Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
TPHA0M002906.27ON32732717390.0
KAFR0G026506.27ON32130010001e-136
NDAI0F017406.27ON3133199921e-134
SAKL0E01474g6.27ON3112709881e-134
KNAG0M012406.27ON3143229831e-133
CAGL0E02519g6.27ON3153089731e-131
NCAS0H015106.27ON3132969591e-129
Kpol_1032.96.27ON3182989561e-129
Kwal_56.224546.27ON3153219451e-127
TDEL0G044206.27ON3223219411e-127
TBLA0E030606.27ON3192919291e-125
KLLA0D01331g6.27ON3083089201e-124
KLTH0C11044g6.27ON3153249201e-124
YOL002C (IZH2)6.27ON3173109201e-123
ZYRO0C07612g6.27ON3193079151e-123
Smik_15.1686.27ON3273179071e-121
Skud_15.1606.27ON3273099021e-121
ACL002C6.27ON3293068971e-120
Suva_15.1736.27ON3272808741e-116
Ecym_30316.27ON3282678681e-115
KLTH0C09504g3.90ON3192696985e-90
SAKL0C09218g3.90ON3143086976e-90
ZYRO0B06556g3.90ON3182766882e-88
TPHA0A006403.90ON3273116865e-88
Kwal_56.227043.90ON3203096752e-86
TDEL0D053403.90ON3163106724e-86
Kpol_1053.263.90ON3243096639e-85
CAGL0G04631g3.90ON3163296603e-84
KAFR0A081303.90ON3193276578e-84
NDAI0A071603.90ON3303296457e-82
Skud_4.7663.90ON3163236431e-81
KLLA0C12441g3.90ON3153016352e-80
Smik_4.7693.90ON3163236281e-79
YDR492W (IZH1)3.90ON3163056272e-79
Suva_2.6683.90ON3153186263e-79
AFR337W3.90ON3172976254e-79
Ecym_35883.90ON3052756236e-79
NCAS0I025703.90ON3143186072e-76
TBLA0B022903.90ON3263285952e-74
KNAG0K021603.90ON3233335673e-70
TBLA0B082553.90ON2962964001e-45
NCAS0C049203.90ON3262853532e-38
NDAI0G043003.90ON3183133462e-37
CAGL0I07491g3.90ON3012842936e-30
Suva_15.643.90ON3123162376e-22
Skud_15.533.90ON3122362156e-19
Smik_15.563.90ON3123002148e-19
YOL101C (IZH4)3.90ON3122302023e-17
KAFR0J006705.197ON5092821744e-13
TPHA0E031205.197ON5692411728e-13
AAL153C5.197ON4193751692e-12
Kpol_2002.945.197ON5772401584e-11
TDEL0E043205.197ON4503291541e-10
Smik_12.865.197ON5422431513e-10
KLLA0F15510g5.197ON6223231505e-10
YLR023C (IZH3)5.197ON5432431452e-09
Skud_12.915.197ON5422481452e-09
NCAS0D026005.197ON5431631433e-09
NDAI0I023305.197ON5782481434e-09
TBLA0C060505.197ON4373711406e-09
KNAG0B051005.197ON5382471407e-09
Suva_10.1045.197ON5412411382e-08
Ecym_71095.197ON5682821345e-08
ZYRO0B10538g5.197ON5312421311e-07
KNAG0K006703.90ON3211221238e-07
KLTH0B03498g5.197ON5462511212e-06
SAKL0G12980g5.197ON5632011141e-05
Kwal_33.151225.197ON5662491113e-05
CAGL0D03322g5.197ON5452471033e-04
Ecym_30806.106ON47953712.2
Kpol_478.176.106ON48476712.3
AAR153C6.106ON47850693.6
ZYRO0C05016g6.106ON48385693.6
KLTH0H06798g6.106ON48850694.1
TBLA0C06220singletonON49450685.6
NCAS0D032506.106ON49780676.7
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= TPHA0M00290
         (327 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

TPHA0M00290 Chr13 (57784..58767) [984 bp, 327 aa] {ON} Anc_6.27 ...   674   0.0  
KAFR0G02650 Chr7 complement(547561..548526) [966 bp, 321 aa] {ON...   389   e-136
NDAI0F01740 Chr6 (429141..430082) [942 bp, 313 aa] {ON} Anc_6.27      386   e-134
SAKL0E01474g Chr5 (112382..113317) [936 bp, 311 aa] {ON} similar...   385   e-134
KNAG0M01240 Chr13 (226766..227710) [945 bp, 314 aa] {ON} Anc_6.2...   383   e-133
CAGL0E02519g Chr5 complement(242867..243814) [948 bp, 315 aa] {O...   379   e-131
NCAS0H01510 Chr8 complement(287981..288922) [942 bp, 313 aa] {ON...   374   e-129
Kpol_1032.9 s1032 (22700..23656) [957 bp, 318 aa] {ON} (22700..2...   372   e-129
Kwal_56.22454 s56 (136175..137122) [948 bp, 315 aa] {ON} YOL002C...   368   e-127
TDEL0G04420 Chr7 complement(802412..803380) [969 bp, 322 aa] {ON...   367   e-127
TBLA0E03060 Chr5 (769031..769990) [960 bp, 319 aa] {ON} Anc_6.27...   362   e-125
KLLA0D01331g Chr4 (117469..118395) [927 bp, 308 aa] {ON} similar...   358   e-124
KLTH0C11044g Chr3 complement(908604..909551) [948 bp, 315 aa] {O...   358   e-124
YOL002C Chr15 complement(323411..324364) [954 bp, 317 aa] {ON}  ...   358   e-123
ZYRO0C07612g Chr3 complement(578864..579823) [960 bp, 319 aa] {O...   357   e-123
Smik_15.168 Chr15 complement(290724..291707) [984 bp, 327 aa] {O...   353   e-121
Skud_15.160 Chr15 complement(283003..283986) [984 bp, 327 aa] {O...   352   e-121
ACL002C Chr3 complement(353449..354438) [990 bp, 329 aa] {ON} Sy...   350   e-120
Suva_15.173 Chr15 complement(297915..298898) [984 bp, 327 aa] {O...   341   e-116
Ecym_3031 Chr3 (61592..62578) [987 bp, 328 aa] {ON} similar to A...   338   e-115
KLTH0C09504g Chr3 complement(788442..789401) [960 bp, 319 aa] {O...   273   5e-90
SAKL0C09218g Chr3 (839747..840691) [945 bp, 314 aa] {ON} similar...   273   6e-90
ZYRO0B06556g Chr2 (526478..527434) [957 bp, 318 aa] {ON} similar...   269   2e-88
TPHA0A00640 Chr1 complement(115042..116025) [984 bp, 327 aa] {ON...   268   5e-88
Kwal_56.22704 s56 (244431..245393) [963 bp, 320 aa] {ON} YDR492W...   264   2e-86
TDEL0D05340 Chr4 (969608..970558) [951 bp, 316 aa] {ON} Anc_3.90...   263   4e-86
Kpol_1053.26 s1053 complement(40099..41073) [975 bp, 324 aa] {ON...   259   9e-85
CAGL0G04631g Chr7 (441149..442099) [951 bp, 316 aa] {ON} similar...   258   3e-84
KAFR0A08130 Chr1 (1638153..1639112) [960 bp, 319 aa] {ON} Anc_3....   257   8e-84
NDAI0A07160 Chr1 complement(1630482..1631474) [993 bp, 330 aa] {...   253   7e-82
Skud_4.766 Chr4 (1354630..1355580) [951 bp, 316 aa] {ON} YDR492W...   252   1e-81
KLLA0C12441g Chr3 complement(1057427..1058374) [948 bp, 315 aa] ...   249   2e-80
Smik_4.769 Chr4 (1356263..1357213) [951 bp, 316 aa] {ON} YDR492W...   246   1e-79
YDR492W Chr4 (1434924..1435874) [951 bp, 316 aa] {ON}  IZH1Membr...   246   2e-79
Suva_2.668 Chr2 (1186763..1187710) [948 bp, 315 aa] {ON} YDR492W...   245   3e-79
AFR337W Chr6 (1051645..1052598) [954 bp, 317 aa] {ON} Syntenic h...   245   4e-79
Ecym_3588 Chr3 (1117646..1118563) [918 bp, 305 aa] {ON} similar ...   244   6e-79
NCAS0I02570 Chr9 complement(480266..481210) [945 bp, 314 aa] {ON...   238   2e-76
TBLA0B02290 Chr2 complement(534472..535452) [981 bp, 326 aa] {ON...   233   2e-74
KNAG0K02160 Chr11 (436744..437715) [972 bp, 323 aa] {ON} Anc_3.9...   223   3e-70
TBLA0B08255 Chr2 (1973757..1974647) [891 bp, 296 aa] {ON}             158   1e-45
NCAS0C04920 Chr3 complement(1003692..1004672) [981 bp, 326 aa] {...   140   2e-38
NDAI0G04300 Chr7 (1035664..1036620) [957 bp, 318 aa] {ON} Anc_3.90    137   2e-37
CAGL0I07491g Chr9 complement(719539..720444) [906 bp, 301 aa] {O...   117   6e-30
Suva_15.64 Chr15 complement(100035..100973) [939 bp, 312 aa] {ON...    96   6e-22
Skud_15.53 Chr15 complement(86339..87277) [939 bp, 312 aa] {ON} ...    87   6e-19
Smik_15.56 Chr15 complement(90083..91021) [939 bp, 312 aa] {ON} ...    87   8e-19
YOL101C Chr15 complement(126982..127920) [939 bp, 312 aa] {ON}  ...    82   3e-17
KAFR0J00670 Chr10 (120378..121907) [1530 bp, 509 aa] {ON} Anc_5....    72   4e-13
TPHA0E03120 Chr5 complement(654079..655788) [1710 bp, 569 aa] {O...    71   8e-13
AAL153C Chr1 complement(75086..76345) [1260 bp, 419 aa] {ON} Syn...    70   2e-12
Kpol_2002.94 s2002 (229517..231250) [1734 bp, 577 aa] {ON} (2295...    65   4e-11
TDEL0E04320 Chr5 complement(804655..806007) [1353 bp, 450 aa] {O...    64   1e-10
Smik_12.86 Chr12 complement(172288..173916) [1629 bp, 542 aa] {O...    63   3e-10
KLLA0F15510g Chr6 (1433494..1435362) [1869 bp, 622 aa] {ON} some...    62   5e-10
YLR023C Chr12 complement(185498..187129) [1632 bp, 543 aa] {ON} ...    60   2e-09
Skud_12.91 Chr12 complement(177334..178962) [1629 bp, 542 aa] {O...    60   2e-09
NCAS0D02600 Chr4 (499689..501320) [1632 bp, 543 aa] {ON} Anc_5.1...    60   3e-09
NDAI0I02330 Chr9 (532412..534148) [1737 bp, 578 aa] {ON} Anc_5.197     60   4e-09
TBLA0C06050 Chr3 (1468152..1469465) [1314 bp, 437 aa] {ON} Anc_5...    59   6e-09
KNAG0B05100 Chr2 (976101..977717) [1617 bp, 538 aa] {ON} Anc_5.1...    59   7e-09
Suva_10.104 Chr10 complement(191663..193288) [1626 bp, 541 aa] {...    58   2e-08
Ecym_7109 Chr7 complement(210829..212535) [1707 bp, 568 aa] {ON}...    56   5e-08
ZYRO0B10538g Chr2 complement(830311..831906) [1596 bp, 531 aa] {...    55   1e-07
KNAG0K00670 Chr11 complement(119419..120384) [966 bp, 321 aa] {O...    52   8e-07
KLTH0B03498g Chr2 complement(281148..282788) [1641 bp, 546 aa] {...    51   2e-06
SAKL0G12980g Chr7 complement(1108751..1110442) [1692 bp, 563 aa]...    49   1e-05
Kwal_33.15122 s33 (968885..970585) [1701 bp, 566 aa] {ON} YLR023...    47   3e-05
CAGL0D03322g Chr4 complement(340949..342586) [1638 bp, 545 aa] {...    44   3e-04
Ecym_3080 Chr3 (149461..150900) [1440 bp, 479 aa] {ON} similar t...    32   2.2  
Kpol_478.17 s478 (61375..62829) [1455 bp, 484 aa] {ON} (61375..6...    32   2.3  
AAR153C Chr1 complement(619953..621389) [1437 bp, 478 aa] {ON} S...    31   3.6  
ZYRO0C05016g Chr3 (394581..396032) [1452 bp, 483 aa] {ON} simila...    31   3.6  
KLTH0H06798g Chr8 (596966..598432) [1467 bp, 488 aa] {ON} unipro...    31   4.1  
TBLA0C06220 Chr3 (1507690..1509174) [1485 bp, 494 aa] {ON}             31   5.6  
NCAS0D03250 Chr4 (608476..609969) [1494 bp, 497 aa] {ON} Anc_6.106     30   6.7  

>TPHA0M00290 Chr13 (57784..58767) [984 bp, 327 aa] {ON} Anc_6.27
           YOL002C
          Length = 327

 Score =  674 bits (1739), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 327/327 (100%), Positives = 327/327 (100%)

Query: 1   MTSSSRLQKRNGETIVSSSAVTEEEYTIANDGVKSNKKLVKIIGRFTRQLITITHWDDLP 60
           MTSSSRLQKRNGETIVSSSAVTEEEYTIANDGVKSNKKLVKIIGRFTRQLITITHWDDLP
Sbjct: 1   MTSSSRLQKRNGETIVSSSAVTEEEYTIANDGVKSNKKLVKIIGRFTRQLITITHWDDLP 60

Query: 61  DWQKDNEHIHEGYVKETNSFINCFESLFFLHNESVNIYSHMVPGLCALFMLLIDINIIKK 120
           DWQKDNEHIHEGYVKETNSFINCFESLFFLHNESVNIYSHMVPGLCALFMLLIDINIIKK
Sbjct: 61  DWQKDNEHIHEGYVKETNSFINCFESLFFLHNESVNIYSHMVPGLCALFMLLIDINIIKK 120

Query: 121 FPTTTFVDYFMIDLFLAGAFSCLILSSAFHTLKSHSLFVAIYGNKLDYLGIVILIVTSMI 180
           FPTTTFVDYFMIDLFLAGAFSCLILSSAFHTLKSHSLFVAIYGNKLDYLGIVILIVTSMI
Sbjct: 121 FPTTTFVDYFMIDLFLAGAFSCLILSSAFHTLKSHSLFVAIYGNKLDYLGIVILIVTSMI 180

Query: 181 SILYYGFYDTPYFFHLFSTITILFGIACGTVSLANKFRSREWRPYRATLFVCFGLSAVFP 240
           SILYYGFYDTPYFFHLFSTITILFGIACGTVSLANKFRSREWRPYRATLFVCFGLSAVFP
Sbjct: 181 SILYYGFYDTPYFFHLFSTITILFGIACGTVSLANKFRSREWRPYRATLFVCFGLSAVFP 240

Query: 241 VLTGIWYYGLEDTFKRIQLKWIVTEGFFYIFGAFLYAMRYPERICPGAFDLWGHSHQIFH 300
           VLTGIWYYGLEDTFKRIQLKWIVTEGFFYIFGAFLYAMRYPERICPGAFDLWGHSHQIFH
Sbjct: 241 VLTGIWYYGLEDTFKRIQLKWIVTEGFFYIFGAFLYAMRYPERICPGAFDLWGHSHQIFH 300

Query: 301 VFVVIAAYSHFHGLLSAYEYAHEMLIK 327
           VFVVIAAYSHFHGLLSAYEYAHEMLIK
Sbjct: 301 VFVVIAAYSHFHGLLSAYEYAHEMLIK 327

>KAFR0G02650 Chr7 complement(547561..548526) [966 bp, 321 aa] {ON}
           Anc_6.27 YOL002C
          Length = 321

 Score =  389 bits (1000), Expect = e-136,   Method: Compositional matrix adjust.
 Identities = 183/300 (61%), Positives = 231/300 (77%), Gaps = 3/300 (1%)

Query: 27  TIANDGVKSNKKLVKIIGRFTRQLITITHWDDLPDWQKDNEHIHEGYVKETNSFINCFES 86
           T   D V+ NK       R   ++I + +W+++PDWQKDNEHI  GYVKETNSF +C ES
Sbjct: 17  TAFQDVVEQNKGETI---RSLEKIIQLYNWNEIPDWQKDNEHIISGYVKETNSFFSCIES 73

Query: 87  LFFLHNESVNIYSHMVPGLCALFMLLIDINIIKKFPTTTFVDYFMIDLFLAGAFSCLILS 146
           LF+LHNESVN+YSH++P +C L   L++  I+ KF TTT +DY  IDLF  GAF+CLILS
Sbjct: 74  LFYLHNESVNVYSHLIPAVCFLMTSLLNKTIVPKFRTTTVLDYLYIDLFFLGAFTCLILS 133

Query: 147 SAFHTLKSHSLFVAIYGNKLDYLGIVILIVTSMISILYYGFYDTPYFFHLFSTITILFGI 206
           S FH  KSHSL +A +GNKLDYLGIV+LI TSMIS+LYYGFYDTP  F++F+ IT+ FG+
Sbjct: 134 STFHCFKSHSLRIATFGNKLDYLGIVVLISTSMISLLYYGFYDTPSLFYVFAFITLSFGL 193

Query: 207 ACGTVSLANKFRSREWRPYRATLFVCFGLSAVFPVLTGIWYYGLEDTFKRIQLKWIVTEG 266
           AC TVSL +KFRSRE R YRATLFVCFGLSAV PV+ G+++YG  +T+ RIQLKW++ EG
Sbjct: 194 ACATVSLKDKFRSRECRAYRATLFVCFGLSAVLPVICGLYHYGFYNTWHRIQLKWVLLEG 253

Query: 267 FFYIFGAFLYAMRYPERICPGAFDLWGHSHQIFHVFVVIAAYSHFHGLLSAYEYAHEMLI 326
            FYIFGAFLY +R+PE+  PG +D+WGHSHQ+FH+ VVIAA  HF  L+ +YE+ H  +I
Sbjct: 254 VFYIFGAFLYGIRFPEKYTPGKYDIWGHSHQLFHILVVIAALCHFKALMCSYEHVHMFVI 313

>NDAI0F01740 Chr6 (429141..430082) [942 bp, 313 aa] {ON} Anc_6.27
          Length = 313

 Score =  386 bits (992), Expect = e-134,   Method: Compositional matrix adjust.
 Identities = 189/319 (59%), Positives = 236/319 (73%), Gaps = 10/319 (3%)

Query: 7   LQKRNGETIVSSSAVTEEEYTIANDGVKSNKKLVKIIGRFTRQLITITHWDDLPDWQKDN 66
           +QKR G T  S++ V E      ++G    +   K++ +  R       WD++P+WQKDN
Sbjct: 5   IQKR-GNT--STTTVVEGIINNTDNGDSIEQVKRKVVYKLYR-------WDEIPEWQKDN 54

Query: 67  EHIHEGYVKETNSFINCFESLFFLHNESVNIYSHMVPGLCALFMLLIDINIIKKFPTTTF 126
           EHI  GYV+ETNSF  C  SLF++HNES N+YSH++PG+   F ++++   I  + TT+ 
Sbjct: 55  EHIISGYVRETNSFKGCLHSLFYVHNESGNVYSHLLPGVFFFFTMVLNKYGITIYSTTSI 114

Query: 127 VDYFMIDLFLAGAFSCLILSSAFHTLKSHSLFVAIYGNKLDYLGIVILIVTSMISILYYG 186
           VDY MIDLF  GAF CLILSS FH  KSHSL VA  GNKLDYLGIVILIVTSMISI+Y+G
Sbjct: 115 VDYLMIDLFFFGAFCCLILSSLFHCFKSHSLKVATLGNKLDYLGIVILIVTSMISIMYFG 174

Query: 187 FYDTPYFFHLFSTITILFGIACGTVSLANKFRSREWRPYRATLFVCFGLSAVFPVLTGIW 246
           F+D P FF+ FS++T LFG AC TVSL + FRSREWRPYRA LFV FGLSA+ P+L G +
Sbjct: 175 FFDNPLFFYFFSSLTFLFGGACATVSLKDHFRSREWRPYRAGLFVAFGLSAILPILAGTF 234

Query: 247 YYGLEDTFKRIQLKWIVTEGFFYIFGAFLYAMRYPERICPGAFDLWGHSHQIFHVFVVIA 306
           YYG+E+TF RIQLKWI+ EGFFYIFGAFLY +R+PE+  PG+FD+WGHSHQIFH+ VV+A
Sbjct: 235 YYGIEETFIRIQLKWIILEGFFYIFGAFLYGVRFPEKYVPGSFDIWGHSHQIFHILVVVA 294

Query: 307 AYSHFHGLLSAYEYAHEML 325
           A+ H  GLLS+YE  H  L
Sbjct: 295 AFCHLRGLLSSYEIVHSRL 313

>SAKL0E01474g Chr5 (112382..113317) [936 bp, 311 aa] {ON} similar to
           uniprot|Q12442 Saccharomyces cerevisiae YOL002C IZH2
           Membrane protein involved in zinc metabolism member of
           the four-protein IZH family direct target of the Zap1p
           transcription factor expression induced by zinc
           deficiency and fatty acids deletion increases
           sensitivity to elevated zinc
          Length = 311

 Score =  385 bits (988), Expect = e-134,   Method: Compositional matrix adjust.
 Identities = 173/270 (64%), Positives = 219/270 (81%)

Query: 56  WDDLPDWQKDNEHIHEGYVKETNSFINCFESLFFLHNESVNIYSHMVPGLCALFMLLIDI 115
           W+++PDWQKDNEHI  GYV+ETNSF+ CF+SLF++HNESVNIY+H++PGLC  F++L D 
Sbjct: 39  WEEIPDWQKDNEHIRHGYVRETNSFLGCFDSLFYMHNESVNIYTHLLPGLCFFFVVLFDK 98

Query: 116 NIIKKFPTTTFVDYFMIDLFLAGAFSCLILSSAFHTLKSHSLFVAIYGNKLDYLGIVILI 175
             IK F TTTF+DY M+DLF  GAF+CLILSS FH LK+HSL +AI GNKLDYLGIV LI
Sbjct: 99  VAIKVFDTTTFLDYIMVDLFFLGAFTCLILSSTFHCLKTHSLRIAILGNKLDYLGIVALI 158

Query: 176 VTSMISILYYGFYDTPYFFHLFSTITILFGIACGTVSLANKFRSREWRPYRATLFVCFGL 235
           V+SMISI+YYGF+D+  FF+ FST+T++FGIAC   SL++ FRSREWRPYRA LFV FGL
Sbjct: 159 VSSMISIMYYGFFDSGKFFYGFSTLTLVFGIACAIASLSDTFRSREWRPYRAALFVAFGL 218

Query: 236 SAVFPVLTGIWYYGLEDTFKRIQLKWIVTEGFFYIFGAFLYAMRYPERICPGAFDLWGHS 295
           SAV P+ +G+  YG ++T+ ++Q+KW++  G FYI GA LYA+R PERI PG FD+WGHS
Sbjct: 219 SAVLPIFSGVAVYGFKETWVKVQVKWVLLGGVFYIIGALLYALRLPERISPGKFDIWGHS 278

Query: 296 HQIFHVFVVIAAYSHFHGLLSAYEYAHEML 325
           HQIFH+ VVIAA  H   +L++YE  H+ L
Sbjct: 279 HQIFHILVVIAALCHLKAVLNSYELVHKKL 308

>KNAG0M01240 Chr13 (226766..227710) [945 bp, 314 aa] {ON} Anc_6.27
           YOL002C
          Length = 314

 Score =  383 bits (983), Expect = e-133,   Method: Compositional matrix adjust.
 Identities = 183/322 (56%), Positives = 234/322 (72%), Gaps = 15/322 (4%)

Query: 4   SSRLQKRNGETIVSSSAVTEEEYTIANDGVKSNKKLVKIIGRFTRQLITITHWDDLPDWQ 63
           SSR+Q+   +T+  +  V  E+     DG +      KI  R       I  W+++P+WQ
Sbjct: 2   SSRVQR---QTVTITEPVVYED-----DGGEMKTATKKITKR-------IYTWNEIPEWQ 46

Query: 64  KDNEHIHEGYVKETNSFINCFESLFFLHNESVNIYSHMVPGLCALFMLLIDINIIKKFPT 123
           KDNEHI +GYV+ETNSF+ C  SLF+LHNESVN+YSH++P LC   +L ++   +K F T
Sbjct: 47  KDNEHIIDGYVRETNSFLKCVHSLFYLHNESVNVYSHLIPALCFFSVLFLNKYCVKSFET 106

Query: 124 TTFVDYFMIDLFLAGAFSCLILSSAFHTLKSHSLFVAIYGNKLDYLGIVILIVTSMISIL 183
           T+ VDY  IDLF  GAF+CLILSS FH  KSHSL VA +GNKLDYLGIV+LIVTSMISIL
Sbjct: 107 TSLVDYLFIDLFFLGAFTCLILSSTFHCFKSHSLKVATFGNKLDYLGIVVLIVTSMISIL 166

Query: 184 YYGFYDTPYFFHLFSTITILFGIACGTVSLANKFRSREWRPYRATLFVCFGLSAVFPVLT 243
           YYGFYD+   F+ FS +T+ FG ACG VSL + FRSREWRPYRA LFV FGLSA+ P+L+
Sbjct: 167 YYGFYDSSVMFYFFSFVTLSFGTACGVVSLKDHFRSREWRPYRAGLFVAFGLSAILPILS 226

Query: 244 GIWYYGLEDTFKRIQLKWIVTEGFFYIFGAFLYAMRYPERICPGAFDLWGHSHQIFHVFV 303
           G++ YG+E+ F RIQ+KWI+ EG FYI GAFLY +R+PE+  PG +D+WGHSHQ+FH+ V
Sbjct: 227 GMFAYGIEEAFHRIQIKWIILEGVFYILGAFLYGIRFPEKGSPGKYDIWGHSHQVFHILV 286

Query: 304 VIAAYSHFHGLLSAYEYAHEML 325
           V+AA  H  GL+ +YE  H+ L
Sbjct: 287 VVAALCHLKGLMVSYELVHKGL 308

>CAGL0E02519g Chr5 complement(242867..243814) [948 bp, 315 aa] {ON}
           similar to uniprot|Q12442 Saccharomyces cerevisiae
           YOL002c
          Length = 315

 Score =  379 bits (973), Expect = e-131,   Method: Compositional matrix adjust.
 Identities = 179/308 (58%), Positives = 227/308 (73%), Gaps = 10/308 (3%)

Query: 16  VSSSAVTEEEYTIANDG-VKSNKKLVKIIGRFTRQLITITHWDDLPDWQKDNEHIHEGYV 74
           V++   TEE+  I  DG +K  KK V       R+L T   W+++P+WQKDNEHIH GYV
Sbjct: 9   VATMVTTEEQPLIGTDGQIKLRKKTV------VRKLYT---WEEIPEWQKDNEHIHTGYV 59

Query: 75  KETNSFINCFESLFFLHNESVNIYSHMVPGLCALFMLLIDINIIKKFPTTTFVDYFMIDL 134
           +ET+S + C  SLF+LHNE+VNIYSH++P +     +  +  ++  + TTT +DY +ID+
Sbjct: 60  RETSSVMECIRSLFYLHNETVNIYSHLIPAIAFFSTIFFNKYVVPTYSTTTLIDYLIIDI 119

Query: 135 FLAGAFSCLILSSAFHTLKSHSLFVAIYGNKLDYLGIVILIVTSMISILYYGFYDTPYFF 194
           F  GAFSCLILSS FH LKSHSL VA++GNKLDYLGIV LIV SM+SILYYGF+  P+FF
Sbjct: 120 FFLGAFSCLILSSTFHCLKSHSLRVAVFGNKLDYLGIVFLIVASMVSILYYGFHGNPWFF 179

Query: 195 HLFSTITILFGIACGTVSLANKFRSREWRPYRATLFVCFGLSAVFPVLTGIWYYGLEDTF 254
            +FS IT+ FG AC  VSL + FRSREWRPYRA LFV FGLSAV P+L G++ YG  +T+
Sbjct: 180 GIFSLITMTFGAACAVVSLKDTFRSREWRPYRAALFVIFGLSAVLPILAGLFKYGPTETW 239

Query: 255 KRIQLKWIVTEGFFYIFGAFLYAMRYPERICPGAFDLWGHSHQIFHVFVVIAAYSHFHGL 314
            RIQLKW++ EG FYIFGAFLY +R+PE++ PG+FDLWGHSHQIFH+ VV+AA  H   L
Sbjct: 240 TRIQLKWVILEGVFYIFGAFLYGIRFPEKMSPGSFDLWGHSHQIFHILVVVAALCHLKAL 299

Query: 315 LSAYEYAH 322
           L +Y   H
Sbjct: 300 LGSYSLVH 307

>NCAS0H01510 Chr8 complement(287981..288922) [942 bp, 313 aa] {ON}
           Anc_6.27
          Length = 313

 Score =  374 bits (959), Expect = e-129,   Method: Compositional matrix adjust.
 Identities = 182/296 (61%), Positives = 220/296 (74%), Gaps = 8/296 (2%)

Query: 30  NDGVKSNKKLVKIIGRFTRQLITITHWDDLPDWQKDNEHIHEGYVKETNSFINCFESLFF 89
           N  +K  KK   I     R+L T   WD++P+WQKDNEHI  GYV+ETNSF  CF+SLF+
Sbjct: 26  NVSIKHTKKTTTI-----RKLYT---WDEIPEWQKDNEHIIAGYVRETNSFRRCFDSLFY 77

Query: 90  LHNESVNIYSHMVPGLCALFMLLIDINIIKKFPTTTFVDYFMIDLFLAGAFSCLILSSAF 149
           +HNE+ N+YSH+VPG+     +L D   I  F TTTF DY +I+LF  GAF+CLILSS F
Sbjct: 78  IHNETGNVYSHLVPGVVFFLTMLFDKYAIVSFETTTFTDYLIINLFFLGAFTCLILSSTF 137

Query: 150 HTLKSHSLFVAIYGNKLDYLGIVILIVTSMISILYYGFYDTPYFFHLFSTITILFGIACG 209
           H  KSHSL +A +GNKLDYLGIV+LIVTSMISIL+YGFYD   FF+ FS +T+ FG AC 
Sbjct: 138 HCFKSHSLKIATFGNKLDYLGIVVLIVTSMISILFYGFYDNGPFFYGFSLLTLSFGSACA 197

Query: 210 TVSLANKFRSREWRPYRATLFVCFGLSAVFPVLTGIWYYGLEDTFKRIQLKWIVTEGFFY 269
            VSL +KFRSREWRPYRA LFV FGLSAV P+LTG+ YYG  +T+ RIQLKW+V EG FY
Sbjct: 198 IVSLKDKFRSREWRPYRAGLFVAFGLSAVLPILTGVMYYGPHETWTRIQLKWVVLEGVFY 257

Query: 270 IFGAFLYAMRYPERICPGAFDLWGHSHQIFHVFVVIAAYSHFHGLLSAYEYAHEML 325
           IFGAFLY +R+PE+   G FD+WGHSHQIFH+ VV+AA+ H   LL +YE  H  L
Sbjct: 258 IFGAFLYGIRFPEKYVNGTFDIWGHSHQIFHLLVVVAAFCHLKALLGSYELVHMNL 313

>Kpol_1032.9 s1032 (22700..23656) [957 bp, 318 aa] {ON}
           (22700..23656) [957 nt, 319 aa]
          Length = 318

 Score =  372 bits (956), Expect = e-129,   Method: Compositional matrix adjust.
 Identities = 171/298 (57%), Positives = 219/298 (73%), Gaps = 7/298 (2%)

Query: 28  IANDGVKSNKKLVKIIGRFTRQLITITHWDDLPDWQKDNEHIHEGYVKETNSFINCFESL 87
           +  DG KS+   +K       QL+T   W+ LPDWQKDNEHI  GYVKETNS   C  SL
Sbjct: 23  VEKDGAKSSYSYIKR----GVQLVT---WEHLPDWQKDNEHILSGYVKETNSIKACLHSL 75

Query: 88  FFLHNESVNIYSHMVPGLCALFMLLIDINIIKKFPTTTFVDYFMIDLFLAGAFSCLILSS 147
            F+HNESVNI+SH+VP  C +  ++ D  +++++PTTT  DY M+DLFL GAF+CL++SS
Sbjct: 76  LFIHNESVNIFSHLVPAFCFMTTIIFDKYVVERYPTTTLKDYLMLDLFLFGAFTCLMMSS 135

Query: 148 AFHTLKSHSLFVAIYGNKLDYLGIVILIVTSMISILYYGFYDTPYFFHLFSTITILFGIA 207
           AFH LK+HS +V+ +GNKLDYLGIV+LIV+SM SILYYGFYD  + +  FS IT  FG++
Sbjct: 136 AFHCLKAHSPYVSSFGNKLDYLGIVVLIVSSMSSILYYGFYDNSFLYFTFSAITFTFGLS 195

Query: 208 CGTVSLANKFRSREWRPYRATLFVCFGLSAVFPVLTGIWYYGLEDTFKRIQLKWIVTEGF 267
           C  VSL  +FR+REWRPYRA +FV FGLSA+ P+  G  YYG+++T  R+QLKW+V EG 
Sbjct: 196 CAVVSLGERFRAREWRPYRAAMFVAFGLSALLPIFAGFLYYGVQETTIRVQLKWVVLEGV 255

Query: 268 FYIFGAFLYAMRYPERICPGAFDLWGHSHQIFHVFVVIAAYSHFHGLLSAYEYAHEML 325
           FYIFGA LY +R+PER+ PG FD+WGHSHQ+FH+ VV+AA  H  GLL +Y   H  L
Sbjct: 256 FYIFGALLYGVRFPERLKPGMFDIWGHSHQLFHILVVVAALCHLRGLLGSYTIVHTRL 313

>Kwal_56.22454 s56 (136175..137122) [948 bp, 315 aa] {ON} YOL002C -
           Hypothetical ORF [contig 185] FULL
          Length = 315

 Score =  368 bits (945), Expect = e-127,   Method: Compositional matrix adjust.
 Identities = 178/321 (55%), Positives = 227/321 (70%), Gaps = 12/321 (3%)

Query: 7   LQKRNGETIVSSSAVTEEEYTIANDGVKSNKKLVKIIGRFTRQLITITHWDDLPDWQKDN 66
           L KR    I     +TEE  T+ N          +I  R  R+L     WD++P+WQKDN
Sbjct: 6   LTKRKAVGIEPEGVMTEETTTLLNGS--------RIEERTRRRLYK---WDEIPEWQKDN 54

Query: 67  EHIHEGYVKETNSFINCFESLFFLHNESVNIYSHMVPGLCALFMLLIDINIIKKFPTTTF 126
           EHI  GY+ ET S   C +SL +LHNESVNIY+H++PG C L M L +   I+++ TT  
Sbjct: 55  EHILNGYILETKSVGACLKSLLYLHNESVNIYTHLIPGWCFLLMTLFNQLAIERYETTRM 114

Query: 127 VDYFMIDLFLAGAFSCLILSSAFHTLKSHSLFVAIYGNKLDYLGIVILIVTSMISILYYG 186
           +DY MIDLF  G F+CL++SS FH  K HSL VA+ GNKLDYLGIV L+VTSM+SIL+YG
Sbjct: 115 IDYIMIDLFFLGGFTCLMMSSTFHCFKCHSLPVAVLGNKLDYLGIVALVVTSMVSILFYG 174

Query: 187 FYDTPYFFHLFSTITILFGIACGTVSLANKFRSREWRPYRATLFVCFGLSAVFPVLTGIW 246
           F+D   +F++FS +TI+FG+AC  VSL++KFRSR+WRPYRA LFV FGLSA+FPV+ GI 
Sbjct: 175 FHDNNLYFYVFSGLTIMFGLACTIVSLSDKFRSRDWRPYRAALFVAFGLSALFPVIAGIC 234

Query: 247 YYGLEDTFKRIQLKWIVTEGFFYIFGAFLYAMRYPERICPGAFDLWGHSHQIFHVFVVIA 306
           +YG + T+ RIQLKW+  EG FYI GA LY +R+PER+ PG FD+WG SHQ+FHV VVIA
Sbjct: 235 HYGFKVTWTRIQLKWVFLEGVFYILGALLYGVRFPERVAPGTFDIWGQSHQLFHVLVVIA 294

Query: 307 AYSHFHGLLSAYEYAH-EMLI 326
           A  H   LL AY++ H +MLI
Sbjct: 295 ASCHLRALLGAYKWVHSQMLI 315

>TDEL0G04420 Chr7 complement(802412..803380) [969 bp, 322 aa] {ON}
           Anc_6.27 YOL002C
          Length = 322

 Score =  367 bits (941), Expect = e-127,   Method: Compositional matrix adjust.
 Identities = 175/321 (54%), Positives = 231/321 (71%), Gaps = 10/321 (3%)

Query: 4   SSRLQKRNGETIVS--SSAVTEEEYTIANDGVKSNKKLVKIIGRFTRQLITITHWDDLPD 61
           S  L+KR+  ++ +  +S VT+EE +    G K++K     + +  R+L T   WD++P 
Sbjct: 2   SDSLKKRSQCSLTTDQTSTVTKEETSGPVKGQKTDK-----MSKKKRKLYT---WDEIPH 53

Query: 62  WQKDNEHIHEGYVKETNSFINCFESLFFLHNESVNIYSHMVPGLCALFMLLIDINIIKKF 121
           WQ+DNEHI  GYV ET S   CF SLF+LHNESVNIY+H++PG+  LF+L  D   + +F
Sbjct: 54  WQRDNEHILSGYVGETRSMFQCFLSLFYLHNESVNIYTHLLPGIAFLFVLCFDKFAVTQF 113

Query: 122 PTTTFVDYFMIDLFLAGAFSCLILSSAFHTLKSHSLFVAIYGNKLDYLGIVILIVTSMIS 181
            TTT +DY MIDLF   +F+CL LSS FH LK+HS  VA +GNKLDYLGIV+L+VTSM+S
Sbjct: 114 ETTTLIDYVMIDLFSLVSFTCLTLSSIFHCLKNHSRSVATFGNKLDYLGIVVLVVTSMVS 173

Query: 182 ILYYGFYDTPYFFHLFSTITILFGIACGTVSLANKFRSREWRPYRATLFVCFGLSAVFPV 241
           I+YYGF++TP  F+LFS IT  FG AC  VSL   FR+REWRPYRA +FV FGLSAV P+
Sbjct: 174 IMYYGFFETPALFYLFSFITCTFGAACAVVSLKEGFRTREWRPYRAAMFVAFGLSAVLPI 233

Query: 242 LTGIWYYGLEDTFKRIQLKWIVTEGFFYIFGAFLYAMRYPERICPGAFDLWGHSHQIFHV 301
           +TGI+YYG  + + RIQ+KW++  G FYI GA LY +R+PE+  PG +D+WGHSHQ+FHV
Sbjct: 234 VTGIFYYGFSEIYLRIQVKWVLLGGIFYITGAVLYGVRFPEKYAPGKYDIWGHSHQLFHV 293

Query: 302 FVVIAAYSHFHGLLSAYEYAH 322
            VV+AA  H +GL+ +Y   H
Sbjct: 294 LVVVAALCHLYGLIKSYNLVH 314

>TBLA0E03060 Chr5 (769031..769990) [960 bp, 319 aa] {ON} Anc_6.27
           YOL002C
          Length = 319

 Score =  362 bits (929), Expect = e-125,   Method: Compositional matrix adjust.
 Identities = 168/291 (57%), Positives = 215/291 (73%), Gaps = 3/291 (1%)

Query: 35  SNKKLVKIIGRFTRQLITITHWDDLPDWQKDNEHIHEGYVKETNSFINCFESLFFLHNES 94
            N++ +   G   ++L T   WD++P WQ DNE+I+ GYV+ETNS    F SLF++HNES
Sbjct: 24  DNQQQLNTSGSSGKRLYT---WDEIPVWQHDNEYIYTGYVRETNSMKESFLSLFYIHNES 80

Query: 95  VNIYSHMVPGLCALFMLLIDINIIKKFPTTTFVDYFMIDLFLAGAFSCLILSSAFHTLKS 154
           VNIY+H++P  C L MLL +   +K  PTTT+ DY  IDLF  GAF+CL LSS FH  KS
Sbjct: 81  VNIYTHLIPAFCFLSMLLFNTYGVKPHPTTTYGDYVAIDLFFIGAFTCLGLSSTFHCFKS 140

Query: 155 HSLFVAIYGNKLDYLGIVILIVTSMISILYYGFYDTPYFFHLFSTITILFGIACGTVSLA 214
           HSL ++++GNKLDYLGIVILI TS+IS+LY+G++D P+ F++FS IT+ FGIACG  SL 
Sbjct: 141 HSLKISVFGNKLDYLGIVILISTSLISVLYFGYHDDPFIFYIFSGITLCFGIACGIASLK 200

Query: 215 NKFRSREWRPYRATLFVCFGLSAVFPVLTGIWYYGLEDTFKRIQLKWIVTEGFFYIFGAF 274
           +KFR+REWRPYRA LFV FGLS V P++ GI  YG+ + F+R+QLKWI+ EG  YIFGAF
Sbjct: 201 DKFRTREWRPYRAALFVLFGLSGVLPIIAGIMKYGIREVFERVQLKWIIWEGVLYIFGAF 260

Query: 275 LYAMRYPERICPGAFDLWGHSHQIFHVFVVIAAYSHFHGLLSAYEYAHEML 325
           LY  R+PE+  PG  D+WG SHQIFHV VVIAA  H  GL+ +YE  H+ L
Sbjct: 261 LYGARFPEKFMPGKVDIWGQSHQIFHVLVVIAALCHLRGLIGSYELVHQKL 311

>KLLA0D01331g Chr4 (117469..118395) [927 bp, 308 aa] {ON} similar to
           uniprot|Q12442 Saccharomyces cerevisiae YOL002C IZH2
           Membrane protein involved in zinc metabolism member of
           the four-protein IZH family direct target of the Zap1p
           transcription factor expression induced by zinc
           deficiency and fatty acids deletion increases
           sensitivity to elevated zinc
          Length = 308

 Score =  358 bits (920), Expect = e-124,   Method: Compositional matrix adjust.
 Identities = 170/308 (55%), Positives = 225/308 (73%), Gaps = 9/308 (2%)

Query: 19  SAVTEEEYTIANDGVKSNKKLVKIIGRFTRQLITITHWDDLPDWQKDNEHIHEGYVKETN 78
           S VTEE   I  +     KK V++  R       +  WD++PDWQKDNEHI  GYV+ET 
Sbjct: 7   SVVTEETALI--EETPGTKKTVRVYER------RVYSWDEIPDWQKDNEHILHGYVRETQ 58

Query: 79  SFINCFESLFFLHNESVNIYSHMVPGLCALFMLLIDIN-IIKKFPTTTFVDYFMIDLFLA 137
           S+   F SLF+LHNESVNIY+H++P +   F++L   + +I ++PTT+ +DYFMI+LF  
Sbjct: 59  SWKELFHSLFYLHNESVNIYTHLIPAVALFFIMLFATHHVINEYPTTSAIDYFMINLFFF 118

Query: 138 GAFSCLILSSAFHTLKSHSLFVAIYGNKLDYLGIVILIVTSMISILYYGFYDTPYFFHLF 197
           G  +CL +SS FHT+K HSL +A +GNKLDYLGIV+LI TSMISIL+YGF+D+   F+ F
Sbjct: 119 GCATCLTMSSMFHTIKCHSLPIATFGNKLDYLGIVVLISTSMISILFYGFHDSSLLFYPF 178

Query: 198 STITILFGIACGTVSLANKFRSREWRPYRATLFVCFGLSAVFPVLTGIWYYGLEDTFKRI 257
           + +T LFG+ CG +SL +KFRSREWRPYRAT+FV FGLSAVFP++ G   YG ++T+KR+
Sbjct: 179 AGLTSLFGLICGYMSLKDKFRSREWRPYRATMFVLFGLSAVFPIVAGFIVYGKDETWKRV 238

Query: 258 QLKWIVTEGFFYIFGAFLYAMRYPERICPGAFDLWGHSHQIFHVFVVIAAYSHFHGLLSA 317
           QL W++ EG  YIFGAFLY +R+PER+ PG FD+WGHSHQ+FHV VV+AA  H   L+ +
Sbjct: 239 QLTWVIWEGVLYIFGAFLYGVRFPERLAPGKFDIWGHSHQLFHVLVVVAALCHLKALVVS 298

Query: 318 YEYAHEML 325
           Y   H+ L
Sbjct: 299 YGLVHQAL 306

>KLTH0C11044g Chr3 complement(908604..909551) [948 bp, 315 aa] {ON}
           similar to uniprot|Q12442 Saccharomyces cerevisiae
           YOL002C IZH2 Membrane protein involved in zinc
           metabolism member of the four-protein IZH family direct
           target of the Zap1p transcription factor expression
           induced by zinc deficiency and fatty acids deletion
           increases sensitivity to elevated zinc
          Length = 315

 Score =  358 bits (920), Expect = e-124,   Method: Compositional matrix adjust.
 Identities = 170/324 (52%), Positives = 225/324 (69%), Gaps = 12/324 (3%)

Query: 1   MTSSSRLQKRNGETIVSSSAVTEEEYTIANDGVKSNKKLVKIIGRFTRQLITITHWDDLP 60
           M      Q++  E  +    V E    + +  +K   K         R+L T   WD++P
Sbjct: 1   MEQGGLTQRKPVEVELHHRMVEENSSLLKDSNLKQRTK---------RRLYT---WDEIP 48

Query: 61  DWQKDNEHIHEGYVKETNSFINCFESLFFLHNESVNIYSHMVPGLCALFMLLIDINIIKK 120
           +WQ+DNEHI  GY+ ET S   C +SL +LHNESVNIY+H++PG C L + + +  +I+K
Sbjct: 49  EWQRDNEHIVGGYILETKSTWECLKSLLYLHNESVNIYTHLLPGWCFLLVAVFNQVVIEK 108

Query: 121 FPTTTFVDYFMIDLFLAGAFSCLILSSAFHTLKSHSLFVAIYGNKLDYLGIVILIVTSMI 180
           F TT  +DY MIDLF  G F+CL++SS FH  K HSL VAI GNKLDYLGIV L+VTS++
Sbjct: 109 FETTRLIDYVMIDLFFLGGFTCLMMSSVFHCFKCHSLPVAILGNKLDYLGIVALVVTSIV 168

Query: 181 SILYYGFYDTPYFFHLFSTITILFGIACGTVSLANKFRSREWRPYRATLFVCFGLSAVFP 240
           SIL+YGF+D   +F LFS +T+ FG+AC TVSL+NKFRSREWRPYRA+LFV FGLSA+ P
Sbjct: 169 SILFYGFHDYDLYFWLFSGLTMAFGLACATVSLSNKFRSREWRPYRASLFVAFGLSALLP 228

Query: 241 VLTGIWYYGLEDTFKRIQLKWIVTEGFFYIFGAFLYAMRYPERICPGAFDLWGHSHQIFH 300
           V+ G  +YGL++T+ RIQL+W++  G FYI GA LY +R+PER+ PG FD+WGHSHQ+FH
Sbjct: 229 VIAGALHYGLKETWTRIQLEWVLLGGVFYILGAVLYGIRFPERMAPGCFDIWGHSHQLFH 288

Query: 301 VFVVIAAYSHFHGLLSAYEYAHEM 324
           + VV+AA  H   LL AY+  H +
Sbjct: 289 ILVVVAALCHLRALLGAYKLFHHV 312

>YOL002C Chr15 complement(323411..324364) [954 bp, 317 aa] {ON}
           IZH2Plasma membrane protein involved in zinc homeostasis
           and osmotin-induced apoptosis; transcription regulated
           by Zap1p, zinc and fatty acid levels; similar to
           mammalian adiponectins; deletion increases sensitivity
           to elevated zinc
          Length = 317

 Score =  358 bits (920), Expect = e-123,   Method: Compositional matrix adjust.
 Identities = 171/310 (55%), Positives = 224/310 (72%), Gaps = 3/310 (0%)

Query: 13  ETIVSSSAVTEEEYTIANDGVKSNKKLVKIIGRFTRQLITITHWDDLPDWQKDNEHIHEG 72
            T++  +   +E    A     +N   V    +  R+L +   WD++P+WQ+DN+ I  G
Sbjct: 2   STLLERTKSVQELKKRAAGKTSANPAEVAKAKKVLRRLYS---WDEIPEWQRDNDFILHG 58

Query: 73  YVKETNSFINCFESLFFLHNESVNIYSHMVPGLCALFMLLIDINIIKKFPTTTFVDYFMI 132
           YVKET+SFI  F+SLF+LHNESVNIYSH++P L    +LL+D + IK F TTT++D+ +I
Sbjct: 59  YVKETSSFIETFKSLFYLHNESVNIYSHLIPALGFFTVLLLDKSTIKVFATTTWLDHMVI 118

Query: 133 DLFLAGAFSCLILSSAFHTLKSHSLFVAIYGNKLDYLGIVILIVTSMISILYYGFYDTPY 192
           DLF +GAF+CLILSS+FH LKSHSL +A  GNKLDYLGI ILIVTSM+SILYYG+++   
Sbjct: 119 DLFYSGAFACLILSSSFHCLKSHSLRIATLGNKLDYLGICILIVTSMVSILYYGYFEKFS 178

Query: 193 FFHLFSTITILFGIACGTVSLANKFRSREWRPYRATLFVCFGLSAVFPVLTGIWYYGLED 252
            F LF+ IT+ FGIAC  VSL +KFR REWRPYRA LFVCFGLS++ P+ +G++ Y   +
Sbjct: 179 LFCLFALITVSFGIACSIVSLKDKFRKREWRPYRAGLFVCFGLSSIIPIFSGLYCYSFSE 238

Query: 253 TFKRIQLKWIVTEGFFYIFGAFLYAMRYPERICPGAFDLWGHSHQIFHVFVVIAAYSHFH 312
            + +IQL W++  G  YI GA LY MR+PE+ICPG FD+WGHSHQ+FH  VVIAA  H  
Sbjct: 239 IWTQIQLFWVLLGGVLYIIGAVLYGMRFPEKICPGKFDIWGHSHQLFHFLVVIAALCHLR 298

Query: 313 GLLSAYEYAH 322
           GLL++YE  H
Sbjct: 299 GLLNSYELVH 308

>ZYRO0C07612g Chr3 complement(578864..579823) [960 bp, 319 aa] {ON}
           similar to uniprot|Q12442 Saccharomyces cerevisiae
           YOL002C IZH2 Membrane protein involved in zinc
           metabolism member of the four-protein IZH family direct
           target of the Zap1p transcription factor expression
           induced by zinc deficiency and fatty acids deletion
           increases sensitivity to elevated zinc
          Length = 319

 Score =  357 bits (915), Expect = e-123,   Method: Compositional matrix adjust.
 Identities = 173/307 (56%), Positives = 216/307 (70%), Gaps = 13/307 (4%)

Query: 21  VTEEEYTIANDGVKSNKKLVKIIGRFTRQLITITHWDDLPDWQKDNEHIHEGYVKETNSF 80
           V +E+ TI  + V + KKL+               W+++PDWQKDNEHI  GYV+ETNS 
Sbjct: 23  VNQEQTTIKIEPVNTQKKLLYT-------------WNEIPDWQKDNEHIVGGYVRETNSI 69

Query: 81  INCFESLFFLHNESVNIYSHMVPGLCALFMLLIDINIIKKFPTTTFVDYFMIDLFLAGAF 140
             C +SL +LHNES+NIY+H +PGLC L   + D   IK F TTT++DY  ID F  GAF
Sbjct: 70  RECLQSLLYLHNESINIYTHFLPGLCFLATCIFDKFAIKNFDTTTWIDYMAIDFFFFGAF 129

Query: 141 SCLILSSAFHTLKSHSLFVAIYGNKLDYLGIVILIVTSMISILYYGFYDTPYFFHLFSTI 200
           SCLILSS FH  KSHS  V+++GNKLDYLGIVILIV SMISILYY F+D+   F+ F+ I
Sbjct: 130 SCLILSSTFHCFKSHSSRVSVFGNKLDYLGIVILIVCSMISILYYAFHDSNKLFYSFTLI 189

Query: 201 TILFGIACGTVSLANKFRSREWRPYRATLFVCFGLSAVFPVLTGIWYYGLEDTFKRIQLK 260
              FG++C   S  + FRSREWRPYRA LFV FGLSA+ P++ GI  YG  +T+ RIQ+K
Sbjct: 190 IFCFGVSCTIASFDDTFRSREWRPYRAGLFVAFGLSALLPIMGGIIKYGFHETWTRIQMK 249

Query: 261 WIVTEGFFYIFGAFLYAMRYPERICPGAFDLWGHSHQIFHVFVVIAAYSHFHGLLSAYEY 320
           W++ EG FYIFGAFLY++R+PER+ PGAFD  GHSHQIFHV VVIAA  H   L+++YE 
Sbjct: 250 WVILEGIFYIFGAFLYSIRFPERLAPGAFDFVGHSHQIFHVLVVIAALCHLVALMNSYEL 309

Query: 321 AHEMLIK 327
            H  L+ 
Sbjct: 310 VHTNLLS 316

>Smik_15.168 Chr15 complement(290724..291707) [984 bp, 327 aa] {ON}
           YOL002C (REAL)
          Length = 327

 Score =  353 bits (907), Expect = e-121,   Method: Compositional matrix adjust.
 Identities = 168/317 (52%), Positives = 225/317 (70%), Gaps = 3/317 (0%)

Query: 6   RLQKRNGETIVSSSAVTEEEYTIANDGVKSNKKLVKIIGRFTRQLITITHWDDLPDWQKD 65
           R +     T++  +   +E    A     +N   V    +  ++L +   WD++P+WQ+D
Sbjct: 5   RKESFQMSTLLERTKSVQELKKRAAGKTSANPAEVAEAKKVLKRLYS---WDEIPEWQRD 61

Query: 66  NEHIHEGYVKETNSFINCFESLFFLHNESVNIYSHMVPGLCALFMLLIDINIIKKFPTTT 125
           N+ I  GYV+ET+SFI  F+SLF+LHNESVNIYSH+VP L    +LL+D + IK F TTT
Sbjct: 62  NDFILHGYVRETSSFIETFKSLFYLHNESVNIYSHLVPALGFFTVLLLDKSTIKVFETTT 121

Query: 126 FVDYFMIDLFLAGAFSCLILSSAFHTLKSHSLFVAIYGNKLDYLGIVILIVTSMISILYY 185
           + D+ +IDLF +GAF+CLILSS+FH LKSHSL +A  GNKLDYLGI ILIVTSM+SIL+Y
Sbjct: 122 WKDHVVIDLFYSGAFACLILSSSFHCLKSHSLRIATLGNKLDYLGICILIVTSMVSILFY 181

Query: 186 GFYDTPYFFHLFSTITILFGIACGTVSLANKFRSREWRPYRATLFVCFGLSAVFPVLTGI 245
           G+Y+    F LF+ IT+ FG+AC  VSL +KFR REWRPYRA LFVCFGLS++ P+ +G+
Sbjct: 182 GYYEKFSLFCLFALITVSFGVACSIVSLKDKFRKREWRPYRAGLFVCFGLSSIVPIFSGL 241

Query: 246 WYYGLEDTFKRIQLKWIVTEGFFYIFGAFLYAMRYPERICPGAFDLWGHSHQIFHVFVVI 305
           + Y   + + +IQL W++  G  YI GA LY MR+PE++CPG FD+WGHSHQ+FH  VVI
Sbjct: 242 YCYSFSEIWTQIQLFWVLLGGVLYIIGAVLYGMRFPEKVCPGKFDIWGHSHQLFHFLVVI 301

Query: 306 AAYSHFHGLLSAYEYAH 322
           A+  H  GLL++YE  H
Sbjct: 302 ASLCHLRGLLNSYELVH 318

>Skud_15.160 Chr15 complement(283003..283986) [984 bp, 327 aa] {ON}
           YOL002C (REAL)
          Length = 327

 Score =  352 bits (902), Expect = e-121,   Method: Compositional matrix adjust.
 Identities = 165/309 (53%), Positives = 223/309 (72%), Gaps = 3/309 (0%)

Query: 14  TIVSSSAVTEEEYTIANDGVKSNKKLVKIIGRFTRQLITITHWDDLPDWQKDNEHIHEGY 73
           T++  +   +E    A     +N   V    +  ++L +   WD++P+WQ+DN++I  GY
Sbjct: 13  TLLERTKSVQELKKRAAGKTPANPAEVAEAKKVLKRLYS---WDEIPEWQRDNDYILHGY 69

Query: 74  VKETNSFINCFESLFFLHNESVNIYSHMVPGLCALFMLLIDINIIKKFPTTTFVDYFMID 133
           V+ET SF+  F+SLF++HNESVNIYSH++P L    +LL+D + IK F TTT+ D+ +ID
Sbjct: 70  VRETCSFVETFKSLFYMHNESVNIYSHLIPALGFFTVLLLDKSTIKVFETTTWKDHMIID 129

Query: 134 LFLAGAFSCLILSSAFHTLKSHSLFVAIYGNKLDYLGIVILIVTSMISILYYGFYDTPYF 193
           LF +GAF+CLILSS+FH LKSHSL +A  GNKLDYLGI ILIVTSM SILYYG+Y+    
Sbjct: 130 LFYSGAFACLILSSSFHCLKSHSLRIATLGNKLDYLGICILIVTSMTSILYYGYYEKFSL 189

Query: 194 FHLFSTITILFGIACGTVSLANKFRSREWRPYRATLFVCFGLSAVFPVLTGIWYYGLEDT 253
           F LF+ IT+ FGIAC  V+L +KFR REWRPYRA LFVCFGLS++ P+ +G++ Y   + 
Sbjct: 190 FCLFALITVSFGIACSIVTLKDKFRKREWRPYRAGLFVCFGLSSIVPIFSGLYCYTFSEI 249

Query: 254 FKRIQLKWIVTEGFFYIFGAFLYAMRYPERICPGAFDLWGHSHQIFHVFVVIAAYSHFHG 313
           + +IQL W++  G  YI GA LY MR+PE++CPG FD+WGHSHQ+FH  VVIA++ H  G
Sbjct: 250 WTQIQLFWVLLGGVLYIIGAVLYGMRFPEKVCPGKFDIWGHSHQLFHFLVVIASFCHLRG 309

Query: 314 LLSAYEYAH 322
           LL++YE  H
Sbjct: 310 LLNSYELVH 318

>ACL002C Chr3 complement(353449..354438) [990 bp, 329 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YOL002C
          Length = 329

 Score =  350 bits (897), Expect = e-120,   Method: Compositional matrix adjust.
 Identities = 165/306 (53%), Positives = 215/306 (70%), Gaps = 3/306 (0%)

Query: 17  SSSAVTEEEYTIANDGVKSNKKLVKIIGRFTRQLITITHWDDLPDWQKDNEHIHEGYVKE 76
           ++S+ + +E T   DG  +            R++ ++  WDDLPDWQKDNEHI  GYV+E
Sbjct: 19  TASSYSTKETTFLQDGTVAAAITATRA---IREVSSLCSWDDLPDWQKDNEHILSGYVRE 75

Query: 77  TNSFINCFESLFFLHNESVNIYSHMVPGLCALFMLLIDINIIKKFPTTTFVDYFMIDLFL 136
           TNS+   F SLF+LHNESVNIYSH++PG+C LF+ L +  ++  + TTT+ DY MID+FL
Sbjct: 76  TNSYRKTFRSLFYLHNESVNIYSHLIPGICFLFIALFNKYVVADYSTTTWKDYLMIDIFL 135

Query: 137 AGAFSCLILSSAFHTLKSHSLFVAIYGNKLDYLGIVILIVTSMISILYYGFYDTPYFFHL 196
            GA  CL LS  +H +KSHSL V+++GNKLDY+GIV LI  SMIS +YYGFYD+   F L
Sbjct: 136 LGAVVCLTLSGVYHCMKSHSLEVSVFGNKLDYIGIVALISCSMISQMYYGFYDSTAMFSL 195

Query: 197 FSTITILFGIACGTVSLANKFRSREWRPYRATLFVCFGLSAVFPVLTGIWYYGLEDTFKR 256
           FST+T+   +AC  VSL+  FRSREWR YRA +F  FGLS + PV+T  +YYG  + + R
Sbjct: 196 FSTVTLSLALACAVVSLSPHFRSREWRKYRAAIFTAFGLSGLLPVITSCFYYGPIEAYSR 255

Query: 257 IQLKWIVTEGFFYIFGAFLYAMRYPERICPGAFDLWGHSHQIFHVFVVIAAYSHFHGLLS 316
           IQLKW+  EG  YI GA LY +R+PE++ PG+FD+WGHSHQ+FHV VVIAA  H   LLS
Sbjct: 256 IQLKWLSLEGVLYISGAVLYGVRFPEKLEPGSFDIWGHSHQLFHVLVVIAALCHLRALLS 315

Query: 317 AYEYAH 322
            Y+  H
Sbjct: 316 CYKNVH 321

>Suva_15.173 Chr15 complement(297915..298898) [984 bp, 327 aa] {ON}
           YOL002C (REAL)
          Length = 327

 Score =  341 bits (874), Expect = e-116,   Method: Compositional matrix adjust.
 Identities = 161/280 (57%), Positives = 213/280 (76%)

Query: 43  IGRFTRQLITITHWDDLPDWQKDNEHIHEGYVKETNSFINCFESLFFLHNESVNIYSHMV 102
           + +  + L  +  WD++P+WQ+DN++I  GYVKET+SF++ F+SLF++HNESVNIYSH++
Sbjct: 39  VAKAKKVLKRVYSWDEIPEWQRDNDYILHGYVKETSSFVDTFKSLFYMHNESVNIYSHLI 98

Query: 103 PGLCALFMLLIDINIIKKFPTTTFVDYFMIDLFLAGAFSCLILSSAFHTLKSHSLFVAIY 162
           P +  L +LL+D   I  F TTT++D+ MIDLF  GAF+CLILSS+FH  KSHSL +A  
Sbjct: 99  PAVGFLTVLLLDKTTITVFETTTWLDHMMIDLFFTGAFACLILSSSFHCFKSHSLKIATL 158

Query: 163 GNKLDYLGIVILIVTSMISILYYGFYDTPYFFHLFSTITILFGIACGTVSLANKFRSREW 222
           GNKLDYLGI ILIVTSM+SILYYG+YD    F LF+ IT+ FGIAC  VSL +KFR REW
Sbjct: 159 GNKLDYLGICILIVTSMVSILYYGYYDKFPAFCLFALITVSFGIACSIVSLKDKFRKREW 218

Query: 223 RPYRATLFVCFGLSAVFPVLTGIWYYGLEDTFKRIQLKWIVTEGFFYIFGAFLYAMRYPE 282
           RPYRA LFVCFGLS++ P+ +G++YY   + + +IQL W++  G  YI GA LY MR+PE
Sbjct: 219 RPYRAGLFVCFGLSSIVPIFSGLYYYSFSEIWNQIQLFWVLLGGALYIIGAVLYGMRFPE 278

Query: 283 RICPGAFDLWGHSHQIFHVFVVIAAYSHFHGLLSAYEYAH 322
           ++ PG FD+WGHSHQ+FH  VVIA+  H  G+L++YE  H
Sbjct: 279 KVYPGRFDIWGHSHQLFHFLVVIASLCHMRGVLNSYELVH 318

>Ecym_3031 Chr3 (61592..62578) [987 bp, 328 aa] {ON} similar to
           Ashbya gossypii ACL002C
          Length = 328

 Score =  338 bits (868), Expect = e-115,   Method: Compositional matrix adjust.
 Identities = 151/267 (56%), Positives = 201/267 (75%)

Query: 56  WDDLPDWQKDNEHIHEGYVKETNSFINCFESLFFLHNESVNIYSHMVPGLCALFMLLIDI 115
           W ++P+WQ+DNEHI  GYVKETNSF     SL +LHNESVNIY+H++PG+C   +L ++ 
Sbjct: 51  WHEIPEWQRDNEHILGGYVKETNSFKETLHSLLYLHNESVNIYTHLIPGVCFFCVLFLNK 110

Query: 116 NIIKKFPTTTFVDYFMIDLFLAGAFSCLILSSAFHTLKSHSLFVAIYGNKLDYLGIVILI 175
            +I +F TTT+ DY +ID F  GAF+CL++S  +H LKSHS  V+I GN+LDY+GIVILI
Sbjct: 111 YVISRFKTTTWKDYAIIDTFFVGAFACLVMSGTYHCLKSHSYPVSIVGNQLDYIGIVILI 170

Query: 176 VTSMISILYYGFYDTPYFFHLFSTITILFGIACGTVSLANKFRSREWRPYRATLFVCFGL 235
            TSM S+LYYGFY++   F+ FS +T+L G  C  V+L ++FRSR WRPYRA++FV FGL
Sbjct: 171 STSMFSLLYYGFYNSSKMFYGFSGVTLLLGTICTVVTLDSRFRSRLWRPYRASIFVAFGL 230

Query: 236 SAVFPVLTGIWYYGLEDTFKRIQLKWIVTEGFFYIFGAFLYAMRYPERICPGAFDLWGHS 295
           S++ P+L  I YYG E+T+  +QL WI+ EG  YIFGAF+Y +R+PE + PG+FD+WGHS
Sbjct: 231 SSILPILASILYYGSEETWNSVQLGWIILEGVLYIFGAFIYGIRFPESMAPGSFDIWGHS 290

Query: 296 HQIFHVFVVIAAYSHFHGLLSAYEYAH 322
           HQ+FHV VVIAA  HF  +  +YE  H
Sbjct: 291 HQLFHVLVVIAALCHFKAVTQSYELVH 317

>KLTH0C09504g Chr3 complement(788442..789401) [960 bp, 319 aa] {ON}
           similar to uniprot|Q6Q557 Saccharomyces cerevisiae
           YDR492W IZH1 Membrane protein involved in zinc
           metabolism member of the four-protein IZH family
           transcription is regulated directly by Zap1p expression
           induced by zinc deficiency and fatty acids deletion
           increases sensitivity to elevated zinc
          Length = 319

 Score =  273 bits (698), Expect = 5e-90,   Method: Compositional matrix adjust.
 Identities = 125/269 (46%), Positives = 180/269 (66%), Gaps = 2/269 (0%)

Query: 56  WDDLPDWQKDNEHIHEGYVKETNSFINCFESLFFLHNESVNIYSHMVPGLCALFMLL--I 113
           +++LPDWQ+DN+ I  GYV+ETNS   CFESL + HNE+VNIY+H++P    L ML+   
Sbjct: 37  FEELPDWQRDNDKILAGYVRETNSMKKCFESLTYFHNETVNIYTHLIPSGTYLVMLMFFT 96

Query: 114 DINIIKKFPTTTFVDYFMIDLFLAGAFSCLILSSAFHTLKSHSLFVAIYGNKLDYLGIVI 173
           D+ +I +FPTTT  DY MI+ FL GAF CL+ S+ FH LK HS   +   +K+DY+GI++
Sbjct: 97  DLFLIPQFPTTTMSDYIMINFFLLGAFLCLMCSTCFHCLKQHSEAQSNIWSKVDYMGIIV 156

Query: 174 LIVTSMISILYYGFYDTPYFFHLFSTITILFGIACGTVSLANKFRSREWRPYRATLFVCF 233
           LI  S +S+LYYGFYD  + F +F+   ++ G  C    L ++F ++ WR  RA  FV F
Sbjct: 157 LISCSTVSLLYYGFYDYLFHFKMFTIAVVVLGSCCAAFVLNDRFNAKNWRACRAGFFVTF 216

Query: 234 GLSAVFPVLTGIWYYGLEDTFKRIQLKWIVTEGFFYIFGAFLYAMRYPERICPGAFDLWG 293
           G S + P++ G+  +G+ ++ KR+QL++++ E  FYI GA +Y  R PE + PG FD  G
Sbjct: 217 GFSGIVPIVVGLVKFGIAESSKRVQLRFVLLEALFYISGAVIYGFRIPETLLPGKFDFVG 276

Query: 294 HSHQIFHVFVVIAAYSHFHGLLSAYEYAH 322
           HSHQIFH+ VV+ +  HF  LL +Y + H
Sbjct: 277 HSHQIFHILVVLGSLCHFRALLGSYFFMH 305

>SAKL0C09218g Chr3 (839747..840691) [945 bp, 314 aa] {ON} similar to
           uniprot|Q6Q557 Saccharomyces cerevisiae YDR492W IZH1
           Membrane protein involved in zinc metabolism member of
           the four-protein IZH family transcription is regulated
           directly by Zap1p expression induced by zinc deficiency
           and fatty acids deletion increases sensitivity to
           elevated zinc
          Length = 314

 Score =  273 bits (697), Expect = 6e-90,   Method: Compositional matrix adjust.
 Identities = 136/308 (44%), Positives = 197/308 (63%), Gaps = 10/308 (3%)

Query: 17  SSSAVTEEEYTIANDGVKSNKKLVKIIGRFTRQLITITHWDDLPDWQKDNEHIHEGYVKE 76
           S++ V +   T       S + +    GR  ++L T   +++LPDWQKDNE I +GYV+E
Sbjct: 3   STTTVRQRRKTTQK---ASAESIATAKGR--KRLCT---FEELPDWQKDNELILDGYVRE 54

Query: 77  TNSFINCFESLFFLHNESVNIYSHMVPGLCALFML--LIDINIIKKFPTTTFVDYFMIDL 134
           T S   CF+SL + HNE+VNIY+H+VPG+  L ML  L D  +I KFP++T  DY +I+ 
Sbjct: 55  TRSVSECFKSLLYFHNETVNIYTHLVPGVTYLLMLMFLTDFILIPKFPSSTMTDYIIINF 114

Query: 135 FLAGAFSCLILSSAFHTLKSHSLFVAIYGNKLDYLGIVILIVTSMISILYYGFYDTPYFF 194
           FL GAF CL+ SS FH LK HS   +   +K+DY+GI++LI  SM+SILYYGF+D  + F
Sbjct: 115 FLLGAFVCLMCSSCFHCLKQHSEEHSDIWSKVDYMGIIVLISCSMVSILYYGFHDHLFHF 174

Query: 195 HLFSTITILFGIACGTVSLANKFRSREWRPYRATLFVCFGLSAVFPVLTGIWYYGLEDTF 254
            +F+ +T++ G  C    L ++F S+ +R +RA+ FV FG S + P++ G+  +G+ ++ 
Sbjct: 175 KIFTVVTVILGSCCAAFVLNDRFNSKNFRVFRASFFVSFGFSGLVPIIFGLVKFGISESV 234

Query: 255 KRIQLKWIVTEGFFYIFGAFLYAMRYPERICPGAFDLWGHSHQIFHVFVVIAAYSHFHGL 314
            R+QLK++  E  FYI GA  Y  R PE   PG FDL GHSHQIFHV VV+ +  H   +
Sbjct: 235 HRVQLKYVGLEAVFYIGGAVFYGFRIPENFGPGKFDLVGHSHQIFHVMVVLGSLCHLRAV 294

Query: 315 LSAYEYAH 322
           + +Y + H
Sbjct: 295 VGSYIFMH 302

>ZYRO0B06556g Chr2 (526478..527434) [957 bp, 318 aa] {ON} similar to
           uniprot|Q6Q557 Saccharomyces cerevisiae YDR492W IZH1
           Membrane protein involved in zinc metabolism member of
           the four-protein IZH family transcription is regulated
           directly by Zap1p expression induced by zinc deficiency
           and fatty acids deletion increases sensitivity to
           elevated zinc
          Length = 318

 Score =  269 bits (688), Expect = 2e-88,   Method: Compositional matrix adjust.
 Identities = 126/276 (45%), Positives = 184/276 (66%), Gaps = 2/276 (0%)

Query: 52  TITHWDDLPDWQKDNEHIHEGYVKETNSFINCFESLFFLHNESVNIYSHMVPGLCALFML 111
           T+  + +LP+WQ+DN+ I  GY++ET S + C  SLF  +NE+VNIY+H+V  +    ++
Sbjct: 31  TLYDFHELPEWQQDNDKILTGYIRETKSVLKCVRSLFIWNNETVNIYTHLVSAVSYFLLM 90

Query: 112 L--IDINIIKKFPTTTFVDYFMIDLFLAGAFSCLILSSAFHTLKSHSLFVAIYGNKLDYL 169
           L   D+ ++  FPT+TF DY +I+ +L GAF CL+ SS FHT K HS   +   +K+DY+
Sbjct: 91  LGITDLVMVPHFPTSTFTDYSVINFYLLGAFGCLMCSSCFHTFKQHSGPHSDAWSKVDYM 150

Query: 170 GIVILIVTSMISILYYGFYDTPYFFHLFSTITILFGIACGTVSLANKFRSREWRPYRATL 229
           GI++LI  SMIS++YYGF+D   +F LF+ +T+    AC    L++KF  +++RP RA  
Sbjct: 151 GIIVLITCSMISLIYYGFFDHMEYFRLFTVLTLTLATACTVCVLSDKFNHKDFRPLRAGF 210

Query: 230 FVCFGLSAVFPVLTGIWYYGLEDTFKRIQLKWIVTEGFFYIFGAFLYAMRYPERICPGAF 289
           F+ FGLS VFPV  GI  +G++   +R+QLK++  E  FYI GA +Y  R PE + PG F
Sbjct: 211 FIAFGLSGVFPVAAGIIKFGIQGGVQRVQLKYLGLEAIFYIAGALIYGFRIPETMFPGRF 270

Query: 290 DLWGHSHQIFHVFVVIAAYSHFHGLLSAYEYAHEML 325
           D WGHSHQIFHV VVIA++ H   ++ +Y + H  L
Sbjct: 271 DFWGHSHQIFHVLVVIASFLHLKAVMGSYIFKHSHL 306

>TPHA0A00640 Chr1 complement(115042..116025) [984 bp, 327 aa] {ON}
           Anc_3.90 YOL101C
          Length = 327

 Score =  268 bits (686), Expect = 5e-88,   Method: Compositional matrix adjust.
 Identities = 133/311 (42%), Positives = 200/311 (64%), Gaps = 6/311 (1%)

Query: 17  SSSAVTEEEYTIANDGVKSNKKLVKIIGRFTRQLITITHWDDLPDWQKDNEHIHEGYVKE 76
            SS ++   ++++ +G    +   +I+  ++++L +   + +LP+WQKDNE I +GYV+E
Sbjct: 13  QSSKLSRRRFSVSKNGTVLLES-TEIVETYSKKLYS---FHELPEWQKDNELIIQGYVRE 68

Query: 77  TNSFINCFESLFFLHNESVNIYSHMVPGLCALFMLLI--DINIIKKFPTTTFVDYFMIDL 134
           TNS+  CF SL + HNES+NIY+H++PGL    MLL   D+ ++  FP+TT +DY +ID 
Sbjct: 69  TNSWFKCFHSLSYFHNESINIYTHLIPGLVYFIMLLFYTDLLVVPSFPSTTIMDYIVIDF 128

Query: 135 FLAGAFSCLILSSAFHTLKSHSLFVAIYGNKLDYLGIVILIVTSMISILYYGFYDTPYFF 194
           +L GAF CL+ SS FH LK HS   + + +K+DY+GI+ LI  S+IS+LYYG++D   +F
Sbjct: 129 YLLGAFICLVGSSCFHCLKQHSEDQSNFWSKIDYVGIICLISCSLISLLYYGYFDHFIYF 188

Query: 195 HLFSTITILFGIACGTVSLANKFRSREWRPYRATLFVCFGLSAVFPVLTGIWYYGLEDTF 254
            +F+ IT++    C    L  +F ++ +RP RA  FV F  SAV P+ TG+  +   +  
Sbjct: 189 KVFTLITLILATICTVCVLDERFNAKNFRPIRAGFFVVFATSAVIPICTGLIKFDYVEVI 248

Query: 255 KRIQLKWIVTEGFFYIFGAFLYAMRYPERICPGAFDLWGHSHQIFHVFVVIAAYSHFHGL 314
            RIQL+++  E FFY+ GA LY  R PE   PG FDL G SHQIFHV VVI +  H   +
Sbjct: 249 NRIQLRFVGWETFFYVVGALLYGYRIPEIFAPGRFDLVGSSHQIFHVMVVIGSLFHLKAV 308

Query: 315 LSAYEYAHEML 325
           + +YE+ H+ L
Sbjct: 309 IGSYEFMHKSL 319

>Kwal_56.22704 s56 (244431..245393) [963 bp, 320 aa] {ON} YDR492W -
           Hypothetical ORF [contig 184] FULL
          Length = 320

 Score =  264 bits (675), Expect = 2e-86,   Method: Compositional matrix adjust.
 Identities = 124/309 (40%), Positives = 192/309 (62%), Gaps = 5/309 (1%)

Query: 16  VSSSAVTEEEYTIANDGVKSNKKLVKIIGRFTRQLITITHWDDLPDWQKDNEHIHEGYVK 75
           +SS+   ++  +   + +K N K  K   +  +    +  +++LP+WQ+DNE I  GYV+
Sbjct: 1   MSSTCTLKQRRSACKNELK-NGKNSKSAEQTKKS--ALCRFEELPEWQRDNEKILAGYVR 57

Query: 76  ETNSFINCFESLFFLHNESVNIYSHMVPG--LCALFMLLIDINIIKKFPTTTFVDYFMID 133
           ET S   C ESL + HNE++NIY+H++P      L M   D+ +I  FP+TT  DY MI+
Sbjct: 58  ETRSMRKCLESLTYFHNETLNIYTHLIPSGTYLVLLMFFTDVFLIPHFPSTTMSDYIMIN 117

Query: 134 LFLAGAFSCLILSSAFHTLKSHSLFVAIYGNKLDYLGIVILIVTSMISILYYGFYDTPYF 193
            +L GAF CL+ S+ FH LK HS   +   +K+DY+GI++LI  S +S+LYYGF+D  + 
Sbjct: 118 FYLLGAFLCLLCSTCFHCLKQHSEAQSNIWSKVDYMGIIVLISCSTVSLLYYGFHDYLFH 177

Query: 194 FHLFSTITILFGIACGTVSLANKFRSREWRPYRATLFVCFGLSAVFPVLTGIWYYGLEDT 253
           F +F+   ++ G  C    L ++F ++ WR  RA  FV FG S + P++ G+  +G+ ++
Sbjct: 178 FKIFTIAVVVLGSCCAAFVLNDRFNAKNWRACRAGFFVTFGFSGIVPIIMGLVKFGVAES 237

Query: 254 FKRIQLKWIVTEGFFYIFGAFLYAMRYPERICPGAFDLWGHSHQIFHVFVVIAAYSHFHG 313
            KR+QL++++ E FFYI GA +Y  R PE + PG FD  GHSHQIFH+ VV+ +  HF  
Sbjct: 238 SKRVQLRFVLLEAFFYIGGAIIYGFRIPETLIPGKFDFVGHSHQIFHILVVLGSLCHFRA 297

Query: 314 LLSAYEYAH 322
           L+ +Y + H
Sbjct: 298 LIGSYFFMH 306

>TDEL0D05340 Chr4 (969608..970558) [951 bp, 316 aa] {ON} Anc_3.90
           YOL101C
          Length = 316

 Score =  263 bits (672), Expect = 4e-86,   Method: Compositional matrix adjust.
 Identities = 127/310 (40%), Positives = 198/310 (63%), Gaps = 10/310 (3%)

Query: 16  VSSSAVTEEEYTIANDGVKSNKKLVKIIGRFTRQLITITHWDDLPDWQKDNEHIHEGYVK 75
           +SS+    +  T   +  K+      I+G+       + H+++LP+WQ+DN+ I  GYV+
Sbjct: 1   MSSTTTIRQRKTTVQETQKARDSKDGIMGK------KLYHFNELPEWQQDNDKILTGYVR 54

Query: 76  ETNSFINCFESLFFLHNESVNIYSHMVPGLCALFMLLI---DINIIKKFPTTTFVDYFMI 132
           ET S + C +SL + +NESVNIY+H++  + A F+LL+   DI +I  FP+TT  DY +I
Sbjct: 55  ETKSVLRCLDSLSYWNNESVNIYTHLLSAV-AYFVLLLFFTDILLIPSFPSTTMTDYIII 113

Query: 133 DLFLAGAFSCLILSSAFHTLKSHSLFVAIYGNKLDYLGIVILIVTSMISILYYGFYDTPY 192
           + +L GAF CL+ SS FH  K HS   +   +K+DY+GI+ LI  S+IS+LYYG++D  +
Sbjct: 114 NFYLLGAFVCLMCSSCFHCFKQHSNSQSDAWSKVDYMGIIGLISCSVISLLYYGYFDHVF 173

Query: 193 FFHLFSTITILFGIACGTVSLANKFRSREWRPYRATLFVCFGLSAVFPVLTGIWYYGLED 252
           +F LFS IT++  +AC    L+++F + + RP RA+ F+ F  S+V P+ TG++ +G  +
Sbjct: 174 YFKLFSVITVVLAMACSVCVLSDRFNTSDMRPLRASFFITFAFSSVIPIATGMFKFGWTE 233

Query: 253 TFKRIQLKWIVTEGFFYIFGAFLYAMRYPERICPGAFDLWGHSHQIFHVFVVIAAYSHFH 312
            F R+QL+++  E FFY+ GA LY  R PE I PG FD  G SHQ+FHV VV+ ++ H  
Sbjct: 234 VFHRVQLRFVGWEAFFYLSGALLYGYRIPETIAPGKFDFIGSSHQLFHVLVVLGSFCHLR 293

Query: 313 GLLSAYEYAH 322
            ++ +Y + H
Sbjct: 294 AVMGSYMFMH 303

>Kpol_1053.26 s1053 complement(40099..41073) [975 bp, 324 aa] {ON}
           complement(40099..41073) [975 nt, 325 aa]
          Length = 324

 Score =  259 bits (663), Expect = 9e-85,   Method: Compositional matrix adjust.
 Identities = 134/309 (43%), Positives = 188/309 (60%), Gaps = 5/309 (1%)

Query: 20  AVTEEEYTIANDGVKS---NKKLVKIIGRFTRQLITITHWDDLPDWQKDNEHIHEGYVKE 76
           A  E EY+  +    S   N  +   + R   + I + H+ +LPDWQKDNE I  GYV+E
Sbjct: 5   ATVEREYSSVSKRRTSKSANGTVTIEVEREEHEEIKLCHFHELPDWQKDNEFILTGYVRE 64

Query: 77  TNSFINCFESLFFLHNESVNIYSHMVPGLCALFMLL--IDINIIKKFPTTTFVDYFMIDL 134
           TNS   C  SL   +NES+NIYSH++  +    +LL   DI  I  FP+TTFVDY +IDL
Sbjct: 65  TNSIKKCLRSLGCFNNESINIYSHLIAAISYFVVLLFYTDILCIPSFPSTTFVDYMVIDL 124

Query: 135 FLAGAFSCLILSSAFHTLKSHSLFVAIYGNKLDYLGIVILIVTSMISILYYGFYDTPYFF 194
           +L GAF+CLI SS FH +K HS   +   +K+DY+GI+ LI  S+IS+LYYG+ D   +F
Sbjct: 125 YLLGAFTCLIGSSLFHCMKQHSESHSDMWSKVDYIGIICLITCSLISLLYYGYMDHFIYF 184

Query: 195 HLFSTITILFGIACGTVSLANKFRSREWRPYRATLFVCFGLSAVFPVLTGIWYYGLEDTF 254
            +F+ IT++    C    L  +F S+ +RP RA  F+ F +SAV P+  G   +G  +  
Sbjct: 185 KVFTVITLVLATICTICVLDQRFNSKNFRPIRAGFFILFSMSAVIPIGAGFSKFGFTEVL 244

Query: 255 KRIQLKWIVTEGFFYIFGAFLYAMRYPERICPGAFDLWGHSHQIFHVFVVIAAYSHFHGL 314
           +RIQL+++  E FFY+ GA LY  R PE + PG FDL G SHQIFH+ V++ +  H   +
Sbjct: 245 QRIQLRFVAWETFFYVVGALLYGFRIPETLYPGNFDLVGSSHQIFHIMVILGSVFHLKAV 304

Query: 315 LSAYEYAHE 323
           L +Y + H 
Sbjct: 305 LGSYTFMHS 313

>CAGL0G04631g Chr7 (441149..442099) [951 bp, 316 aa] {ON} similar to
           uniprot|Q03419 Saccharomyces cerevisiae YDR492w
          Length = 316

 Score =  258 bits (660), Expect = 3e-84,   Method: Compositional matrix adjust.
 Identities = 129/329 (39%), Positives = 199/329 (60%), Gaps = 17/329 (5%)

Query: 1   MTSSSRLQKRNGETIVSSSAVTEEEYTIANDGVKSNKKLVKIIGRFTRQLITITHWDDLP 60
           M++++ L+KR  +++  S      + +I   G + ++KL             + H+++LP
Sbjct: 1   MSATTTLRKRASKSVGESGG--RNDGSIHAHGEEKSEKL-------------LWHFNELP 45

Query: 61  DWQKDNEHIHEGYVKETNSFINCFESLFFLHNESVNIYSHMVPGL--CALFMLLIDINII 118
           +WQKDN+ I  GYV+ETNSF  C +SL +L+NESVNIY+H++P +   +L + L ++ +I
Sbjct: 46  EWQKDNDKILRGYVRETNSFKRCLQSLLYLNNESVNIYTHLIPAVFYISLSLYLANVFLI 105

Query: 119 KKFPTTTFVDYFMIDLFLAGAFSCLILSSAFHTLKSHSLFVAIYGNKLDYLGIVILIVTS 178
             +P+T+ VDY +I++F  GAF CL+ SS FH +K HS       +KLDYLGI+ LI  S
Sbjct: 106 PVYPSTSSVDYVIINVFFLGAFFCLLCSSCFHCMKQHSESQCNVWSKLDYLGIICLISCS 165

Query: 179 MISILYYGFYDTPYFFHLFSTITILFGIACGTVSLANKFRSREWRPYRATLFVCFGLSAV 238
            + ++YYG++D    F +F+ IT+L  I C    L +KF + E+RP RA+ F  FG S +
Sbjct: 166 TVPMIYYGYFDHISEFTIFTGITLLLAIGCSVFVLTDKFNTTEYRPIRASFFTLFGFSGI 225

Query: 239 FPVLTGIWYYGLEDTFKRIQLKWIVTEGFFYIFGAFLYAMRYPERICPGAFDLWGHSHQI 298
            P+  G   +G E   +RI L +I  E  FYI GA +Y  R+PE I PG FD +G SHQI
Sbjct: 226 IPLGAGFLKFGAEGVLQRISLPFIGLEALFYISGAIIYGFRFPETIAPGKFDFFGSSHQI 285

Query: 299 FHVFVVIAAYSHFHGLLSAYEYAHEMLIK 327
           FH+ VV+ +  H   ++ +Y   H   ++
Sbjct: 286 FHIMVVLGSICHLFAMVESYHLIHSNFLR 314

>KAFR0A08130 Chr1 (1638153..1639112) [960 bp, 319 aa] {ON} Anc_3.90
           YOL101C
          Length = 319

 Score =  257 bits (657), Expect = 8e-84,   Method: Compositional matrix adjust.
 Identities = 136/327 (41%), Positives = 196/327 (59%), Gaps = 22/327 (6%)

Query: 3   SSSRLQKRNGETIVSSSAVTEEEYTIANDGVKSNKKLVKIIGRFTRQLITITHWDDLPDW 62
           S +R +KR+     + S +T    T ++  +K  K++             + H+ +LP W
Sbjct: 5   SLTRTRKRSKSFRSAKSTITR---TRSDSSIKIEKRI-------------LYHFHELPTW 48

Query: 63  QKDNEHIHEGYVKETNSFINCFESLFFLHNESVNIYSHMVPGLCAL---FMLLIDINI-- 117
           Q+DN+ I  GYV+ETNSF  C ESLF+L+NES+NIYSH++P L  L    MLLI+I+   
Sbjct: 49  QQDNDKILGGYVRETNSFTKCIESLFYLNNESINIYSHLIPSLIYLTIAVMLLIEIDQFL 108

Query: 118 -IKKFPTTTFVDYFMIDLFLAGAFSCLILSSAFHTLKSHSLFVAIYGNKLDYLGIVILIV 176
            I  +PTTT  D+  I++FL GAF CL+ S  FH LK HS     + +++DY+GI++LI 
Sbjct: 109 NIPIYPTTTKYDFIFINIFLVGAFLCLLGSGCFHLLKQHSELQCNFWSRIDYMGIIVLIS 168

Query: 177 TSMISILYYGFYDTPYFFHLFSTITILFGIACGTVSLANKFRSREWRPYRATLFVCFGLS 236
            SM+ +LYYGF+D    F+ F T+T+ F   C  + ++  F   ++R  RA +F  FG S
Sbjct: 169 CSMMPVLYYGFFDHIVLFYCFITLTLAFASVCSIIVMSETFNLSKYRLLRACVFAAFGFS 228

Query: 237 AVFPVLTGIWYYGLEDTFKRIQLKWIVTEGFFYIFGAFLYAMRYPERICPGAFDLWGHSH 296
            + P++ G   +GL   F+RI LK+I  E  FY+ GA LY  R PE I PG FDL+G SH
Sbjct: 229 GLIPMIVGFSKFGLSGVFQRISLKFIFWESVFYLVGATLYGFRIPESILPGKFDLFGSSH 288

Query: 297 QIFHVFVVIAAYSHFHGLLSAYEYAHE 323
           Q+FH FVVI +  HF  ++ +Y   H 
Sbjct: 289 QLFHCFVVIGSVLHFKAVIESYILMHS 315

>NDAI0A07160 Chr1 complement(1630482..1631474) [993 bp, 330 aa] {ON}
           Anc_3.90
          Length = 330

 Score =  253 bits (645), Expect = 7e-82,   Method: Compositional matrix adjust.
 Identities = 135/329 (41%), Positives = 206/329 (62%), Gaps = 14/329 (4%)

Query: 1   MTSSSRLQKRNGETIVSSSAVTEEEYTIANDGVKSNKKLVKIIGRFTRQLITITHWDDLP 60
           +T++  L+ R+     S   + E  +   ND  +  K       R  R+ I ++ +D+LP
Sbjct: 11  LTTTCLLRSRSN----SVGGIFETNHLEDNDTSQKPKT-----NRRKRK-IHLSKFDELP 60

Query: 61  DWQKDNEHIHEGYVKETNSFINCFESLFFLHNESVNIYSHMVPGL----CALFMLLIDIN 116
           +WQKDN+ I  GYV+ETNSFI+CF+SLF+L+NE++NIY+H++P +     +L  + I+  
Sbjct: 61  EWQKDNDKILTGYVRETNSFIHCFQSLFYLNNETINIYTHLIPSIIYLIVSLTFIFINFI 120

Query: 117 IIKKFPTTTFVDYFMIDLFLAGAFSCLILSSAFHTLKSHSLFVAIYGNKLDYLGIVILIV 176
            I KFPTT+ +DY +I++F+ GAF+CL+LSS FH LK HS       +KLDY+GI+ILI 
Sbjct: 121 AIPKFPTTSVIDYIVINIFILGAFTCLLLSSCFHCLKQHSFKQCTLWSKLDYIGIIILIS 180

Query: 177 TSMISILYYGFYDTPYFFHLFSTITILFGIACGTVSLANKFRSREWRPYRATLFVCFGLS 236
            S+I ILY+G++D   +F  F+ +T  F I C  + L  KF    +RP RA LF+ F  +
Sbjct: 181 CSIIPILYFGYFDRLSYFKFFTILTFSFAIVCSIIVLNEKFDLPSYRPLRAGLFMLFSFT 240

Query: 237 AVFPVLTGIWYYGLEDTFKRIQLKWIVTEGFFYIFGAFLYAMRYPERICPGAFDLWGHSH 296
            + P++TG + +G +   +RI L +++ E  FYI G  LY  R PE   PG FD++G SH
Sbjct: 241 GLIPMITGFYIFGYKGVMERISLNFVLLEAIFYIIGTLLYGFRIPETFKPGNFDMFGSSH 300

Query: 297 QIFHVFVVIAAYSHFHGLLSAYEYAHEML 325
           QIFH+FVV+ +  HF  ++ +Y   H ++
Sbjct: 301 QIFHIFVVLGSICHFGAVIKSYCLMHHLI 329

>Skud_4.766 Chr4 (1354630..1355580) [951 bp, 316 aa] {ON} YDR492W
           (REAL)
          Length = 316

 Score =  252 bits (643), Expect = 1e-81,   Method: Compositional matrix adjust.
 Identities = 126/323 (39%), Positives = 191/323 (59%), Gaps = 14/323 (4%)

Query: 3   SSSRLQKRNGETIVSSSAVTEEEYTIANDGVKSNKKLVKIIGRFTRQLITITHWDDLPDW 62
           S +  ++RN E++   +     +         S K+  K++  F          D+LP+W
Sbjct: 2   SITTTRRRNQESVCCKATTASIKVEAVQSKTASEKE--KLLHNF----------DELPEW 49

Query: 63  QKDNEHIHEGYVKETNSFINCFESLFFLHNESVNIYSHMVPGLCALFMLLIDIN--IIKK 120
           QKDN+ I  GYV+ET S+  C  SLF+ +NE+VNIY+H+VP +      +   N  +I  
Sbjct: 50  QKDNDKILTGYVRETLSWKKCLRSLFYWNNETVNIYTHLVPAIIYFLFAITLTNYFLIPV 109

Query: 121 FPTTTFVDYFMIDLFLAGAFSCLILSSAFHTLKSHSLFVAIYGNKLDYLGIVILIVTSMI 180
           FP+T++ DY +I++FL GAFSCL+ SS FH LK HS   + + +KLDYLGI+ LI  SMI
Sbjct: 110 FPSTSWSDYTVINIFLMGAFSCLMCSSCFHCLKQHSEEQSNFWSKLDYLGIISLISCSMI 169

Query: 181 SILYYGFYDTPYFFHLFSTITILFGIACGTVSLANKFRSREWRPYRATLFVCFGLSAVFP 240
            I+Y+G++D   +F LF+T+T++    C    L  KF +  +RP+RA  F+ FG S + P
Sbjct: 170 PIIYFGYFDHVSYFSLFTTVTLVLATFCTVCVLHEKFNTSTFRPFRAMFFILFGFSGLLP 229

Query: 241 VLTGIWYYGLEDTFKRIQLKWIVTEGFFYIFGAFLYAMRYPERICPGAFDLWGHSHQIFH 300
           + TG + +G++    RI++ ++  E  FYI GA +Y  R PE I PG FD  G SHQIFH
Sbjct: 230 LTTGFFKFGIQGVLNRIKVSFVFWEALFYISGAVIYGFRIPETIAPGKFDFLGSSHQIFH 289

Query: 301 VFVVIAAYSHFHGLLSAYEYAHE 323
           + VV+ +  H   ++ +Y+  H 
Sbjct: 290 IMVVLGSLCHLKAIIDSYKLMHS 312

>KLLA0C12441g Chr3 complement(1057427..1058374) [948 bp, 315 aa]
           {ON} similar to uniprot|Q6Q557 Saccharomyces cerevisiae
           YDR492W IZH1 Membrane protein involved in zinc
           metabolism member of the four-protein IZH family
           transcription is regulated directly by Zap1p expression
           induced by zinc deficiency and fatty acids deletion
           increases sensitivity to elevated zinc
          Length = 315

 Score =  249 bits (635), Expect = 2e-80,   Method: Compositional matrix adjust.
 Identities = 125/301 (41%), Positives = 189/301 (62%), Gaps = 7/301 (2%)

Query: 29  ANDGVKSNKKLVKIIGRFTRQLITIT-----HWDDLPDWQKDNEHIHEGYVKETNSFINC 83
           A   ++  + + + + + T   I+ T      + +LP+WQ+DN+ I  GY++ET S   C
Sbjct: 3   ATTTIRHRRSISEKLEQLTPVAISSTIKRLYRYSELPEWQQDNDKIITGYIRETKSVKEC 62

Query: 84  FESLFFLHNESVNIYSHMVPGLCALFML--LIDINIIKKFPTTTFVDYFMIDLFLAGAFS 141
            +SLF  HNES+NIYSH+VP +  L +L  L D+ ++ +FP +T +   MI  FL G+  
Sbjct: 63  VKSLFLFHNESINIYSHLVPTITYLVLLVGLADMFLVPQFPNSTMMQSVMIHFFLLGSVL 122

Query: 142 CLILSSAFHTLKSHSLFVAIYGNKLDYLGIVILIVTSMISILYYGFYDTPYFFHLFSTIT 201
           CL  SS FH LK HS       +K+DY+GI+I+I  S+IS+LYYGF+D  + F  F+  T
Sbjct: 123 CLGCSSFFHCLKQHSESHCHIWSKVDYMGIIIMITCSIISLLYYGFHDHIFHFKCFTVFT 182

Query: 202 ILFGIACGTVSLANKFRSREWRPYRATLFVCFGLSAVFPVLTGIWYYGLEDTFKRIQLKW 261
           ++ G  C   +L +KF S+ +RP+RA  +V FGLS + P++TG W +G  +  +R+QLK+
Sbjct: 183 VILGTICTVFALHDKFNSKTFRPFRAMFYVTFGLSGIVPIVTGFWKFGAYEAIRRVQLKY 242

Query: 262 IVTEGFFYIFGAFLYAMRYPERICPGAFDLWGHSHQIFHVFVVIAAYSHFHGLLSAYEYA 321
           ++ E  FYI GA +Y  R+PE + PG FD  GHSHQIFH+ VV+ +  HF  +L +Y + 
Sbjct: 243 VLLEAMFYIAGAVIYGFRFPEVLAPGKFDFVGHSHQIFHIMVVLGSICHFRAILGSYVFM 302

Query: 322 H 322
           H
Sbjct: 303 H 303

>Smik_4.769 Chr4 (1356263..1357213) [951 bp, 316 aa] {ON} YDR492W
           (REAL)
          Length = 316

 Score =  246 bits (628), Expect = 1e-79,   Method: Compositional matrix adjust.
 Identities = 125/323 (38%), Positives = 191/323 (59%), Gaps = 14/323 (4%)

Query: 3   SSSRLQKRNGETIVSSSAVTEEEYTIANDGVKSNKKLVKIIGRFTRQLITITHWDDLPDW 62
           S +  ++RN E++  S      +    +    S KK  K++  F          D+LP+W
Sbjct: 2   SLTTTRRRNQESVCCSVTTGSIKVEAVSSTTVSEKK--KLLHNF----------DELPEW 49

Query: 63  QKDNEHIHEGYVKETNSFINCFESLFFLHNESVNIYSHMVPGLCALFMLLIDIN--IIKK 120
           QKDN+ I  GYV+ET S+  C  SLF+ +NE+VNIY+H+VP +      +   N  +I  
Sbjct: 50  QKDNDKILTGYVRETLSWKKCLYSLFYWNNETVNIYTHLVPAVIYFVFAITLTNYFLIPV 109

Query: 121 FPTTTFVDYFMIDLFLAGAFSCLILSSAFHTLKSHSLFVAIYGNKLDYLGIVILIVTSMI 180
           FP+T++ DY +I++FL GAFSCL+ SS FH +K HS   + + +KLDYLGI+ LI  SMI
Sbjct: 110 FPSTSWSDYTVINIFLMGAFSCLMCSSCFHCMKQHSEKQSNFWSKLDYLGIISLISCSMI 169

Query: 181 SILYYGFYDTPYFFHLFSTITILFGIACGTVSLANKFRSREWRPYRATLFVCFGLSAVFP 240
            I+Y+G++D   +F LF+ +T++    C    L  KF +  +RP+RA  F+ FG S + P
Sbjct: 170 PIIYFGYFDHISYFSLFTIVTLVLATFCTVCVLHEKFNTSTFRPFRAMFFILFGFSGLLP 229

Query: 241 VLTGIWYYGLEDTFKRIQLKWIVTEGFFYIFGAFLYAMRYPERICPGAFDLWGHSHQIFH 300
           + TG + +G++    RI++ ++  E  FYI GA +Y  R PE + PG FD  G SHQIFH
Sbjct: 230 LTTGFFKFGIQGVLNRIKVSFVFWEALFYISGAVIYGFRIPETLAPGKFDFLGSSHQIFH 289

Query: 301 VFVVIAAYSHFHGLLSAYEYAHE 323
           + VV+ +  H   ++ +Y+  H 
Sbjct: 290 IMVVLGSICHLKAIIGSYKLMHS 312

>YDR492W Chr4 (1434924..1435874) [951 bp, 316 aa] {ON}  IZH1Membrane
           protein involved in zinc ion homeostasis, member of the
           four-protein IZH family; transcription is regulated
           directly by Zap1p, expression induced by zinc deficiency
           and fatty acids; deletion increases sensitivity to
           elevated zinc
          Length = 316

 Score =  246 bits (627), Expect = 2e-79,   Method: Compositional matrix adjust.
 Identities = 119/305 (39%), Positives = 192/305 (62%), Gaps = 5/305 (1%)

Query: 23  EEEYTIANDGVKSNKKLVKIIGR--FTRQLITITHWDDLPDWQKDNEHIHEGYVKETNSF 80
             + ++     +++ K+  + G+  F +Q + + ++D+LP+WQKDN+ I  GYV+ET S+
Sbjct: 9   RNQDSVCCKATRASIKVEAVSGQTVFEKQKL-LHNFDELPEWQKDNDKILTGYVRETLSW 67

Query: 81  INCFESLFFLHNESVNIYSHMVPGLCALFMLLIDIN--IIKKFPTTTFVDYFMIDLFLAG 138
             C  SLF+ +NE+VNIY+H+VP +      +   N  +I  FP+T++ DY +I++FL G
Sbjct: 68  KKCLYSLFYWNNETVNIYTHLVPAIVYFVFAITLTNYFLIPVFPSTSWSDYTVINIFLMG 127

Query: 139 AFSCLILSSAFHTLKSHSLFVAIYGNKLDYLGIVILIVTSMISILYYGFYDTPYFFHLFS 198
           AFSCL+ SS FH +K HS   + + +KLDYLGI+ LI  SMI I+Y+G++D   +F LF+
Sbjct: 128 AFSCLMCSSCFHCMKQHSEKQSNFWSKLDYLGIISLISCSMIPIIYFGYFDHISYFSLFT 187

Query: 199 TITILFGIACGTVSLANKFRSREWRPYRATLFVCFGLSAVFPVLTGIWYYGLEDTFKRIQ 258
            +T++    C    L +KF +  +RP+RA  F+ FG S + P+ TG + +G++    RI+
Sbjct: 188 IVTLVLATFCTVCVLHDKFNTSTFRPFRAMFFILFGFSGLLPLTTGFFKFGIQGVLNRIK 247

Query: 259 LKWIVTEGFFYIFGAFLYAMRYPERICPGAFDLWGHSHQIFHVFVVIAAYSHFHGLLSAY 318
           + ++  E  FYI GA +Y  R PE + PG FD +G SHQIFH+ VV+ +  H   ++ +Y
Sbjct: 248 VSFVFWEALFYISGAVIYGFRIPETLAPGKFDFFGSSHQIFHIMVVLGSVCHLKAIIDSY 307

Query: 319 EYAHE 323
           +  H 
Sbjct: 308 KLMHS 312

>Suva_2.668 Chr2 (1186763..1187710) [948 bp, 315 aa] {ON} YDR492W
           (REAL)
          Length = 315

 Score =  245 bits (626), Expect = 3e-79,   Method: Compositional matrix adjust.
 Identities = 125/318 (39%), Positives = 194/318 (61%), Gaps = 15/318 (4%)

Query: 8   QKRNGETIVSSSAVTEEEYTIANDGVKSNKKLVKIIGRFTRQLITITHWDDLPDWQKDNE 67
           ++RN E +   ++ +     I  + +KS   L K       +L+   H  +LPDWQ+DN+
Sbjct: 7   RRRNQENVCCKTSTS-----IKVEALKSKVTLRK------EKLLHDFH--ELPDWQRDND 53

Query: 68  HIHEGYVKETNSFINCFESLFFLHNESVNIYSHMVPGLC--ALFMLLIDINIIKKFPTTT 125
            I  GYV+ET S+  C  SLF+ +NE+VNIY+H+VP +      + L +  +I  FP+TT
Sbjct: 54  KILTGYVRETLSWKKCLYSLFYWNNETVNIYTHLVPAIVYFVFGVTLTNYFLIPVFPSTT 113

Query: 126 FVDYFMIDLFLAGAFSCLILSSAFHTLKSHSLFVAIYGNKLDYLGIVILIVTSMISILYY 185
           + DY +I++FL GAF CL+ SS FH +K HS   + + +KLDYLGI+ LI  SMI I+Y+
Sbjct: 114 WSDYTVINIFLMGAFLCLMCSSCFHCMKQHSEKQSDFWSKLDYLGIISLISCSMIPIIYF 173

Query: 186 GFYDTPYFFHLFSTITILFGIACGTVSLANKFRSREWRPYRATLFVCFGLSAVFPVLTGI 245
           G++D   +F LF+ +T++    C    L +KF +  +RP+RA  F+ FG S + P+ TG+
Sbjct: 174 GYFDHASYFSLFTIVTLVLATFCTICVLHDKFNTSTFRPFRAMFFILFGFSGLLPLTTGL 233

Query: 246 WYYGLEDTFKRIQLKWIVTEGFFYIFGAFLYAMRYPERICPGAFDLWGHSHQIFHVFVVI 305
           + +GL+    RI++ ++  E  FYI GA +Y  R PE + PG FD +G SHQIFH+ VV+
Sbjct: 234 FKFGLQGVLNRIRVSFVFWEALFYISGALIYGFRIPETLAPGKFDFFGSSHQIFHIMVVL 293

Query: 306 AAYSHFHGLLSAYEYAHE 323
            +  H   ++ +Y+  H 
Sbjct: 294 GSVCHLKAIIDSYKLMHS 311

>AFR337W Chr6 (1051645..1052598) [954 bp, 317 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YDR492W (IZH1) and
           YOL101C (IZH4)
          Length = 317

 Score =  245 bits (625), Expect = 4e-79,   Method: Compositional matrix adjust.
 Identities = 125/297 (42%), Positives = 180/297 (60%), Gaps = 5/297 (1%)

Query: 24  EEYTIANDGVKSNKKLVKIIGRFTRQLITITHWDDLPDWQKDNEHIHEGYVKETNSFINC 83
           +E TI+    +      + + +  R+L T   +D+LP WQKDNE I  GYV+ETNS   C
Sbjct: 8   KEQTISEMAQEMAHTTSEGLKKRIRKLYT---FDELPAWQKDNELILSGYVRETNSVKEC 64

Query: 84  FESLFFLHNESVNIYSHMVPGLC--ALFMLLIDINIIKKFPTTTFVDYFMIDLFLAGAFS 141
             ++ + +NES+NIY+H++PG+    LF++  D+ + +  P     ++ M+  +L GAF+
Sbjct: 65  LRAMTYFNNESINIYTHLIPGVAYLVLFLIFADLVLAQLLPGLDAGEHRMLRFYLLGAFT 124

Query: 142 CLILSSAFHTLKSHSLFVAIYGNKLDYLGIVILIVTSMISILYYGFYDTPYFFHLFSTIT 201
           CL  SS FH LK HS   +   +K+DYLGI+  I  S IS+LYYG++  P  F  FST+T
Sbjct: 125 CLACSSCFHCLKQHSEPHSRLWSKVDYLGILAQITCSTISLLYYGYHSYPSHFVFFSTLT 184

Query: 202 ILFGIACGTVSLANKFRSREWRPYRATLFVCFGLSAVFPVLTGIWYYGLEDTFKRIQLKW 261
           +    AC  + L + F +  +RP RA LF+ FGLS V PVL G + +G  +   RIQLK+
Sbjct: 185 VALCSACAVLVLNDSFNTVAFRPLRAFLFMAFGLSGVIPVLAGSYQFGFAEWAARIQLKY 244

Query: 262 IVTEGFFYIFGAFLYAMRYPERICPGAFDLWGHSHQIFHVFVVIAAYSHFHGLLSAY 318
           ++ E  FYI GA +Y  R PER  PG FD+ GHSHQIFH+ VV+    HF  +  +Y
Sbjct: 245 VLYEAVFYITGALVYGFRIPERFAPGKFDMVGHSHQIFHLLVVLGTLCHFRAVTGSY 301

>Ecym_3588 Chr3 (1117646..1118563) [918 bp, 305 aa] {ON} similar to
           Ashbya gossypii AFR337W
          Length = 305

 Score =  244 bits (623), Expect = 6e-79,   Method: Compositional matrix adjust.
 Identities = 125/275 (45%), Positives = 179/275 (65%), Gaps = 5/275 (1%)

Query: 46  FTRQLITITHWDDLPDWQKDNEHIHEGYVKETNSFINCFESLFFLHNESVNIYSHMVPGL 105
           F R+L +   +D+LP+WQKDNE I  GYV+ETNSF+ C +S+ + +NESVNIY+H+VP +
Sbjct: 18  FNRRLYS---FDELPEWQKDNELIRMGYVRETNSFLECLKSMTYFNNESVNIYTHLVPSV 74

Query: 106 CALFMLLIDINII--KKFPTTTFVDYFMIDLFLAGAFSCLILSSAFHTLKSHSLFVAIYG 163
               +LL+ ++++    FP TT  +Y MID +L G F CL+ S+ FH LK HS       
Sbjct: 75  TYFILLLLFVDLVVTPMFPGTTMREYIMIDFYLFGVFVCLMCSTCFHCLKQHSESHNRIW 134

Query: 164 NKLDYLGIVILIVTSMISILYYGFYDTPYFFHLFSTITILFGIACGTVSLANKFRSREWR 223
           +K+DY+GI++ I +S++SILYYGFYD        S +T+  G+ C T  L ++F + ++R
Sbjct: 135 SKVDYIGIIVQITSSIVSILYYGFYDHISHIKWLSVLTLTLGVCCVTFVLNDRFNAIDYR 194

Query: 224 PYRATLFVCFGLSAVFPVLTGIWYYGLEDTFKRIQLKWIVTEGFFYIFGAFLYAMRYPER 283
             RA  F  FG S V PVL GI+ +GL +   RIQLK+++    FYIFGA +Y  R PE 
Sbjct: 195 LLRAIFFTVFGFSGVVPVLIGIYQFGLIEWLARIQLKFVLAGTIFYIFGALIYGFRIPEA 254

Query: 284 ICPGAFDLWGHSHQIFHVFVVIAAYSHFHGLLSAY 318
           + PG FD  GHSHQIFH+ VV+ +  HF  ++ +Y
Sbjct: 255 LAPGKFDFIGHSHQIFHLLVVLGSICHFRAVIGSY 289

>NCAS0I02570 Chr9 complement(480266..481210) [945 bp, 314 aa] {ON}
           Anc_3.90 YDR492W
          Length = 314

 Score =  238 bits (607), Expect = 2e-76,   Method: Compositional matrix adjust.
 Identities = 129/318 (40%), Positives = 187/318 (58%), Gaps = 14/318 (4%)

Query: 10  RNGETIVSSSAVTEEEYTIANDGVKSNKKLVKIIGRFTRQLITITHWDDLPDWQKDNEHI 69
           R   T V + AV         D  K N K         R+L    ++++LP+WQ+DN+ I
Sbjct: 8   RRKPTKVQAVAVGSSNKHADGDKTKRNWK---------RRLF---NFNELPEWQRDNDKI 55

Query: 70  HEGYVKETNSFINCFESLFFLHNESVNIYSHMVPGL--CALFMLLIDINIIKKFPTTTFV 127
             GYV+ET SF  C +SL + +NE++NIY+H++P L    + + LI+  ++  FPTT+ +
Sbjct: 56  LTGYVRETKSFKQCLQSLLYWNNETINIYTHLIPALFYLTISVTLINYVVVPHFPTTSIM 115

Query: 128 DYFMIDLFLAGAFSCLILSSAFHTLKSHSLFVAIYGNKLDYLGIVILIVTSMISILYYGF 187
           DYF+I++FL GAF CLILSS FH LK HS       +KLDY+GI+ILI  S+I ++Y+G+
Sbjct: 116 DYFVINVFLMGAFVCLILSSCFHCLKQHSSRQCTLWSKLDYMGIIILISCSLIPMIYFGY 175

Query: 188 YDTPYFFHLFSTITILFGIACGTVSLANKFRSREWRPYRATLFVCFGLSAVFPVLTGIWY 247
           +D  Y+ + F  +T  F   C    L  KF    +RP+RA +F+ F  S   P+LTG + 
Sbjct: 176 FDHLYYVNFFIILTFSFATLCSICVLNEKFNVPHYRPFRAIVFMLFSFSGFIPILTGFYL 235

Query: 248 YGLEDTFKRIQLKWIVTEGFFYIFGAFLYAMRYPERICPGAFDLWGHSHQIFHVFVVIAA 307
           +G    F+R+ LK++  E  FYI GA LY  R PE   PG FD  G SHQIFH+ VV+ +
Sbjct: 236 FGFHGVFERVALKFVAWEALFYITGATLYGFRIPECFKPGDFDFLGSSHQIFHILVVLGS 295

Query: 308 YSHFHGLLSAYEYAHEML 325
             HF  ++ +Y   H  +
Sbjct: 296 ICHFRAVIKSYILMHSSM 313

>TBLA0B02290 Chr2 complement(534472..535452) [981 bp, 326 aa] {ON}
           Anc_3.90 YOL101C
          Length = 326

 Score =  233 bits (595), Expect = 2e-74,   Method: Compositional matrix adjust.
 Identities = 126/328 (38%), Positives = 187/328 (57%), Gaps = 17/328 (5%)

Query: 7   LQKRNGETIVSSSAVTEEEYTIANDGVKSNKKLVKIIGRFTRQLITIT---HWDDLPDWQ 63
           +Q+  G    SSS +T           KS   ++       +Q IT T    +++LP WQ
Sbjct: 1   MQQSTGANAHSSSPLTHHR-------SKSISSILSQAAEDVKQKITDTLLYTYEELPSWQ 53

Query: 64  KDNEHIHEGYVKETNSFINCFESLFFLHNESVNIYSHMVPGLCALFMLLI-----DINII 118
           +DNE I  GY++ETNS+  C  SL F HNE++NIYSH +    A+++LL+     ++  +
Sbjct: 54  QDNEMILTGYIRETNSWKLCLRSLTFFHNETINIYSHGISA--AIYLLLLVFFFTNLIYL 111

Query: 119 KKFPTTTFVDYFMIDLFLAGAFSCLILSSAFHTLKSHSLFVAIYGNKLDYLGIVILIVTS 178
             FPTTT  DY ++D++L GA +CL LSS FH LK HS   +   +K+DY+GI+ LI  S
Sbjct: 112 PSFPTTTLHDYLVLDIYLLGAATCLTLSSCFHCLKQHSQSQSDIWSKMDYIGIICLITCS 171

Query: 179 MISILYYGFYDTPYFFHLFSTITILFGIACGTVSLANKFRSREWRPYRATLFVCFGLSAV 238
            IS+LY+G+ D   +F  F+  T +  I C       KF +R+W+  RA  F+ F  S +
Sbjct: 172 TISLLYFGYRDHFNYFKFFAISTFILAITCTVFVTMEKFNTRDWKHVRALFFIAFAGSGL 231

Query: 239 FPVLTGIWYYGLEDTFKRIQLKWIVTEGFFYIFGAFLYAMRYPERICPGAFDLWGHSHQI 298
            P++TGI  +G  + ++R+QL  +  E   Y+ GA LY  R PE   PG FD  G+SHQ 
Sbjct: 232 IPLITGINIFGFPEVWQRVQLPSLTLELICYVIGALLYGYRIPEVFAPGKFDNIGNSHQW 291

Query: 299 FHVFVVIAAYSHFHGLLSAYEYAHEMLI 326
           FH+FVV+ +  H   L+ +Y + H  L+
Sbjct: 292 FHIFVVLGSLLHLRALVGSYYFMHSFLL 319

>KNAG0K02160 Chr11 (436744..437715) [972 bp, 323 aa] {ON} Anc_3.90
           YOL101C
          Length = 323

 Score =  223 bits (567), Expect = 3e-70,   Method: Compositional matrix adjust.
 Identities = 130/333 (39%), Positives = 187/333 (56%), Gaps = 23/333 (6%)

Query: 4   SSRLQKRN---GETIVSSSAVTEEEY-----TIANDGVKSNKKLVKIIGRFTRQLITITH 55
           SS L+KR    GET + ++ V+         T  + G  S ++     GR  R       
Sbjct: 2   SSELRKRAVSLGETAIETATVSRGSRGKLLVTGTSSGAPSGQR-----GRLCR------- 49

Query: 56  WDDLPDWQKDNEHIHEGYVKETNSFINCFESLFFLHNESVNIYSHMVPGLC--ALFMLLI 113
           +++LP WQ+DN+ I  GYV+ET S   C  SL + +NESVN+YSH+VP +   A   L +
Sbjct: 50  YEELPAWQQDNDCIRTGYVRETLSVRRCLGSLLYWNNESVNMYSHLVPAVLYIAGATLAL 109

Query: 114 DINIIKKFPTTTFVDYFMIDLFLAGAFSCLILSSAFHTLKSHSLFVAIYGNKLDYLGIVI 173
               + +FPTTT+ DY +I+ FL GA +CL+ SS FH LK HS       +++DY+GI++
Sbjct: 110 SQWGVPRFPTTTWSDYLIINTFLVGAGACLLCSSLFHCLKQHSERHCEAWSRMDYMGIIL 169

Query: 174 LIVTSMISILYYGFYDTPYFFHLFSTITILFGIACGTVSLANK-FRSREWRPYRATLFVC 232
           LI  S I ++Y+G++D      LF+ +T+  G+AC  V L NK F S  ++  RA  F+ 
Sbjct: 170 LIACSTIPMIYFGYFDYMGHCLLFTAVTVALGVACSGVVLFNKQFNSSSFKLVRAAFFIA 229

Query: 233 FGLSAVFPVLTGIWYYGLEDTFKRIQLKWIVTEGFFYIFGAFLYAMRYPERICPGAFDLW 292
           F  + + P+ TG   +G+     RI LK++  E  FYI GA LY  R PE   PG  DLW
Sbjct: 230 FAFNGLIPMATGFVKFGIPGVLDRISLKYVWFEAVFYIAGAMLYGFRVPEIWIPGKVDLW 289

Query: 293 GHSHQIFHVFVVIAAYSHFHGLLSAYEYAHEML 325
           G+SHQ+FHV VV  +  H   +L +Y   H  L
Sbjct: 290 GNSHQMFHVMVVFGSLCHLKAVLESYSLMHRHL 322

>TBLA0B08255 Chr2 (1973757..1974647) [891 bp, 296 aa] {ON}
          Length = 296

 Score =  158 bits (400), Expect = 1e-45,   Method: Compositional matrix adjust.
 Identities = 96/296 (32%), Positives = 151/296 (51%), Gaps = 28/296 (9%)

Query: 47  TRQLITITHWDDLPDWQKDNEHIHEGYVKETNSFINCFESLFFLHNESVNIYSHMVPGLC 106
           ++  + + +++DLPDWQKDN  I   YV+ETNS      S+F  H+ES+NI++H++P   
Sbjct: 2   SKHSLQLCNFNDLPDWQKDNPLIVNYYVRETNSLFKSLCSIFLFHSESMNIFTHLIP--- 58

Query: 107 ALFMLLIDINIIKKFPTTTFVDYFMIDLFLAGAFSCLILSSAFHTLKSHSLFVAIYGNKL 166
           AL       N I      ++   F    +L     C +LSS FH  K  S+    +  KL
Sbjct: 59  ALLYAKFTYNAITTLEQVSYPIVF----YLISVIICFLLSSLFHLFKCTSVQSNEFWGKL 114

Query: 167 DYLGIVILIVTSMISILYYGFYDTPY------FFHLFSTIT---ILFGIAC--------- 208
           DY+GI +LI  +++S+   GF ++ Y      F    S +T   I+  I           
Sbjct: 115 DYVGISLLINATIVSMALLGFNESRYTIMKNTFVTQTSCLTAYVIILAIKSHPKQGENED 174

Query: 209 ---GTVSLANKFRSREWRPYRATLFVCFGLSAVFPVLTGIWYYGLEDTFKRIQLKWIVTE 265
              GT+S  +     + +  RA LF   GLS + PV+TG++ YG +  + +I +  ++  
Sbjct: 175 DNDGTLSEDDDCCCDDHKGTRAKLFASLGLSGLIPVITGLYIYGPKVVYYKINIPMVIAS 234

Query: 266 GFFYIFGAFLYAMRYPERICPGAFDLWGHSHQIFHVFVVIAAYSHFHGLLSAYEYA 321
              YI G  +Y  + PE+  PG FDL G SHQ+FH+F+V     H+H + +A  +A
Sbjct: 235 VLCYIVGTLIYVFKIPEKFYPGRFDLVGSSHQLFHIFIVFGTVCHYHAIQTAKNFA 290

>NCAS0C04920 Chr3 complement(1003692..1004672) [981 bp, 326 aa] {ON}
           Anc_3.90
          Length = 326

 Score =  140 bits (353), Expect = 2e-38,   Method: Compositional matrix adjust.
 Identities = 91/285 (31%), Positives = 149/285 (52%), Gaps = 7/285 (2%)

Query: 46  FTRQLITITHWDDLPDWQKD--NEHIHEGYVKETNSFINCFESLFFLHNESVNIYSHMVP 103
           F R+   +    +LP WQK   N  I  GYV+ETNS I C  ++ + +N++VNI  + V 
Sbjct: 34  FPRRPKVLPILKELPQWQKQYSNSKIINGYVRETNSLIKCLHTVTYWNNQTVNIILNTVF 93

Query: 104 GLC--ALFMLLIDINIIKKFPTTTFVDYFMIDLFLAGAFSCLILSSAFHTLKSHSLFVAI 161
                 L +   D+ +I   P TT  DY M++ +L GAF    L+S F+ L+SHSL    
Sbjct: 94  STVYFTLLLFFTDLYLIPSSPATTMSDYIMVNFYLFGAFQYFALNSIFYLLESHSLAKCH 153

Query: 162 YGNKLDYLGIVILIVTSMISILYYGFYDTPYFFHLFSTITILFGIACGTVSLANKFRSRE 221
              KL +L  +  I TS+I+ LYY F+D  ++F   +  T+L        +L+ +F  R+
Sbjct: 154 LWFKLSHLAFINYISTSIITQLYYTFFDNVFYFKFLTISTLLISSIFAIFTLSEQFL-RK 212

Query: 222 WRPYRATLFVCFGLS-AVFPVLTGIWYYGLEDTFKRIQLKWIVTEGFFYIFGAFLYAMRY 280
            R  R  + + F +S  + P  + ++ +      +R++ K I+ E   Y+F   L A++ 
Sbjct: 213 NRSQRNMVSITFIVSLLILPTASLMFKFNTFRILRRVEGKAILLELSLYLFSMTLKAVQV 272

Query: 281 PERICPGAFDLWGHSHQIFHVFVVIAAYSHFHGLLSAYEYAHEML 325
           PER     FD  G+S  I+H+ +++ +  HF  LL++Y + H  L
Sbjct: 273 PERFSEN-FDFIGNSENIYHICIILGSLLHFKMLLNSYFFMHSGL 316

>NDAI0G04300 Chr7 (1035664..1036620) [957 bp, 318 aa] {ON} Anc_3.90
          Length = 318

 Score =  137 bits (346), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 93/313 (29%), Positives = 166/313 (53%), Gaps = 16/313 (5%)

Query: 19  SAVTEEEYTIANDGVKSNKKLVKIIGRFTRQLITITHWD--DLPDWQKD--NEHIHEGYV 74
           S++T  +    ND   ++K+   I      +L T  H+   +LP+WQ++  +  +  G++
Sbjct: 2   SSITTTKGGCPNDNYPTSKRYTVI-----SKLSTRNHYKLKELPEWQREFNSGKVITGFL 56

Query: 75  KETNSFINCFESLFFLHNESVNIYSHMVPGLCALFMLL---IDINIIKKFPTTTFVDYFM 131
           KETNSF  C  S  + HN S+NI  + +      FMLL    D  +I  FP+TT  DY +
Sbjct: 57  KETNSFKKCLWSTMYWHNSSINISLNGIAA-TVYFMLLFFFTDCYLIPSFPSTTMSDYIV 115

Query: 132 IDLFLAGAFSCLILSSAFHTLKSHSLFVAIYGNKLDYLGIVILIVTSMISILYYGFYDTP 191
           ++L+L  A    ++ + F+ +KSHS   A    KL+ +G++  I +S++++LYY ++D  
Sbjct: 116 LNLYLLTATQNFMVGTIFYIMKSHSKQQAFLWYKLNNIGLINHIASSVVTLLYYHYFDYV 175

Query: 192 YFFHLFSTITILFGIACGTVSLANKFRSREWRPYRATLFVCF-GLSAVFPVLTGIWYYGL 250
           ++F  F+ +T+L  I   T S+ +   ++  R  +  L + +  L  + P L  I  +GL
Sbjct: 176 FYFKFFTIVTLLL-ITLFTCSIISDSFNKMTRIRKNFLLLAYIILLTLMPSLFAILRFGL 234

Query: 251 EDTFKRIQLKWIVTEGFFYIFGAFLYAMRYPERICPGAFDLWGHSHQIFHVFVVIAAYSH 310
               +RI L  I+ E F Y FG  +   + PER    +FD  G+S  ++ + +++ ++ H
Sbjct: 235 AKVLERISLNLIILEIFIYAFGLTIRTSQLPERFF-NSFDFLGNSENVYQLSIIVCSFIH 293

Query: 311 FHGLLSAYEYAHE 323
           F  L+++Y   H 
Sbjct: 294 FKILMNSYCLMHS 306

>CAGL0I07491g Chr9 complement(719539..720444) [906 bp, 301 aa] {ON}
           similar to uniprot|Q03419 Saccharomyces cerevisiae
           YDR492w
          Length = 301

 Score =  117 bits (293), Expect = 6e-30,   Method: Compositional matrix adjust.
 Identities = 86/284 (30%), Positives = 137/284 (48%), Gaps = 18/284 (6%)

Query: 53  ITHWDDLPDWQKD--NEHIHEGYVKETN-SFINCFESLFFLHNESVNIYSHMVPGLCALF 109
           I   + LP W +   N  I  GY   TN +++ C + L   +N+S++IY ++V GL +  
Sbjct: 10  IVTLEKLPVWYRRYGNSRIKTGYFYYTNATYLGCLQKLVKFNNDSISIYMNLVCGLISGV 69

Query: 110 MLL--IDINIIKKFPTTTFVDYFMIDLFLAGAFSCLILSSAFHTLKSHSLFVAIYGNKLD 167
           MLL   D+ +I   P+TT  DY +I+LFL    +     +    LK HS +     N+  
Sbjct: 70  MLLFYTDVRLIPSHPSTTMTDYIIINLFLMATTTYFATMTLGQLLKGHSEYQGKLWNQAK 129

Query: 168 YLGIVILIVTSMISILYYGFYDTPYFFHLFSTITILFGIACGTVSLANKFRSREWRPYRA 227
            L +V+L+  S++++LYY F+D  + F LF   T L       V + ++++    R  + 
Sbjct: 130 QLALVLLLTCSIVTLLYYAFFDHVFLFKLFVIWTCLLMSITSIVIINDQYK----RVQKL 185

Query: 228 TLFVCFG-LSAVFPVLTGIWYYGLEDTFK--RIQLKWIVTEGFFYIFGAFLYAMRYPERI 284
           +  V FG LS   P+   I  +GL D++K  RI  + +  E   Y   A L   R PE  
Sbjct: 186 SCVVIFGVLSISLPIAVSIIKFGLFDSYKKQRIPFQVLTWEIVLYSLSAMLQLTRLPELT 245

Query: 285 CPGAFD-LW-----GHSHQIFHVFVVIAAYSHFHGLLSAYEYAH 322
                D  W     G+S Q+  +  + A   HF+ ++ AYE  H
Sbjct: 246 LSTLGDSFWIVDYLGNSDQVSQLVTIFAIIVHFNTIIFAYEVVH 289

>Suva_15.64 Chr15 complement(100035..100973) [939 bp, 312 aa] {ON}
           YOL101C (REAL)
          Length = 312

 Score = 95.9 bits (237), Expect = 6e-22,   Method: Compositional matrix adjust.
 Identities = 97/316 (30%), Positives = 147/316 (46%), Gaps = 46/316 (14%)

Query: 24  EEYTIANDGVKSNKKLVKIIGRFTRQLITITHWDDLPDWQKDNEHIHEGYVKETNSFINC 83
           E+Y+ A   V SN  +       T++      + DL  WQK  ++      K + S    
Sbjct: 19  EKYSDATGAVTSNADVE------TKETKKGFPFHDLAKWQKQYKN------KSSRS---- 62

Query: 84  FESLFFLHNESVNIYSHMVPGLCALFMLLI---DINIIKKFPTTT-FVDYFMIDLFLAGA 139
            ESL  L      IY   + G  + F LLI   D  +I  FPTTT   DY + + +L   
Sbjct: 63  -ESLVAL------IY---LLGSMSSFCLLIFFTDFYLIPLFPTTTTMTDYIVFNFYLLNV 112

Query: 140 FSCLILSSAFHTLKSHSLFVAI-YGNKLDYLGIVILIVTSMISILYYGFYDTPYFFHLFS 198
           F   ++   +H +K+ SL   I    K  YL  + L+++S I+ILYY FYD  +FF +F+
Sbjct: 113 FVFCMIHFIYHFIKNISLQQHIEIWQKFSYLANINLLISSQITILYYLFYDYVFFFKIFT 172

Query: 199 TITILFGIACGTVSLANKFRSREWRPYRATLF------VCFGLSAVFPVLTGIWYY-GLE 251
            +    G+A   V L +K  S  ++ +  T+F      VC  L    P+LT I  + GLE
Sbjct: 173 LLMTFIGLAAYFVILTDKLNS--YKRFNKTVFFISVSVVCCSL----PLLTAIITFDGLE 226

Query: 252 DTFKRIQLKWIVTEGFFYIFGAFLYAMRYPERIC--PGAFDLWGHSHQIFHVFVVIAAYS 309
           +   RI+L  I  E    +  + +Y  R+PE +C      + W HS   FH+ +   A+ 
Sbjct: 227 NLKDRIKLNAITWELVTLVVASMIYVTRFPESLCRRNEKEEGWNHSEYFFHLLISGTAFY 286

Query: 310 HFHGLLSAYEYAHEML 325
           HF  L+ +Y   H  L
Sbjct: 287 HFFILIQSYILMHSSL 302

>Skud_15.53 Chr15 complement(86339..87277) [939 bp, 312 aa] {ON}
           YOL101C (REAL)
          Length = 312

 Score = 87.4 bits (215), Expect = 6e-19,   Method: Compositional matrix adjust.
 Identities = 73/236 (30%), Positives = 117/236 (49%), Gaps = 20/236 (8%)

Query: 104 GLCALFMLLI---DINIIKKFPTTT-FVDYFMIDLFLAGAFSCLILSSAFHTLKSHSLFV 159
           G  + F LLI   D  +I  FPTTT   DY + + +L   F   ++   +H +K+ SL  
Sbjct: 73  GSMSSFCLLIFFTDFYLIPLFPTTTTMTDYIVFNFYLLNVFVFCMVHFVYHFIKNISLQQ 132

Query: 160 AI-YGNKLDYLGIVILIVTSMISILYYGFYDTPYFFHLFSTITILFGIACGTVSLANKFR 218
            + +  K  YL  + L+++S I+ILYY FYD  +FF +F+ +    G+      L +K  
Sbjct: 133 HLEHWQKFSYLSNINLLISSQITILYYLFYDYVFFFKIFTLLMNFIGLVAYFFILTDKLN 192

Query: 219 SREWRPYRATLF------VCFGLSAVFPVLTGIWYY-GLEDTFKRIQLKWIVTEGFFYIF 271
           S   + +  T+F      VC  L    P+LT I  + GLE+  +RI++K I  E    + 
Sbjct: 193 SS--KRFNKTVFFISVSVVCCSL----PLLTAIITFDGLENLKERIKVKAITCELVALVA 246

Query: 272 GAFLYAMRYPERIC--PGAFDLWGHSHQIFHVFVVIAAYSHFHGLLSAYEYAHEML 325
            + +Y  R+PE +       + W HS  +FH+ +   A+ HF  L+ +Y   H  L
Sbjct: 247 ASIIYVTRFPESLFRRNKKEESWNHSEYLFHLVISGTAFYHFFILIQSYILMHSSL 302

>Smik_15.56 Chr15 complement(90083..91021) [939 bp, 312 aa] {ON}
           YOL101C (REAL)
          Length = 312

 Score = 87.0 bits (214), Expect = 8e-19,   Method: Compositional matrix adjust.
 Identities = 80/300 (26%), Positives = 139/300 (46%), Gaps = 28/300 (9%)

Query: 34  KSNKKLVKIIGRFTRQLITITHWDDLPDWQKDNEHIHEGYVKETNSFINCFESLFFLHNE 93
            S  ++   +G  T++      + DL  WQ       E Y  +++             NE
Sbjct: 23  NSTAEINSTVGAKTKETKKGFPFHDLAKWQ-------EQYKNKSS------------RNE 63

Query: 94  SVNIYSHMVPGLCALFMLLI--DINIIKKFPTTT-FVDYFMIDLFLAGAFSCLILSSAFH 150
           SV    +++  + +  +L+   D  +I  FPTTT   DY + + +L   F   ++   +H
Sbjct: 64  SVVALIYLLGSMLSFCLLIFFTDFYLIPLFPTTTTMTDYIVFNFYLLNVFVFCMVHFIYH 123

Query: 151 TLKSHSLFVAI-YGNKLDYLGIVILIVTSMISILYYGFYDTPYFFHLFSTITILFGIACG 209
            +K+ SL   + +  K  YL  + L+++S I+ILYY FYD  +FF +F+ +    G+   
Sbjct: 124 FIKNISLQQHLEHWQKFSYLSNINLLISSQITILYYLFYDYVFFFKIFTLLMNFIGLVAY 183

Query: 210 TVSLANKFRSREWRPYRATLFVCFG-LSAVFPVLTGIWYY-GLEDTFKRIQLKWIVTEGF 267
              L +K  S + R  +   F+    +    P+LT I  + GLE+  +RI++  I  E  
Sbjct: 184 FFILTDKLISSK-RFNKTVFFISVSVICCSLPLLTAIITFDGLENLKERIKVNAITWELV 242

Query: 268 FYIFGAFLYAMRYPERICPGAF--DLWGHSHQIFHVFVVIAAYSHFHGLLSAYEYAHEML 325
             +  + +Y  R+PE    G    + W HS  +FH+ +  AA+ HF  L+ +Y   H  L
Sbjct: 243 ALVAASIIYVTRFPELFLRGKKKEEGWNHSEYLFHLIISGAAFYHFFILIQSYILMHSSL 302

>YOL101C Chr15 complement(126982..127920) [939 bp, 312 aa] {ON}
           IZH4Membrane protein involved in zinc ion homeostasis,
           member of the four-protein IZH family, expression
           induced by fatty acids and altered zinc levels; deletion
           reduces sensitivity to excess zinc; possible role in
           sterol metabolism
          Length = 312

 Score = 82.4 bits (202), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 68/230 (29%), Positives = 112/230 (48%), Gaps = 17/230 (7%)

Query: 107 ALFMLLIDINIIKKFPTTT-FVDYFMIDLFLAGAFSCLILSSAFHTLKSHSLFVAI-YGN 164
            L +   D  +I  FPTTT   DY + + +L   F   ++   +H +K+ SL   + +  
Sbjct: 79  CLLIFFTDFYLIPLFPTTTTMTDYIVFNFYLLNVFVFCMVHFIYHFVKNISLQQHLEHWQ 138

Query: 165 KLDYLGIVILIVTSMISILYYGFYDTPYFFHLFSTITILFGIACGTVSLANKFRSREWRP 224
           K  YL  + L+++S I+ILYY FYD  +FF +F+ +    G+      L +K  S   + 
Sbjct: 139 KFSYLSNINLLISSQITILYYLFYDYVFFFKIFTLLMNFIGLVAYFFILTDKLISS--KR 196

Query: 225 YRATLF------VCFGLSAVFPVLTGIWYY-GLEDTFKRIQLKWIVTEGFFYIFGAFLYA 277
           +  T+F      VC  L    P+LT I  + GLE+  +RI++  I  E    +  + +Y 
Sbjct: 197 FNKTVFFISVSVVCCSL----PLLTAIITFDGLENLKERIKVNAITWELVALVAASIIYV 252

Query: 278 MRYPERIC--PGAFDLWGHSHQIFHVFVVIAAYSHFHGLLSAYEYAHEML 325
            R+PE +       + W HS  +FH+ +   A+ HF  L+ +Y   H  L
Sbjct: 253 TRFPESLFRRNKKEEGWNHSEYLFHLLISGTAFYHFFILIQSYILMHSSL 302

>KAFR0J00670 Chr10 (120378..121907) [1530 bp, 509 aa] {ON} Anc_5.197
           YLR023C
          Length = 509

 Score = 71.6 bits (174), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 74/282 (26%), Positives = 128/282 (45%), Gaps = 38/282 (13%)

Query: 22  TEEEYTIANDGVKSNKKLVKIIGRFTRQLITIT---HWDDLPDWQKDNEHIHEGYVKETN 78
           T +E  ++++ +KS   L+KI G      +  +   H+  LP   ++N +I   Y +  +
Sbjct: 161 TTKEAKLSSEQIKS---LIKIFGYDRAYELGKSEHLHYYQLPFPYRENRYIINNY-RFYD 216

Query: 79  SFINCFESLFFLHNESVNIYSHMVPGLCALFMLLIDINIIKKFPTTTFVDYFMID----- 133
           S      S+F LHNE+ NI+SH++  +  L++L  D+      P +  V   M+      
Sbjct: 217 SHKKSLLSIFKLHNEATNIWSHLLGAIYFLYVLFHDL------PNSIIVSSSMVPTTAKL 270

Query: 134 ---LFLAGAFSCLILSSAFHT------LKSHSLFVAIYGNKLDYLGIVILIVTSMISILY 184
              LF+  +  C++ S+ +HT      LK    F+ +     DY GI ILI +S++SI +
Sbjct: 271 FLYLFVFASLKCMLSSTFYHTFNGTSMLKLRRKFMCV-----DYSGISILITSSILSIQF 325

Query: 185 YGFYDTPYFFHLFSTITILFGIACGTVSLANKFRSREWRPYRATLFVCFGLSAVFPVLTG 244
              YD P     +   + + G+    ++ +  F S E RP R   F+       F +L  
Sbjct: 326 ISLYDYPNILKFYMCASFMLGVLGIFMNWSPLFDSPEARPLRIKFFILLSSCGAFALLHL 385

Query: 245 IWYYGLEDT-FKRIQLKWIVTEG--FFYIFGAFLYAMRYPER 283
           ++   LE + F  I +   +T     +Y+ G   Y    PER
Sbjct: 386 VF---LEKSIFAAIDVLLPLTNKSIVWYLVGVVFYGSFIPER 424

>TPHA0E03120 Chr5 complement(654079..655788) [1710 bp, 569 aa] {ON}
           Anc_5.197 YLR023C
          Length = 569

 Score = 70.9 bits (172), Expect = 8e-13,   Method: Compositional matrix adjust.
 Identities = 69/241 (28%), Positives = 112/241 (46%), Gaps = 19/241 (7%)

Query: 55  HWDDLPDWQKDNEHIHEGYVKETNSFINCFESLFF---LHNESVNIYSHMVPGLCALFML 111
           H+ +LP   ++N++I  GY +  + F     S+F    +HNE+ NI++HM+     +++L
Sbjct: 245 HYYELPFPWRENKYIIHGY-RFHDKFYQLILSVFNWYGVHNETTNIWTHMLAAFYLIYLL 303

Query: 112 LIDINII------KKFPTTTFVDYFMIDLFLAGAFSCLILSSAFHTLK-SHSLFVAIYGN 164
            +D          +  P TT    ++I +FL     C+  S  +HT   + S+ +     
Sbjct: 304 TVDFQKTFIVLDTEHVPATT---KYIIYMFLGAGIKCMFASVFWHTFNGTTSIRLRPKFC 360

Query: 165 KLDYLGIVILIVTSMISILYYGFYDTPYFFHLFSTITILFGIACGTVSLANKFRSREWRP 224
            +DY GI +LI  S++S  Y   YD P     +  ++ +F +    ++ + KF S E RP
Sbjct: 361 CVDYTGITLLISASIMSAEYITLYDYPKAMSFYMILSGIFAVFGLYLNWSPKFDSPEARP 420

Query: 225 YRATLFVCFGLSAVFPVLTGIWYYGLEDTFKRIQLKWIVTEG--FFYIFGAFLYAMRYPE 282
            R   FV   L A    L+ +    LE   + I L   VT     +YI G F Y    PE
Sbjct: 421 LRIKFFV---LLAAVGGLSFVNLVCLEGLSRAIWLFSPVTNKSVIYYIIGVFFYGSFIPE 477

Query: 283 R 283
           R
Sbjct: 478 R 478

>AAL153C Chr1 complement(75086..76345) [1260 bp, 419 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YLR023C
          Length = 419

 Score = 69.7 bits (169), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 88/375 (23%), Positives = 149/375 (39%), Gaps = 85/375 (22%)

Query: 5   SRLQKRNGETIVSSSAV--TEEEYTIANDGVKSNKKLVKIIGRFTRQLITITHWDDLPDW 62
           SR +   G +++ +S    +  ++  A     + ++ +       R L    H+ +LP  
Sbjct: 54  SRGEAGGGRSVLCASGEPGSAHKWAGAVTCSGAEEQPLHWAESRARGLARHLHYWELPYA 113

Query: 63  QKDNEHI---HEGYVKETNSFINCFESLFFLHNESVNIYSHMVPGLCALFMLLI------ 113
            ++N +I   H  Y     S ++   + +  HNE++NI+SH+V G   L  LL       
Sbjct: 114 WRENRYIIYGHRFYHSHRKSLLSVLNA-YGWHNETINIWSHLV-GAAVLAYLLCWGWPRS 171

Query: 114 DINIIKKFPTTTFVDYFMIDLFLAGAFSCLILSSAFHT------LKSHSLFVAIYGNKLD 167
           D+    + P    +  + I  FLA    C+  S A+HT      LK  S FV +     D
Sbjct: 172 DVYRAAQVPR---LAKWAIGAFLACGVKCMASSVAWHTFNGTCHLKLRSRFVCV-----D 223

Query: 168 YLGIVILIVTSMISILYYGFYD-TPYFFHLFSTITILFGIACGTVSLANKFRSREWRPYR 226
           Y GI +L+  S+++ +    Y  +    + +   +I  G A G ++ +  F   E RP R
Sbjct: 224 YTGITLLVTASVVTTVAVTLYGLSRPLMYAYMVASIGLGTAAGVMNWSPHFDRPEARPLR 283

Query: 227 ATLFVCFGLSAVFPV-LTGIWYYGLEDTFKRIQLKW---------IVTEGFFYIFGAFLY 276
             ++V  GL+A+  V    +W          +Q++W         +     +Y  G   Y
Sbjct: 284 IAVYV--GLAALGLVSFVHVW----------MQVRWASAHLMAPLVYKSLVWYGIGVVFY 331

Query: 277 AMRYPER--------ICPGA----------------------FDLW-----GHSHQIFHV 301
           A   PER         C G                       + LW      HSH ++HV
Sbjct: 332 ATLVPERWRSDVTLDCCSGPVHEAACRQFRDLPPVARKDRQFWSLWWVDYFCHSHFLWHV 391

Query: 302 FVVIAAYSHFHGLLS 316
           FVV+    H+  +L 
Sbjct: 392 FVVLGVVGHYRAVLQ 406

>Kpol_2002.94 s2002 (229517..231250) [1734 bp, 577 aa] {ON}
           (229517..231250) [1734 nt, 578 aa]
          Length = 577

 Score = 65.5 bits (158), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 65/240 (27%), Positives = 114/240 (47%), Gaps = 18/240 (7%)

Query: 55  HWDDLPDWQKDNEHIHEGYV---KETNSFINCFESLFFLHNESVNIYSHMVPGLCALFML 111
           H+  LP   ++N +I  GY    K +   ++ F + +  HNE+ NI+SH++  +   +++
Sbjct: 252 HYYQLPFPWRENRYIINGYRFYHKNSKLLLSVF-NWYGFHNETANIWSHLLGAIYFAYIV 310

Query: 112 LIDI--NIIKKFPTTTFVDYFMIDLFLAGAFSCLILSSAFHTLK-SHSLFVAIYGNKLDY 168
           L +   + I + P       +++ LFL     C++ S  +HT   + S+ +      +DY
Sbjct: 311 LFEFPKSFIVQSPEVPPSAKYIVYLFLLAGIKCMLASVFWHTFNGTCSIKLRPKYCCVDY 370

Query: 169 LGIVILIVTSMISILYYGFYDTPYFFHLFSTITILFGIACGTVSLANKFRSREWRPYRAT 228
            GI ILI  S+++  +   YD      ++ ++++LFG     ++ + KF S E RP R  
Sbjct: 371 SGITILITASILTAEFVSLYDHRSIMTVYMSLSLLFGCFGLYLNWSPKFDSPEARPLRIK 430

Query: 229 LFV---CFGLSAVFPV--LTGIWYYGLEDTFKRIQLKWIVTEGFFYIFGAFLYAMRYPER 283
            F+     G  A F V  L G+ Y      +  +  K IV    +Y+ G F Y    PER
Sbjct: 431 FFILLAALGGLAFFHVAYLEGMAYAAW--LYSPVTSKSIV----WYLIGVFFYGSFIPER 484

>TDEL0E04320 Chr5 complement(804655..806007) [1353 bp, 450 aa] {ON}
           Anc_5.197 YLR023C
          Length = 450

 Score = 63.9 bits (154), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 81/329 (24%), Positives = 127/329 (38%), Gaps = 82/329 (24%)

Query: 55  HWDDLPDWQKDNEHIHEGY------VKETNSFINCFESLFFLHNESVNIYSHMVPGLCAL 108
           H+  LP   ++N  I  GY       K   S +N +      HNE+ NI++H+   L  L
Sbjct: 133 HYYQLPFPWRENRFIIHGYRFYDSHYKSLLSIVNWYG----WHNETANIWTHLGGALYVL 188

Query: 109 FMLLIDINIIKKFPTTT--------FVDYFMIDLFLAGAFSCLILSSAFHT------LKS 154
           ++ + D      FP T+         V   ++ +FLA A  C++ S   HT      L  
Sbjct: 189 WLAVYD------FPRTSVWESEQVPMVAKCIVYVFLAAALKCMLASVFGHTFNGTCCLAL 242

Query: 155 HSLFVAIYGNKLDYLGIVILIVTSMISILYYGFYDTPYFFHLFSTITILFGIACGTVSLA 214
            S F  +     DY GI +LI  S+++  +   Y+ P+    +  ++ + GI    ++ +
Sbjct: 243 RSKFACV-----DYSGITMLITASILTTEFVTMYNYPWSLRFYLAVSTVLGIFGVIMNWS 297

Query: 215 NKFRSREWRPYRATLFVCF----GLSAVFPVLTGIWYYG--LEDTFKRIQLKWIVTEGFF 268
            KF   E RP R   F+      GLS +   L G W Y   L        L W +    F
Sbjct: 298 PKFDRPEARPLRIKFFILLAAMGGLSFMQLGLLGGWKYASWLMAPVTHKSLVWYLLGVAF 357

Query: 269 YIFGAFL-------------------------YAMRY------PERICPGAFDLW----- 292
           Y  G+F+                            R+      PE       DLW     
Sbjct: 358 Y--GSFVPERFRTDIVVDKRIPTEQELSTSLEVVTRHKHVHFRPEPTAGARTDLWSLWWV 415

Query: 293 ---GHSHQIFHVFVVIAAYSHFHGLLSAY 318
              G SH  +H+FVV+    H+H ++  +
Sbjct: 416 DYVGCSHSWWHLFVVLGVVGHYHAIIDMF 444

>Smik_12.86 Chr12 complement(172288..173916) [1629 bp, 542 aa] {ON}
           YLR023C (REAL)
          Length = 542

 Score = 62.8 bits (151), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 62/243 (25%), Positives = 108/243 (44%), Gaps = 24/243 (9%)

Query: 55  HWDDLPDWQKDNEHIHEGYV---KETNSFINCFESLFFLHNESVNIYSHMVPGLCALFML 111
           H+  LP   ++N +I  GY      + S ++ F + +  HNE+ NI+SH++  +  +++ 
Sbjct: 216 HYYQLPFPWRENRYIIHGYRFYNTHSKSLLSIF-NWYGWHNETSNIWSHLLGAMYLIYLA 274

Query: 112 LIDI--NIIKKFPTTTFVDYFMIDLFLAGAFSCLILSSAFHT------LKSHSLFVAIYG 163
           + D   + + K P       +++ +FLA A  C++ S  +HT      LK  S F  +  
Sbjct: 275 IYDFPQSEVWKNPKVPPQARWIVFMFLAAALKCMLSSVFWHTFNGTSFLKLRSKFACV-- 332

Query: 164 NKLDYLGIVILIVTSMISILYYGFYDTPYFFHLFSTITILFGIACGTVSLANKFRSREWR 223
              DY GI ILI  S+++  +   Y   +    +  I++  GI    ++ + +F   E R
Sbjct: 333 ---DYSGITILITASILTTEFVTMYSCYWAMCTYMGISLALGIFGVFMNWSPRFDRPEAR 389

Query: 224 PYRATLFVCFGLSAVFPVLTGIWYYGLE---DTFKRIQLKWIVTEGFFYIFGAFLYAMRY 280
           P R   F+      V   L  I+   L      F  +  K +V    +Y+ G   Y    
Sbjct: 390 PLRIRFFILLATMGVLSFLHLIFLTDLRYAARLFSPVTYKSVV----WYLVGVAFYGSFI 445

Query: 281 PER 283
           PER
Sbjct: 446 PER 448

>KLLA0F15510g Chr6 (1433494..1435362) [1869 bp, 622 aa] {ON} some
           similarities with uniprot|Q07959 Saccharomyces
           cerevisiae YLR023C IZH3 Membrane protein involved in
           zinc metabolism member of the four-protein IZH family
           expression induced by zinc deficiency deletion reduces
           sensitivity to elevated zinc and shortens lag phase
           overexpression reduces Zap1p activity
          Length = 622

 Score = 62.4 bits (150), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 73/323 (22%), Positives = 130/323 (40%), Gaps = 63/323 (19%)

Query: 55  HWDDLPDWQKDNEHIHEGY------VKETNSFINCFESLFFLHNESVNIYSHMVPGLCAL 108
           H+ +LP   ++N +I  GY      VK   S +N +      HNE++NI+SH+   +   
Sbjct: 300 HFYELPFPWRENRYIIHGYRFYDSHVKSVLSVVNWYG----WHNETLNIWSHLFGAVYLA 355

Query: 109 FMLLIDINIIKKFPTT--TFVDYFMIDLFLAGAFSCLILSSAFHTLK-SHSLFVAIYGNK 165
           ++L I +   K F +         +I +FL     CL+ SS +HTL  +  L +      
Sbjct: 356 YLLFIQLPTTKVFMSQDVPLFGKLIIQVFLIAGVKCLLSSSVWHTLNGTCCLPLRCKFAC 415

Query: 166 LDYLGIVILIVTSMISILYYGFYDTP-----YFFHLFSTITILFGIACGTVSLANKFRSR 220
           +DY GI +LI  S++S  +   Y+           ++ ++++  GI    ++ + +F   
Sbjct: 416 IDYTGITVLITASILSTEFVSVYNLATQSLSTSMTVYMSLSLCLGIFGSFMNWSPRFDRP 475

Query: 221 EWRPYRATLFVCFGLSAVFPVLTGIWYYGLEDTFKRIQLKWIVTEGFFYIFGAFLYAMRY 280
           E RP+R   +V      +   L      G++ + +  +  W  +   +Y+ G   Y    
Sbjct: 476 ESRPFRIAFYVLLAGLGMISFLHLTISRGIDHSSQFFKPVWNRS-LIWYLIGVVFYGSFI 534

Query: 281 PER----------------ICP-----------------------GAFDLWG-----HSH 296
           PER                +C                        G F LW       SH
Sbjct: 535 PERWRTDVELDYTIPTDAELCSNLDILTKHKHVHFRAVPSKSSRTGFFSLWWVDYFLSSH 594

Query: 297 QIFHVFVVIAAYSHFHGLLSAYE 319
            ++H FV++    H++ LL  +E
Sbjct: 595 TLWHFFVLLGVIGHYNALLDMFE 617

>YLR023C Chr12 complement(185498..187129) [1632 bp, 543 aa] {ON}
           IZH3Membrane protein involved in zinc ion homeostasis,
           member of the four-protein IZH family, expression
           induced by zinc deficiency; deletion reduces sensitivity
           to elevated zinc and shortens lag phase, overexpression
           reduces Zap1p activity
          Length = 543

 Score = 60.5 bits (145), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 59/243 (24%), Positives = 109/243 (44%), Gaps = 24/243 (9%)

Query: 55  HWDDLPDWQKDNEHIHEGYV---KETNSFINCFESLFFLHNESVNIYSHMVPGLCALFML 111
           H+  LP   ++N +I  GY      + S ++ F + +  HNE+ NI+SH++  +  +++ 
Sbjct: 217 HYYQLPFPWRENRYIIHGYRFYNTHSKSLLSIF-NWYGWHNETSNIWSHLLGAIYIIYLA 275

Query: 112 LIDINIIKKFPTTTFVDY--FMIDLFLAGAFSCLILSSAFHT------LKSHSLFVAIYG 163
           + D    + +  +       +++ +FLA A  C++ S  +HT      LK  S F  +  
Sbjct: 276 IYDFPQSEVWRNSQVPPQARWIVFMFLAAALKCMLSSVFWHTFNGTSFLKLRSKFACV-- 333

Query: 164 NKLDYLGIVILIVTSMISILYYGFYDTPYFFHLFSTITILFGIACGTVSLANKFRSREWR 223
              DY GI ILI  S+++  +   Y   +  + + +I++  G+    ++ + +F   E R
Sbjct: 334 ---DYSGITILITASILTTEFVTMYSCYWAMYTYMSISLALGVFGVFMNWSPRFDRPEAR 390

Query: 224 PYRATLFVCFGLSAVFPVLTGIWYYGLE---DTFKRIQLKWIVTEGFFYIFGAFLYAMRY 280
           P R   F+      V   L  I+   L      F  +  K +V    +Y+ G   Y    
Sbjct: 391 PLRIRFFILLATMGVLSFLHLIFLTDLHYAATLFSPVTYKSVV----WYLVGVVFYGSFI 446

Query: 281 PER 283
           PER
Sbjct: 447 PER 449

>Skud_12.91 Chr12 complement(177334..178962) [1629 bp, 542 aa] {ON}
           YLR023C (REAL)
          Length = 542

 Score = 60.5 bits (145), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 62/248 (25%), Positives = 107/248 (43%), Gaps = 34/248 (13%)

Query: 55  HWDDLPDWQKDNEHIHEGY------VKETNSFINCFESLFFLHNESVNIYSHMVPGLCAL 108
           H+  LP   ++N +I  GY       K   S IN +      HNE+ NI+SH++  +  +
Sbjct: 216 HYYQLPFPWRENRYIIHGYRFYNTHSKSLLSIINWYG----WHNETSNIWSHLLGAMYII 271

Query: 109 FMLLIDI--NIIKKFPTTTFVDYFMIDLFLAGAFSCLILSSAFHT------LKSHSLFVA 160
           ++ + D   + + + P       +++ +FLA A  C++ S  +HT      L+  S F  
Sbjct: 272 YLAIYDFPQSEVWRNPNVPQQARWIVFMFLAAALKCMLSSVFWHTFNGTSFLRLRSKFAC 331

Query: 161 IYGNKLDYLGIVILIVTSMISILYYGFYDTPYFFHLFSTITILFGIACGTVSLANKFRSR 220
           +     DY GI ILI  S+++  +   Y   +    +  I++  G+    ++ + +F   
Sbjct: 332 V-----DYSGITILITASILTTEFVTMYSCYWAMCTYMGISLALGVIGVFMNWSPRFDRP 386

Query: 221 EWRPYRATLFVCFGLSAVFP-----VLTGIWYYGLEDTFKRIQLKWIVTEGFFYIFGAFL 275
           E RP R   F+      V        LT I+Y      F  +  K +V    +Y+ G   
Sbjct: 387 EARPLRIRFFILLATMGVLSFLHLIFLTDIYY--ASRLFGPVTYKSVV----WYLVGVVF 440

Query: 276 YAMRYPER 283
           Y    PER
Sbjct: 441 YGSFIPER 448

>NCAS0D02600 Chr4 (499689..501320) [1632 bp, 543 aa] {ON} Anc_5.197
           YLR023C
          Length = 543

 Score = 59.7 bits (143), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 50/163 (30%), Positives = 75/163 (46%), Gaps = 19/163 (11%)

Query: 91  HNESVNIYSHMVPGLCALFMLLID-----INIIKKFPTTTFVDYFMIDLFLAGAFSCLIL 145
           HNE+ NI++H++ GL  ++M + D     I +  K PTT      ++ LFL  A  CL  
Sbjct: 255 HNETSNIWTHLIGGLYLIYMAVYDFPRSEIFLSDKIPTTA---KLIVYLFLFAAIKCLFA 311

Query: 146 SSAFH------TLKSHSLFVAIYGNKLDYLGIVILIVTSMISILYYGFYDTPYFFHLFST 199
           S  +H      TLK  S F  +     DY GI ILI  S+++  +   Y +     ++  
Sbjct: 312 SVFWHSFNGTCTLKLRSKFACV-----DYSGISILITASILTTEFVTLYSSYRAMCVYMA 366

Query: 200 ITILFGIACGTVSLANKFRSREWRPYRATLFVCFGLSAVFPVL 242
           I++  GI    ++ + KF   E RP R   FV      V   L
Sbjct: 367 ISLSLGIFGVFMNWSPKFDRPEARPLRIKFFVLLASMGVLSFL 409

>NDAI0I02330 Chr9 (532412..534148) [1737 bp, 578 aa] {ON} Anc_5.197
          Length = 578

 Score = 59.7 bits (143), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 64/248 (25%), Positives = 109/248 (43%), Gaps = 34/248 (13%)

Query: 55  HWDDLPDWQKDNEHI---HEGYVKETNSFINCFESLFFLHNESVNIYSHMVPGLCALFML 111
           H+  LP   ++N +I   +  Y     S ++ F + +  HNES NI++H++  +  +++ 
Sbjct: 251 HYYQLPFPWRENRYIIYNYRFYDSHKKSLLSIF-NWYGWHNESSNIWTHLLGAIYLIYLS 309

Query: 112 LID-----INIIKKFPTTTFVDYFMIDLFLAGAFSCLILSSAFHT------LKSHSLFVA 160
           + D     I   +K PTT      ++ LFL  A  CL+ S  +HT      LK  S F  
Sbjct: 310 IYDFPNSEIFQSEKVPTTA---KLIVYLFLFAAIKCLLASVFWHTFNGTSFLKLRSKFAC 366

Query: 161 IYGNKLDYLGIVILIVTSMISILYYGFYDTPYFFHLFSTITILFGIACGTVSLANKFRSR 220
           +     DY GI ILI  S+++  +   Y + +   ++ TI++  G+    ++ + KF   
Sbjct: 367 V-----DYSGITILITASILTTEFVTMYSSFFAMCIYMTISLSLGMFGVFMNWSPKFDRP 421

Query: 221 EWRPYRATLFVCFGLSAVFPVLTGIWYYGLEDTFKRIQLKWIVTEG-----FFYIFGAFL 275
           E RP R   F+      V   L   +   L+         W++T        +Y+ G   
Sbjct: 422 EARPLRIKFFILLASMGVLSFLHLTYLTNLQ------YATWLLTPVTNKSIVWYLVGVVF 475

Query: 276 YAMRYPER 283
           Y    PER
Sbjct: 476 YGSFIPER 483

>TBLA0C06050 Chr3 (1468152..1469465) [1314 bp, 437 aa] {ON}
           Anc_5.197 YLR023C
          Length = 437

 Score = 58.5 bits (140), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 84/371 (22%), Positives = 152/371 (40%), Gaps = 75/371 (20%)

Query: 13  ETIVSSSAVTEEEYTIANDGVKSNKKLVKIIGRFTRQLI-------TITHWDDLPDWQKD 65
           E ++S+    E++     D + S K +   I  F  Q            H+  LP   ++
Sbjct: 70  EKLLSTKKSEEQD----PDFIASGKSIRDYINTFNWQTAYNLGRSNNTLHYYQLPFPWRE 125

Query: 66  NEHIHEGYVKETNSFINCFESL---FFLHNESVNIYSHMVPGLCALFMLL-----IDINI 117
           N +I +GY +  +S + C  S+   +  HNE++NI+SH+   L  L++ +      ++  
Sbjct: 126 NRYIIKGY-RFYDSNVKCLLSVVNYYGWHNETLNIWSHLGGFLTLLYIAVFVYPNTEVYQ 184

Query: 118 IKKFPTTTFVDYFMIDLFLAGAFSCLILSSAFHTLK---SHSLFVAIYGNKLDYLGIVIL 174
            +  PTT  +  F   +FL     C++ S  +HT     S++L        +DY GI IL
Sbjct: 185 SELIPTTAKMLLF---VFLIAGMKCMLASVFWHTFDGTCSYTLRPKFCC--VDYTGITIL 239

Query: 175 IVTSMISILYYGFYDTPYFFHLFSTITILFGIACGTVSLANKFRSREWRPYRATLFV--- 231
           I  S+++  Y      P +  ++ ++++  G     ++ + KF   E RP R   FV   
Sbjct: 240 ITASILTAEYVSLSHAPIWMFIYMSLSLALGTFGVYINWSPKFDGPEARPLRIKFFVTLS 299

Query: 232 -------------------CFGLSAVFPVLT-----GIWYYG--LEDTFKR--IQLKWIV 263
                              C+ L+ +    T     G+++YG  + + ++   I  K I 
Sbjct: 300 AMGCLSFVHLIFTTSLRHACWLLAPIISKSTIWYVIGVFFYGSFIPEKYRSDYILDKTIP 359

Query: 264 TEGFFYIFGAFLYAMRY--------PERICP---GAFDLW-----GHSHQIFHVFVVIAA 307
           T        + +   R+        P +  P   G   LW     G SH I+H+FV++  
Sbjct: 360 TSKQLSCDLSIITKDRHIHFRDQPTPNKNGPRKTGLRSLWWVDYVGQSHTIWHIFVLLGV 419

Query: 308 YSHFHGLLSAY 318
             H+   L  +
Sbjct: 420 VGHYKACLDMF 430

>KNAG0B05100 Chr2 (976101..977717) [1617 bp, 538 aa] {ON} Anc_5.197
           YLR023C
          Length = 538

 Score = 58.5 bits (140), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 65/247 (26%), Positives = 107/247 (43%), Gaps = 32/247 (12%)

Query: 55  HWDDLP-DWQKDNEHIH-----EGYVKETNSFINCFESLFFLHNESVNIYSHMVPGLCAL 108
           H+ +LP  W+++   IH     +  VK   S IN +      HNE+ NI+SH +     +
Sbjct: 218 HYYELPFPWRENRYIIHNYRFYDSNVKSLLSAINWYG----WHNETSNIWSHFLGFFYVV 273

Query: 109 FMLLIDI--NIIKKFPTTTFVDYFMIDLFLAGAFSCLILSSAFHT------LKSHSLFVA 160
           ++ + +   +++ +         F++ +FL  A  CLI S+ +HT      LK    F  
Sbjct: 274 YLAVYEFPQSVVFQSDRIPSSAKFVVYIFLFAAMKCLIASAFWHTFNGTAFLKMRRRFAC 333

Query: 161 IYGNKLDYLGIVILIVTSMISILYYGFYDTPYFFHLFSTITILFGIACGTVSLANKFRSR 220
           +     DY GI ILI  S+++  +    D      L+ TI++  GI    ++ + +F + 
Sbjct: 334 V-----DYSGISILITASILTAEFVTLNDHRPMMILYMTISLTLGIIGVFLNCSPQFDTP 388

Query: 221 EWRPYRATLFVCFGLSAVFPVLTG----IWYYGLEDTFKRIQLKWIVTEGFFYIFGAFLY 276
           E RP R   F+      V   +       W Y + D    I  K IV    +Y+ G   Y
Sbjct: 389 EARPLRIRFFMLLAAMGVLSFINASYLESWAYAV-DLLSPITNKSIV----WYLVGVVFY 443

Query: 277 AMRYPER 283
               PER
Sbjct: 444 GSFIPER 450

>Suva_10.104 Chr10 complement(191663..193288) [1626 bp, 541 aa] {ON}
           YLR023C (REAL)
          Length = 541

 Score = 57.8 bits (138), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 62/241 (25%), Positives = 106/241 (43%), Gaps = 20/241 (8%)

Query: 55  HWDDLPDWQKDNEHIHEGY------VKETNSFINCFESLFFLHNESVNIYSHMVPGLCAL 108
           H+  LP   ++N +I  GY       K   S IN +      HNE+ NI++H++  +  +
Sbjct: 216 HYYQLPFPWRENRYIIHGYRFYNTHYKSLLSVINWYG----WHNETSNIWTHLLGAMYIV 271

Query: 109 FMLLIDI--NIIKKFPTTTFVDYFMIDLFLAGAFSCLILSSAFHTLKSHSLFVAIYGN-- 164
           ++ + D   + + + P       +++  FLA A  C++ S  +HT    S F+ +     
Sbjct: 272 YLAVYDFPHSEVWQNPEVPQQARWIVFAFLAAALKCMLSSVFWHTFNGTS-FLGLRSKFA 330

Query: 165 KLDYLGIVILIVTSMISILYYGFYDTPYFFHLFSTITILFGIACGTVSLANKFRSREWRP 224
            +DY GI ILI  S+++  +   Y   +    + TI++  G+    ++ + +F   E RP
Sbjct: 331 CVDYSGITILITASILTTEFVTMYSCYWAMCTYMTISLALGVFGVFMNWSPRFDRPEARP 390

Query: 225 YRATLFVCFGLSAVFPVLTGIWYYGLEDTFKRIQLKWIVTEG--FFYIFGAFLYAMRYPE 282
            R   F+      V   L  I+   L D    I L   VT     +Y+ G   Y    PE
Sbjct: 391 LRIRFFILLATMGVLSFLHLIF---LTDLHYAIWLFSPVTNKSVVWYLVGVVFYGSFIPE 447

Query: 283 R 283
           R
Sbjct: 448 R 448

>Ecym_7109 Chr7 complement(210829..212535) [1707 bp, 568 aa] {ON}
           similar to Ashbya gossypii AAL153C
          Length = 568

 Score = 56.2 bits (134), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 67/282 (23%), Positives = 123/282 (43%), Gaps = 35/282 (12%)

Query: 20  AVTEEEYTIANDGVKS-NKKLVKIIGRFTRQLITITHWDDLPDWQKDNEHI---HEGYVK 75
           A   +  ++A+ G KS +     ++GR  R L    H+ +LP   ++N +I   H  Y  
Sbjct: 210 ATDGDAVSVADGGDKSYSWAKSYMLGR-ARHL----HYYELPQPWRENPYIIYGHRFYHS 264

Query: 76  ETNSFINCFESLFFLHNESVNIYSHMVPGLCALFMLLIDINIIKKFPTTTF--VDYFMID 133
              S ++   +++  HNE++NI+SH+   +  L+++L        F +T    V    I 
Sbjct: 265 HKKSLLSIL-NVYGWHNETINIWSHIAGAIILLYIMLRGFPNSDVFNSTQVPKVAKGAIY 323

Query: 134 LFLAGAFSCLILSSAFHT------LKSHSLFVAIYGNKLDYLGIVILIVTSMISILYYGF 187
           +FL     C++ S  +HT      L   S F  +     DY GI ILI  S+++   +  
Sbjct: 324 VFLLCGIKCMVSSVMWHTFSGTCHLPLRSRFSCV-----DYTGITILITASVMTTEAFTL 378

Query: 188 YD-TPYFFHLFSTITILFGIACGTVSLANKFRSREWRPYRATLFVCFG----LSAVFPVL 242
           Y   P   +L+  I++  G+     + + +F   + R +R   +V       +S V   +
Sbjct: 379 YRLAPKAMYLYMGISLCLGVFAAFTNWSRRFDGPDSRIFRVAFYVILAGLGLISFVHLTV 438

Query: 243 TGIWYYGLEDTFKRIQLKWIVTEGF-FYIFGAFLYAMRYPER 283
              W      +  R+ +  ++ +   +Y+ G   YA   PER
Sbjct: 439 HSDW------SSSRLMITPLINKSIVWYLIGVVFYATLVPER 474

>ZYRO0B10538g Chr2 complement(830311..831906) [1596 bp, 531 aa] {ON}
           some similarities with uniprot|Q07959 Saccharomyces
           cerevisiae YLR023C IZH3 Membrane protein involved in
           zinc metabolism member of the four-protein IZH family
           expression induced by zinc deficiency deletion reduces
           sensitivity to elevated zinc and shortens lag phase
           overexpression reduces Zap1p activity
          Length = 531

 Score = 55.1 bits (131), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 62/242 (25%), Positives = 108/242 (44%), Gaps = 22/242 (9%)

Query: 55  HWDDLPDWQKDNEHIHEGY---VKETNSFINCFESLFFLHNESVNIYSHMVPGLCALFML 111
           H+  LP   ++N++I  GY        SF++   + +  HNE+ NI++H++ GL  +++ 
Sbjct: 206 HYYQLPFPYRENKYIIHGYRFYASHKKSFLSII-NWYGWHNETSNIWTHLLGGLYLIYLA 264

Query: 112 LI-----DINIIKKFPTTTFVDYFMIDLFLAGAFSCLILSSAFHTLK-SHSLFVAIYGNK 165
                  +I +  + P        ++ +FLA A  C+  S  +HT   +H L +      
Sbjct: 265 FYHFPHSNIWLSDRVPKPAKC---IVAVFLAAAIKCMFASVFWHTFNGTHLLRLRSKFAC 321

Query: 166 LDYLGIVILIVTSMISILYYGFYDTPYFFHLFSTITILFGIACGTVSLANKFRSREWRPY 225
           +DY GI ILI  S++++ +   YD       +   ++  GI   +++ + KF   E RP 
Sbjct: 322 VDYTGITILITASILTVEFVTMYDYKISLLFYMICSLALGIIGVSMNWSPKFDRPEARPL 381

Query: 226 RATLFVCFGL----SAVFPVLTGIWYYGLEDTFKRIQLKWIVTEGFFYIFGAFLYAMRYP 281
           R   F+        S +  V    W Y   D    +  K +V    +Y+ G F Y    P
Sbjct: 382 RIKFFILLATVGCSSFIRLVFLTNWRYA-ADLLTPLTNKSVV----WYLIGVFFYGSFIP 436

Query: 282 ER 283
           ER
Sbjct: 437 ER 438

>KNAG0K00670 Chr11 complement(119419..120384) [966 bp, 321 aa] {ON} 
          Length = 321

 Score = 52.0 bits (123), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 33/122 (27%), Positives = 59/122 (48%), Gaps = 10/122 (8%)

Query: 108 LFMLLIDINIIKKFPTTTFVDYFMIDLFLAGAFSCLILSSAFHTLKSHSLFVAIYGNKLD 167
           L +   D+ ++ +  +TT  DY ++++FLA AF C    +A H ++    F    G+ L 
Sbjct: 109 LLVFFTDVYLVPRHVSTTMTDYVLLNVFLATAFQC----AACHMVQ---CFTTTAGSVLS 161

Query: 168 YLGIVILIVTSMISILYYGFYDTPYFFHLFSTIT---ILFGIACGTVSLANKFRSREWRP 224
            + ++     S +++LYY +YD  ++F L +  T    L   A    S A+    R+W  
Sbjct: 162 TITMLNHWACSAVTLLYYSYYDNVFYFKLLALFTANWTLVVAAVTVTSTASNSPKRQWWS 221

Query: 225 YR 226
            R
Sbjct: 222 RR 223

>KLTH0B03498g Chr2 complement(281148..282788) [1641 bp, 546 aa] {ON}
           some similarities with uniprot|Q07959 Saccharomyces
           cerevisiae YLR023C IZH3 Membrane protein involved in
           zinc metabolism member of the four-protein IZH family
           expression induced by zinc deficiency deletion reduces
           sensitivity to elevated zinc and shortens lag phase
           overexpression reduces Zap1p activity
          Length = 546

 Score = 51.2 bits (121), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 64/251 (25%), Positives = 102/251 (40%), Gaps = 35/251 (13%)

Query: 55  HWDDLPDWQKDNEHIHEGYVKETNSFINCFESLFFL---HNESVNIYSHMVPGLCALFML 111
           H+ +LP   ++N  I  GY +  NS+     S+F     HNE+VNI++H+   L   F+ 
Sbjct: 216 HYYELPFPWRENRFIIHGY-RFYNSYSKSLLSIFNWYGWHNETVNIWTHLCGALYFAFL- 273

Query: 112 LIDINIIKKFPTTTF--------VDYFMIDLFLAGAFSCLILSSAFHT------LKSHSL 157
                I K F  TT            FM  +FL     C + S  +HT      LK  S 
Sbjct: 274 -----IFKGFSQTTVYQSELVPTAAKFMAFVFLTAGLECFLFSVVWHTFNGICHLKQRSN 328

Query: 158 FVAIYGNKLDYLGIVILIVTSMIS---ILYYGFYDTPYFFHL--FSTITILFGIACGTVS 212
              +     DY GI +L+  S+++   +   G  D  + + L  F+  +   G     ++
Sbjct: 329 CACV-----DYTGITVLVTASILTTEFVTLSGSSDATFTWSLLFFTGASAALGAVGVFMN 383

Query: 213 LANKFRSREWRPYRATLFVCFGLSAVFPVLTGIWYYGLEDTFKRIQLKWIVTEGFFYIFG 272
            + KF   E RP R   ++       F  L    +    D+   I+  ++ +   +YI G
Sbjct: 384 WSPKFDRPESRPLRIAFYLLLASFGFFSYLHSRLFNTAVDSSDLIKPVFMKSLA-WYIIG 442

Query: 273 AFLYAMRYPER 283
              Y    PER
Sbjct: 443 VVFYGTFIPER 453

>SAKL0G12980g Chr7 complement(1108751..1110442) [1692 bp, 563 aa]
           {ON} some similarities with uniprot|Q07959 Saccharomyces
           cerevisiae YLR023C IZH3 Membrane protein involved in
           zinc metabolism member of the four-protein IZH family
           expression induced by zinc deficiency deletion reduces
           sensitivity to elevated zinc and shortens lag phase
           overexpression reduces Zap1p activity
          Length = 563

 Score = 48.5 bits (114), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 51/201 (25%), Positives = 89/201 (44%), Gaps = 35/201 (17%)

Query: 55  HWDDLPDWQKDNEHIHEGYV---KETNSFINCFESLFFLHNESVNIYSHMVPGLCALFML 111
           H+ +LP   ++N  I  GY      T S ++   + +  HNE+ NI++H+   L   ++ 
Sbjct: 233 HYYELPFPWRENRFIIHGYRFYHSHTKSLLSIL-NWYGWHNETTNIWTHLFGSLYIAYLA 291

Query: 112 LIDINIIKKFPTTT---------FVDYFMIDLFLAGAFSCLILSSAFHTLK-SHSLFVAI 161
             +      FP ++         F  Y M+ LFL   F CL+ S  +HT   +  L +  
Sbjct: 292 FYE------FPQSSVYLSGDVPQFAKY-MVYLFLGAGFKCLVSSVTWHTFNGTCKLHLRS 344

Query: 162 YGNKLDYLGIVILIVTSMIS---ILYYGFYDTPY--------FFHLFSTITILFGIACGT 210
               +DY GI +LI  S+++   +  YG  D P         F+   S++   FG+    
Sbjct: 345 KFACMDYTGITVLITASIMTAEFVSLYGNGDNPNSPVTFSLIFYMAVSSVLCCFGVF--- 401

Query: 211 VSLANKFRSREWRPYRATLFV 231
           ++ + +F   E RP R   ++
Sbjct: 402 MNWSPRFDRPESRPLRIAFYL 422

>Kwal_33.15122 s33 (968885..970585) [1701 bp, 566 aa] {ON} YLR023C -
           Hypothetical ORF [contig 94] FULL
          Length = 566

 Score = 47.4 bits (111), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 60/249 (24%), Positives = 107/249 (42%), Gaps = 31/249 (12%)

Query: 55  HWDDLPDWQKDNEHIHEGYVKETNSFINCFESLFFL---HNESVNIYSHMVPGLCALFML 111
           H+ +LP   ++N  I  GY +  NS+     S+F     HNE+VNI++H+   L   ++L
Sbjct: 236 HYYELPFPWRENRFIIHGY-RFYNSYKKSLLSIFNWYGWHNETVNIWTHLGGALYLAYLL 294

Query: 112 LIDINIIKKF-----PTTTFVDYFMIDLFLAGAFSCLILSSAFHT------LKSHSLFVA 160
               +    +     PT      F   +FL     C + S  +HT      L+  S    
Sbjct: 295 FRGFSQTAVYQSELVPTAAKCMAF---VFLLSGLECFLFSVVWHTFNGICHLQQRSNCAC 351

Query: 161 IYGNKLDYLGIVILIVTSMIS---ILYYGFYDTPYFFHL--FSTITILFGIACGTVSLAN 215
           +     DY GI IL+  S+++   +   G  + P+ + L  F+T + + G+    ++ + 
Sbjct: 352 V-----DYTGITILVTASILTTEFVTLSGAAEAPFTWSLLFFTTTSSILGVIGVYMNWSP 406

Query: 216 KFRSREWRPYRATLFVCFGLSAVFPVLTGIWYYGLEDTFKRIQLKWIVTEGF-FYIFGAF 274
           KF   E RP R   ++       F  L    ++    + + I  K ++++   +Y+ G  
Sbjct: 407 KFDRPESRPLRIAFYLLLASFGFFSYLHSRIFHTSISSSELI--KPVLSKSLAWYLIGVV 464

Query: 275 LYAMRYPER 283
            Y    PER
Sbjct: 465 FYGTFIPER 473

>CAGL0D03322g Chr4 complement(340949..342586) [1638 bp, 545 aa] {ON}
           similar to uniprot|Q07959 Saccharomyces cerevisiae
           YLR023c
          Length = 545

 Score = 44.3 bits (103), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 63/247 (25%), Positives = 105/247 (42%), Gaps = 32/247 (12%)

Query: 55  HWDDLPDWQKDNEHIHEGYVKETNSFINCFESL---FFLHNESVNIYSHMVPGLCALFML 111
           H+ +LP   ++N  I  GY +  NS      S+   +  HNE+ NI++H++ GL  L+++
Sbjct: 215 HYYELPFPWRENRCIINGY-RFYNSHKKSLLSIVNWYGWHNETSNIWTHLLGGLYILYLM 273

Query: 112 LIDINIIKKFPTTTFVDYFMID-----------LFLAGAFSCLILSSAFHTLKSHSLF-V 159
                   +FP++   + FM +           +FL  A  CL  S  +HT    SL  +
Sbjct: 274 FY------QFPSS---EVFMSEQVPKAAKLITYVFLIAAAKCLFSSVFWHTFNGTSLLRL 324

Query: 160 AIYGNKLDYLGIVILIVTSMISILYYGFYDTPYFFHLFSTITILFGIACGTVSLANKFRS 219
                 +DY GI ILI  S+++  +   Y  P+    +  ++   GI    ++ + KF  
Sbjct: 325 RCKFACVDYSGISILITASILTTEFVTMYQCPWAMVSYMALSTALGIFGVFMNWSPKFDR 384

Query: 220 REWRPYRATLFVCFGLSAVFPVLTGIWYYGLEDT---FKRIQLKWIVTEGFFYIFGAFLY 276
            E RP R   F+      +   L   +   L  +      I  K +V    +Y+ G   Y
Sbjct: 385 PEARPLRIKFFILLASMGILSFLHLTFITSLSHSTWLLSPITKKSVV----WYLVGVVFY 440

Query: 277 AMRYPER 283
               PER
Sbjct: 441 GSFIPER 447

>Ecym_3080 Chr3 (149461..150900) [1440 bp, 479 aa] {ON} similar to
           Ashbya gossypii AAR153C
          Length = 479

 Score = 32.0 bits (71), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 16/53 (30%), Positives = 25/53 (47%), Gaps = 9/53 (16%)

Query: 263 VTEGFFYIFGAFLYAMRYPERI---------CPGAFDLWGHSHQIFHVFVVIA 306
           +T G+  ++    Y+ R+P R+           G+   WGHSH+I H F   A
Sbjct: 126 ITAGYHRLWSHRSYSARWPLRLFFAVFGASSVEGSIKWWGHSHRIHHRFTDTA 178

>Kpol_478.17 s478 (61375..62829) [1455 bp, 484 aa] {ON}
           (61375..62829) [1455 nt, 485 aa]
          Length = 484

 Score = 32.0 bits (71), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 22/76 (28%), Positives = 33/76 (43%), Gaps = 13/76 (17%)

Query: 263 VTEGFFYIFGAFLYAMRYPERI---------CPGAFDLWGHSHQIFHVFVVIA--AYSHF 311
           VT G+  ++    Y+ R+P R+           G+   WGHSH+I H +       Y   
Sbjct: 129 VTAGYHRLWSHRAYSARWPLRLFFGIFGSASVQGSIKWWGHSHRIHHRYTDTPRDPYDAR 188

Query: 312 HGLLSAYEYAHEMLIK 327
            GL   Y +   ML+K
Sbjct: 189 QGLW--YSHMGWMLVK 202

>AAR153C Chr1 complement(619953..621389) [1437 bp, 478 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YGL055W
           (OLE1)
          Length = 478

 Score = 31.2 bits (69), Expect = 3.6,   Method: Compositional matrix adjust.
 Identities = 14/50 (28%), Positives = 24/50 (48%), Gaps = 9/50 (18%)

Query: 263 VTEGFFYIFGAFLYAMRYPERI---------CPGAFDLWGHSHQIFHVFV 303
           +T G+  ++    Y+ R+P R+           G+   WGHSH+I H + 
Sbjct: 125 ITAGYHRLWAHRSYSARWPLRVMYALFGASSVEGSIKWWGHSHRIHHRYT 174

>ZYRO0C05016g Chr3 (394581..396032) [1452 bp, 483 aa] {ON} similar
           to uniprot|P21147 Saccharomyces cerevisiae YGL055W OLE1
           Fatty acid desaturase required for monounsaturated fatty
           acid synthesis and for normal distribution of
           mitochondria
          Length = 483

 Score = 31.2 bits (69), Expect = 3.6,   Method: Compositional matrix adjust.
 Identities = 22/85 (25%), Positives = 35/85 (41%), Gaps = 22/85 (25%)

Query: 233 FGLSAVFPVLTG-----IWYYGLEDTFKRIQLKWIVTEGFFYIFGAFLYAMRYPERI--- 284
           F LS   P+  G     ++YY L            +T G+  ++    Y+ R+P R+   
Sbjct: 102 FSLSGKVPLKLGTAVFAVFYYALGGA--------SITAGYHRLWAHRSYSARWPLRLFFA 153

Query: 285 ------CPGAFDLWGHSHQIFHVFV 303
                   G+   WGHSH+I H + 
Sbjct: 154 IFGSASVEGSIKWWGHSHRIHHRYT 178

>KLTH0H06798g Chr8 (596966..598432) [1467 bp, 488 aa] {ON}
           uniprot|P79047 Delta 9-fatty acid desaturase
          Length = 488

 Score = 31.2 bits (69), Expect = 4.1,   Method: Compositional matrix adjust.
 Identities = 14/50 (28%), Positives = 24/50 (48%), Gaps = 9/50 (18%)

Query: 263 VTEGFFYIFGAFLYAMRYPERI---------CPGAFDLWGHSHQIFHVFV 303
           +T G+  ++    Y+ R+P R+           G+   WGHSH+I H + 
Sbjct: 134 ITAGYHRLWSHRAYSARWPLRLFFAIFGAASVEGSIKWWGHSHRIHHRYT 183

>TBLA0C06220 Chr3 (1507690..1509174) [1485 bp, 494 aa] {ON} 
          Length = 494

 Score = 30.8 bits (68), Expect = 5.6,   Method: Compositional matrix adjust.
 Identities = 14/50 (28%), Positives = 24/50 (48%), Gaps = 9/50 (18%)

Query: 263 VTEGFFYIFGAFLYAMRYPERI---------CPGAFDLWGHSHQIFHVFV 303
           +T G+  ++    Y+ R+P R+           G+   WGHSH+I H + 
Sbjct: 137 ITAGYHRLWAHRAYSARWPLRLFFAFFGSANVEGSIKWWGHSHRIHHRYT 186

>NCAS0D03250 Chr4 (608476..609969) [1494 bp, 497 aa] {ON} Anc_6.106
          Length = 497

 Score = 30.4 bits (67), Expect = 6.7,   Method: Compositional matrix adjust.
 Identities = 20/80 (25%), Positives = 33/80 (41%), Gaps = 12/80 (15%)

Query: 233 FGLSAVFPVLTGIWYYGLEDTFKRIQLKWIVTEGFFYIFGAFLYAMRYPERI-------- 284
           F LS   PV   +  + L   F  +     +T G+  ++    +  R+P R+        
Sbjct: 114 FALSGKVPVRKNVVLFAL---FYYVASGITITAGYHRLWSHRAFEARWPLRLFFAILGAA 170

Query: 285 -CPGAFDLWGHSHQIFHVFV 303
              G+   WGHSH+I H + 
Sbjct: 171 NVQGSIKWWGHSHRIHHRYT 190

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.330    0.143    0.453 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 35,068,975
Number of extensions: 1543103
Number of successful extensions: 5299
Number of sequences better than 10.0: 92
Number of HSP's gapped: 5363
Number of HSP's successfully gapped: 95
Length of query: 327
Length of database: 53,481,399
Length adjustment: 110
Effective length of query: 217
Effective length of database: 40,868,139
Effective search space: 8868386163
Effective search space used: 8868386163
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.8 bits)
S2: 66 (30.0 bits)