRANMPLDVDFIRYYSREMLKCVKV 566
                    I   +  G L++VME    +   + +   +  L    I   SRE LK ++ 
Sbjct: 758 F--------IDSYLFRGDLWVVMEY--MEGGSLTDVVTHCILTEGQIGAVSRETLKGLQF 807

Query: 567 VHDAGIVHSDLKPANFVL-VKGILKIIDFGIANAVPDHTVNIYRDTQIGTPNYMAPEALV 625
           +H  G++H D+K  N +L + G +K+ DFG    +  + VN+ R T +GTP +MAPE + 
Sbjct: 808 LHSKGVIHRDIKSDNILLSMNGDIKLTDFGFCAQI--NEVNLKRTTMVGTPYWMAPEVV- 864

Query: 626 ALNEVSNVEKKNRWRVGKPSDIWSCGCIMYQMFYGRPPYGAFQNQNRLLAIMNPEVKIVF 685
                      +R   G   DIWS G ++ +M  G PPY    N+  L A+      ++ 
Sbjct: 865 -----------SRKEYGPKVDIWSLGIMIIEMIEGEPPY---LNETPLRALY-----LIA 905

Query: 686 SEKTSKNERVPKSALDTMKA----CLIRSPEKRWTADEILDASFL 726
           +  T K  + P +    M      CL+  PE R TA ++L+  F+
Sbjct: 906 TNGTPK-LKDPGNLSHKMAMFLNWCLMVDPEDRGTAADLLEDPFI 949

>KLLA0C01650g Chr3 (128119..131457) [3339 bp, 1112 aa] {ON} similar
           to uniprot|Q12263 Saccharomyces cerevisiae YDR507C
          Length = 1112

 Score = 86.7 bits (213), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 65/227 (28%), Positives = 109/227 (48%), Gaps = 28/227 (12%)

Query: 525 LYLVMECGDH-DLSQILNQRANMPLDVDFIRYYSREMLKCVKVVHDAGIVHSDLKPANFV 583
           LY+V+E  +  +L  +L +R  +P + + +R++ R+++  +   H  GIVH DLKP N +
Sbjct: 101 LYMVLEYVEKGELFNLLVERGPLP-ENEAVRFF-RQIIIGISYCHALGIVHRDLKPENLL 158

Query: 584 L-VKGILKIIDFGIANAVPDHTVNIYRDTQIGTPNYMAPEALVALNEVSNVEKKNRWRVG 642
           L  K  +K+ DFG+A      + +   +T  G+P+Y APE +  L              G
Sbjct: 159 LDHKFNVKLADFGMAAL---ESKDKLLETSCGSPHYAAPEIVSGLP-----------YHG 204

Query: 643 KPSDIWSCGCIMYQMFYGRPPYGAFQN--QNRLLAIMNPEVKIVFSEKTSKNERVPKSAL 700
             SD+WSCG I+Y +  GR P+       +N LL + + + ++        ++ +   A 
Sbjct: 205 FESDVWSCGVILYALLTGRLPFDEEDGNIRNLLLKVQSGKFEM------PGDDEISSEAQ 258

Query: 701 DTMKACLIRSPEKRWTADEILDASFLN--PVLVTPYIVRDLIRNAVY 745
           D +   L   PE+R    EIL    L   P +     +R+L R   Y
Sbjct: 259 DLIARILTVDPEQRIKTREILKHPLLRKYPSIKDSKSIRNLPREDTY 305

>TPHA0G02800 Chr7 (597211..598722) [1512 bp, 503 aa] {ON} Anc_2.425
           YKL139W
          Length = 503

 Score = 85.5 bits (210), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 71/248 (28%), Positives = 116/248 (46%), Gaps = 36/248 (14%)

Query: 421 KIVKKVEIVEPPTSMTNRKSSKSIVSVNDIEYERIELLGRGGSSKVYKVKNTNNNRVYAL 480
           K V KV+++  PT+  N K ++S+       YE++  +G G   KVYK KN   N++ AL
Sbjct: 124 KPVNKVKVL--PTTFINEKRTESV-------YEKLVQVGEGTYGKVYKAKNLVTNKLVAL 174

Query: 481 KRVVFDE----FDDTSVDAFKGXXXXXXXXXXXXXXXXXIQYQMDNGVLYLVMECGDHDL 536
           K++  +     F  TS+   K                   Q +    ++Y++ E  D+DL
Sbjct: 175 KKLRLESEREGFPITSIREIKILQSLQHKNISTLNEIMIEQQK----IVYMIFEYADNDL 230

Query: 537 SQILNQRANMPLDVDFIRYYSREMLKCVKVVHDAGIVHSDLKPANFVLV--KGILKIIDF 594
           S +L     + ++V   +    ++LK V+ +HD  I+H D+K +N +LV  KG LKI DF
Sbjct: 231 SGLL-MNNKISINVGQCKDIFMQLLKGVQYLHDHNILHRDIKGSN-ILVDNKGRLKITDF 288

Query: 595 GIANAVPDH--TVNIYRD--TQIGTPNYMAPEALVALNEVSNVEKKNRWRVGKPSDIWSC 650
           G+A  +     T     D   ++ T  Y  PE L+     S              D+W C
Sbjct: 289 GLARKMKQKASTTAFLHDYTNRVITLWYRPPELLMGTTNYST-----------EVDMWGC 337

Query: 651 GCIMYQMF 658
           GC++ ++F
Sbjct: 338 GCLLVELF 345

>SAKL0A01254g Chr1 (119884..124560) [4677 bp, 1558 aa] {ON} similar to
            uniprot|P53599 Saccharomyces cerevisiae YNR031C SSK2
            Suppressor of Sensor Kinase (SLN1) A MAP kinase kinase
            kinase activator of Pbs2p
          Length = 1558

 Score = 86.7 bits (213), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 53/179 (29%), Positives = 88/179 (49%), Gaps = 27/179 (15%)

Query: 556  YSREMLKCVKVVHDAGIVHSDLKPANFVL-VKGILKIIDFGIANAVPDHTVNIYRD---- 610
            Y+ ++L+ +  +H +G+VH D+KP N +L   GI+K +DFG A  +  ++     D    
Sbjct: 1366 YALQLLEGLAYLHQSGVVHRDIKPENILLDFNGIIKYVDFGAAKLLAKNSTKGNIDATSS 1425

Query: 611  --------TQIGTPNYMAPEALVALNEVSNVEKKNRWRVGKPSDIWSCGCIMYQMFYGRP 662
                    T +GTP YM+PE++             + + G   DIWS GC++ +M  GR 
Sbjct: 1426 EAKQDRINTMMGTPMYMSPESITG---------TIKGKFGS-DDIWSLGCVILEMVTGRR 1475

Query: 663  PYGAFQNQNRLLAIMNPEVKIVFSEKTSKNERVPKSALDTMKACLIRSPEKRWTADEIL 721
            P+    N+    AIM   V    + +    + + ++    +  CLI+ P KR TA E+L
Sbjct: 1476 PWANLDNE---WAIMY-HVAAGHAPQFPARDEISRAGRKFLSRCLIQDPNKRATAVELL 1530

>KLTH0C08932g Chr3 (749308..750867) [1560 bp, 519 aa] {ON} similar
           to uniprot|P38070 Saccharomyces cerevisiae YBR028C
           Hypothetical ORF
          Length = 519

 Score = 85.5 bits (210), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 83/319 (26%), Positives = 139/319 (43%), Gaps = 76/319 (23%)

Query: 451 EYERIELLGRGGSSKVYKVKNTNNNRVYALKRVVFDEF---DDTSVDAFKGXXXXXXXXX 507
           +++ I +LGRG   KV  V++++ +R+YA+K++   E    +D S D  +          
Sbjct: 123 DFKPIRVLGRGAYGKVLLVRDSHTHRLYAMKQLKKAEILIHEDKSSDTEETKDDALEKRL 182

Query: 508 XXXXXXXXIQYQM-------------DNGVLYLVME-CGDHDLSQILNQRANMPLDVDFI 553
                   I  Q+             D+  LYLV++     +L   L ++    LD + +
Sbjct: 183 ERTFAERIILSQLEHPNIVKLFYSFHDHHKLYLVLQFIPGGELFYHLKEQGT--LDENTV 240

Query: 554 RYYSREMLKCVKVVHDAGIVHSDLKPANFVL-VKGILKIIDFGIA--------------- 597
            +Y+ E+   +K +H+ GIV+ DLKP N +L  +G L + DFG++               
Sbjct: 241 TFYAAEISCALKFLHERGIVYRDLKPENCLLDERGHLVLTDFGLSKKSAADSDTPERSDI 300

Query: 598 --NAVPDHT---VN-IYRDTQIGTPNYMAPEALVALNEVSNVEKKNRWRVGKP----SDI 647
             +A+  H+   VN +Y  + IGTP Y APE L                 GKP     D 
Sbjct: 301 DGDALNSHSGEPVNKLY--SIIGTPEYCAPEIL----------------EGKPYTQNCDW 342

Query: 648 WSCGCIMYQMFYGRPPYGAFQNQ---NRLLAIMNPEVKIVFSEKTSKNERVPKSALDTMK 704
           +S GC+++ M  G+PPY    ++    ++L    P++    SE             D + 
Sbjct: 343 YSLGCLVFDMLIGKPPYTGVNHKVILGKILKDKTPKIPSYLSEGMK----------DYLG 392

Query: 705 ACLIRSPEKRWTADEILDA 723
           A L +   KRW  D+  D+
Sbjct: 393 ALLKKDVTKRWDVDKFWDS 411

>KLTH0A07458g Chr1 (620459..623080) [2622 bp, 873 aa] {ON} similar
           to uniprot|P53739 Saccharomyces cerevisiae YNR047W
           Putative protein kinase that when overexpressed
           interferes with pheromone-induced growth arrest
           localizes to the cytoplasm potential Cdc28p substrate
          Length = 873

 Score = 86.3 bits (212), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 77/293 (26%), Positives = 120/293 (40%), Gaps = 43/293 (14%)

Query: 445 VSVNDIEYERIELLGRGGSSKVYKVKNTNNNRVYALKRVVFDEFDDTSVDAFKGXXXXXX 504
           V V    +E+I+LLG+G   KVY VK    NR+YALK  +F + +       K       
Sbjct: 462 VIVGPQSFEKIKLLGQGDVGKVYLVKEKKTNRLYALK--IFSKEEMIKRKKIKRILAEQE 519

Query: 505 XXXXXXXXXXXIQYQ--MDNGVLYLVME-CGDHDLSQILNQRANMPLDVDFIRYYSREML 561
                        Y        LYL ME C   +  + L  R    ++ D  R+YS E++
Sbjct: 520 ILATSNHPFIVTLYHSFQSEDYLYLCMEYCMGGEFFRALQTRKTKCIEEDDARFYSSEVV 579

Query: 562 KCVKVVHDAGIVHSDLKPANFVLVK-GILKIIDFGIANAVPDHTVNIYR--------DTQ 612
             ++ +H  G ++ DLKP N +L K G + + DF ++    D    + +        DT+
Sbjct: 580 AAIEYLHLMGFIYRDLKPENILLHKSGHIMLSDFDLSVQAKDTKNPVVKGSAQASLLDTK 639

Query: 613 I-----------GTPNYMAPEALVALNEVSNVEKKNRWRVGKPSDIWSCGCIMYQMFYGR 661
           I           GT  Y+APE +      + V            D W+ G ++Y+M +G 
Sbjct: 640 ICSDGFRTNSFVGTEEYIAPEVIRGNGHTAAV------------DWWTLGILIYEMLFGF 687

Query: 662 PPYGAFQNQNRLLAIMNPEVKIVFSEKTSKNERVPKSALDTMKACLIRSPEKR 714
            P+ A         ++  EV          N  V ++  D +K  LI+S  KR
Sbjct: 688 TPFKADTTNKTFSNVLKNEVTF------PNNNEVSRNCKDLIKKLLIKSETKR 734

>NCAS0B08600 Chr2 (1649375..1652728) [3354 bp, 1117 aa] {ON}
           Anc_5.591 YDR466W
          Length = 1117

 Score = 86.3 bits (212), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 66/230 (28%), Positives = 112/230 (48%), Gaps = 28/230 (12%)

Query: 522 NGVLYLVMECGDH-DLSQILNQRANMPLDVDFIRYYSREMLKCVKVVHDAGIVHSDLKPA 580
           N  LY+++E  +  +L  +L ++  +P + + +R++ R+++  +   H  GIVH DLKP 
Sbjct: 106 NSNLYMILEYAEKGELFNLLVEKGPLP-EKEAVRFF-RQIIIGISYCHALGIVHRDLKPE 163

Query: 581 NFVL-VKGILKIIDFGIANAVPDHTVNIYRDTQIGTPNYMAPEALVALNEVSNVEKKNRW 639
           N +L  K  +KI DFG+A      T +   +T  G+P+Y APE       VS +      
Sbjct: 164 NLLLDHKFNIKIADFGMAAL---ETEDKLLETSCGSPHYAAPEI------VSGIPYH--- 211

Query: 640 RVGKPSDIWSCGCIMYQMFYGRPPYGAFQN--QNRLLAIMNPEVKIVFSEKTSKNERVPK 697
             G  SD+WSCG I++ +  GR P+       +N LL + + + ++   ++ S++     
Sbjct: 212 --GFESDVWSCGVILFALLTGRLPFDEEDGNIRNLLLKVQSGQFEMPDDDEMSRD----- 264

Query: 698 SALDTMKACLIRSPEKRWTADEILDASFLN--PVLVTPYIVRDLIRNAVY 745
            A D +   L   P KR    EIL    L   P +     +++L R   Y
Sbjct: 265 -AQDLISRILTVDPTKRIKTREILKHPLLQKYPSIKDSKSIKNLPREDTY 313

>Kwal_27.11803 s27 (952938..953678) [741 bp, 246 aa] {ON} YPL031C
           (PHO85) - cyclin-dependent protein kinase [contig 27]
           FULL
          Length = 246

 Score = 81.6 bits (200), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 55/177 (31%), Positives = 90/177 (50%), Gaps = 30/177 (16%)

Query: 525 LYLVMECGDHDLSQILNQR--ANMP--LDVDFIRYYSREMLKCVKVVHDAGIVHSDLKPA 580
           L LV E  D+DL + ++ R   N P   ++  ++Y+  ++L+ V   H+  I+H DLKP 
Sbjct: 22  LTLVFEFMDNDLKKYMDSRIVGNTPYGFEMSLVKYFEWQLLQGVAFCHENRILHRDLKPQ 81

Query: 581 NFVLV-KGILKIIDFGIANA--VPDHTVNIYRDTQIGTPNYMAPEALVALNEVSNVEKKN 637
           N ++  KG LK+ DFG+A A  +P +T +    +++ T  Y AP+ L+     S      
Sbjct: 82  NLLINNKGQLKLGDFGLARAFGIPVNTFS----SEVVTLWYRAPDVLMGSRTYSTS---- 133

Query: 638 RWRVGKPSDIWSCGCIMYQMFYGRPPYGAFQNQNRLLAIMNPEVKIVFSEKTSKNER 694
                   DIWSCGCI+ +M  GRP +    ++ +L        K++F    +  ER
Sbjct: 134 -------IDIWSCGCILAEMITGRPLFPGTNDEEQL--------KLIFETMGTPTER 175

>Kwal_26.7788 s26 (511530..515333) [3804 bp, 1267 aa] {ON} YKL101W
           (HSL1) - Putative protein kinase homologous to S. pombe
           cdr1/nim1 [contig 55] FULL
          Length = 1267

 Score = 86.3 bits (212), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 77/273 (28%), Positives = 119/273 (43%), Gaps = 28/273 (10%)

Query: 458 LGRGGSSKVYKVKNTNNNRVYALKRVVFDEFDDTSVDAFKGXXXXXXXXXXXXXXXXXIQ 517
           LG+G S +V   KN    ++ A+K V   +   T    +                   + 
Sbjct: 64  LGKGSSGRVRLAKNMETGKLAAIKIVPKTKSSRTGSLPYGIEREIIIMKLISHPNVMGLY 123

Query: 518 YQMDNGV-LYLVMECGDH-DLSQILNQRANMPLDVDFIRYYSREMLKCVKVVHDAGIVHS 575
              +N + L+LV+E  D  +L   L  R  +P + + I Y+ R++++     H   I H 
Sbjct: 124 EVWENKLELFLVLEYVDGGELFDYLVSRGRLP-EKEAIHYF-RQIIEGTAYCHGFNICHR 181

Query: 576 DLKPANFVLVKG--ILKIIDFGIANAVPDHTVNIYRDTQIGTPNYMAPEALVALNEVSNV 633
           DLKP N +L K    +KI DFG+A      T N   +T  G+P+Y +PE ++  N     
Sbjct: 182 DLKPENLLLDKKNKRIKIADFGMAAL---QTSNKLLETSCGSPHYASPEIVMGKN----- 233

Query: 634 EKKNRWRVGKPSDIWSCGCIMYQMFYGRPPYGAFQNQNRLLAIMNPEVKIVFSEKTSKNE 693
                   G PSD+WSCG I++ +  G  P+    N  RLL         V + K    +
Sbjct: 234 ------YNGGPSDVWSCGIILFALLTGHLPFND-DNIKRLLL-------KVQAGKYQMPQ 279

Query: 694 RVPKSALDTMKACLIRSPEKRWTADEILDASFL 726
            V   A D +   L+  P+KR + +EIL    L
Sbjct: 280 SVSSGAQDLISRILVVDPDKRISINEILAHPLL 312

>NCAS0A02120 Chr1 (401097..402230) [1134 bp, 377 aa] {ON} Anc_4.184
          Length = 377

 Score = 84.0 bits (206), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 60/214 (28%), Positives = 101/214 (47%), Gaps = 24/214 (11%)

Query: 525 LYLVMECGDHDLSQIL-NQRANMPLDVDFIRYYSREMLKCVKVVHDAGIVHSDLKPANFV 583
           +YLV E  + DL +++ N   N  L  D I+Y++ ++L+ +K +H A ++H DLKP+N +
Sbjct: 90  VYLVQELMETDLQRVISNNNTNKSLTDDHIQYFTYQILRALKSIHSAKVIHRDLKPSNLL 149

Query: 584 LVKGI-LKIIDFGIANAVPDH-----TVNIYRDTQIGTPNYMAPEALVALNEVSNVEKKN 637
           L     LKI DFG++  +        T+  +    + T  Y APE ++   E +      
Sbjct: 150 LNSNCDLKICDFGLSRCLTSSNDSKKTLVGFMTEYVATRWYRAPEIMLTFQEYTTA---- 205

Query: 638 RWRVGKPSDIWSCGCIMYQMFYGRPPYGAFQNQNRLLAIMNPEVKIVFSEKTSKNERVPK 697
                   DIWS GCI+ +M  GRP +      ++L  I+    +++ +      E++  
Sbjct: 206 -------MDIWSVGCILAEMVTGRPLFPGRDYHHQLWLIL----EVLGTPSLEDFEQIKS 254

Query: 698 SALDTMKACLIRSPEKRWTADEILDASFLNPVLV 731
                  A L   P   W  D +L  + LNP L+
Sbjct: 255 KRAREYIANLPLKPPMAW--DIVLSNTNLNPDLI 286

>KLLA0E21693g Chr5 complement(1936438..1939488) [3051 bp, 1016 aa]
           {ON} weakly similar to uniprot|P38692 Saccharomyces
           cerevisiae YHR102W KIC1 Protein kinase of the PAK/Ste20
           kinase family required for cell integrity possibly
           through regulating 1 6-beta-glucan levels in the wall
           physically interacts with Cdc31p (centrin) which is a
           component of the spindle pole body
          Length = 1016

 Score = 85.9 bits (211), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 70/277 (25%), Positives = 122/277 (44%), Gaps = 25/277 (9%)

Query: 452 YERIELLGRGGSSKVYKVKNTNNNRVYALKRVVFDEFDDTSVDAFKGXXXXXXXXXXXXX 511
           ++R E++GRG    VYK  +    +VYA+K +  D  +D   D  K              
Sbjct: 16  FKRKEIIGRGKFGVVYKAFHVKTQQVYAIKVLNLDNTEDEVEDIRKEIQFLSSLKQTPNI 75

Query: 512 XXXXIQYQMDNGVLYLVME-CGDHDLSQILNQRANMPLDVDFIRYYSREMLKCVKVVHDA 570
                 Y +D   L+++ME C    L  +L  R  + ++  +I    RE+L  +  +H  
Sbjct: 76  THYYGSYLIDTK-LWVIMEYCAGGSLRTLL--RPGI-IEEKYIGVIMREILVALISIHRD 131

Query: 571 GIVHSDLKPANFVLV-KGILKIIDFGIANAVPDHTVNIYRDTQIGTPNYMAPEALVALNE 629
            ++H D+K AN ++   G +K+ DFG+A  +    +   R T  GTP +MAPE ++   E
Sbjct: 132 NVIHRDIKAANILIANNGSVKLCDFGVAAQLSQSMLK--RQTMAGTPYWMAPEVIM---E 186

Query: 630 VSNVEKKNRWRVGKPSDIWSCGCIMYQMFYGRPPYGAFQNQNRLLAIMNPEVKIVFSEKT 689
               + K         DIWS G   Y++  G PPY   +    +  I   +   +   + 
Sbjct: 187 GVYYDTK--------VDIWSLGITAYEIATGNPPYCHMEAIRAMQMITKSKPPRLEGREY 238

Query: 690 SKNERVPKSALDTMKACLIRSPEKRWTADEILDASFL 726
           S+  +      + +  CL   P++R  A+E+  +  +
Sbjct: 239 SQPLK------EFIALCLDEDPKERPYAEELFKSKLI 269

>Smik_6.125 Chr6 (201071..202177) [1107 bp, 368 aa] {ON} YGR040W
           (REAL)
          Length = 368

 Score = 83.6 bits (205), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 48/163 (29%), Positives = 86/163 (52%), Gaps = 23/163 (14%)

Query: 525 LYLVMECGDHDLSQILNQR--ANMPLDVDFIRYYSREMLKCVKVVHDAGIVHSDLKPANF 582
           +YLV E  + DL +++N +   +  L  D ++Y++ ++L+ +K +H A ++H D+KP+N 
Sbjct: 90  VYLVEELMETDLQKVINNQNSGSSTLSDDHVQYFTYQILRALKSIHSAQVIHRDIKPSNL 149

Query: 583 VLVKGI-LKIIDFGIANAVPDHTVNIYRDTQIG-------TPNYMAPEALVALNEVSNVE 634
           +L     LK+ DFG+A  +   + +  R+T +G       T  Y APE ++   E +   
Sbjct: 150 LLNSNCDLKVCDFGLARCLASSSDS--RETLVGFMTEYVATRWYRAPEIMLTFQEYTTA- 206

Query: 635 KKNRWRVGKPSDIWSCGCIMYQMFYGRPPYGAFQNQNRLLAIM 677
                      DIWSCGCI+ +M  G+P +      ++L  I+
Sbjct: 207 ----------MDIWSCGCILAEMISGKPLFPGRDYHHQLWLIL 239

>TBLA0H01660 Chr8 complement(377521..380511) [2991 bp, 996 aa] {ON}
           Anc_5.406 YHR102W
          Length = 996

 Score = 85.9 bits (211), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 72/292 (24%), Positives = 127/292 (43%), Gaps = 26/292 (8%)

Query: 452 YERIELLGRGGSSKVYKVKNTNNNRVYALKRVVFDEFDDTSVDAFKGXXXXXXXXXXXXX 511
           Y+R +++G+G    VYK  +  + +V+A+K +  D  D   +   +              
Sbjct: 6   YKRTKVIGKGKFGTVYKGHSIKSKKVFAIKVLNLD-CDINEIQDIQNEIKFLSLLRYAPN 64

Query: 512 XXXXIQYQMDNGVLYLVME-CGDHDLSQILNQRANMPLDVDFIRYYSREMLKCVKVVHDA 570
                   + N  ++++ME C    +  ++        +  +I    RE+L  ++ +H  
Sbjct: 65  ITYYYHSYLINRKIWIIMEYCNGGSVRNLIKIGR---FNEIYISVILRELLYALEYIHHD 121

Query: 571 GIVHSDLKPANFVLVK-GILKIIDFGIANAVPDHTVNIYRDTQIGTPNYMAPEALVALNE 629
            I+H D+K AN ++ + G +K+ DFGIA  +        R T  GTP +MAPE ++   E
Sbjct: 122 NIIHRDIKAANILINQNGGIKLCDFGIAAKL--EFSKPKRQTMAGTPYWMAPEVII---E 176

Query: 630 VSNVEKKNRWRVGKPSDIWSCGCIMYQMFYGRPPYGAFQNQNRLLAIMNPEVKIVFSEKT 689
            S  + K        +DIWS G   Y++  G PPY  +     +  I             
Sbjct: 177 SSLYDTK--------ADIWSVGITAYEITTGNPPYCEYDATKAMQLITK------LKPPR 222

Query: 690 SKNERVPKSALDTMKACLIRSPEKRWTADEILDASFLNPVLVTPY-IVRDLI 740
            + +   KS  + +  CL   P +R T+ ++L+  F+     TP  I+ DLI
Sbjct: 223 LEGKMYSKSLKEFIALCLDEDPSERLTSTKLLETEFIKEYQETPTKILIDLI 274

>YLR113W Chr12 (371620..372927) [1308 bp, 435 aa] {ON}
           HOG1Mitogen-activated protein kinase involved in
           osmoregulation; acts via three independent osmosensors;
           mitophagy-specific regulator; mediates the recruitment
           and activation of RNA Pol II at Hot1p-dependent
           promoters; localization regulated by Ptp2p and Ptp3p
          Length = 435

 Score = 84.3 bits (207), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 68/228 (29%), Positives = 111/228 (48%), Gaps = 43/228 (18%)

Query: 525 LYLVMECGDHDLSQILNQRANMPLDVDFIRYYSREMLKCVKVVHDAGIVHSDLKPANFVL 584
           +Y V E    DL ++L  R   PL+  F++Y+  ++L+ +K VH AG++H DLKP+N ++
Sbjct: 96  IYFVTELQGTDLHRLLQTR---PLEKQFVQYFLYQILRGLKYVHSAGVIHRDLKPSNILI 152

Query: 585 VKGI-LKIIDFGIANAVPDHTVNIYRDTQIGTPNYMAPEALVALNEVSNVEKKNRWRVGK 643
            +   LKI DFG+A  + D  +  Y    + T  Y APE ++   +  +VE         
Sbjct: 153 NENCDLKICDFGLAR-IQDPQMTGY----VSTRYYRAPEIMLTWQKY-DVE--------- 197

Query: 644 PSDIWSCGCIMYQMFYGRPPYGAFQNQNRLLAIMN-----PE--VKIVFSEKTSK----- 691
             DIWS GCI  +M  G+P +    + ++   I +     P+  +  + SE T K     
Sbjct: 198 -VDIWSAGCIFAEMIEGKPLFPGKDHVHQFSIITDLLGSPPKDVINTICSENTLKFVTSL 256

Query: 692 --------NER---VPKSALDTMKACLIRSPEKRWTADEILDASFLNP 728
                   +ER   V   A+D ++  L+  P+KR TA + L   +  P
Sbjct: 257 PHRDPIPFSERFKTVEPDAVDLLEKMLVFDPKKRITAADALAHPYSAP 304

>CAGL0G04609g Chr7 complement(437162..440059) [2898 bp, 965 aa] {ON}
           similar to uniprot|Q12236 Saccharomyces cerevisiae
           YOL100w PKH2
          Length = 965

 Score = 85.5 bits (210), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 71/288 (24%), Positives = 121/288 (42%), Gaps = 48/288 (16%)

Query: 447 VNDIEYERIELL-GRGGSSKVYKVKNTNNNRVYALKRVVFDEFDDTSVDAFK---GXXXX 502
           + D  Y ++ L   +  SSK Y VK  N   +   K+V +   + T++   K   G    
Sbjct: 124 LGDGSYSQVFLATSKTDSSKTYAVKVLNKEYLIKQKKVKYVNIEKTALQNLKSVTGVINL 183

Query: 503 XXXXXXXXXXXXXIQYQMDNGVLYLVMECGDHDLSQILNQRANMPLDVDFIRYYSREMLK 562
                        ++Y  +   L L+ + G       LN+   +        YYS +++ 
Sbjct: 184 SFTFQDEANLYFLLEYAPNGDFLSLIKKFG------TLNEECTI--------YYSAQIID 229

Query: 563 CVKVVHDAGIVHSDLKPANFVLVKGI-LKIIDFGIA---------NAVPDHTVNIYRDTQ 612
            +  +H  GI+H D+KP N +L   + +K+ DFG A         N  P + +     + 
Sbjct: 230 AIGSMHSHGIIHRDIKPENILLDGNMKIKLTDFGTAKLLQKKSDKNGKPHYNLLTRSSSF 289

Query: 613 IGTPNYMAPEALVALNEVSNVEKKNRWRVGKPSDIWSCGCIMYQMFYGRPPYGAFQNQNR 672
           +GT  Y++PE L         +    ++     DIW+ GC++YQM  G+PP+ A      
Sbjct: 290 VGTAEYVSPELLS--------DNYTDYKC----DIWAFGCLVYQMIAGKPPFKATNEYLT 337

Query: 673 LLAIMNPEVKIVFSEKTSKNERVPKSALDTMKACLIRSPEKRWTADEI 720
              +M  +V+  F+         P    D +K  L++ PEKR T  +I
Sbjct: 338 FQKVM--KVQFAFTAG------FPTIIRDLVKNILVKQPEKRLTIPQI 377

>YCR073C Chr3 complement(242588..246583) [3996 bp, 1331 aa] {ON}
            SSK22MAP kinase kinase kinase of the HOG1
            mitogen-activated signaling pathway; functionally
            redundant with, and homologous to, Ssk2p; interacts with
            and is activated by Ssk1p; phosphorylates Pbs2p
          Length = 1331

 Score = 85.9 bits (211), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 78/323 (24%), Positives = 140/323 (43%), Gaps = 47/323 (14%)

Query: 450  IEYERIELLGRGGSSKVYKVKNTNNNRVYALKRVVFDEFDDTSVDAFKGXXXXXXXXXXX 509
            + +++   +G G   +VY   N  N  + A+K +     D T++                
Sbjct: 1032 MRWQKRSFIGGGTFGQVYSAINLENGEILAVKEIKIH--DTTTMKKIFPLIKEEMTVLEM 1089

Query: 510  XXXXXXIQY---QMDNGVLYLVME-CGDHDLSQILNQRANMPLDVDFIRYYSREMLKCVK 565
                  +QY   ++    + + ME C    L+ +L+       D    + Y+ E+L+ + 
Sbjct: 1090 LNHPNIVQYYGVEVHRDKVNIFMEYCEGGSLASLLDH--GRIEDEMVTQVYTFELLEGLA 1147

Query: 566  VVHDAGIVHSDLKPANFVL-VKGILKIIDFGIANAVPDHTVNIYRDTQI----------- 613
             +H +G+VH D+KP N +L   GI+K +DFG A  V        R+  +           
Sbjct: 1148 YLHQSGVVHRDIKPENILLDFNGIIKYVDFGTARTVVGSRTRTVRNAAVQDFGVETKSLN 1207

Query: 614  ---GTPNYMAPEALVALNEVSNVEKKNRWRVGKPSDIWSCGCIMYQMFYGRPPYGAFQNQ 670
               GTP YMAPE +      S V+ K    +G   D+W+ GC++ +M  GR P+    N+
Sbjct: 1208 EMMGTPMYMAPETISG----SAVKGK----LG-ADDVWALGCVVLEMATGRRPWSNLDNE 1258

Query: 671  NRLLAIMNPEVKIVFSEKTSKNERVPKSALDTMKACLIRSPEKRWTADEILDASFLNPVL 730
                AIM         +  +++E +  +    ++ CL++ P  R TA E+         L
Sbjct: 1259 ---WAIMYHVAAGRIPQLPNRDE-MTAAGRAFLERCLVQDPTMRATAVEL---------L 1305

Query: 731  VTPYIVRDLIRNAVYYGSDQGQV 753
            + P++++  IR   +  S++ QV
Sbjct: 1306 IDPWMIQ--IREIAFGNSEKDQV 1326

>KLTH0D06006g Chr4 complement(532589..535453) [2865 bp, 954 aa] {ON}
           similar to uniprot|Q03497 Saccharomyces cerevisiae
           YHL007C STE20 Signal transducing kinase of the PAK (p21-
           activated kinase) family involved in pheromone response
           and pseudohyphal/invasive growth pathways activated by
           Cdc42p binds Ste4p at a GBB motif present in
           noncatalytic domains of PAK kinases
          Length = 954

 Score = 85.5 bits (210), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 58/185 (31%), Positives = 87/185 (47%), Gaps = 40/185 (21%)

Query: 553 IRYYSREMLKCVKVVHDAGIVHSDLKPANFVL-VKGILKIIDFGIANAVPDHTVNIYRDT 611
           I   SRE LK ++ +H  G++H D+K  N +L + G +K+ DFG    +  + +N+ R T
Sbjct: 762 IGAVSRETLKGLQFLHSKGVIHRDIKSDNILLSMTGEIKLTDFGFCAQI--NEINLKRTT 819

Query: 612 QIGTPNYMAPEALVALNEVSNVEKKNRWRVGKPSDIWSCGCIMYQMFYGRPPYGAFQNQN 671
            +GTP +MAPE +            +R   G   DIWS G ++ +M  G PPY    N+ 
Sbjct: 820 MVGTPYWMAPEVV------------SRKEYGPKVDIWSLGIMIIEMIEGEPPY---LNET 864

Query: 672 RLLAIM------NPEVKIVFSEKTSKNERVPKSALDTMKA----CLIRSPEKRWTADEIL 721
            L A+        PE+K               S  D +K     CL   P++R TA E+L
Sbjct: 865 PLRALYLIATNGTPELKDA------------DSLSDDLKGFLGWCLHVDPDERATASELL 912

Query: 722 DASFL 726
              F+
Sbjct: 913 SDPFI 917

>KAFR0F03900 Chr6 (763094..764203) [1110 bp, 369 aa] {ON} Anc_4.184
           YGR040W
          Length = 369

 Score = 83.2 bits (204), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 68/240 (28%), Positives = 111/240 (46%), Gaps = 52/240 (21%)

Query: 525 LYLVMECGDHDLSQILNQRA---NMPLDVDFIRYYSREMLKCVKVVHDAGIVHSDLKPAN 581
           +YLV E  + DL +I+N  A      L  D I+Y++ ++L+ +K +H A ++H DLKP+N
Sbjct: 90  VYLVQELMETDLQKIINNSATGLGSTLTDDHIQYFTYQILRALKSIHSAKVIHRDLKPSN 149

Query: 582 FVLVKGI-LKIIDFGIANAVPDHTVNIYRDTQIG-------TPNYMAPEALVALNEVSNV 633
            +L     LK+ DFG+A  +   + +  R+T +G       T  Y APE +++  E +  
Sbjct: 150 LLLNSNCDLKVCDFGLARCLASSSDS--RETLVGIMTEYVATRWYRAPEIMLSFQEYTTA 207

Query: 634 EKKNRWRVGKPSDIWSCGCIMYQMFYGRPPYGAFQNQNRLLAIM----NPEVKIVFSEKT 689
                       DIWS GCI+ +M  G+P +      ++L  I+     PE    F +  
Sbjct: 208 -----------MDIWSVGCILAEMVSGKPLFPGRDYHHQLWYILEVLGTPEYD-DFRQIK 255

Query: 690 SKNER-----VPKSA------------------LDTMKACLIRSPEKRWTADEILDASFL 726
           SK  +     +P  A                  LD +   L+ +P+KR +A E L   +L
Sbjct: 256 SKRAKEYIANLPMKAPMSWGVVFANRKDLNPDMLDLLTKMLMFNPDKRISAAEALKHPYL 315

>Kwal_23.6458 s23 (1592349..1594955) [2607 bp, 868 aa] {ON} YNR047W
           - Hypothetical ORF [contig 18] FULL
          Length = 868

 Score = 85.5 bits (210), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 78/294 (26%), Positives = 123/294 (41%), Gaps = 45/294 (15%)

Query: 445 VSVNDIEYERIELLGRGGSSKVYKVKNTNNNRVYALKRVVFDEFDDTSVDAFKGXXXXXX 504
           V V    +E+I+LLG+G   KVY VK    NR+YALK  +F + +       K       
Sbjct: 457 VIVGPQSFEKIKLLGQGDVGKVYLVKEKKTNRLYALK--IFSKEEMIKRKKIKRILAEQE 514

Query: 505 XXXXXXXXXXXIQYQ--MDNGVLYLVME-CGDHDLSQILNQRANMPLDVDFIRYYSREML 561
                        Y        LYL ME C   +  + L  R    +D D  R+YS E++
Sbjct: 515 ILATSNHPFIVTLYHSFQSEDYLYLCMEYCMGGEFFRALQTRKTKCIDEDDARFYSSEVV 574

Query: 562 KCVKVVHDAGIVHSDLKPANFVLVK-GILKIIDFGIANAVPDHTVNIYR--------DTQ 612
             ++ +H  G ++ DLKP N +L K G + + DF ++    D    + +        DT+
Sbjct: 575 AAIEYLHLMGFIYRDLKPENILLHKSGHIMLSDFDLSVQAKDTKNPVVKGSAQSSLLDTK 634

Query: 613 I-----------GTPNYMAPEALVALNEVSNVEKKNRWRVGKPSDIWSCGCIMYQMFYGR 661
           I           GT  Y+APE +      + V            D W+ G ++Y+M +G 
Sbjct: 635 ICSDGFRTNSFVGTEEYIAPEVIRGNGHTAAV------------DWWTLGILIYEMLFGF 682

Query: 662 PPYGAFQNQNRLLA-IMNPEVKIVFSEKTSKNERVPKSALDTMKACLIRSPEKR 714
            PY    N N+  + ++  EV          N  V ++  D ++  LI+S  +R
Sbjct: 683 TPYKG-DNTNKTFSNVLKNEVSF------PNNNEVSRNCKDLIRKLLIKSETRR 729

>KNAG0K00680 Chr11 (120919..124206) [3288 bp, 1095 aa] {ON} Anc_3.92
           YDR490C
          Length = 1095

 Score = 85.5 bits (210), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 62/223 (27%), Positives = 100/223 (44%), Gaps = 36/223 (16%)

Query: 521 DNGVLYLVMECG-DHDLSQILNQRANMPLDVDFIRYYSREMLKCVKVVHDAGIVHSDLKP 579
           D   LY ++E   + D   ++ +  +  L+ D  +YYS +++  +  +H  GIVH D+KP
Sbjct: 217 DEASLYFLLEFAPNGDFLSLMKKFGS--LNEDAAKYYSAQIIDAIGFLHSRGIVHRDMKP 274

Query: 580 ANFVLVKGI-LKIIDFGIANAV------------PDHTVNIYRDTQIGTPNYMAPEALVA 626
            N +L K   +KI DFG A  +            P++ +     + +GT  Y++PE L  
Sbjct: 275 ENILLDKNWKIKITDFGTAKILEKTAQQEAGGSGPEYNLLTRSKSFVGTAEYVSPELL-- 332

Query: 627 LNEVSNVEKKNRWRVGKPSDIWSCGCIMYQMFYGRPPYGAFQNQNRLLAIMNPEVKIVFS 686
                     N   V    DIW+ GCI+YQM  G+PP+ A         +M  +V+  F+
Sbjct: 333 ----------NDSFVDYRCDIWAFGCIVYQMLAGKPPFKATNEYLTFQKVM--KVQYAFT 380

Query: 687 EKTSKNERVPKSALDTMKACLIRSPEKRWTADEILDASFLNPV 729
                    P    D +K  L++  +KR T  +I    F   V
Sbjct: 381 AG------FPLVIRDLVKRILVKDLDKRLTVQQIQRHHFFKGV 417

>NDAI0E03170 Chr5 complement(677441..678392,678524..678543) [972 bp,
           323 aa] {ON} Anc_8.482
          Length = 323

 Score = 82.8 bits (203), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 61/224 (27%), Positives = 109/224 (48%), Gaps = 24/224 (10%)

Query: 445 VSVNDIEYERIELLGRGGSSKVYKVKNTNNNRVYALKRVVFDEFDDTSVDAFKGXXXXXX 504
           +S +  +++++E LG G  + VYK  N +     ALK V  D  + T   A +       
Sbjct: 1   MSSSSSQFKQLEKLGNGTYATVYKGLNKSTGAFVALKEVKLDSEEGTPSTAIREISLMKE 60

Query: 505 XXXXXXXXXXXIQYQMDNGVLYLVMECGDHDLSQILNQRA--NMP--LDVDFIRYYSREM 560
                      + +  +   L LV E  D+DL + ++ ++  N P  L+++ ++Y+  ++
Sbjct: 61  LKHENIVRLYDVIHTENK--LTLVFEYMDNDLKKYMDSQSTGNTPRGLELNLVKYFQWQL 118

Query: 561 LKCVKVVHDAGIVHSDLKPANFVL-VKGILKIIDFGIANA--VPDHTVNIYRDTQIGTPN 617
            + +   H+  I+H DLKP N ++  KG LK+ DFG+A A  +P +T +    +++ T  
Sbjct: 119 FEGLAFCHENKILHRDLKPQNLLINKKGQLKLGDFGLARAFGIPVNTFS----SEVVTLW 174

Query: 618 YMAPEALVALNEVSNVEKKNRWRVGKPSDIWSCGCIMYQMFYGR 661
           Y AP+ L+     +              DIWSCGCI+ +M  G+
Sbjct: 175 YRAPDVLMGSRTYTT-----------SIDIWSCGCILAEMITGK 207

>TDEL0D05320 Chr4 complement(965082..968255) [3174 bp, 1057 aa] {ON}
           Anc_3.92 YDR490C
          Length = 1057

 Score = 85.5 bits (210), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 61/215 (28%), Positives = 96/215 (44%), Gaps = 31/215 (14%)

Query: 521 DNGVLYLVME-CGDHDLSQILNQRANMPLDVDFIRYYSREMLKCVKVVHDAGIVHSDLKP 579
           D   LY ++E   + D   I+ +  +  L+ D   YYS +++  +  +H  GIVH D+KP
Sbjct: 237 DESSLYFLLEYAPNGDFLSIMKKYGS--LNEDCACYYSAQIIDAIDFLHSKGIVHRDIKP 294

Query: 580 ANFVLVKGI-LKIIDFGIA-------NAVPDHTVNIYRDTQIGTPNYMAPEALVALNEVS 631
            N +L K   +K+ DFG A       N    + +     + +GT  Y++PE L       
Sbjct: 295 ENILLDKDFKVKLTDFGTAKILEPKPNTTDSYDLLSRSKSFVGTAEYVSPELL------- 347

Query: 632 NVEKKNRWRVGKPSDIWSCGCIMYQMFYGRPPYGAFQNQNRLLAIMNPEVKIVFSEKTSK 691
                N   V    DIW+ GCI++QM  G+PP+ A         +M  +V+  F+     
Sbjct: 348 -----NDNYVDYRCDIWAFGCILFQMIAGKPPFKATNEYLTFQKVM--KVQYAFTAG--- 397

Query: 692 NERVPKSALDTMKACLIRSPEKRWTADEILDASFL 726
               P    D +K  LI+ P +R T  +I    F 
Sbjct: 398 ---FPLVVRDLVKGILIKQPAQRLTIPQIKSHHFF 429

>Suva_2.157 Chr2 complement(275484..277064) [1581 bp, 526 aa] {ON}
           YBR028C (REAL)
          Length = 526

 Score = 84.3 bits (207), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 83/331 (25%), Positives = 137/331 (41%), Gaps = 70/331 (21%)

Query: 432 PTSMTNRKSSKSIVSVNDIEYERIELLGRGGSSKVYKVKNTNNNRVYALKRVVFDEF--D 489
           P  M +   +++ +S N  +++ + +LG+G   KV  VK+TN +++YA+K++   E    
Sbjct: 109 PQDMISSNINENELSRNLHDFKPVRVLGQGAYGKVILVKDTNTSKLYAMKQLQKAEILIS 168

Query: 490 DTSVDAFK---------------GXXXXXXXXXXXXXXXXXIQYQ---------MDNGVL 525
            T  D+ K               G                 I++           DN  L
Sbjct: 169 PTVTDSNKENEENNSAANNDNDNGLSKRLERTFAERSILSEIEHPNIVKLFYSFHDNSKL 228

Query: 526 YLVME-CGDHDLSQILNQRANMPLDVDFIRYYSREMLKCVKVVHDAGIVHSDLKPANFVL 584
           YL+++     +L   L +     LD   + +Y+ E+   ++ +H  G+V+ DLKP N +L
Sbjct: 229 YLLLQYIPGGELFYHLKEHGT--LDETTVSFYAAEISCALRFLHTKGVVYRDLKPENCLL 286

Query: 585 VK-GILKIIDFGIANAVPDHTVNIYRDTQ--------IGTPNYMAPEALVALNEVSNVEK 635
            + G L + DFG++    D ++    D +        IGTP Y APE L       N   
Sbjct: 287 NQNGHLVLTDFGLSKKSADDSMANEEDPENVNTLHSIIGTPEYCAPEILSGQAYTQNC-- 344

Query: 636 KNRWRVGKPSDIWSCGCIMYQMFYGRPPYGAFQNQNRLLAIMNPEVKIVFSEKTSKNERV 695
                     D +S GC++Y M  G+PPY      N    I+N         K  +N++ 
Sbjct: 345 ----------DWYSLGCLLYDMLVGKPPYTG----NNHKVIIN---------KIQQNKQG 381

Query: 696 PKSAL-------DTMKACLIRSPEKRWTADE 719
           PK          D + A L +   KRW  D+
Sbjct: 382 PKIPFYLSEGMKDMLNALLKKETSKRWNVDK 412

>Skud_11.126 Chr11 (235011..239567) [4557 bp, 1518 aa] {ON} YKL101W
           (REAL)
          Length = 1518

 Score = 85.5 bits (210), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 59/205 (28%), Positives = 98/205 (47%), Gaps = 27/205 (13%)

Query: 525 LYLVMECGDH-DLSQILNQRANMPLDVDFIRYYSREMLKCVKVVHDAGIVHSDLKPANFV 583
           LYLV+E  D  +L   L  +  +P + + I Y+ +++++ V   H   I H DLKP N +
Sbjct: 189 LYLVLEYVDGGELFDYLVSKGKLP-EREAIHYF-KQIVEGVSFCHSFNICHRDLKPENLL 246

Query: 584 LVKG--ILKIIDFGIANAVPDHTVNIYRDTQIGTPNYMAPEALVALNEVSNVEKKNRWRV 641
           L K    +KI DFG+A        N    T  G+P+Y +PE ++            R   
Sbjct: 247 LDKKNRKIKIADFGMAAL---ELPNKLLKTSCGSPHYASPEIVMG-----------RPYH 292

Query: 642 GKPSDIWSCGCIMYQMFYGRPPYGAFQNQNRLLAIMNPEVKIVFSEKTSKNERVPKSALD 701
           G PSD+WSCG +++ +  G  P+     +  LL + + + ++  +        +   A D
Sbjct: 293 GGPSDVWSCGIVLFALLTGHLPFNDDNIKKLLLKVQSGKYQMPMN--------LSAEARD 344

Query: 702 TMKACLIRSPEKRWTADEILDASFL 726
            +   L+ +PEKR T  EIL+   +
Sbjct: 345 LISKILVINPEKRITTQEILNHPLI 369

>Kwal_23.5576 s23 complement(1223517..1225031) [1515 bp, 504 aa]
           {ON} YHR030C (SLT2) - serine/threonine MAP kinase
           [contig 11] FULL
          Length = 504

 Score = 84.3 bits (207), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 76/279 (27%), Positives = 128/279 (45%), Gaps = 48/279 (17%)

Query: 522 NGVLYLVMECGDHDLSQILNQRANMPLDVDFIRYYSREMLKCVKVVHDAGIVHSDLKPAN 581
           NG LYL  E  + D+ QI+  ++  PL     + +  ++L  +K +H A ++H DLKP N
Sbjct: 102 NG-LYLYEELMECDIHQII--KSGQPLTDAHYQSFIYQLLCALKYIHSADVLHRDLKPGN 158

Query: 582 FVL-VKGILKIIDFGIANAVPDHTV--NIYRDTQIGTPNYMAPEALVALNEVSNVEKKNR 638
            ++     LK+ DFG+A    ++ V  N +    + T  Y APE +++    +       
Sbjct: 159 LLVNADCQLKVCDFGLARGYSENPVENNQFLTEYVATRWYRAPEIMLSYQGYT------- 211

Query: 639 WRVGKPSDIWSCGCIMYQMFYGRPPYGA--FQNQ-NRLLAIMNPEVKIVFSEKTSKNER- 694
               K  DIWSCGCI+ ++  G+P +    + +Q NR+L ++    +       SKN + 
Sbjct: 212 ----KAIDIWSCGCILAELLGGKPIFKGKDYVDQLNRILQVLGTPPEETLERIGSKNVQD 267

Query: 695 -------VPK------------SALDTMKACLIRSPEKRWTADEILDASFLNPVLVTPYI 735
                  +PK             ALD ++  L   P+KR T +E L+  +L+       I
Sbjct: 268 YIHQLGYIPKVPFVTLYPQANVQALDLLEKMLTFDPQKRITVEEALEHPYLS-------I 320

Query: 736 VRDLIRNAVYYGS-DQGQVSEDKITELADDVLNRLADFR 773
             D     V     D G  S +++ +L   +L+ + DFR
Sbjct: 321 WHDPTDEPVCTEKFDFGFESVNEMEDLKQMILDEVRDFR 359

>Ecym_7392 Chr7 complement(803240..807544) [4305 bp, 1434 aa] {ON}
           similar to Ashbya gossypii ABL034W
          Length = 1434

 Score = 85.5 bits (210), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 61/205 (29%), Positives = 96/205 (46%), Gaps = 27/205 (13%)

Query: 525 LYLVME-CGDHDLSQILNQRANMPLDVDFIRYYSREMLKCVKVVHDAGIVHSDLKPANFV 583
           LYLV+E     +L   L  R  +P + + + Y+ +++++ V   H   I H DLKP N +
Sbjct: 142 LYLVLEYVEGGELFDYLISRGKLP-EQEAVHYF-KQIVQGVSYCHHFNICHRDLKPENLL 199

Query: 584 LVKGIL--KIIDFGIANAVPDHTVNIYRDTQIGTPNYMAPEALVALNEVSNVEKKNRWRV 641
           L K  L  KI DFG+A      T +   +T  G+P+Y +PE ++            ++  
Sbjct: 200 LDKKNLSVKIADFGMAAL---ETTDKLLETSCGSPHYASPEIVMG----------QKYH- 245

Query: 642 GKPSDIWSCGCIMYQMFYGRPPYGAFQNQNRLLAIMNPEVKIVFSEKTSKNERVPKSALD 701
           G PSD+WSCG I++ +  G  P+     +  LL +         S K    + +   A D
Sbjct: 246 GSPSDVWSCGIILFALLTGHLPFNDDNVKKLLLKVQ--------SGKYQMPQNISNEAKD 297

Query: 702 TMKACLIRSPEKRWTADEILDASFL 726
            +   LI  P  R T DE+L+   L
Sbjct: 298 LIAKILIVDPAMRITIDEVLEHPLL 322

>CAGL0K08514g Chr11 complement(854143..858612) [4470 bp, 1489 aa]
           {ON} similar to uniprot|P34244 Saccharomyces cerevisiae
           YKL101w serine/threonine-protein kinase
          Length = 1489

 Score = 85.5 bits (210), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 60/219 (27%), Positives = 104/219 (47%), Gaps = 29/219 (13%)

Query: 525 LYLVMECGDH-DLSQILNQRANMPLDVDFIRYYSREMLKCVKVVHDAGIVHSDLKPANFV 583
           LYLV+E  D  +L   L  +  +  + + + Y++ ++++ V   H   I H DLKP N +
Sbjct: 201 LYLVLEYVDGGELFDYLVSKGKLS-EPEAVHYFT-QIIQGVSYCHSFNICHRDLKPENLL 258

Query: 584 LVKG--ILKIIDFGIAN-AVPDHTVNIYRDTQIGTPNYMAPEALVALNEVSNVEKKNRWR 640
           L K   ++KI DFG+A   +P+  +    +T  G+P+Y +PE ++            +  
Sbjct: 259 LDKKNKVIKIADFGMAALELPNKLL----ETSCGSPHYASPEIVMG-----------KPY 303

Query: 641 VGKPSDIWSCGCIMYQMFYGRPPYGAFQNQNRLLAIMNPEVKIVFSEKTSKNERVPKSAL 700
            G PSD+WSCG I++ +  G  P+     +  LL +     ++           +   A 
Sbjct: 304 HGGPSDVWSCGIILFALLTGHLPFNDDNIKKLLLKVQAGRFQLP--------PYLTNDAK 355

Query: 701 DTMKACLIRSPEKRWTADEILDASFLNPVLVTPYIVRDL 739
           D +   L+ +PEKR T +EIL+   +      P  +R L
Sbjct: 356 DLITRILVTNPEKRLTINEILNHPLIKKYRNPPAHIRKL 394

>TPHA0M01500 Chr13 (317999..319291) [1293 bp, 430 aa] {ON} Anc_3.338
           YPR054W
          Length = 430

 Score = 83.6 bits (205), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 91/366 (24%), Positives = 157/366 (42%), Gaps = 72/366 (19%)

Query: 415 DNKEGQKIVKKVEIVEPPTSMTNRKSSKSIVSVNDIEYERIELLGRGGSSKVYKVKNTN- 473
           D K  +K  +++E   P    T  +SSK  VS+    YE +++LG+G    V  V++ N 
Sbjct: 28  DIKNSKKPTEQIE--GPRVPRTIHESSK--VSLPQ-RYEVVQVLGKGSYGIVCSVRDLNS 82

Query: 474 --NNRVYALKRVVFDEFDDT----SVDAFKGXXXXXXXXXXXXXXXXXIQYQMDNGVLYL 527
             NN + A+K++    + +     ++   K                  I        LY 
Sbjct: 83  NTNNALLAVKKITNIFYKEILIKRAIRELKFIKYFRGHKNIVSLLDVDIVLDAPYDGLYC 142

Query: 528 VMECGDHDLSQILNQRANMPLDVDFIRYYSREMLKCVKVVHDAGIVHSDLKPANFVL-VK 586
             E  D+DL+++++  +++ L    I+Y+  ++L  +K +H A ++H DLKP N +  + 
Sbjct: 143 YQELIDYDLAKVVH--SSVLLTEFHIKYFFYQILCGLKYIHSADVLHRDLKPGNILCTLN 200

Query: 587 GILKIIDFGIANAV----------------PDHTVNIYRDTQIGTPNYMAPEALVALNEV 630
           G LKI DFG+A  +                P    N+     + T  Y APE +++ NE 
Sbjct: 201 GTLKICDFGLARGISQTVLQKANRQNSTNEPVQYYNLDITNYVATRWYRAPELILSHNEY 260

Query: 631 SNVEKKNRWRVGKPSDIWSCGCIMYQMFYGRPPYGAFQNQNRLLAIM-------NPEVKI 683
                       K  DIWSCGCI+ + FYGR P   F  ++ +  I        +P  ++
Sbjct: 261 D-----------KSIDIWSCGCILAE-FYGRKP--VFMGKDAMHQIFEIIKVIGSPSKEL 306

Query: 684 VFSEKTSKNERVPKS--------------------ALDTMKACLIRSPEKRWTADEILDA 723
           + +  +SK+  V  S                    A D M+  +    + R+T +E ++ 
Sbjct: 307 LETYGSSKSWTVYNSNMINYKKKEWSEVYPHATAQATDLMENLMKWVSKDRYTVEEAIEH 366

Query: 724 SFLNPV 729
            FL+ V
Sbjct: 367 PFLSDV 372

>TDEL0A02010 Chr1 (365325..366782) [1458 bp, 485 aa] {ON} Anc_2.425
           YKL139W
          Length = 485

 Score = 84.0 bits (206), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 80/288 (27%), Positives = 131/288 (45%), Gaps = 51/288 (17%)

Query: 393 KIHISESRESQSSTVEKPHTFQDNKEGQKIVKKVEIVEPPTSMTNRKSSKSIVSVNDIEY 452
           K+ +S   + +SS+V K          Q I +K   V PP+ +T  + S    SV    Y
Sbjct: 112 KVAMSRYNDGKSSSVTK----------QAIEEKK--VPPPSLLTQIRDS----SV----Y 151

Query: 453 ERIELLGRGGSSKVYKVKNTNNNRVYALKRVVFD-EFDDTSVDAFKGXXXXXXXXXXXXX 511
           ERI  +G G   KVYK ++T   ++ ALKR+  + E +   + + +              
Sbjct: 152 ERILQVGEGTYGKVYKARSTVTGKIVALKRLRLEGEREGFPITSIREIKLLQSFDHPNVS 211

Query: 512 XXXXIQYQMDNGVLYLVMECGDHDLSQILNQRANMPLDVDF--IRYYSREMLKCVKVVHD 569
               I  +    V Y++ E  D+DLS +L    N  +D+D    ++   ++L+ ++ +H 
Sbjct: 212 TLNEIMVESQKTV-YMIFEYADNDLSGLL---LNKQIDIDAAQCKHIFEQLLRGMEYLHG 267

Query: 570 AGIVHSDLKPANFVLV-KGILKIIDFGIANAV---PDHTVNIYRDTQIGTPNYMAPEALV 625
            GI+H D+K +N ++  KG L+I DFG+A  V    D+T       ++ T  Y  PE L+
Sbjct: 268 NGILHRDIKGSNILIDNKGQLRITDFGLARKVKAESDYT------NRVITLWYRPPELLL 321

Query: 626 ALNEVSNVEKKNRWRVGKPSDIWSCGCIMYQMFYGRPPYGAFQNQNRL 673
                           G   D+W CGC++ ++F        FQ QN L
Sbjct: 322 GTTN-----------YGPEVDMWGCGCVLVELFNK---VAIFQGQNEL 355

>ACL006W Chr3 (344395..346521) [2127 bp, 708 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YMR001C (CDC5)
          Length = 708

 Score = 84.7 bits (208), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 64/235 (27%), Positives = 110/235 (46%), Gaps = 27/235 (11%)

Query: 439 KSSKSIVSVNDIEYERIELLGRGGSSKVYKVKNTNNNRVYALKRVVFDEFDDTSVDAFKG 498
           K+  S++     +Y R   LG GG ++ +++K+ ++ +V+A K V        S+ + K 
Sbjct: 60  KTPPSLIKTKGRDYHRGMFLGEGGFARCFQMKD-DSGKVFAAKTVA-----KISIKSEKT 113

Query: 499 XXXXXXXXXXXXXXXX--XIQYQ---MDNGVLYLVME-CGDHDLSQILNQRANMPLDVDF 552
                              +Q+     D+  +Y+++E C +  L  +L QR    L    
Sbjct: 114 RKKLLSEIQIHKSMKHPNIVQFTDCFEDDTNVYILLEICPNGSLMDLLKQRKQ--LTEPE 171

Query: 553 IRYYSREMLKCVKVVHDAGIVHSDLKPANFVLVKGI-LKIIDFGIANAVPDHTVNIYRDT 611
           +R+++ +++  +K +H   I+H DLK  N    K   LKI DFG+A  + +     Y  T
Sbjct: 172 VRFFTTQIVGAIKYMHSRRIIHRDLKLGNIFFDKHFNLKIGDFGLAAVLANDRERKY--T 229

Query: 612 QIGTPNYMAPEALVALNEVSNVEKKNRWRVGKPSDIWSCGCIMYQMFYGRPPYGA 666
             GTPNY+APE L   +   + E           DIWS G ++Y +  G+PP+ A
Sbjct: 230 ICGTPNYIAPEVLTGKHTGHSFE----------VDIWSIGVMIYALLIGKPPFQA 274

>Kpol_1040.20 s1040 (57057..60950) [3894 bp, 1297 aa] {ON}
            (57057..60950) [3894 nt, 1298 aa]
          Length = 1297

 Score = 85.1 bits (209), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 61/198 (30%), Positives = 98/198 (49%), Gaps = 30/198 (15%)

Query: 530  ECGDHDLSQILNQRANMPLDVDFIRYYSREMLKCVKVVHDAGIVHSDLKPANFVL-VKGI 588
            E G  DL  ++  + NM  +V+  +    +++  +K +HD GIVH D+K  N ++  +G 
Sbjct: 1127 ETGCIDLFDLIEFKTNMS-EVE-TKLIFMQVVSSIKFLHDQGIVHRDIKDENVIVDSQGF 1184

Query: 589  LKIIDFGIANAVPDHTVNIYRDTQIGTPNYMAPEALVALNEVSNVEKKNRWRVGKPSDIW 648
            +K+IDFG A  V     +++    +GT +Y APE L                VGKP DIW
Sbjct: 1185 IKLIDFGSAAYVKSGPFDVF----VGTIDYAAPEVL-----------GGEPYVGKPQDIW 1229

Query: 649  SCGCIMYQMFYGRPPYGAFQNQNRLLAIMNPEVKIVFSEKTSKNERVPKSALDTMKACLI 708
            + G ++Y + +   P   F N + +L     E ++ F+  T   E      +D +K  L 
Sbjct: 1230 AIGILLYTIIFKENP---FYNIDEIL-----EAELKFNTSTGACE----DCVDLIKRILT 1277

Query: 709  RSPEKRWTADEILDASFL 726
            R+P KR T DEI +  +L
Sbjct: 1278 RNPTKRPTIDEIYNDKWL 1295

>Smik_8.42 Chr8 complement(74075..76894) [2820 bp, 939 aa] {ON}
           YHL007C (REAL)
          Length = 939

 Score = 85.1 bits (209), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 73/284 (25%), Positives = 123/284 (43%), Gaps = 37/284 (13%)

Query: 450 IEYERIELLGRGGSSKVYKVKNTNNNRVYALKRVVFD-----EFDDTSVDAFKGXXXXXX 504
           I+Y  +  +G+G S  VY       N   A+K++  +     E     +   KG      
Sbjct: 620 IKYANLVKIGQGASGGVYTAYEIGTNVSVAIKQMNLEKQPKKELIINEILVMKGSRHPNI 679

Query: 505 XXXXXXXXXXXIQYQMDNGVLYLVMECGDH-DLSQILNQRANMPLDVDFIRYYSREMLKC 563
                      I   +  G L+++ME  +   L+ ++       L    I    RE L  
Sbjct: 680 VNF--------IDSYVLKGDLWVIMEYMEGGSLTDVVTHCI---LTEGQIGAVCRETLSG 728

Query: 564 VKVVHDAGIVHSDLKPANFVL-VKGILKIIDFGIANAVPDHTVNIYRDTQIGTPNYMAPE 622
           +K +H  G++H D+K  N +L ++G +K+ DFG    +  + +N+ R T +GTP +MAPE
Sbjct: 729 LKFLHSKGVLHRDIKSDNILLSMEGDIKLTDFGFCAQI--NELNLKRTTMVGTPYWMAPE 786

Query: 623 ALVALNEVSNVEKKNRWRVGKPSDIWSCGCIMYQMFYGRPPYGAFQNQNRLLAIMNPEVK 682
            +            +R   G   DIWS G ++ +M  G PPY    N+  L A+    + 
Sbjct: 787 VV------------SRKEYGPKVDIWSLGIMIIEMIEGEPPY---LNETPLRALY--LIA 829

Query: 683 IVFSEKTSKNERVPKSALDTMKACLIRSPEKRWTADEILDASFL 726
              + K  + E +  S    +  CL   PE+R +A E+L   ++
Sbjct: 830 TNGTPKLKEPENLSSSLKKFLDWCLCVEPEERASATELLHDEYI 873

>Kpol_1054.2 s1054 complement(4365..7655) [3291 bp, 1096 aa] {ON}
           complement(4365..7655) [3291 nt, 1097 aa]
          Length = 1096

 Score = 85.1 bits (209), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 60/220 (27%), Positives = 101/220 (45%), Gaps = 35/220 (15%)

Query: 521 DNGVLYLVME-CGDHDLSQILNQRANMPLDVDFIRYYSREMLKCVKVVHDAGIVHSDLKP 579
           D   LY ++E   + D   ++ +  +M  + D   YYS +++  +  VH  GI+H D+KP
Sbjct: 281 DEASLYFLLEYAPNGDFLSLIKKFGSM--NEDCASYYSAQIIDAIHFVHSRGIIHRDIKP 338

Query: 580 ANFVLVKGI-LKIIDFGIANAV---------PDHTVNIYRDTQ--IGTPNYMAPEALVAL 627
            N +L   + +K+ DFG A  +            T ++   ++  +GT  Y++PE L   
Sbjct: 339 ENILLDSEMKVKLTDFGTAKILEPKSSSSSSKHETYDLLTRSKSFVGTAEYVSPELL--- 395

Query: 628 NEVSNVEKKNRWRVGKPSDIWSCGCIMYQMFYGRPPYGAFQNQNRLLAIMNPEVKIVFSE 687
                    N        DIW+ GCI++QM  G+PP+ A         +M  +V+  F+ 
Sbjct: 396 ---------NDSYADSRCDIWAFGCIVFQMIAGKPPFKATNEYLTFQKVM--KVQYAFTA 444

Query: 688 KTSKNERVPKSALDTMKACLIRSPEKRWTADEILDASFLN 727
                   P    D +K  LI++PE+R T  +I    FL+
Sbjct: 445 G------FPLVIRDLVKRILIKAPEQRLTISQIKKHHFLS 478

>Kwal_26.7861 s26 complement(544126..546993) [2868 bp, 955 aa] {ON}
           YHL007C (STE20) - serine/threonine protein kinase
           [contig 55] FULL
          Length = 955

 Score = 85.1 bits (209), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 57/186 (30%), Positives = 90/186 (48%), Gaps = 40/186 (21%)

Query: 553 IRYYSREMLKCVKVVHDAGIVHSDLKPANFVL-VKGILKIIDFGIANAVPDHTVNIYRDT 611
           I   SRE LK ++ +H  G++H D+K  N +L + G +K+ DFG    +  + +N+ R T
Sbjct: 763 IGAVSRETLKGLQFLHSKGVIHRDIKSDNVLLSMSGEIKLTDFGFCAQI--NEINLKRTT 820

Query: 612 QIGTPNYMAPEALVALNEVSNVEKKNRWRVGKPSDIWSCGCIMYQMFYGRPPYGAFQNQN 671
            +GTP +MAPE +            +R   G   DIWS G ++ +M  G PPY    N+ 
Sbjct: 821 MVGTPYWMAPEVV------------SRKEYGPKVDIWSLGIMIIEMIEGEPPY---LNET 865

Query: 672 RLLAIM------NPEVKIVFSEKTSKNERVPKSALDTMKA----CLIRSPEKRWTADEIL 721
            L A+        PE+K               S  D +K+    CL  +P++R TA ++L
Sbjct: 866 PLRALYLIATNGTPELKDA------------DSLSDDLKSFLGWCLHVNPDERATASQLL 913

Query: 722 DASFLN 727
              F++
Sbjct: 914 SDPFIS 919

>SAKL0E01584g Chr5 complement(121830..123917) [2088 bp, 695 aa] {ON}
           highly similar to uniprot|P32562 Saccharomyces
           cerevisiae YMR001C
          Length = 695

 Score = 84.7 bits (208), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 72/300 (24%), Positives = 128/300 (42%), Gaps = 35/300 (11%)

Query: 439 KSSKSIVSVNDIEYERIELLGRGGSSKVYKVKNTNNNRVYALKRVVFDEFDDTSVDAFKG 498
           K+  S++     +Y R   LG GG ++ +++K+ ++ +++A K V               
Sbjct: 64  KTPPSLIKTRGRDYHRGHFLGEGGFARCFQMKD-DSGKIFAAKTVAKISIKSEKTRKKLL 122

Query: 499 XXXXXXXXXXXXXXXXXIQYQMDNGVLYLVME-CGDHDLSQILNQRANMPLDVDFIRYYS 557
                            I    D+  +Y+++E C +  L  +L +R    L    +RY++
Sbjct: 123 SEIQIHKSMKHPNIVQFIDCFEDDTNVYILLEICPNGSLMDLLKKRK--VLTEPEVRYFT 180

Query: 558 REMLKCVKVVHDAGIVHSDLKPANFVLVKGI-LKIIDFGIANAVPDHTVNIYRDTQIGTP 616
            +++  +K +H+  ++H DLK  N        LKI DFG+A  + +     Y  T  GTP
Sbjct: 181 TQIVGAIKYMHNRRVIHRDLKLGNIFFDSNYNLKIGDFGLAAVLANDRERKY--TVCGTP 238

Query: 617 NYMAPEALVALNEVSNVEKKNRWRVGKPSDIWSCGCIMYQMFYGRPPYGAFQNQNRLLAI 676
           NY+APE L   +   + E           DIWS G ++Y +  G+PP+ A          
Sbjct: 239 NYIAPEVLAGKHSGHSYE----------VDIWSIGVMIYALLIGKPPFQA---------- 278

Query: 677 MNPEVKIVFSEKTSKNERVP------KSALDTMKACLIRSPEKRWTADEILDASFLNPVL 730
              EV I++    S +   P      K  +  ++  L   P +R + DEI+D  +   + 
Sbjct: 279 --KEVNIIYERIKSGDYIFPREKPTSKEVMVLIQDILSIDPIERPSLDEIMDYVWFRGIF 336

>NCAS0B05560 Chr2 complement(1050313..1051371) [1059 bp, 352 aa]
           {ON} Anc_8.162
          Length = 352

 Score = 82.4 bits (202), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 64/236 (27%), Positives = 106/236 (44%), Gaps = 50/236 (21%)

Query: 525 LYLVMECGDHDLSQILNQRANMPLDVDFIRYYSREMLKCVKVVHDAGIVHSDLKPANFVL 584
           +Y++ E    DL ++++ +    L  D I+Y+  + L+ VKV+H + ++H DLKP+N ++
Sbjct: 89  VYIIQELMQTDLHRVISTQN---LTDDHIQYFIYQTLRAVKVLHGSNVIHRDLKPSNLLI 145

Query: 585 VKGI-LKIIDFGIANAVPDHTVNIYRDTQ--------IGTPNYMAPEALVALNEVSNVEK 635
                LKI DFG+A  + + T +   + Q        + T  Y APE ++          
Sbjct: 146 NSNCDLKICDFGLARIIEEDTGDDEPNAQLQNGMTEYVATRWYRAPEVMLTAA------- 198

Query: 636 KNRWRVGKPSDIWSCGCIMYQMFYGRPPYGAFQNQNRLLAIMN----------------- 678
               R  K  DIWSCGCI+ ++F  RP +     +++L+ I                   
Sbjct: 199 ----RYSKAMDIWSCGCILAELFMKRPIFPGKDYRHQLMLIFGLIGTPSGRDLLCIESRR 254

Query: 679 --------PEVKIVFSEKTSKNERVPKSALDTMKACLIRSPEKRWTADEILDASFL 726
                   P+ + V  EK   N  V    +D ++  LI  P  R TA+E L   +L
Sbjct: 255 AREYITTLPKYEPVPWEKVFPN--VNPLGIDLLQRMLIFDPRSRITAEEALAHPYL 308

>NDAI0G04290 Chr7 complement(1030530..1033871) [3342 bp, 1113 aa]
           {ON} Anc_3.92
          Length = 1113

 Score = 85.1 bits (209), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 80/329 (24%), Positives = 135/329 (41%), Gaps = 52/329 (15%)

Query: 417 KEGQKIVKKVEIVEPPTSMTNRKSSKSIVS-------VNDIEYERIELLGRGGSSKVYKV 469
           K   KI++  EIV+P T  T ++  K  +        + D  Y  + L     S K Y V
Sbjct: 141 KGAAKIIQ--EIVDPETGQTTKQVIKKGIKDFKFGEMIGDGAYSTVLLATSIDSGKKYAV 198

Query: 470 KNTNNNRVYALKRVVFDEFDDTSVDAFKGXXXXXXXXXXXXXXXXXIQYQMDNGVLYLVM 529
           K  N   +   K+V +   +  ++                        +Q D   LY ++
Sbjct: 199 KVLNKEYLIRQKKVKYVNIEKIALQRLNNSRSIIRLF---------FTFQ-DEASLYFLL 248

Query: 530 E-CGDHDLSQILNQRANMPLDVDFIRYYSREMLKCVKVVHDAGIVHSDLKPANFVLVKGI 588
           E   + D   ++ +  +  L+ +   YY  ++L  +  +H  GI+H D+KP N ++ K +
Sbjct: 249 EYAPNGDFLSVMKKYGS--LNEECACYYGAQILDAIGFMHTRGIIHRDIKPENILMDKDM 306

Query: 589 -LKIIDFGIANAVPDHT---------VNIYRDTQIGTPNYMAPEALVALNEVSNVEKKNR 638
            +KI DFG A  + + T         +     + +GT  Y++PE L            N 
Sbjct: 307 KVKITDFGTAKILDEKTNGNNKTSYELLTRSKSFVGTAEYVSPELL------------ND 354

Query: 639 WRVGKPSDIWSCGCIMYQMFYGRPPYGAFQNQNRLLAIMNPEVKIVFSEKTSKNERVPKS 698
                  DIW+ GCI+YQM  G+PP+ A         +M  +V+  F+         P  
Sbjct: 355 NYSDSRCDIWAFGCILYQMIAGKPPFKATNEYLTFQKVM--KVQYAFTAG------FPTI 406

Query: 699 ALDTMKACLIRSPEKRWTADEILDASFLN 727
             D +K  L++ PE+R T  +I    F +
Sbjct: 407 IRDLIKRILLKVPEQRLTIGQIKSHLFFS 435

>KLLA0C12485g Chr3 (1060167..1062944) [2778 bp, 925 aa] {ON} similar
           to uniprot|Q12236 YOL100W Saccharomyces cerevisiae
           YOL100W PKH2 Serine/threonine protein kinase involved in
           sphingolipid-mediated signaling pathway that controls
           endocytosis
          Length = 925

 Score = 84.7 bits (208), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 58/215 (26%), Positives = 103/215 (47%), Gaps = 31/215 (14%)

Query: 521 DNGVLYLVME-CGDHDLSQILNQRANMPLDVDFIRYYSREMLKCVKVVHDAGIVHSDLKP 579
           D   LY ++E   + DL  ++  R +  ++    +YY+ +++  +  +HD G++H DLKP
Sbjct: 225 DESSLYFLLEYAPNGDLLSLM--RKHGSVNEKCTQYYAAQIIDALGFMHDKGVIHRDLKP 282

Query: 580 ANFVL-VKGILKIIDFGIANAVPDHTVNIYR-------DTQIGTPNYMAPEALVALNEVS 631
            N +L V   +K+ DFG A  +   + +  +       ++ +GT  Y++PE L       
Sbjct: 283 ENILLDVDMKVKLTDFGTARLLDSTSEDDLKYDLLTRSNSFVGTAEYVSPELL------- 335

Query: 632 NVEKKNRWRVGKPSDIWSCGCIMYQMFYGRPPYGAFQNQNRLLAIMNPEVKIVFSEKTSK 691
                N   V    DIW+ GCI++QM  G+PP+ A         +M  +V+  F+     
Sbjct: 336 -----NDNYVDFRCDIWAFGCILFQMIAGKPPFKANNEYLTFQKVM--KVQFAFTAG--- 385

Query: 692 NERVPKSALDTMKACLIRSPEKRWTADEILDASFL 726
               P +  D +K  LI++PE+R   ++I    F 
Sbjct: 386 ---FPMTVRDLVKNILIKNPERRLLINQIKAHQFF 417

>YMR001C Chr13 complement(269019..271136) [2118 bp, 705 aa] {ON}
           CDC5Polo-like kinase with multiple functions in mitosis
           and cytokinesis through substrate phosphorylation, also
           functions in adaptation to DNA damage during meiosis;
           has similarity to Xenopus Plx1 and S. pombe Plo1p;
           possible Cdc28p substrate
          Length = 705

 Score = 84.7 bits (208), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 58/230 (25%), Positives = 104/230 (45%), Gaps = 17/230 (7%)

Query: 439 KSSKSIVSVNDIEYERIELLGRGGSSKVYKVKNTNNNRVYALKRVVFDEFDDTSVDAFKG 498
           K+  S++     +Y R   LG GG ++ +++K+ ++  ++A K V               
Sbjct: 69  KTPPSLIKTRGKDYHRGHFLGEGGFARCFQIKD-DSGEIFAAKTVAKASIKSEKTRKKLL 127

Query: 499 XXXXXXXXXXXXXXXXXIQYQMDNGVLYLVME-CGDHDLSQILNQRANMPLDVDFIRYYS 557
                            I    D+  +Y+++E C +  L ++L +R    L    +R+++
Sbjct: 128 SEIQIHKSMSHPNIVQFIDCFEDDSNVYILLEICPNGSLMELLKRRKV--LTEPEVRFFT 185

Query: 558 REMLKCVKVVHDAGIVHSDLKPANFVLVKGI-LKIIDFGIANAVPDHTVNIYRDTQIGTP 616
            ++   +K +H   ++H DLK  N        LKI DFG+A  + + +   Y  T  GTP
Sbjct: 186 TQICGAIKYMHSRRVIHRDLKLGNIFFDSNYNLKIGDFGLAAVLANESERKY--TICGTP 243

Query: 617 NYMAPEALVALNEVSNVEKKNRWRVGKPSDIWSCGCIMYQMFYGRPPYGA 666
           NY+APE L+  +   + E           DIWS G ++Y +  G+PP+ A
Sbjct: 244 NYIAPEVLMGKHSGHSFE----------VDIWSLGVMLYALLIGKPPFQA 283

>Smik_16.204 Chr16 complement(369272..370021) [750 bp, 249 aa] {ON}
           YPL031C (REAL)
          Length = 249

 Score = 80.5 bits (197), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 54/178 (30%), Positives = 93/178 (52%), Gaps = 30/178 (16%)

Query: 525 LYLVMECGDHDLSQILNQR--ANMP--LDVDFIRYYSREMLKCVKVVHDAGIVHSDLKPA 580
           L LV E  D+DL + ++ R   N P  L+++ ++Y+  ++L+ +   H+  I+H DLKP 
Sbjct: 22  LTLVFEFMDNDLKKYMDSRTVGNTPRGLELNLVKYFQWQLLQGLAFCHENKILHRDLKPQ 81

Query: 581 NFVL-VKGILKIIDFGIANA--VPDHTVNIYRDTQIGTPNYMAPEALVALNEVSNVEKKN 637
           N ++  KG LK+ DFG+A A  +P +T +    +++ T  Y AP+ L+     S      
Sbjct: 82  NLLINKKGQLKLGDFGLARAFGIPVNTFS----SEVVTLWYRAPDVLMGSRTYST----- 132

Query: 638 RWRVGKPSDIWSCGCIMYQMFYGRPPYGAFQNQNRLLAIMNPEVKIVFSEKTSKNERV 695
                   DIWSCGCI+ +M  G+P +    ++ +L        K++F    + NE +
Sbjct: 133 ------SIDIWSCGCILAEMITGKPLFPGTNDEEQL--------KLIFDIMGTPNESL 176

>NDAI0B02900 Chr2 complement(737651..738709) [1059 bp, 352 aa] {ON}
           Anc_8.482 YPL031C
          Length = 352

 Score = 82.4 bits (202), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 65/235 (27%), Positives = 108/235 (45%), Gaps = 48/235 (20%)

Query: 525 LYLVMECGDHDLSQILNQRANMPLDVDFIRYYSREMLKCVKVVHDAGIVHSDLKPANFVL 584
           +Y++ E    DL ++++ +    L  D I+Y+  + L+ VK +H + ++H DLKP+N ++
Sbjct: 89  VYIIQELMQTDLHRVISTQN---LTDDHIQYFIYQTLRAVKTLHGSNVIHRDLKPSNLLI 145

Query: 585 VKGI-LKIIDFGIANAVPDHTVNIYRDTQ--------IGTPNYMAPEALVALNEVSNVEK 635
                LKI DFG+A  + +   +  + TQ        + T  Y APE ++   + S    
Sbjct: 146 NSNCDLKICDFGLARIIEEDREDDDQMTQLQNGMTEYVATRWYRAPEVMLTAAKYS---- 201

Query: 636 KNRWRVGKPSDIWSCGCIMYQMFYGRPPYGAFQNQNRLLAIMNPEVKIVFSE-------- 687
                  K  DIWSCGCI+ ++F  RP +     +++LL I    +   F E        
Sbjct: 202 -------KAMDIWSCGCILAELFMKRPIFPGKDYRHQLLLIFG-LIGTPFEEDLNCIESR 253

Query: 688 -------KTSKNERVPKS---------ALDTMKACLIRSPEKRWTADEILDASFL 726
                     + E VP S          +D ++  LI  P+KR TA+E L   +L
Sbjct: 254 RAREYIMTLPRYEPVPLSKVLPQVNPLGIDLLQRMLIFDPKKRITAEEALSHPYL 308

>Smik_13.159 Chr13 complement(260249..262366) [2118 bp, 705 aa] {ON}
           YMR001C (REAL)
          Length = 705

 Score = 84.7 bits (208), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 58/230 (25%), Positives = 104/230 (45%), Gaps = 17/230 (7%)

Query: 439 KSSKSIVSVNDIEYERIELLGRGGSSKVYKVKNTNNNRVYALKRVVFDEFDDTSVDAFKG 498
           K+  S++     +Y R   LG GG ++ +++K+ + + ++A K V               
Sbjct: 69  KTPPSLIKTRGKDYHRGHFLGEGGFARCFQIKDDSGD-IFAAKTVAKASIKSEKTRKKLL 127

Query: 499 XXXXXXXXXXXXXXXXXIQYQMDNGVLYLVME-CGDHDLSQILNQRANMPLDVDFIRYYS 557
                            I    D+  +Y+++E C +  L ++L +R    L    +R+++
Sbjct: 128 SEIQIHKSMAHPNIVQFIDCFEDDSNVYILLEICPNGSLMELLKRRKV--LSEPEVRFFT 185

Query: 558 REMLKCVKVVHDAGIVHSDLKPANFVLVKGI-LKIIDFGIANAVPDHTVNIYRDTQIGTP 616
            ++   +K +H   ++H DLK  N        LKI DFG+A  + + +   Y  T  GTP
Sbjct: 186 TQICGAIKYMHSRRVIHRDLKLGNIFFDSNYNLKIGDFGLAAVLANESERKY--TICGTP 243

Query: 617 NYMAPEALVALNEVSNVEKKNRWRVGKPSDIWSCGCIMYQMFYGRPPYGA 666
           NY+APE L+  +   + E           DIWS G ++Y +  G+PP+ A
Sbjct: 244 NYIAPEVLMGKHSGHSFE----------VDIWSLGVMLYALLIGKPPFQA 283

>Suva_6.169 Chr6 complement(300200..304654) [4455 bp, 1484 aa] {ON}
            YJL095W (REAL)
          Length = 1484

 Score = 85.1 bits (209), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 77/290 (26%), Positives = 126/290 (43%), Gaps = 35/290 (12%)

Query: 449  DIEYERIELLGRGGSSKVYKVKNTNNNRVYALKRVVFDEFDD------TSVDAFKGXXXX 502
            +  + + E++G+G    VY   N     + A+K+V   ++        ++V+A +     
Sbjct: 1178 EFAWMKGEMIGKGSFGAVYLCLNVTTGEMMAVKQVEVPKYSSQNEAILSTVEALRSEVST 1237

Query: 503  XXXXXXXXXXXXXIQYQMDNGVLYLVME--CGDHDLSQILNQRANMPLDVDFIRYYSREM 560
                         + ++  N +  L +E   G    S I   R     D   I++ + ++
Sbjct: 1238 LKDLDHLNIVQY-LGFENKNSIYSLFLEYVAGGSVGSLI---RMYGRFDESLIKHLTTQV 1293

Query: 561  LKCVKVVHDAGIVHSDLKPANFVLVK-GILKIIDFGIANAVPDHTVNIYRDTQI---GTP 616
            L+ +  +H  GI+H D+K  N +L + GI KI DFGI+    D    IY ++ +   GT 
Sbjct: 1294 LRGLAYLHSKGILHRDMKADNLLLDQDGICKISDFGISRKSKD----IYSNSDMTMRGTV 1349

Query: 617  NYMAPEALVALNEVSNVEKKNRWRVGKPSDIWSCGCIMYQMFYGRPPYGAFQNQNRLLAI 676
             +MAPE          V+ K  +      DIWS GCI+ +MF G+ P+   +    +  I
Sbjct: 1350 FWMAPEM---------VDTKQGYSAK--VDIWSLGCIVLEMFAGKRPWSNLEVVAAMFKI 1398

Query: 677  MNPEVKIVFSEKT-SKNERVPKSALDTMKACLIRSPEKRWTADEILDASF 725
               +      E T     RV +S LD   AC    PEKR TA ++L   F
Sbjct: 1399 GKSKSAPPIPEDTLPLITRVGRSFLD---ACFEIDPEKRPTATKLLSHQF 1445

>KLLA0F13552g Chr6 complement(1252906..1256709) [3804 bp, 1267 aa]
           {ON} weakly similar to uniprot|P34244 Saccharomyces
           cerevisiae YKL101W HSL1 Nim1p-related protein kinase
           that regulates the morphogenesis and septin checkpoints
           associates with the assembled septin filament required
           along with Hsl7p for bud neck recruitment
           phosphorylation and degradation of Swe1p
          Length = 1267

 Score = 85.1 bits (209), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 60/205 (29%), Positives = 95/205 (46%), Gaps = 27/205 (13%)

Query: 525 LYLVME-CGDHDLSQILNQRANMPLDVDFIRYYSREMLKCVKVVHDAGIVHSDLKPANFV 583
           LYLV+E     +L   L  +  +P + + I Y+ +++++ V   H   I H DLKP N +
Sbjct: 149 LYLVLEYVEGGELFDYLVSKGKLP-ESEAIHYF-KQIVQAVAYCHGFNICHRDLKPENLL 206

Query: 584 L--VKGILKIIDFGIANAVPDHTVNIYRDTQIGTPNYMAPEALVALNEVSNVEKKNRWRV 641
           L   K  +KI DFG+A      T +   +T  G+P+Y +PE ++            R   
Sbjct: 207 LDKKKRSIKIADFGMAAL---ETSDKLLETSCGSPHYASPEIVLG-----------RKYH 252

Query: 642 GKPSDIWSCGCIMYQMFYGRPPYGAFQNQNRLLAIMNPEVKIVFSEKTSKNERVPKSALD 701
           G PSD+WSCG I++ +  G  P+     +  LL +         S K    + +   A D
Sbjct: 253 GSPSDVWSCGIILFALLTGHLPFNDDNVKKLLLKVQ--------SGKYQMPQWLSVEAKD 304

Query: 702 TMKACLIRSPEKRWTADEILDASFL 726
            +   L+  P +R T D+IL    L
Sbjct: 305 LISRILVVDPNRRITIDQILQHELL 329

>Skud_13.154 Chr13 complement(255263..257380) [2118 bp, 705 aa] {ON}
           YMR001C (REAL)
          Length = 705

 Score = 84.3 bits (207), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 58/230 (25%), Positives = 104/230 (45%), Gaps = 17/230 (7%)

Query: 439 KSSKSIVSVNDIEYERIELLGRGGSSKVYKVKNTNNNRVYALKRVVFDEFDDTSVDAFKG 498
           K+  S++     +Y R   LG GG ++ +++K+ ++  ++A K V               
Sbjct: 69  KTPPSLIKTRGKDYHRGHFLGEGGFARCFQIKD-DSGEIFAAKTVAKASIKSEKTRKKLL 127

Query: 499 XXXXXXXXXXXXXXXXXIQYQMDNGVLYLVME-CGDHDLSQILNQRANMPLDVDFIRYYS 557
                            I    D+  +Y+++E C +  L ++L +R    L    +R+++
Sbjct: 128 SEIQIHKSMSHPNIVQFIDCFEDDSNVYILLEICPNGSLMELLKRRKV--LTEPEVRFFT 185

Query: 558 REMLKCVKVVHDAGIVHSDLKPANFVLVKGI-LKIIDFGIANAVPDHTVNIYRDTQIGTP 616
            ++   +K +H   ++H DLK  N        LKI DFG+A  + + +   Y  T  GTP
Sbjct: 186 TQICGAIKYMHSRRVIHRDLKLGNIFFDSNYNLKIGDFGLAAVLANESERKY--TICGTP 243

Query: 617 NYMAPEALVALNEVSNVEKKNRWRVGKPSDIWSCGCIMYQMFYGRPPYGA 666
           NY+APE L+  +   + E           DIWS G ++Y +  G+PP+ A
Sbjct: 244 NYIAPEVLMGKHSGHSFE----------VDIWSLGVMLYALLIGKPPFQA 283

>Skud_10.119 Chr10 (215299..219744) [4446 bp, 1481 aa] {ON} YJL095W
            (REAL)
          Length = 1481

 Score = 85.1 bits (209), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 78/290 (26%), Positives = 126/290 (43%), Gaps = 35/290 (12%)

Query: 449  DIEYERIELLGRGGSSKVYKVKNTNNNRVYALKRVVFDEFDDT------SVDAFKGXXXX 502
            +  + + E++G+G    VY   N     + A+K+V   ++         +V+A +     
Sbjct: 1175 EFAWMKGEMIGKGSFGAVYLCLNVTTGEMMAVKQVEVPKYSSQNEAILGTVEALRSEVST 1234

Query: 503  XXXXXXXXXXXXXIQYQMDNGVLYLVME--CGDHDLSQILNQRANMPLDVDFIRYYSREM 560
                         + ++  N +  L +E   G    S I   R     D   IR+ + ++
Sbjct: 1235 LKDLDHLNIVQY-LGFENKNNIYSLFLEYVAGGSVGSLI---RMYGRFDESLIRHLTTQV 1290

Query: 561  LKCVKVVHDAGIVHSDLKPANFVLVK-GILKIIDFGIANAVPDHTVNIYRDTQI---GTP 616
            LK +  +H  GI+H D+K  N +L + GI KI DFGI+    D    IY ++ +   GT 
Sbjct: 1291 LKGLAYLHSKGILHRDMKADNLLLDQDGICKISDFGISRKSKD----IYSNSDMTMRGTV 1346

Query: 617  NYMAPEALVALNEVSNVEKKNRWRVGKPSDIWSCGCIMYQMFYGRPPYGAFQNQNRLLAI 676
             +MAPE          V+ K  +      DIWS GCI+ +MF G+ P+   +    +  I
Sbjct: 1347 FWMAPEM---------VDTKQGYSAK--VDIWSLGCIVLEMFAGKRPWSNLEVVAAMFKI 1395

Query: 677  MNPEVKIVFSEKT-SKNERVPKSALDTMKACLIRSPEKRWTADEILDASF 725
               +      E T     +V +S LD   AC   +PE+R TA E+L   F
Sbjct: 1396 GKSKSAPPIPEDTLPLISQVGRSFLD---ACFEINPEERPTATELLSHQF 1442

>CAGL0L03520g Chr12 complement(403100..407443) [4344 bp, 1447 aa] {ON}
            similar to uniprot|Q01389 Saccharomyces cerevisiae
            YJL095w BCK1
          Length = 1447

 Score = 85.1 bits (209), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 56/182 (30%), Positives = 89/182 (48%), Gaps = 21/182 (11%)

Query: 548  LDVDFIRYYSREMLKCVKVVHDAGIVHSDLKPANFVLVK-GILKIIDFGIANAVPDHTVN 606
             D   IR+ + ++L  +K +H  GI+H D+K  N +L + GI KI DFGI+      + N
Sbjct: 1251 FDEKLIRHLNTQVLSGLKYLHSKGILHRDMKADNLLLDEDGICKISDFGISKK----SKN 1306

Query: 607  IYRDTQI---GTPNYMAPEALVALNEVSNVEKKNRWRVGKPSDIWSCGCIMYQMFYGRPP 663
            IY ++ +   GT  +MAPE          V+ K  +      DIWS GC++ +MF G+ P
Sbjct: 1307 IYSNSDMTMRGTVFWMAPEM---------VDTKQGYSAK--VDIWSLGCVVLEMFAGKRP 1355

Query: 664  YGAFQNQNRLLAIMNPEVKIVFSEKTSKNERVPKSALDTMKACLIRSPEKRWTADEILDA 723
            +   +    +  I   +      + T   + +     D +  C    PEKR TAD++L+ 
Sbjct: 1356 WSNLEVVAAMFQIGKSKSAPPIPDDTI--QLISSKGKDFLSKCFEIDPEKRPTADDLLEH 1413

Query: 724  SF 725
            SF
Sbjct: 1414 SF 1415

>KNAG0A06140 Chr1 (931737..933437) [1701 bp, 566 aa] {ON} Anc_2.425
           YKL139W
          Length = 566

 Score = 84.0 bits (206), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 68/231 (29%), Positives = 108/231 (46%), Gaps = 30/231 (12%)

Query: 452 YERIELLGRGGSSKVYKVKNTNNNRVYALKRVVF----DEFDDTSVDAFKGXXXXXXXXX 507
           YERI  +G G   KVYK KN+    + ALK++      + F  TS+   K          
Sbjct: 230 YERILQVGEGTYGKVYKAKNSLTGGLVALKKLRLQSEREGFPITSIREIK------LLQS 283

Query: 508 XXXXXXXXIQYQM--DNGVLYLVMECGDHDLSQILNQRANMPLDVDFIRYYSREMLKCVK 565
                   I+  M   + V+Y++ +  D+DL  IL   + + L     ++ +R++L+  K
Sbjct: 284 FDHENVSNIREIMVESSKVIYMIFDYADNDLGGILLNNS-LKLSDAQRKHVTRQLLEGCK 342

Query: 566 VVHDAGIVHSDLKPANFVLVK-GILKIIDFGIANAV-PDHTVNIYRDT-QIGTPNYMAPE 622
            +H+  ++H D+K +N ++   G LKI DFG+A  + P H  N    T ++ T  Y  PE
Sbjct: 343 YLHEQRVIHRDIKGSNILIDNDGRLKITDFGLARRMAPSHGNNGQGYTNRVITLWYRPPE 402

Query: 623 ALVALNEVSNVEKKNRWRVGKPSDIWSCGCIMYQMFYGRPPYGAFQNQNRL 673
            L+                G   D+W CGC++ +MFYG+     FQ  N L
Sbjct: 403 LLLGTTHY-----------GTEVDMWGCGCLLLEMFYGK---AVFQGANEL 439

>YKL101W Chr11 (248920..253476) [4557 bp, 1518 aa] {ON}
           HSL1Nim1p-related protein kinase that regulates the
           morphogenesis and septin checkpoints; associates with
           the assembled septin filament; required along with Hsl7p
           for bud neck recruitment, phosphorylation, and
           degradation of Swe1p
          Length = 1518

 Score = 85.1 bits (209), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 61/201 (30%), Positives = 95/201 (47%), Gaps = 29/201 (14%)

Query: 525 LYLVMECGDH-DLSQILNQRANMPLDVDFIRYYSREMLKCVKVVHDAGIVHSDLKPANFV 583
           LYLV+E  D  +L   L  +  +P + + I Y+ +++++ V   H   I H DLKP N +
Sbjct: 189 LYLVLEYVDGGELFDYLVSKGKLP-EREAIHYF-KQIVEGVSYCHSFNICHRDLKPENLL 246

Query: 584 LVKG--ILKIIDFGIAN-AVPDHTVNIYRDTQIGTPNYMAPEALVALNEVSNVEKKNRWR 640
           L K    +KI DFG+A   +P+  +     T  G+P+Y +PE ++            R  
Sbjct: 247 LDKKNRRIKIADFGMAALELPNKLLK----TSCGSPHYASPEIVMG-----------RPY 291

Query: 641 VGKPSDIWSCGCIMYQMFYGRPPYGAFQNQNRLLAIMNPEVKIVFSEKTSKNERVPKSAL 700
            G PSD+WSCG +++ +  G  P+     +  LL +         S K      +   A 
Sbjct: 292 HGGPSDVWSCGIVLFALLTGHLPFNDDNIKKLLLKVQ--------SGKYQMPSNLSSEAR 343

Query: 701 DTMKACLIRSPEKRWTADEIL 721
           D +   L+  PEKR T  EIL
Sbjct: 344 DLISKILVIDPEKRITTQEIL 364

>Suva_2.105 Chr2 (186428..187489) [1062 bp, 353 aa] {ON} YBL016W
           (REAL)
          Length = 353

 Score = 82.4 bits (202), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 63/236 (26%), Positives = 110/236 (46%), Gaps = 47/236 (19%)

Query: 525 LYLVMECGDHDLSQILNQRANMPLDVDFIRYYSREMLKCVKVVHDAGIVHSDLKPANFVL 584
           +Y++ E    DL ++++ +    L  D I+Y+  + L+ VKV+H + ++H DLKP+N ++
Sbjct: 89  VYIIQELMQTDLHRVISTQL---LSDDHIQYFIYQTLRAVKVLHGSNVIHRDLKPSNLLI 145

Query: 585 VKGI-LKIIDFGIANAV-------PDHTVNIYRDTQ-IGTPNYMAPEALVALNEVSNVEK 635
                LK+ DFG+A  +       P+ T      T+ + T  Y APE ++          
Sbjct: 146 NSNCDLKVCDFGLARIIDEAGADDPEATGQQNGMTEYVATRWYRAPEVML---------- 195

Query: 636 KNRWRVGKPSDIWSCGCIMYQMFYGRPPYGAFQNQNRLLAIMN--------PEVKIVFSE 687
               R  +  D+WSCGCI+ ++F  RP +     +++LL I           E++ + S 
Sbjct: 196 -TSARYSRAMDVWSCGCILAELFLRRPIFPGRDYRHQLLLIFGVIGTPQSEEELRCIESA 254

Query: 688 KTSKNER-------VPKSAL---------DTMKACLIRSPEKRWTADEILDASFLN 727
           +  +  +       VP   L         D ++  L+  PEKR TA E L+  +L 
Sbjct: 255 RAREYIKSLPAYPAVPLEKLLPGINPQGVDLLQRMLVFDPEKRITAKEALEHPYLQ 310

>TDEL0A02550 Chr1 (457841..461950) [4110 bp, 1369 aa] {ON} Anc_2.479
           YKL101W
          Length = 1369

 Score = 84.7 bits (208), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 67/236 (28%), Positives = 109/236 (46%), Gaps = 32/236 (13%)

Query: 525 LYLVMECGDH-DLSQILNQRANMPLDVDFIRYYSREMLKCVKVVHDAGIVHSDLKPANFV 583
           LYLV+E  D  +L   L  R  +  + + + Y+ +++++ V   H   I H DLKP N +
Sbjct: 191 LYLVLEYVDGGELFDYLVSRGRL-CEREAVHYF-KQIIQGVSYCHAFNICHRDLKPENLL 248

Query: 584 LVK--GILKIIDFGIANAVPDHTVNIYRDTQIGTPNYMAPEALVALNEVSNVEKKNRWRV 641
           L K    +KI DFG+A        N    T  G+P+Y +PE ++            +   
Sbjct: 249 LDKKNSTIKIADFGMAAL---EVSNKLLQTSCGSPHYASPEIVMG-----------KQYH 294

Query: 642 GKPSDIWSCGCIMYQMFYGRPPYGAFQNQNRLLAIMNPEVKIVFSEKTSKNERVPKSALD 701
           G PSD+WSCG I++ +  G  P+     +  LL +         S K    + + K A D
Sbjct: 295 GGPSDVWSCGIILFALLTGHLPFNDDSIKKLLLKVQ--------SGKYQMPQNLSKEAQD 346

Query: 702 TMKACLIRSPEKRWTADEILDASFLNPVLVT-PYIVRDLIRNAVYYGSDQGQVSED 756
            +   L  +P KR T +EIL     +P++V    +++     A+Y    QG+ + D
Sbjct: 347 LIAKILTVNPAKRLTTEEILR----HPLIVKYDSMMKTKKYKALYKNMGQGKSNAD 398

>AFR335C Chr6 complement(1046756..1049857) [3102 bp, 1033 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YOL100W
           (PKH2) and YDR490C (PKH1)
          Length = 1033

 Score = 84.7 bits (208), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 65/250 (26%), Positives = 109/250 (43%), Gaps = 39/250 (15%)

Query: 521 DNGVLYLVME-CGDHDLSQILNQRANMPLDVDFIRYYSREMLKCVKVVHDAGIVHSDLKP 579
           D   LY ++E   + D   ++ +     L  +  +YY  ++L  +  +H  GI+H D+KP
Sbjct: 272 DEANLYFLLEYAPNGDFLSVMKRFGT--LSEECTKYYGAQILDAIHHLHKQGIIHRDVKP 329

Query: 580 ANFVLVKGI-LKIIDFGIANAV------PDHTVNIYRDTQIGTPNYMAPEALVALNEVSN 632
            N +L K + +K+ DFG A  +        + +N    + +GT  Y++PE L        
Sbjct: 330 ENILLDKTMKIKLTDFGTAKLIGREDENKPYDLNTRSKSFVGTAEYVSPELL-------- 381

Query: 633 VEKKNRWRVGKPSDIWSCGCIMYQMFYGRPPYGAFQNQNRLLAIMNPEVKIVFSEKTSKN 692
               N   V    DIW+ GCI++QM  G+PP+ A         +M   V+  F+      
Sbjct: 382 ----NDNYVDSRCDIWAFGCILFQMVAGKPPFKATNEYLTFQKVM--RVQYAFTAG---- 431

Query: 693 ERVPKSALDTMKACLIRSPEKRWTADEILDASFLNPVLVTPYIVRDLIRNAVYYGSDQGQ 752
              P    D +K  L++ PE+R T  +I    F N +           RN   + +   Q
Sbjct: 432 --FPMILRDLIKQLLVKKPEQRLTILQIEKHHFFNDI---------NFRNGSVWSNPAPQ 480

Query: 753 VSEDKITELA 762
           ++  K+T  A
Sbjct: 481 IAPYKVTAKA 490

>Kpol_1072.16 s1072 complement(37585..39972) [2388 bp, 795 aa] {ON}
           complement(37585..39972) [2388 nt, 796 aa]
          Length = 795

 Score = 84.3 bits (207), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 63/206 (30%), Positives = 102/206 (49%), Gaps = 17/206 (8%)

Query: 526 YLVME-CGDHDLSQILNQRANMPLDVDFIRYYSREMLKCVKVVHDAGIVHSDLKPANFVL 584
           YL+ME     DL   +    ++  D    R  +R++L+ VK +H  GI H DLKP N ++
Sbjct: 265 YLLMEFVSGGDLMDFVAAHGSVGEDAG--REITRQILEAVKYIHLQGISHRDLKPDNILI 322

Query: 585 VKG---ILKIIDFGIANAVPDHTVNIYRDTQIGTPNYMAPEALVALNEVSNVEKKNRWRV 641
            +    ++KI DFG+A    + T   +  T  GT  Y+APE +   N  S  E ++R   
Sbjct: 323 EQDDPVLVKITDFGLAKVQGNGT---FMKTFCGTLAYVAPEVIGGKN--SAEENEDRIEY 377

Query: 642 GKPSDIWSCGCIMYQMFYGRPPY-GAFQNQNRLLAIMNPEVKIVFSEKTSKNERVPKSAL 700
               D+WS GC++Y +  G  P+ G+ Q+Q     +     +  + E   K+ R+   A 
Sbjct: 378 SSLVDMWSIGCLVYVILTGHLPFSGSTQDQ-----LYKQICRGSYHEGPLKDFRISDEAR 432

Query: 701 DTMKACLIRSPEKRWTADEILDASFL 726
           D + + L  SP KR TA + L+  ++
Sbjct: 433 DFIDSLLQVSPNKRLTAIKALNHPWI 458

>Skud_3.39 Chr3 (66201..69254) [3054 bp, 1017 aa] {ON} YCL024W
           (REAL)
          Length = 1017

 Score = 84.7 bits (208), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 69/249 (27%), Positives = 104/249 (41%), Gaps = 40/249 (16%)

Query: 525 LYLVMECGDH-DLSQILNQRANMPLDVDFIRYYSREMLKC-------VKVVHDAGIVHSD 576
           LYL++E  +  +L  +L  R  +P          RE +KC       V   H  GIVH D
Sbjct: 102 LYLILEYAEKGELFNLLVDRGALP---------EREAMKCFRQIIIAVSYCHALGIVHRD 152

Query: 577 LKPANFVLVKGI-LKIIDFGIANAVPDHTVNIYRDTQIGTPNYMAPEALVALNEVSNVEK 635
           LKP N +L     +K+ DFG+A    D  +    +T  G+P+Y APE +  L        
Sbjct: 153 LKPENLLLDSDYNIKVADFGMAALQTDAAL---LETSCGSPHYAAPEIVSGLP------- 202

Query: 636 KNRWRVGKPSDIWSCGCIMYQMFYGRPPYGAFQNQNRLLAIMNPEVKIVFSEKTSKNERV 695
                 G  SD+WSCG I++ +  GR P+       R L +     +    + T     +
Sbjct: 203 ----YEGFSSDVWSCGVILFALLTGRLPFDEENGNIRTLLLKVQRGQFEMPDDT----EI 254

Query: 696 PKSALDTMKACLIRSPEKRWTADEILDASFLN--PVLVTPYIVRDLIRNAVYYG--SDQG 751
            K A D +   L+  P +R    +IL    L     +     ++DL R   Y    +D G
Sbjct: 255 SKDAQDLISKILVVDPAQRIKIRDILSHPLLKRYQTIKDSKSIKDLPREDTYLYPLADAG 314

Query: 752 QVSEDKITE 760
              +D I +
Sbjct: 315 AAIDDSILQ 323

>YNR031C Chr14 complement(680694..685433) [4740 bp, 1579 aa] {ON}
            SSK2MAP kinase kinase kinase of the HOG1
            mitogen-activated signaling pathway; interacts with
            Ssk1p, leading to autophosphorylation and activation of
            Ssk2p which phosphorylates Pbs2p; also mediates actin
            cytoskeleton recovery from osmotic stress
          Length = 1579

 Score = 84.7 bits (208), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 59/225 (26%), Positives = 104/225 (46%), Gaps = 56/225 (24%)

Query: 556  YSREMLKCVKVVHDAGIVHSDLKPANFVL-VKGILKIIDFGIANAVPDHTVNIYRDTQI- 613
            Y+ ++L+ +  +H++GIVH D+KP N +L   G++K +DFG A  + ++   +    +I 
Sbjct: 1370 YTLQLLEGLAYLHESGIVHRDVKPENILLDFNGVIKYVDFGAAKKIANNGTRLASMNKIE 1429

Query: 614  -----------------------------GTPNYMAPEALVALNEVSNVEKKNRWRVGKP 644
                                         GTP YMAPE++             + ++G  
Sbjct: 1430 NADGEHEDVTHVSDSKAVKNNENALLDMMGTPMYMAPESITG--------STTKGKLGA- 1480

Query: 645  SDIWSCGCIMYQMFYGRPPYGAFQNQNRLLAIMNPEVKIVFSEKTSKNERVPKSALDTMK 704
             D+WS GC++ +M  GR P+    N+    AIM   V    + +    + V  + +  ++
Sbjct: 1481 DDVWSLGCVVLEMITGRRPWANLDNE---WAIMY-HVAAGHTPQFPTKDEVSSAGMKFLE 1536

Query: 705  ACLIRSPEKRWTADEILDASFLNPVLVTPYIVRDLIRNAVYYGSD 749
             CLI++P KR +A E+         L+ P+IV+  IR  + +G D
Sbjct: 1537 RCLIQNPSKRASAVEL---------LMDPWIVQ--IRE-IAFGDD 1569

>Suva_13.163 Chr13 complement(259136..261253) [2118 bp, 705 aa] {ON}
           YMR001C (REAL)
          Length = 705

 Score = 84.3 bits (207), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 57/230 (24%), Positives = 104/230 (45%), Gaps = 17/230 (7%)

Query: 439 KSSKSIVSVNDIEYERIELLGRGGSSKVYKVKNTNNNRVYALKRVVFDEFDDTSVDAFKG 498
           K+  S++     +Y R   LG GG ++ +++K+ ++  ++A K V               
Sbjct: 69  KTPPSLIKTRGKDYHRGHFLGEGGFARCFQIKD-DSGEIFAAKTVAKASIKSEKTRKKLL 127

Query: 499 XXXXXXXXXXXXXXXXXIQYQMDNGVLYLVME-CGDHDLSQILNQRANMPLDVDFIRYYS 557
                            +    D+  +Y+++E C +  L ++L +R    L    +R+++
Sbjct: 128 SEIQIHKSMAHPNIVQFVDCFEDDSNVYILLEICPNGSLMELLKRRKV--LTEPEVRFFT 185

Query: 558 REMLKCVKVVHDAGIVHSDLKPANFVLVKGI-LKIIDFGIANAVPDHTVNIYRDTQIGTP 616
            ++   +K +H   ++H DLK  N        LKI DFG+A  + + +   Y  T  GTP
Sbjct: 186 TQICGAIKYMHSRRVIHRDLKLGNIFFDSNYNLKIGDFGLAAVLANESERKY--TICGTP 243

Query: 617 NYMAPEALVALNEVSNVEKKNRWRVGKPSDIWSCGCIMYQMFYGRPPYGA 666
           NY+APE L+  +   + E           DIWS G ++Y +  G+PP+ A
Sbjct: 244 NYIAPEVLMGKHSGHSFE----------VDIWSLGVMLYALLIGKPPFQA 283

>Kwal_26.7355 s26 (326867..331207) [4341 bp, 1446 aa] {ON} YJL095W
            (BCK1) - MEKK serine/threonine kinase [contig 48] FULL
          Length = 1446

 Score = 84.7 bits (208), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 75/289 (25%), Positives = 126/289 (43%), Gaps = 31/289 (10%)

Query: 449  DIEYERIELLGRGGSSKVYKVKNTNNNRVYALKRVVFDEF---DDTSVDAFKGXXXXXXX 505
            +  + + E++G+G    V+   N     + A+K+V    +   D+T++   +        
Sbjct: 1143 EFAWIKGEMIGKGSFGSVFLGLNVTTGEMIAVKQVEVPRYGSQDETTLSVLEALRSEVAT 1202

Query: 506  XXXXXXX--XXXIQYQMDNGVLYLVME--CGDHDLSQILNQRANMPLDVDFIRYYSREML 561
                        + ++  N V  L +E   G    S I   R     D + IR+ + ++L
Sbjct: 1203 LKDLDHTNIVQYLGFENKNYVYSLFLEYVAGGSVGSLI---RLYGKFDENLIRFLAVQVL 1259

Query: 562  KCVKVVHDAGIVHSDLKPANFVL-VKGILKIIDFGIANAVPDHTVNIYRDTQI---GTPN 617
            + +  +H   I+H D+K  N +L V GI KI DFGI+      + NIY ++ +   GT  
Sbjct: 1260 RGLSYLHSKKILHRDMKADNLLLDVDGICKISDFGISK----KSNNIYSNSDMTMRGTVF 1315

Query: 618  YMAPEALVALNEVSNVEKKNRWRVGKPSDIWSCGCIMYQMFYGRPPYGAFQNQNRLLAIM 677
            +MAPE          V+ K  +      DIWS GC++ +MF G+ P+   +    +  I 
Sbjct: 1316 WMAPEM---------VDTKQGYSAK--VDIWSLGCVVLEMFAGKRPWSNLEVVAAMFKIG 1364

Query: 678  NPEVKIVFSEKTSKNERVPKSALDTMKACLIRSPEKRWTADEILDASFL 726
              +      E T K   +     + + AC   +PEKR TADE+L   F 
Sbjct: 1365 KFKSAPPIPEDTQK--IISAEGKEFLDACFEINPEKRPTADELLSHPFC 1411

>ZYRO0B06512g Chr2 complement(521075..524410) [3336 bp, 1111 aa]
           {ON} similar to uniprot|Q12236 YOL100W Saccharomyces
           cerevisiae YOL100W PKH2 Serine/threonine protein kinase
           involved in sphingolipid-mediated signaling pathway that
           controls endocytosis
          Length = 1111

 Score = 84.7 bits (208), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 58/210 (27%), Positives = 102/210 (48%), Gaps = 32/210 (15%)

Query: 521 DNGVLYLVME-CGDHDLSQILNQRANMPLDVDFIRYYSREMLKCVKVVHDAGIVHSDLKP 579
           D   LY ++E   + D   I+ +  +  L+ +   YYS +++  +K +H  GI+H D+KP
Sbjct: 240 DEASLYFLLEYAPNGDFLSIMKKYGS--LNEECTCYYSAQIIDAIKFLHQRGIIHRDIKP 297

Query: 580 ANFVLVKGI-LKIIDFGIA------NAVPDHTVNIYRDTQ--IGTPNYMAPEALVALNEV 630
            N +L K + +K+ DFG A      +     T +++  ++  +GT  Y++PE L      
Sbjct: 298 ENILLDKEMKVKLTDFGTAKLLDGKSQASGETYDLHTRSKSFVGTAEYVSPELL------ 351

Query: 631 SNVEKKNRWRVGKPSDIWSCGCIMYQMFYGRPPYGAFQNQNRLLAIMNPEVKIVFSEKTS 690
                 + W V    DIW+ GCI++QM  G+PP+ A         +M  +V+  F+    
Sbjct: 352 -----NDNW-VDYRCDIWAFGCIVFQMIAGKPPFKATNEYLTFQKVM--KVQYAFTAG-- 401

Query: 691 KNERVPKSALDTMKACLIRSPEKRWTADEI 720
                P    D +K  L+R P++R +  +I
Sbjct: 402 ----FPVVVRDLVKRILLRQPDQRLSIPQI 427

>Skud_2.90 Chr2 (176138..177199) [1062 bp, 353 aa] {ON} YBL016W
           (REAL)
          Length = 353

 Score = 82.0 bits (201), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 58/236 (24%), Positives = 110/236 (46%), Gaps = 47/236 (19%)

Query: 525 LYLVMECGDHDLSQILNQRANMPLDVDFIRYYSREMLKCVKVVHDAGIVHSDLKPANFVL 584
           +Y++ E    DL ++++ +    L  D I+Y+  + L+ VKV+H + ++H DLKP+N ++
Sbjct: 89  VYIIQELMQTDLHRVISTQV---LSDDHIQYFIYQTLRAVKVLHGSNVIHRDLKPSNLLI 145

Query: 585 VKGI-LKIIDFGIANAVPDHTVNIYRDT--------QIGTPNYMAPEALVALNEVSNVEK 635
                LK+ DFG+A  + +   +    T         + T  Y APE ++   + S    
Sbjct: 146 NSNCDLKVCDFGLARIIDEAGADDSEATGQQSGMTEYVATRWYRAPEVMLTSAKYS---- 201

Query: 636 KNRWRVGKPSDIWSCGCIMYQMFYGRPPYGAFQNQNRLLAIM--------NPEVKIVFSE 687
                  +  D+WSCGCI+ ++F  RP +     +++LL I         + +++ + S 
Sbjct: 202 -------RAMDVWSCGCILAELFLRRPIFPGRDYRHQLLLIFGIIGTPQSDDDLRCIESP 254

Query: 688 KTSKN----------------ERVPKSALDTMKACLIRSPEKRWTADEILDASFLN 727
           +  +                  R+    +D ++  L+  PEKR TA E L+  +L+
Sbjct: 255 RAREYIKSLPAYPAAALEKMFPRINPQGIDLLERMLVFDPEKRITATEALEHPYLH 310

>TBLA0B02310 Chr2 (539362..541821) [2460 bp, 819 aa] {ON} Anc_3.92
           YDR490C
          Length = 819

 Score = 84.3 bits (207), Expect = 6e-16,   Method: Compositional matrix adjust.
 Identities = 55/214 (25%), Positives = 93/214 (43%), Gaps = 30/214 (14%)

Query: 521 DNGVLYLVMECGDH-DLSQILNQRANMPLDVDFIRYYSREMLKCVKVVHDAGIVHSDLKP 579
           D   LY V+E   H DL  +L +  ++   V    +Y+ ++L  +  +H  G++H D+KP
Sbjct: 215 DRESLYFVLEYAPHGDLLALLRRHGSLSRAVTC--HYAAQLLSAIGALHSVGVIHRDIKP 272

Query: 580 ANFVLVKGI-LKIIDFGIANAVPDHTVNIYRDTQ------IGTPNYMAPEALVALNEVSN 632
            N +L      K+ DFG A  +P    N+ + ++      +GT  Y+ PE L A +    
Sbjct: 273 ENVLLDSHYRAKLTDFGTAALLPQTHSNLEQVSRHVTTSFVGTAEYVPPELLAAGHADGT 332

Query: 633 VEKKNRWRVGKPSDIWSCGCIMYQMFYGRPPYGAFQNQNRLLAIMNPEVKIVFSEKTSKN 692
                        D+W+  C+++Q+  GRPP   FQ +N  L   N     V + + +  
Sbjct: 333 C------------DLWAWACVVFQLIAGRPP---FQARNEFLTFQN-----VMAVRYTYP 372

Query: 693 ERVPKSALDTMKACLIRSPEKRWTADEILDASFL 726
              P    D ++  L   P +R    +I    F 
Sbjct: 373 PGFPSDLKDLLRRVLRHEPRQRLLQPQITQHQFF 406

>ZYRO0G20306g Chr7 complement(1675578..1677227) [1650 bp, 549 aa]
           {ON} similar to uniprot|Q03957 Saccharomyces cerevisiae
           YKL139W CTK1 Catalytic (alpha) subunit of C-terminal
           domain kinase I (CTDK-I) which phosphorylates the C-
           terminal repeated domain of the RNA polymerase II large
           subunit (Rpo21p) to affect both transcription and
           pre-mRNA 3' end processing
          Length = 549

 Score = 83.6 bits (205), Expect = 6e-16,   Method: Compositional matrix adjust.
 Identities = 64/228 (28%), Positives = 112/228 (49%), Gaps = 29/228 (12%)

Query: 452 YERIELLGRGGSSKVYKVKNTNNNRVYALKRVVFD-EFDDTSVDAFKGXXXXXXXXXXXX 510
           YERI  +G G   KVYK +NT   R+ ALK++  + E +   + + +             
Sbjct: 205 YERILQVGEGTYGKVYKARNTVTGRMVALKKLRLESEREGFPITSIREIKLLQSFDHPNV 264

Query: 511 XXXXXIQYQMDNGVLYLVMECGDHDLSQILNQRANMPLDVDFIRYYSREMLKCVKVVHDA 570
                I  +    V Y++ +  D+DLS +L  +  + ++V   ++  +++L+ ++ +HD 
Sbjct: 265 STLTEIMVESQKTV-YMIFDYADNDLSGLLLNK-QIEINVAQCKHIFQQLLQGMEYLHDN 322

Query: 571 GIVHSDLKPANFVLV--KGILKIIDFGIANAV---PDHTVNIYRDTQIGTPNYMAPEALV 625
           G++H D+K +N +LV  KG L+I DFG+A  +    D+T       ++ T  Y  PE L+
Sbjct: 323 GVLHRDIKGSN-ILVDNKGRLRITDFGLARRMKRDKDYT------NRVITLWYRPPELLL 375

Query: 626 ALNEVSNVEKKNRWRVGKPSDIWSCGCIMYQMFYGRPPYGAFQNQNRL 673
              + S           +  D+W CGC++ ++F       AFQ QN L
Sbjct: 376 GTTKYS-----------EEVDMWGCGCVLVELFNKT---AAFQGQNEL 409

>NCAS0A10290 Chr1 complement(2051582..2053111) [1530 bp, 509 aa]
           {ON} Anc_3.229
          Length = 509

 Score = 83.2 bits (204), Expect = 6e-16,   Method: Compositional matrix adjust.
 Identities = 81/308 (26%), Positives = 133/308 (43%), Gaps = 59/308 (19%)

Query: 451 EYERIELLGRGGSSKVYKVKNTNNNRVYALKRVVFDEF-----------DDTSVDAF--K 497
           ++  + +LG+G   KV  VK+   N++YA+K++   E            DD ++     +
Sbjct: 122 DFRPVRVLGQGAYGKVILVKDKLTNKLYAMKQLKKAEILITESPKSNEEDDVNLGKRIER 181

Query: 498 GXXXXXXXXXXXXXXXXXIQYQM-DNGVLYLVME-CGDHDLSQILNQRANMPLDVDFIRY 555
                             + Y   DN  LYL+++     +L   L ++    LD D + +
Sbjct: 182 TFAEKSILAELEHPNIVKLFYSFHDNSKLYLLLQYIPGGELFFHLKEQGT--LDEDTVAF 239

Query: 556 YSREMLKCVKVVHDAGIVHSDLKPANFVL-VKGILKIIDFGIA-------NAVPDHTVNI 607
           Y+ E+   +K +HD GIV+ DLKP N +L  KG L + DFG++       +A P    ++
Sbjct: 240 YAAEISCALKFLHDKGIVYRDLKPENCLLNDKGHLVLTDFGLSKKSVTQNSANPSEVTSL 299

Query: 608 YRDTQ--------IGTPNYMAPEALVALNEVSNVEKKNRWRVGKPSDIWSCGCIMYQMFY 659
              ++        IGTP Y APE L  L    N             D +S GC++Y M  
Sbjct: 300 NEPSEDLSTLHSIIGTPEYCAPEILQGLPYNKNC------------DWYSLGCLIYDMLS 347

Query: 660 GRPPYGAFQNQNRLLAIMNPEVKIVFSEKTSKNERVP----KSALDTMKACLIRSPEKRW 715
           G+PPY    ++     I+N   KI   +K  +  ++P    +   D +   L +   KRW
Sbjct: 348 GKPPYTGANHK----VILN---KI---QKDKQGPKIPYYLSEGMKDMLNWLLKKDQSKRW 397

Query: 716 TADEILDA 723
             D+   A
Sbjct: 398 DVDKYWAA 405

>Kwal_26.7552 s26 (416444..417829) [1386 bp, 461 aa] {ON} YKL139W
           (CTK1) - alpha subunit of the kinase which
           phosphorylates the RNA polymerase largest subunit CTD
           (carboxyl-terminal domain) [contig 53] FULL
          Length = 461

 Score = 83.2 bits (204), Expect = 6e-16,   Method: Compositional matrix adjust.
 Identities = 75/303 (24%), Positives = 131/303 (43%), Gaps = 44/303 (14%)

Query: 452 YERIELLGRGGSSKVYKVKNTNNNRVYALKRVVFD-EFDDTSVDAFKGXXXXXXXXXXXX 510
           YERI+ +G G   KVYK +NT   ++ ALKR+  + E +   + + +             
Sbjct: 131 YERIQQVGEGTYGKVYKARNTVTGQLVALKRLRLEGEREGFPITSIREIKLLQSFDHRNI 190

Query: 511 XXXXXIQYQMDNGVLYLVMECGDHDLSQILNQRANMPLDVDFIRYYSREMLKCVKVVHDA 570
                I  +    V Y++ E  D+DLS +L     + L     ++  + +L+ +  +HD 
Sbjct: 191 STLSEIMVESQKTV-YMIFEYADNDLSGLL-MNEQITLSNANCKHLFKSLLEGIHYLHDN 248

Query: 571 GIVHSDLKPANFVLV-KGILKIIDFGIANAVPDHTVNIYRDTQIGTPNYMAPEALVALNE 629
           GI+H D+K +N ++  KG LKI DFG+A  + D +    R   + T  Y  PE L+    
Sbjct: 249 GILHRDIKGSNILIDNKGQLKITDFGLARKMRDDSDYTNR---VITLWYRPPELLMGSTN 305

Query: 630 VSNVEKKNRWRVGKPSDIWSCGCIMYQMFYGRPPYGA---FQNQNRLLAIMN-------- 678
                       G   D+W CGC++ ++F     +      +  N + +IM         
Sbjct: 306 -----------YGTAVDMWGCGCLLVELFKKTAIFQGTNEVEQLNAIFSIMGTPTVEQWP 354

Query: 679 -----PEVKIVFSEKTSKNER---------VPKS-ALDTMKACLIRSPEKRWTADEILDA 723
                P   ++  ++T K+E          +P S A D  K  L+   ++R++A + L  
Sbjct: 355 NLFEMPWFFMMIPQQTRKHESKFDEKFGPILPSSAAADLAKGLLLYDEKRRFSASDALKH 414

Query: 724 SFL 726
            + 
Sbjct: 415 QYF 417

>ZYRO0D08184g Chr4 (706856..711601) [4746 bp, 1581 aa] {ON} similar to
            uniprot|P53599 Saccharomyces cerevisiae YNR031C SSK2
            Suppressor of Sensor Kinase (SLN1) A MAP kinase kinase
            kinase activator of Pbs2p
          Length = 1581

 Score = 84.3 bits (207), Expect = 6e-16,   Method: Compositional matrix adjust.
 Identities = 84/355 (23%), Positives = 144/355 (40%), Gaps = 63/355 (17%)

Query: 440  SSKSIVSVNDIEYERIELLGRGGSSKVYKVKNTNNNRVYALKRVVFDEFDDTSVDAFKGX 499
            S  S +S   + +++   +G G    VY   N +N  + A+K +     D  ++      
Sbjct: 1253 SLASSISNVSMRWQKRSFIGGGTFGSVYSAVNLDNGEILAVKEIKIQ--DAKTMRKIFPS 1310

Query: 500  XXXXXXXXXXXXXXXXIQY---QMDNGVLYLVME-CGDHDLSQILNQRANMPLDVDFIRY 555
                            +QY   ++    + + ME C    L+ +L        D    + 
Sbjct: 1311 IKEEMSVLEMLNHPNIVQYYGVEVHRDKVNIFMEYCEGGSLASLLEH--GRIEDEMVTQV 1368

Query: 556  YSREMLKCVKVVHDAGIVHSDLKPANFVL-VKGILKIIDFGIANAV-------------- 600
            Y+ E+L+ +  +H +G+VH D+KP N +L   GI+K +DFG A  +              
Sbjct: 1369 YTLELLEGLAYLHQSGVVHRDIKPENILLDFNGIIKYVDFGAARKIARNGTTSLGLNKTS 1428

Query: 601  -------------PDHTVNIYRDTQIGTPNYMAPEALVALNEVSNVEKKNRWRVGKPSDI 647
                         P           IGTP YM+PE++            N+ + G   D+
Sbjct: 1429 TGEGNNSSTGKESPSIPEGPALHDMIGTPMYMSPESITG--------SSNKGKFGA-DDV 1479

Query: 648  WSCGCIMYQMFYGRPPYGAFQNQNRLLAIMNPEVKIVFSEKTSKNERVPKSALDTMKACL 707
            WS GC++ +M  GR P+    N+    AIM   V    + +    E V  +    ++ CL
Sbjct: 1480 WSIGCVVLEMITGRRPWAKLDNE---WAIMY-HVAAGHTPQLPYKEEVSAAGRQFLRRCL 1535

Query: 708  IRSPEKRWTADEILDASFLNPVLVTPYIVRDLIRNAVYYGSDQGQVSEDKITELA 762
            +++  KR TA E+L    L+P +V    +R+L      +G+  G+  E  + E A
Sbjct: 1536 VQNAAKRATAVELL----LDPWMVQ---IRELA-----FGT--GEQQESTVVESA 1576

>YJL095W Chr10 (247255..251691) [4437 bp, 1478 aa] {ON}
            BCK1Mitogen-activated protein (MAP) kinase kinase kinase
            acting in the protein kinase C signaling pathway, which
            controls cell integrity; upon activation by Pkc1p
            phosphorylates downstream kinases Mkk1p and Mkk2p
          Length = 1478

 Score = 84.3 bits (207), Expect = 7e-16,   Method: Compositional matrix adjust.
 Identities = 78/300 (26%), Positives = 129/300 (43%), Gaps = 55/300 (18%)

Query: 449  DIEYERIELLGRGGSSKVYKVKNTNNNRVYALKRVVFDEFDD------TSVDAFKGXXXX 502
            +  + + E++G+G    VY   N     + A+K+V   ++        ++V+A +     
Sbjct: 1172 EFAWMKGEMIGKGSFGAVYLCLNVTTGEMMAVKQVEVPKYSSQNEAILSTVEALRSEVST 1231

Query: 503  XXXXXXXXXXXXXIQYQMDNGVLYLVME--CGDHDLSQILNQRANMPLDVDFIRYYSREM 560
                         + ++  N +  L +E   G    S I   R     D   I++ + ++
Sbjct: 1232 LKDLDHLNIVQY-LGFENKNNIYSLFLEYVAGGSVGSLI---RMYGRFDEPLIKHLTTQV 1287

Query: 561  LKCVKVVHDAGIVHSDLKPANFVLVK-GILKIIDFGIANAVPDHTVNIYRDTQI---GTP 616
            LK +  +H  GI+H D+K  N +L + GI KI DFGI+    D    IY ++ +   GT 
Sbjct: 1288 LKGLAYLHSKGILHRDMKADNLLLDQDGICKISDFGISRKSKD----IYSNSDMTMRGTV 1343

Query: 617  NYMAPEALVALNEVSNVEKKNRWRVGKPSDIWSCGCIMYQMFYGRPPYGAFQNQNRLLAI 676
             +MAPE          V+ K  +      DIWS GCI+ +MF G+ P+   +    ++A 
Sbjct: 1344 FWMAPEM---------VDTKQGYSAK--VDIWSLGCIVLEMFAGKRPWSNLE----VVAA 1388

Query: 677  MNPEVKIVFSEKTSKNERVPKSALDTMK-----------ACLIRSPEKRWTADEILDASF 725
            M          K  K++  P    DT+            AC   +PEKR TA+E+L   F
Sbjct: 1389 MF---------KIGKSKSAPPIPEDTLPLISQIGRNFLDACFEINPEKRPTANELLSHPF 1439

>TDEL0G04380 Chr7 (792278..794446) [2169 bp, 722 aa] {ON} Anc_6.31
           YMR001C
          Length = 722

 Score = 84.0 bits (206), Expect = 7e-16,   Method: Compositional matrix adjust.
 Identities = 74/309 (23%), Positives = 133/309 (43%), Gaps = 34/309 (11%)

Query: 439 KSSKSIVSVNDIEYERIELLGRGGSSKVYKVKNTNNNRVYALKRVVFDEFDDTSVDAFKG 498
           K+  S++     +Y R   LG GG ++ +++K+ ++ +++A K V               
Sbjct: 88  KTPPSLIKTRGRDYHRGHFLGEGGFARCFQIKD-DSGKIFAAKTVAKLSIKTEKTRKKLL 146

Query: 499 XXXXXXXXXXXXXXXXXIQYQMDNGVLYLVME-CGDHDLSQILNQRANMPLDVDFIRYYS 557
                            I    D   +Y+++E C +  L ++L +R    L    +R+++
Sbjct: 147 SEIQIHKSMRHANIVQFIDCFEDETNVYILLEICPNGSLMELLKKRKT--LTEPEVRFFT 204

Query: 558 REMLKCVKVVHDAGIVHSDLKPANFVLVKGI-LKIIDFGIANAVPDHTVNIYRDTQIGTP 616
            ++   +K +H   ++H DLK  N    K   LKI DFG+A  + +     Y  T  GTP
Sbjct: 205 TQICGGIKYMHSRRVIHRDLKLGNIFFDKNYNLKIGDFGLAAVLANDRERKY--TVCGTP 262

Query: 617 NYMAPEALVALNEVSNVEKKNRWRVGKPSDIWSCGCIMYQMFYGRPPYGA-----FQNQN 671
           NY+APE L+  +   + E           DIWS G ++Y +  G+PP+ A        + 
Sbjct: 263 NYIAPEVLMGKHSGHSYE----------VDIWSIGVMIYALLIGKPPFQAKDVNTIYERI 312

Query: 672 RLLAIMNPEVKIVFSEKTSKNERVPKSALDTMKACLIRSPEKRWTADEILDASFLNPVLV 731
           +    + P+ K + SE           A   ++  L   P +R +  E+LD  +   +  
Sbjct: 313 KCCDFVFPKEKYISSE-----------ARILVQDLLSLDPLERPSIMEVLDYVWFRGIF- 360

Query: 732 TPYIVRDLI 740
            PYI  D++
Sbjct: 361 PPYIQSDVM 369

>Skud_8.39 Chr8 complement(76730..79501) [2772 bp, 923 aa] {ON}
           YHL007C (REAL)
          Length = 923

 Score = 84.0 bits (206), Expect = 7e-16,   Method: Compositional matrix adjust.
 Identities = 72/284 (25%), Positives = 123/284 (43%), Gaps = 37/284 (13%)

Query: 450 IEYERIELLGRGGSSKVYKVKNTNNNRVYALKRVVFD-----EFDDTSVDAFKGXXXXXX 504
           ++Y  +  +G+G S  VY       N   A+K++  +     E     +   KG      
Sbjct: 597 LKYANLVKIGQGASGGVYTAYEIGTNVSVAIKQMNLEKQPKKELIINEILVMKGSKHPNI 656

Query: 505 XXXXXXXXXXXIQYQMDNGVLYLVMECGDH-DLSQILNQRANMPLDVDFIRYYSREMLKC 563
                      I   +  G L+++ME  +   L+ ++       L    I    RE L  
Sbjct: 657 VNF--------IDSYVLKGDLWVIMEYMEGGSLTDVVTHCI---LTEGQIGAVCRETLSG 705

Query: 564 VKVVHDAGIVHSDLKPANFVL-VKGILKIIDFGIANAVPDHTVNIYRDTQIGTPNYMAPE 622
           +K +H  G++H D+K  N +L ++G +K+ DFG    +  + +N+ R T +GTP +MAPE
Sbjct: 706 LKFLHSKGVLHRDIKSDNILLSMEGDIKLTDFGFCAQI--NELNLKRTTMVGTPYWMAPE 763

Query: 623 ALVALNEVSNVEKKNRWRVGKPSDIWSCGCIMYQMFYGRPPYGAFQNQNRLLAIMNPEVK 682
            +            +R   G   DIWS G ++ +M  G PPY    N+  L A+    + 
Sbjct: 764 VV------------SRKEYGPKVDIWSLGIMIIEMIEGEPPY---LNETPLRALY--LIA 806

Query: 683 IVFSEKTSKNERVPKSALDTMKACLIRSPEKRWTADEILDASFL 726
              + K  + E +  S    +  CL   PE+R +A E+L   ++
Sbjct: 807 TNGTPKLKEPENLSSSLKKFLDWCLCVEPEERASATELLHDEYI 850

>TDEL0D01400 Chr4 (269367..273656) [4290 bp, 1429 aa] {ON} Anc_1.271
            YJL095W
          Length = 1429

 Score = 84.3 bits (207), Expect = 7e-16,   Method: Compositional matrix adjust.
 Identities = 77/300 (25%), Positives = 123/300 (41%), Gaps = 53/300 (17%)

Query: 449  DIEYERIELLGRGGSSKVYKVKNTNNNRVYALKRVVFDEFDDT------SVDAFKGXXXX 502
            +  + + E++G+G    VY   N     + A+K+V   ++         +V+A +     
Sbjct: 1121 EFAWIKGEMIGKGSFGAVYLCLNVTTGEMMAVKQVEVPKYGSQNEQIIHTVEALRAEMST 1180

Query: 503  XXXXXXXXXXXXXIQYQMDNGVLYLVMECGDHDLSQILNQRANMPLDVDFIRYYSR---- 558
                               N V YL  E  DH  S  L   A   +    IR Y R    
Sbjct: 1181 LKNLDHL------------NIVQYLGFEAKDHMNSLFLEYVAGGSVG-SLIRMYGRFDEV 1227

Query: 559  -------EMLKCVKVVHDAGIVHSDLKPANFVL-VKGILKIIDFGIANAVPDHTVNIYRD 610
                   ++L+ +  +H  GI+H D+K  N +L  +G+ KI DFGI+    D    IY +
Sbjct: 1228 MIKHLTTQVLRGLSYLHSRGILHRDMKADNLLLDQEGVCKISDFGISRKSKD----IYSN 1283

Query: 611  TQI---GTPNYMAPEAL-VALNEVSNVEKKNRWRVGKPSDIWSCGCIMYQMFYGRPPYGA 666
            +++   GT  +MAPE +  A    + V            DIWS GC++ +MF G+ P+  
Sbjct: 1284 SEMTMRGTVFWMAPEMVDTAQGYSAKV------------DIWSMGCVVLEMFAGKRPWSN 1331

Query: 667  FQNQNRLLAIMNPEVKIVFSEKTSKNERVPKSALDTMKACLIRSPEKRWTADEILDASFL 726
             +    +  I   +      E T     + +S  D + AC    PE R TAD+ L   F+
Sbjct: 1332 LEVVAAMFKIGKSKSAPPIPEDTL--PLISQSGRDFIDACFQIDPEARPTADKQLSHPFI 1389

>YGR040W Chr7 (575398..576504) [1107 bp, 368 aa] {ON}
           KSS1Mitogen-activated protein kinase (MAPK) involved in
           signal transduction pathways that control filamentous
           growth and pheromone response; the KSS1 gene is
           nonfunctional in S288C strains and functional in W303
           strains
          Length = 368

 Score = 81.6 bits (200), Expect = 8e-16,   Method: Compositional matrix adjust.
 Identities = 48/163 (29%), Positives = 85/163 (52%), Gaps = 23/163 (14%)

Query: 525 LYLVMECGDHDLSQILNQR--ANMPLDVDFIRYYSREMLKCVKVVHDAGIVHSDLKPANF 582
           +YLV E  + DL +++N +      L  D ++Y++ ++L+ +K +H A ++H D+KP+N 
Sbjct: 90  VYLVEELMETDLQKVINNQNSGFSTLSDDHVQYFTYQILRALKSIHSAQVIHRDIKPSNL 149

Query: 583 VLVKGI-LKIIDFGIANAVPDHTVNIYRDTQIG-------TPNYMAPEALVALNEVSNVE 634
           +L     LK+ DFG+A  +   + +  R+T +G       T  Y APE ++   E +   
Sbjct: 150 LLNSNCDLKVCDFGLARCLASSSDS--RETLVGFMTEYVATRWYRAPEIMLTFQEYTTA- 206

Query: 635 KKNRWRVGKPSDIWSCGCIMYQMFYGRPPYGAFQNQNRLLAIM 677
                      DIWSCGCI+ +M  G+P +      ++L  I+
Sbjct: 207 ----------MDIWSCGCILAEMVSGKPLFPGRDYHHQLWLIL 239

>YAR019C Chr1 complement(172211..175135) [2925 bp, 974 aa] {ON}
           CDC15Protein kinase of the Mitotic Exit Network that is
           localized to the spindle pole bodies at late anaphase;
           promotes mitotic exit by directly switching on the
           kinase activity of Dbf2p; required for spindle
           disassembly after meiosis II
          Length = 974

 Score = 84.0 bits (206), Expect = 8e-16,   Method: Compositional matrix adjust.
 Identities = 74/286 (25%), Positives = 131/286 (45%), Gaps = 43/286 (15%)

Query: 450 IEYERIELLGRGGSSKVYKVKNTNNNRVYALKRVVFD---EFDDTSVDAFKGXXXXXXXX 506
           ++Y   +++GRG    VYK  N + ++V A+K VV++   E +D   +            
Sbjct: 23  VQYHLKQVIGRGSYGVVYKAINKHTDQVVAIKEVVYENDEELNDIMAEI---------SL 73

Query: 507 XXXXXXXXXIQYQ---MDNGVLYLVME-CGDHDLSQILNQRANMPLDVDFIRYYSREMLK 562
                    ++Y      +  LY+++E C +  L ++++ R++  L  +  + Y  + L 
Sbjct: 74  LKNLNHNNIVKYHGFIRKSYELYILLEYCANGSLRRLIS-RSSTGLSENESKTYVTQTLL 132

Query: 563 CVKVVHDAGIVHSDLKPANFVL-VKGILKIIDFGIANAVPDHTVNIYRDTQIGTPNYMAP 621
            +K +H  G++H D+K AN +L     +K+ DFG++  V    +     T  GT N+MAP
Sbjct: 133 GLKYLHGEGVIHRDIKAANILLSADNTVKLADFGVSTIVNSSAL-----TLAGTLNWMAP 187

Query: 622 EALVALNEVSNVEKKNRWRVGKPSDIWSCGCIMYQMFYGRPPYGAFQNQNRLLAIMNPEV 681
           E L            NR      SDIWS G  + +M    PPY    + N   A+ N   
Sbjct: 188 EIL-----------GNR-GASTLSDIWSLGATVVEMLTKNPPYHNLTDANIYYAVEND-- 233

Query: 682 KIVFSEKTSKNERVPKSALDTMKACLIRSPEKRWTADEILDASFLN 727
              +   +S +E +     D +  C +++  KR TAD++L   ++N
Sbjct: 234 --TYYPPSSFSEPLK----DFLSKCFVKNMYKRPTADQLLKHVWIN 273

>KAFR0G02690 Chr7 complement(555573..557714) [2142 bp, 713 aa] {ON}
           Anc_6.31 YMR001C
          Length = 713

 Score = 83.6 bits (205), Expect = 8e-16,   Method: Compositional matrix adjust.
 Identities = 72/292 (24%), Positives = 130/292 (44%), Gaps = 35/292 (11%)

Query: 439 KSSKSIVSVNDIEYERIELLGRGGSSKVYKVKNTNNNRVYALKRVVFDEFDDTSVDAFKG 498
           K+  S++     +Y R   LG GG ++ +++++ ++ +++A K V               
Sbjct: 82  KTPPSLIKTRGRDYHRGHFLGEGGFARCFQIRD-DSGKIFAAKTVAKISIKSEKTRKKLL 140

Query: 499 XXXXXXXXXXXXXXXXXIQYQMDNGVLYLVME-CGDHDLSQILNQRANMPLDVDFIRYYS 557
                            I    D+  +Y+++E C +  L  +L +R +  L    +R+++
Sbjct: 141 SEIQIHKSMKHVNIVQFIDCFEDDTNVYILLEICPNGSLMDLLKKRKS--LTEPEVRFFT 198

Query: 558 REMLKCVKVVHDAGIVHSDLKPAN-FVLVKGILKIIDFGIANAVPDHTVNIYRDTQIGTP 616
            ++   +K +H   ++H DLK  N F   K  LKI DFG+A  + +     Y  T  GTP
Sbjct: 199 TQICGAIKYMHSRKVIHRDLKLGNIFFDRKYNLKIGDFGLAATLANDRERKY--TVCGTP 256

Query: 617 NYMAPEALVALNEVSNVEKKNRWRVGKPSDIWSCGCIMYQMFYGRPPYGAFQNQNRLLAI 676
           NY+APE L+  +   + E           DIWS G ++Y +  GRPP   FQ++      
Sbjct: 257 NYIAPEVLMGKHSGHSYE----------VDIWSIGVMIYALIIGRPP---FQSK------ 297

Query: 677 MNPEVKIVFSEKTSKNERVPKSALDTMKA------CLIRSPEKRWTADEILD 722
              +V  ++     ++   PK  L + +A       L   P +R + +EI+D
Sbjct: 298 ---DVNTIYERIKCRDFSFPKDKLISSEAKILIQDILSLDPLERPSVNEIMD 346

>KAFR0C02840 Chr3 (559821..560873) [1053 bp, 350 aa] {ON} Anc_8.162
           YBL016W
          Length = 350

 Score = 81.6 bits (200), Expect = 8e-16,   Method: Compositional matrix adjust.
 Identities = 59/232 (25%), Positives = 109/232 (46%), Gaps = 44/232 (18%)

Query: 525 LYLVMECGDHDLSQILNQRANMPLDVDFIRYYSREMLKCVKVVHDAGIVHSDLKPANFVL 584
           +Y++ E    DL ++++ +    L  D I+Y+  + L+ VK++H + ++H DLKP+N ++
Sbjct: 89  VYIIQELMQTDLHRVISTQE---LSDDHIQYFIYQTLRAVKILHGSNVIHRDLKPSNLLI 145

Query: 585 VKGI-LKIIDFGIANAVPDHTVNIYRDTQ------IGTPNYMAPEALVALNEVSNVEKKN 637
                LK+ DFG+A  + +H  +     Q      + T  Y APE ++   + S      
Sbjct: 146 NSNCDLKVCDFGLARIIDEHNNSDAYSKQNGMTEYVATRWYRAPEVMLTAAKYS------ 199

Query: 638 RWRVGKPSDIWSCGCIMYQMFYGRPPYGAFQNQNRLLAIM-------NPEVKIVFSEK-- 688
                K  D+WSCGCI+ ++F  RP +     +++L+ I          +++ + S++  
Sbjct: 200 -----KAMDVWSCGCILAELFLKRPLFPGKDYRHQLMLIFGLIGTPTGEDLQCIESKRAR 254

Query: 689 -----TSKNERVPKS---------ALDTMKACLIRSPEKRWTADEILDASFL 726
                  + + VP            +D +K  L+  P KR TA E L   +L
Sbjct: 255 EYIMTVPRYDPVPWEKVFAHVNPLGVDLLKKMLVFDPSKRITAAEALRHPYL 306

>Smik_3.54 Chr3 (80309..83407) [3099 bp, 1032 aa] {ON} YCL024W
           (REAL)
          Length = 1032

 Score = 84.0 bits (206), Expect = 9e-16,   Method: Compositional matrix adjust.
 Identities = 64/220 (29%), Positives = 97/220 (44%), Gaps = 41/220 (18%)

Query: 518 YQMDNGVLYLVMECGDH-DLSQILNQRANMPLDVDFIRYYSREMLKCVKVV-------HD 569
           ++ DN  LYL++E  +  +L  +L  R  +P          RE +KC K +       H 
Sbjct: 96  WETDNN-LYLILEYAEKGELFNLLVDRGPLP---------EREAIKCFKQIIIAISYCHA 145

Query: 570 AGIVHSDLKPANFVLVKGI-LKIIDFGIANAVPDHTVNIYRDTQIGTPNYMAPEALVALN 628
            GIVH DLKP N +L     +KI DFG+A    D  +    +T  G+P+Y APE +  L 
Sbjct: 146 LGIVHRDLKPENLLLDNSYNIKIADFGMAALQTDAGM---LETSCGSPHYAAPEIVSGLP 202

Query: 629 EVSNVEKKNRWRVGKPSDIWSCGCIMYQMFYGRPPYGAFQNQNR--LLAIMNPEVKIVFS 686
                        G  SD+WSCG I++ +  GR P+       R  LL +   + ++   
Sbjct: 203 -----------YEGFASDVWSCGVILFALLTGRLPFDEENGNVRDLLLKVQKGQFEM--- 248

Query: 687 EKTSKNERVPKSALDTMKACLIRSPEKRWTADEILDASFL 726
                N  +   A D ++  L+  P +R    +IL    L
Sbjct: 249 ---PNNAEISGDAQDLIRRILVVDPTQRIKIRDILSHPLL 285

>KAFR0C01440 Chr3 complement(295468..298755) [3288 bp, 1095 aa] {ON}
           Anc_3.92 YDR490C
          Length = 1095

 Score = 84.0 bits (206), Expect = 9e-16,   Method: Compositional matrix adjust.
 Identities = 48/153 (31%), Positives = 76/153 (49%), Gaps = 21/153 (13%)

Query: 521 DNGVLYLVME-CGDHDLSQILNQRANMPLDVDFIRYYSREMLKCVKVVHDAGIVHSDLKP 579
           D   LY ++E C + D   ++ +  +  L+     YYS +++  +  +H  GI+H D+KP
Sbjct: 249 DESSLYFLLEYCPNGDFLSLMKKYGS--LNETVACYYSAQVIDAIDYLHTNGIIHRDIKP 306

Query: 580 ANFVLVKGI-LKIIDFGIANAVPDHTVNIY-----RDTQIGTPNYMAPEALVALNEVSNV 633
            N +L K   +K+ DFG A  +   T N +       + +GT  Y+APE L         
Sbjct: 307 ENILLDKEFKIKLTDFGTAKILDSSTNNKFDLLTRSKSFVGTAEYVAPELL--------- 357

Query: 634 EKKNRWRVGKPSDIWSCGCIMYQMFYGRPPYGA 666
              N   V    D+W+ GCI+YQM  G+PP+ A
Sbjct: 358 ---NDSFVDYRCDVWAFGCILYQMIAGKPPFKA 387

>TPHA0J00420 Chr10 complement(96445..98568) [2124 bp, 707 aa] {ON}
           Anc_6.31 YMR001C
          Length = 707

 Score = 83.2 bits (204), Expect = 9e-16,   Method: Compositional matrix adjust.
 Identities = 74/306 (24%), Positives = 134/306 (43%), Gaps = 24/306 (7%)

Query: 439 KSSKSIVSVNDIEYERIELLGRGGSSKVYKVKNTNNNRVYALKRVVFDEFDDTSVDAFKG 498
           K+  S++     +Y R   LG GG ++ ++  N ++ +++A K V               
Sbjct: 70  KTPPSLIKTRGRDYHRGHFLGEGGFARCFQF-NDDSGKIFAAKTVAKLSIKSEKTRRKLL 128

Query: 499 XXXXXXXXXXXXXXXXXIQYQMDNGVLYLVME-CGDHDLSQILNQRANMPLDVDFIRYYS 557
                            I    D+  +Y+++E C +  L  +L +R +  L    +R+++
Sbjct: 129 SEIQIHKSMKNVNIVQFIDCFEDDTNVYILLEICPNGSLMDLLKKRKS--LTEPEVRFFT 186

Query: 558 REMLKCVKVVHDAGIVHSDLKPANFVLVKGI-LKIIDFGIANAVPDHTVNIYRDTQIGTP 616
            ++   +K +H   ++H DLK  N    K   LKI DFG+A  + +     Y  T  GTP
Sbjct: 187 TQICGAIKYMHSRRVIHRDLKLGNIFFDKDYNLKIGDFGLAAVLANDRERKY--TVCGTP 244

Query: 617 NYMAPEALVALNEVSNVEKKNRWRVGKPSDIWSCGCIMYQMFYGRPPYGAFQNQNRLLAI 676
           NY+APE L+  +   + E           DIWS G ++Y +  G+PP+     Q++ +  
Sbjct: 245 NYIAPEVLMGKHTGHSYE----------VDIWSIGVMLYALLIGKPPF-----QSKDVNT 289

Query: 677 MNPEVKIVFSEKTSKNERVPKSALDTMKACLIRSPEKRWTADEILDASFLNPVLVTPYIV 736
           +   +K        K++ +   A   ++  L   P +R + DEI+D  +    L  P I 
Sbjct: 290 IYERIKCC-DFTFPKDKYISPEAKILIQDLLSLDPLERPSVDEIIDYVWFRG-LFPPQIE 347

Query: 737 RDLIRN 742
            D++ N
Sbjct: 348 SDVMTN 353

>Ecym_6092 Chr6 (178965..180299) [1335 bp, 444 aa] {ON} similar to
           Ashbya gossypii AFR205C
          Length = 444

 Score = 82.4 bits (202), Expect = 9e-16,   Method: Compositional matrix adjust.
 Identities = 64/221 (28%), Positives = 104/221 (47%), Gaps = 42/221 (19%)

Query: 452 YERIELLGRGGSSKVYKVKNTNNNRVYALKRVVF----DEFDDTSVDAFKGXXXXXXXXX 507
           YERI  +G G   KVYK +N   N++ ALK++      D F  TS+   K          
Sbjct: 106 YERITQVGEGTYGKVYKCQNIYTNKLVALKKLRLESERDGFPITSIREIK------LLQH 159

Query: 508 XXXXXXXXIQYQMDNG--VLYLVMECGDHDLSQILNQRANMPLDVDF----IRYYSREML 561
                   I   M  G   +Y++ E  D+DLS +L     M  ++ F     ++  R++L
Sbjct: 160 CQHENVSTIAEIMCEGQKTVYMIFEYADNDLSGLL-----MNKEIRFTEANCKHLFRQLL 214

Query: 562 KCVKVVHDAGIVHSDLKPANFVLV-KGILKIIDFGIANAV---PDHTVNIYRDTQIGTPN 617
           K ++ +H+  I+H D+K +N ++  KG L+I DFG+A  +   PD+T       ++ T  
Sbjct: 215 KGMEYLHENRILHRDIKGSNILIDNKGNLQITDFGLARKMKQEPDYT------NRVITLW 268

Query: 618 YMAPEALVALNEVSNVEKKNRWRVGKPSDIWSCGCIMYQMF 658
           Y  PE L+              + G   D+W CGC++ ++F
Sbjct: 269 YRPPELLLGTT-----------KYGTEVDMWGCGCLLVELF 298

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.313    0.130    0.365 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 83,060,835
Number of extensions: 3767940
Number of successful extensions: 19025
Number of sequences better than 10.0: 2086
Number of HSP's gapped: 16935
Number of HSP's successfully gapped: 2338
Length of query: 774
Length of database: 53,481,399
Length adjustment: 117
Effective length of query: 657
Effective length of database: 40,065,477
Effective search space: 26323018389
Effective search space used: 26323018389
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.9 bits)
S2: 70 (31.6 bits)