Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
TPHA0M002806.23ON30330316270.0
Kpol_1061.27singletonON30630012401e-173
Kpol_385.5singletonON30630012301e-171
KAFR0A050806.23ON31129110841e-149
KNAG0D02240singletonON35929410861e-148
SAKL0E01342g6.23ON34129410761e-147
KNAG0M011906.23ON38029110751e-146
TDEL0G044606.23ON36929410721e-146
NCAS0H008406.23ON36029810671e-146
NCAS0D021706.23ON31029510501e-144
ZYRO0C07722g6.23ON37329810491e-143
CAGL0F01815gsingletonON31429410351e-141
NDAI0C026206.23ON31129210221e-139
KNAG0K01400singletonON30930110221e-139
NDAI0D008306.23ON37430110231e-139
KLLA0D01243g6.23ON31129810111e-138
KAFR0G026806.23ON38329410001e-135
CAGL0I08151gsingletonON3822949981e-135
Kwal_56.224396.23ON3203019881e-134
KLTH0C11154g6.23ON3052959601e-130
Skud_12.1528.256ON1220154722.0
Skud_5.1087.154ON1338133712.2
YEL015W (EDC3)1.442ON55163693.5
Smik_5.1237.154ON1366156685.2
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= TPHA0M00280
         (303 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

TPHA0M00280 Chr13 complement(55778..56689) [912 bp, 303 aa] {ON}...   631   0.0  
Kpol_1061.27 s1061 (79476..80396) [921 bp, 306 aa] {ON} (79476.....   482   e-173
Kpol_385.5 s385 (12788..13708) [921 bp, 306 aa] {ON} (12788..137...   478   e-171
KAFR0A05080 Chr1 complement(1009747..1010682) [936 bp, 311 aa] {...   422   e-149
KNAG0D02240 Chr4 complement(385803..386882) [1080 bp, 359 aa] {O...   422   e-148
SAKL0E01342g Chr5 (101847..102872) [1026 bp, 341 aa] {ON} conser...   419   e-147
KNAG0M01190 Chr13 complement(216456..217598) [1143 bp, 380 aa] {...   418   e-146
TDEL0G04460 Chr7 (809440..810549) [1110 bp, 369 aa] {ON}              417   e-146
NCAS0H00840 Chr8 complement(153671..154753) [1083 bp, 360 aa] {O...   415   e-146
NCAS0D02170 Chr4 complement(403949..404881) [933 bp, 310 aa] {ON...   409   e-144
ZYRO0C07722g Chr3 (585947..587068) [1122 bp, 373 aa] {ON} conser...   408   e-143
CAGL0F01815g Chr6 complement(179470..180414) [945 bp, 314 aa] {O...   403   e-141
NDAI0C02620 Chr3 (608649..609584) [936 bp, 311 aa] {ON} Anc_6.23      398   e-139
KNAG0K01400 Chr11 complement(280379..281308) [930 bp, 309 aa] {O...   398   e-139
NDAI0D00830 Chr4 complement(188085..189209) [1125 bp, 374 aa] {O...   398   e-139
KLLA0D01243g Chr4 complement(108848..109783) [936 bp, 311 aa] {O...   394   e-138
KAFR0G02680 Chr7 (553335..554486) [1152 bp, 383 aa] {ON} Anc_6.23     389   e-135
CAGL0I08151g Chr9 (793917..795065) [1149 bp, 382 aa] {ON} highly...   389   e-135
Kwal_56.22439 s56 complement(129210..130172) [963 bp, 320 aa] {O...   385   e-134
KLTH0C11154g Chr3 (916374..917291) [918 bp, 305 aa] {ON} conserv...   374   e-130
Skud_12.152 Chr12 complement(279947..283609) [3663 bp, 1220 aa] ...    32   2.0  
Skud_5.108 Chr5 complement(165061..169077) [4017 bp, 1338 aa] {O...    32   2.2  
YEL015W Chr5 (126629..128284) [1656 bp, 551 aa] {ON}  EDC3Non-es...    31   3.5  
Smik_5.123 Chr5 complement(172159..176259) [4101 bp, 1366 aa] {O...    31   5.2  

>TPHA0M00280 Chr13 complement(55778..56689) [912 bp, 303 aa] {ON}
           Anc_6.23
          Length = 303

 Score =  631 bits (1627), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 303/303 (100%), Positives = 303/303 (100%)

Query: 1   MSQNTRSILKHFIAQEQAEGVGARVRRSIGTAKMRKFSPFLMLDHFNVIPPAGFPDHPHH 60
           MSQNTRSILKHFIAQEQAEGVGARVRRSIGTAKMRKFSPFLMLDHFNVIPPAGFPDHPHH
Sbjct: 1   MSQNTRSILKHFIAQEQAEGVGARVRRSIGTAKMRKFSPFLMLDHFNVIPPAGFPDHPHH 60

Query: 61  GQETITYVRKGMVAHEDFTGSKGILRPGDLQFMTAGKAVCHSEMPVLMENGEILDGLQLW 120
           GQETITYVRKGMVAHEDFTGSKGILRPGDLQFMTAGKAVCHSEMPVLMENGEILDGLQLW
Sbjct: 61  GQETITYVRKGMVAHEDFTGSKGILRPGDLQFMTAGKAVCHSEMPVLMENGEILDGLQLW 120

Query: 121 VDLPTNLKNTEPRYRDLHKENIPIAKPDENLEIEVISGKSYGIESVKDLAYTPVDFYVYK 180
           VDLPTNLKNTEPRYRDLHKENIPIAKPDENLEIEVISGKSYGIESVKDLAYTPVDFYVYK
Sbjct: 121 VDLPTNLKNTEPRYRDLHKENIPIAKPDENLEIEVISGKSYGIESVKDLAYTPVDFYVYK 180

Query: 181 ARKKGSAFTQDFSRDYNVFLYIVKGSVAIGNEVFPQHSSIFFNTDGDNVQGIVGSDDTEF 240
           ARKKGSAFTQDFSRDYNVFLYIVKGSVAIGNEVFPQHSSIFFNTDGDNVQGIVGSDDTEF
Sbjct: 181 ARKKGSAFTQDFSRDYNVFLYIVKGSVAIGNEVFPQHSSIFFNTDGDNVQGIVGSDDTEF 240

Query: 241 AIIGGQILRQETVQHGPFVEETVEKLVKVFHNYESYTGGFERALNWRSSIRNGIDESQAA 300
           AIIGGQILRQETVQHGPFVEETVEKLVKVFHNYESYTGGFERALNWRSSIRNGIDESQAA
Sbjct: 241 AIIGGQILRQETVQHGPFVEETVEKLVKVFHNYESYTGGFERALNWRSSIRNGIDESQAA 300

Query: 301 NHK 303
           NHK
Sbjct: 301 NHK 303

>Kpol_1061.27 s1061 (79476..80396) [921 bp, 306 aa] {ON}
           (79476..80396) [921 nt, 307 aa]
          Length = 306

 Score =  482 bits (1240), Expect = e-173,   Method: Compositional matrix adjust.
 Identities = 222/300 (74%), Positives = 262/300 (87%)

Query: 3   QNTRSILKHFIAQEQAEGVGARVRRSIGTAKMRKFSPFLMLDHFNVIPPAGFPDHPHHGQ 62
           QN RSI KHFI++EQ+EGVGARVRRSIGT  +RKFSPFLMLDHFNV P AGFPDHPHHGQ
Sbjct: 5   QNLRSIFKHFISREQSEGVGARVRRSIGTMLLRKFSPFLMLDHFNVAPGAGFPDHPHHGQ 64

Query: 63  ETITYVRKGMVAHEDFTGSKGILRPGDLQFMTAGKAVCHSEMPVLMENGEILDGLQLWVD 122
           ETITYV +GM+AHEDFTG KG+L  GDLQFMTAGKA+CH+EMPV   +GE + GLQLWVD
Sbjct: 65  ETITYVNEGMIAHEDFTGCKGVLGKGDLQFMTAGKAICHAEMPVQSNSGEHVVGLQLWVD 124

Query: 123 LPTNLKNTEPRYRDLHKENIPIAKPDENLEIEVISGKSYGIESVKDLAYTPVDFYVYKAR 182
           LPT++KNTEPRYRDL  ++IP A P ++LEIEVISG SYG++SVKDLAYTP+DFY+Y+ +
Sbjct: 125 LPTDMKNTEPRYRDLRNKDIPRANPTDDLEIEVISGNSYGVDSVKDLAYTPIDFYMYRGK 184

Query: 183 KKGSAFTQDFSRDYNVFLYIVKGSVAIGNEVFPQHSSIFFNTDGDNVQGIVGSDDTEFAI 242
           K G+ FTQ FSRD+NVF+Y++KG+V IG++VFPQ+SSIFFNTDGD V G V +DDTEFAI
Sbjct: 185 KAGTEFTQKFSRDFNVFIYVLKGAVNIGDQVFPQYSSIFFNTDGDAVGGTVAADDTEFAI 244

Query: 243 IGGQILRQETVQHGPFVEETVEKLVKVFHNYESYTGGFERALNWRSSIRNGIDESQAANH 302
           IGG+IL QETVQHGPFVEET EKL+KVF++Y+SY+ GFERA NWRSSIR+GI E  A NH
Sbjct: 245 IGGKILDQETVQHGPFVEETKEKLIKVFYDYQSYSNGFERARNWRSSIRDGIKEDDAPNH 304

>Kpol_385.5 s385 (12788..13708) [921 bp, 306 aa] {ON} (12788..13708)
           [921 nt, 307 aa]
          Length = 306

 Score =  478 bits (1230), Expect = e-171,   Method: Compositional matrix adjust.
 Identities = 217/300 (72%), Positives = 263/300 (87%)

Query: 3   QNTRSILKHFIAQEQAEGVGARVRRSIGTAKMRKFSPFLMLDHFNVIPPAGFPDHPHHGQ 62
           QN RSI KHFIA+EQAEGVGARVRRSIGT  +RKFSPFLMLDHFNV P AGFPDHPHHGQ
Sbjct: 5   QNLRSIFKHFIAREQAEGVGARVRRSIGTMLLRKFSPFLMLDHFNVAPGAGFPDHPHHGQ 64

Query: 63  ETITYVRKGMVAHEDFTGSKGILRPGDLQFMTAGKAVCHSEMPVLMENGEILDGLQLWVD 122
           ETITYV +GM+AHEDFTG KG+L  GDLQFMTAGKA+CH+EMPV   +GE + GLQLWVD
Sbjct: 65  ETITYVNEGMIAHEDFTGCKGVLYKGDLQFMTAGKAICHAEMPVQSNSGEHVVGLQLWVD 124

Query: 123 LPTNLKNTEPRYRDLHKENIPIAKPDENLEIEVISGKSYGIESVKDLAYTPVDFYVYKAR 182
           LPT++KNTEPRYRDL  + IP A P ++LE+EVISG SYG++SVKDLAYTP+DFY+Y+ +
Sbjct: 125 LPTDMKNTEPRYRDLKNKEIPRANPTDDLEVEVISGNSYGVDSVKDLAYTPIDFYMYRGK 184

Query: 183 KKGSAFTQDFSRDYNVFLYIVKGSVAIGNEVFPQHSSIFFNTDGDNVQGIVGSDDTEFAI 242
           K G+ FTQ+FSRD+NVF+Y+++G++ IG++VFPQ+SSIFFNTDGD V G + +D+TEFAI
Sbjct: 185 KAGTEFTQNFSRDFNVFIYVLQGAITIGDQVFPQYSSIFFNTDGDAVGGTIAADNTEFAI 244

Query: 243 IGGQILRQETVQHGPFVEETVEKLVKVFHNYESYTGGFERALNWRSSIRNGIDESQAANH 302
           IGG+IL Q+TVQHGPFVEET EKL+KVF++Y+SY+ GFERA NW+SSIR+GI E+ A NH
Sbjct: 245 IGGKILDQQTVQHGPFVEETKEKLIKVFYDYQSYSNGFERARNWKSSIRDGIKENDAPNH 304

>KAFR0A05080 Chr1 complement(1009747..1010682) [936 bp, 311 aa] {ON}
           Anc_6.23
          Length = 311

 Score =  422 bits (1084), Expect = e-149,   Method: Compositional matrix adjust.
 Identities = 194/291 (66%), Positives = 239/291 (82%)

Query: 6   RSILKHFIAQEQAEGVGARVRRSIGTAKMRKFSPFLMLDHFNVIPPAGFPDHPHHGQETI 65
           R+I KHF+A EQ EGVGARVRRS+G+ + R F+PFL+LDHF V  PAGFPDHPHHGQETI
Sbjct: 11  RTINKHFVAVEQEEGVGARVRRSVGSMRQRNFTPFLLLDHFTVSHPAGFPDHPHHGQETI 70

Query: 66  TYVRKGMVAHEDFTGSKGILRPGDLQFMTAGKAVCHSEMPVLMENGEILDGLQLWVDLPT 125
           TYVR GM+AHEDFTGSKGILRPGDLQFMTAGK + HSE+PVLMENG+   GLQLWVDLP 
Sbjct: 71  TYVRNGMIAHEDFTGSKGILRPGDLQFMTAGKGIMHSEIPVLMENGDAGVGLQLWVDLPQ 130

Query: 126 NLKNTEPRYRDLHKENIPIAKPDENLEIEVISGKSYGIESVKDLAYTPVDFYVYKARKKG 185
            +K+ EPRYR+L    IPI +P+E+L+++VISG+SYG+ESVK+LAYTPVDFY + + KKG
Sbjct: 131 EMKDCEPRYRNLRGGEIPIVEPNEHLKVKVISGRSYGVESVKELAYTPVDFYHFISNKKG 190

Query: 186 SAFTQDFSRDYNVFLYIVKGSVAIGNEVFPQHSSIFFNTDGDNVQGIVGSDDTEFAIIGG 245
           + F Q    ++N FLY++KGSV IG+E FPQ+S+IFFN DG+ ++G+V  DDTEFAIIGG
Sbjct: 191 TDFVQQTPENFNFFLYVMKGSVKIGDETFPQYSTIFFNADGNGIKGVVSDDDTEFAIIGG 250

Query: 246 QILRQETVQHGPFVEETVEKLVKVFHNYESYTGGFERALNWRSSIRNGIDE 296
            IL Q  +QHGPF+E T EKL++VF N++    GFERA+ W+SSIRNGI E
Sbjct: 251 LILDQPVIQHGPFIESTREKLIEVFQNFQYGINGFERAVGWKSSIRNGILE 301

>KNAG0D02240 Chr4 complement(385803..386882) [1080 bp, 359 aa] {ON} 
          Length = 359

 Score =  422 bits (1086), Expect = e-148,   Method: Compositional matrix adjust.
 Identities = 198/294 (67%), Positives = 233/294 (79%)

Query: 6   RSILKHFIAQEQAEGVGARVRRSIGTAKMRKFSPFLMLDHFNVIPPAGFPDHPHHGQETI 65
           RSI  HFI +E AEGVGARV+RS+G+ + R+F+PFLMLD F V  P+GFPDHPHHGQETI
Sbjct: 61  RSIANHFIPREVAEGVGARVKRSVGSMQQRRFTPFLMLDDFTVKSPSGFPDHPHHGQETI 120

Query: 66  TYVRKGMVAHEDFTGSKGILRPGDLQFMTAGKAVCHSEMPVLMENGEILDGLQLWVDLPT 125
           TYV  G++AHEDFTGSKG+LRPGDLQFMTAGK + HSEMPV ME+G    GLQLWVDLP 
Sbjct: 121 TYVIDGLIAHEDFTGSKGVLRPGDLQFMTAGKGIVHSEMPVEMEDGRPARGLQLWVDLPK 180

Query: 126 NLKNTEPRYRDLHKENIPIAKPDENLEIEVISGKSYGIESVKDLAYTPVDFYVYKARKKG 185
           +LKN EPRYR+L  E+IP+ KP ENLE+ VISGKSYG ESVKDLAYTP+DFY   A K G
Sbjct: 181 DLKNCEPRYRNLRSEDIPVVKPHENLEVRVISGKSYGTESVKDLAYTPIDFYYMLASKAG 240

Query: 186 SAFTQDFSRDYNVFLYIVKGSVAIGNEVFPQHSSIFFNTDGDNVQGIVGSDDTEFAIIGG 245
           + F Q+   D+N FLY++KGSV I  +VF Q+++IFF+TDG+ V G  GSDDTEFAIIGG
Sbjct: 241 TEFAQEIPSDFNAFLYVMKGSVVINEKVFKQNTAIFFDTDGEGVAGQAGSDDTEFAIIGG 300

Query: 246 QILRQETVQHGPFVEETVEKLVKVFHNYESYTGGFERALNWRSSIRNGIDESQA 299
           +IL Q  VQHGPFVE   EKL + F NYE YT GFERA  WRS I +GI+ES+A
Sbjct: 301 KILDQPLVQHGPFVETDQEKLYEAFMNYEGYTKGFERAKGWRSDIASGINESEA 354

>SAKL0E01342g Chr5 (101847..102872) [1026 bp, 341 aa] {ON} conserved
           hypothetical protein
          Length = 341

 Score =  419 bits (1076), Expect = e-147,   Method: Compositional matrix adjust.
 Identities = 190/294 (64%), Positives = 236/294 (80%)

Query: 6   RSILKHFIAQEQAEGVGARVRRSIGTAKMRKFSPFLMLDHFNVIPPAGFPDHPHHGQETI 65
           R+I KHF+A EQ+EGVGARVRRSIGT ++R F+PFLMLDHFNV PPAGFPDHPHHGQETI
Sbjct: 41  RTIYKHFVAVEQSEGVGARVRRSIGTTQLRNFTPFLMLDHFNVTPPAGFPDHPHHGQETI 100

Query: 66  TYVRKGMVAHEDFTGSKGILRPGDLQFMTAGKAVCHSEMPVLMENGEILDGLQLWVDLPT 125
           TYV  GM+AHEDFTGSKG+LRPGDLQFMTAGK + HSE+PV ME+GE   GLQLWVDLP 
Sbjct: 101 TYVLGGMMAHEDFTGSKGVLRPGDLQFMTAGKGIVHSEIPVKMESGEPTVGLQLWVDLPE 160

Query: 126 NLKNTEPRYRDLHKENIPIAKPDENLEIEVISGKSYGIESVKDLAYTPVDFYVYKARKKG 185
            LKN EPRYRDL     PIA+P +NL++ VISG+SYG++S  +LAYTPV FY + + KKG
Sbjct: 161 RLKNCEPRYRDLRGAETPIAEPHQNLKVRVISGESYGVQSRSELAYTPVHFYHFISSKKG 220

Query: 186 SAFTQDFSRDYNVFLYIVKGSVAIGNEVFPQHSSIFFNTDGDNVQGIVGSDDTEFAIIGG 245
           + F Q F  D+NVF+Y++KGS+ + ++ FPQ+S+IFF  DG+ V+GI  SDDTEFA++GG
Sbjct: 221 TPFEQKFPEDFNVFMYVLKGSLTLNSKNFPQYSAIFFKNDGEGVEGIAASDDTEFALVGG 280

Query: 246 QILRQETVQHGPFVEETVEKLVKVFHNYESYTGGFERALNWRSSIRNGIDESQA 299
            IL Q  VQHGPFVE + E++++VF +Y+    GFERA NW+SSI +GI +  A
Sbjct: 281 SILEQPVVQHGPFVETSKERMIQVFQDYQFGMNGFERAHNWKSSISDGISQQNA 334

>KNAG0M01190 Chr13 complement(216456..217598) [1143 bp, 380 aa] {ON}
           Anc_6.23
          Length = 380

 Score =  418 bits (1075), Expect = e-146,   Method: Compositional matrix adjust.
 Identities = 193/291 (66%), Positives = 241/291 (82%)

Query: 6   RSILKHFIAQEQAEGVGARVRRSIGTAKMRKFSPFLMLDHFNVIPPAGFPDHPHHGQETI 65
           R+I KHFIA EQ EGVGARVRRS+G+ + R FSPFL+LDHF V  PAGFPDHPHHGQETI
Sbjct: 76  RTIQKHFIAGEQEEGVGARVRRSVGSMRQRNFSPFLLLDHFTVSHPAGFPDHPHHGQETI 135

Query: 66  TYVRKGMVAHEDFTGSKGILRPGDLQFMTAGKAVCHSEMPVLMENGEILDGLQLWVDLPT 125
           TYVR+GM+AHEDF GSKG+LRPGDLQFMTAGK + HSE+PVLMENG+   GLQLWVDLP 
Sbjct: 136 TYVREGMIAHEDFLGSKGVLRPGDLQFMTAGKGIMHSEIPVLMENGDAGVGLQLWVDLPK 195

Query: 126 NLKNTEPRYRDLHKENIPIAKPDENLEIEVISGKSYGIESVKDLAYTPVDFYVYKARKKG 185
           ++K+  PRYR+L    IPIA+P+E+L+I+VISGKS+GI+SVK+LAYTPVDFY Y + KKG
Sbjct: 196 DMKDCAPRYRNLRGTEIPIAEPNEHLKIKVISGKSHGIDSVKELAYTPVDFYHYISDKKG 255

Query: 186 SAFTQDFSRDYNVFLYIVKGSVAIGNEVFPQHSSIFFNTDGDNVQGIVGSDDTEFAIIGG 245
           + F Q+   ++NVFLY++KG+V I  +VFPQ+S++F+N +GD ++G+V  DDTEFAIIGG
Sbjct: 256 TGFVQEVPTNFNVFLYVMKGAVKIDGQVFPQYSTVFYNANGDAIRGMVDDDDTEFAIIGG 315

Query: 246 QILRQETVQHGPFVEETVEKLVKVFHNYESYTGGFERALNWRSSIRNGIDE 296
            IL Q  +QHGPFVE T EK+++VF N++    GFERA+ W+SSIRNGI E
Sbjct: 316 LILDQPVIQHGPFVETTREKIIEVFQNFQYGINGFERAVGWKSSIRNGILE 366

>TDEL0G04460 Chr7 (809440..810549) [1110 bp, 369 aa] {ON} 
          Length = 369

 Score =  417 bits (1072), Expect = e-146,   Method: Compositional matrix adjust.
 Identities = 188/294 (63%), Positives = 237/294 (80%)

Query: 6   RSILKHFIAQEQAEGVGARVRRSIGTAKMRKFSPFLMLDHFNVIPPAGFPDHPHHGQETI 65
           RSI+K+F+A +Q EGVGA VRRSIGT +MR+FSPFLMLDHF V PPAGFPDHPHHGQETI
Sbjct: 65  RSIIKNFVATQQEEGVGATVRRSIGTMQMRRFSPFLMLDHFTVSPPAGFPDHPHHGQETI 124

Query: 66  TYVRKGMVAHEDFTGSKGILRPGDLQFMTAGKAVCHSEMPVLMENGEILDGLQLWVDLPT 125
           TY+  GM+AHEDF+ SKGIL PGDLQFMTAGKA+ HSE+PV M++G+   GLQLWVDLP 
Sbjct: 125 TYMLGGMLAHEDFSNSKGILSPGDLQFMTAGKAIIHSEIPVKMDSGQPAVGLQLWVDLPE 184

Query: 126 NLKNTEPRYRDLHKENIPIAKPDENLEIEVISGKSYGIESVKDLAYTPVDFYVYKARKKG 185
            LKN EPRYRDL  ++IP+ KP E+L++ VISG SYG++S +DLAYTPV +Y +   KKG
Sbjct: 185 KLKNCEPRYRDLKAKDIPVIKPSEHLKVTVISGTSYGVQSARDLAYTPVHYYHFATSKKG 244

Query: 186 SAFTQDFSRDYNVFLYIVKGSVAIGNEVFPQHSSIFFNTDGDNVQGIVGSDDTEFAIIGG 245
           + F Q+F R +N F+YI+KGS+ IG ++FPQ S++FF+TDGD V+G   SD+ EF +IGG
Sbjct: 245 TEFVQEFPRVFNAFMYILKGSIGIGEKLFPQFSTVFFDTDGDAVEGFSASDNAEFVLIGG 304

Query: 246 QILRQETVQHGPFVEETVEKLVKVFHNYESYTGGFERALNWRSSIRNGIDESQA 299
           +IL Q+ VQHGPFVE   E+L++VFHNY++   GF+R  NWRS+I  GI ES+A
Sbjct: 305 EILHQDVVQHGPFVETNRERLIEVFHNYQNSINGFDRGRNWRSTIAGGITESEA 358

>NCAS0H00840 Chr8 complement(153671..154753) [1083 bp, 360 aa] {ON}
           Anc_6.23
          Length = 360

 Score =  415 bits (1067), Expect = e-146,   Method: Compositional matrix adjust.
 Identities = 188/298 (63%), Positives = 233/298 (78%)

Query: 2   SQNTRSILKHFIAQEQAEGVGARVRRSIGTAKMRKFSPFLMLDHFNVIPPAGFPDHPHHG 61
           SQ  RSILKHFIA+EQ+EG GA VRRS+G+ +M +FSPFLMLD F V PP GFPDHPHHG
Sbjct: 58  SQKERSILKHFIAEEQSEGDGATVRRSVGSYQMTRFSPFLMLDDFKVTPPEGFPDHPHHG 117

Query: 62  QETITYVRKGMVAHEDFTGSKGILRPGDLQFMTAGKAVCHSEMPVLMENGEILDGLQLWV 121
           QETITYV  G++AHEDFTGSKG+L PGDLQFMTAGK + H EMPV M +  +  GLQ WV
Sbjct: 118 QETITYVTGGILAHEDFTGSKGVLYPGDLQFMTAGKGIVHCEMPVTMNDSAVSTGLQFWV 177

Query: 122 DLPTNLKNTEPRYRDLHKENIPIAKPDENLEIEVISGKSYGIESVKDLAYTPVDFYVYKA 181
           DLP +LKN EPRYR+L  + IP+ + ++NL ++VISGKSY +ESVKDLAYTP+DFY + +
Sbjct: 178 DLPADLKNCEPRYRNLRADTIPVVQVNDNLNVKVISGKSYDVESVKDLAYTPIDFYYFIS 237

Query: 182 RKKGSAFTQDFSRDYNVFLYIVKGSVAIGNEVFPQHSSIFFNTDGDNVQGIVGSDDTEFA 241
            K G+ F Q+   D+N F+Y+ KG++ IG EVF  HSS+FF TDG+ ++G   SD+TEFA
Sbjct: 238 NKAGTEFAQEIPPDFNAFIYVTKGAITIGEEVFKVHSSVFFQTDGNFIRGFTASDNTEFA 297

Query: 242 IIGGQILRQETVQHGPFVEETVEKLVKVFHNYESYTGGFERALNWRSSIRNGIDESQA 299
           +IGG+IL Q+ VQHGPFVE T EKL++VF NY +   GFE+AL W+SSI NGIDE  A
Sbjct: 298 VIGGKILDQQVVQHGPFVETTREKLIEVFDNYRAGINGFEKALGWKSSISNGIDEQTA 355

>NCAS0D02170 Chr4 complement(403949..404881) [933 bp, 310 aa] {ON}
           Anc_6.23
          Length = 310

 Score =  409 bits (1050), Expect = e-144,   Method: Compositional matrix adjust.
 Identities = 189/295 (64%), Positives = 229/295 (77%)

Query: 2   SQNTRSILKHFIAQEQAEGVGARVRRSIGTAKMRKFSPFLMLDHFNVIPPAGFPDHPHHG 61
           S   RS+LK F+A EQ EGVGA VRRSIG+ K R FSPFL++D+F V  PAGFPDHPHHG
Sbjct: 4   SMQFRSVLKSFVAIEQEEGVGAHVRRSIGSMKQRNFSPFLLMDNFTVSHPAGFPDHPHHG 63

Query: 62  QETITYVRKGMVAHEDFTGSKGILRPGDLQFMTAGKAVCHSEMPVLMENGEILDGLQLWV 121
           QETITYV KGM+AHEDFTGS+G+LRPGDLQFMTAGKA+ HSE+PV M NG+   G+QLWV
Sbjct: 64  QETITYVLKGMIAHEDFTGSRGVLRPGDLQFMTAGKAIMHSEIPVQMNNGDAGIGIQLWV 123

Query: 122 DLPTNLKNTEPRYRDLHKENIPIAKPDENLEIEVISGKSYGIESVKDLAYTPVDFYVYKA 181
           DLP  LKN EPRYR+L    IPI KP+++L + V+SGKSYG+ESVKDLAYTP+D+Y    
Sbjct: 124 DLPKKLKNCEPRYRNLRATEIPIVKPNDDLTVRVVSGKSYGVESVKDLAYTPIDYYFMNT 183

Query: 182 RKKGSAFTQDFSRDYNVFLYIVKGSVAIGNEVFPQHSSIFFNTDGDNVQGIVGSDDTEFA 241
           +K G+ F Q+F  D+NVFLYI+KGSV I + V PQ+S+IFF TDGD ++G   S+DTEF 
Sbjct: 184 KKTGTEFVQEFPADFNVFLYIIKGSVKINDTVHPQYSTIFFKTDGDAIKGCSASEDTEFV 243

Query: 242 IIGGQILRQETVQHGPFVEETVEKLVKVFHNYESYTGGFERALNWRSSIRNGIDE 296
           ++GGQIL Q  +QHGPFVE   E L++VF NY+    GFERA  WRS I +GI E
Sbjct: 244 LVGGQILDQPIIQHGPFVESDRESLLEVFKNYQYCINGFERARGWRSRIADGIHE 298

>ZYRO0C07722g Chr3 (585947..587068) [1122 bp, 373 aa] {ON} conserved
           hypothetical protein
          Length = 373

 Score =  408 bits (1049), Expect = e-143,   Method: Compositional matrix adjust.
 Identities = 190/298 (63%), Positives = 235/298 (78%)

Query: 2   SQNTRSILKHFIAQEQAEGVGARVRRSIGTAKMRKFSPFLMLDHFNVIPPAGFPDHPHHG 61
           S + RS+LK+FIA EQ EGVGARVRRSIGT KMR+F PFLMLD F V PPAGFPDHPHHG
Sbjct: 70  SISVRSVLKNFIAIEQEEGVGARVRRSIGTMKMRRFPPFLMLDDFFVKPPAGFPDHPHHG 129

Query: 62  QETITYVRKGMVAHEDFTGSKGILRPGDLQFMTAGKAVCHSEMPVLMENGEILDGLQLWV 121
           QETITY  KGM+AHEDFTGSKG+L PGDLQFMTAGK + HSE+PV +E+G   +GLQLWV
Sbjct: 130 QETITYNLKGMIAHEDFTGSKGVLFPGDLQFMTAGKGIVHSEIPVSLEDGSASNGLQLWV 189

Query: 122 DLPTNLKNTEPRYRDLHKENIPIAKPDENLEIEVISGKSYGIESVKDLAYTPVDFYVYKA 181
           DLP  LKN EPRYRDL K+  P  K ++NL + VISGKSYG++SV++LAYTPV FY +  
Sbjct: 190 DLPAELKNCEPRYRDLRKKQTPEVKVNDNLTVRVISGKSYGVDSVQELAYTPVHFYHFIT 249

Query: 182 RKKGSAFTQDFSRDYNVFLYIVKGSVAIGNEVFPQHSSIFFNTDGDNVQGIVGSDDTEFA 241
            KKG+ F Q+F +D+NVF YI+KGS+A+ ++VFP+HS++FF+TDG+ V G   SDD EF 
Sbjct: 250 SKKGTEFAQEFPKDFNVFFYILKGSLAVNDQVFPEHSAVFFDTDGEGVAGTSVSDDAEFV 309

Query: 242 IIGGQILRQETVQHGPFVEETVEKLVKVFHNYESYTGGFERALNWRSSIRNGIDESQA 299
           +IGG+IL QE +QHGPFVE + E+++ VF NY+    GFE A +W S I  GI E++A
Sbjct: 310 LIGGKILDQEVLQHGPFVETSRERMIDVFRNYQYGMNGFENAHSWDSKIAGGISEAEA 367

>CAGL0F01815g Chr6 complement(179470..180414) [945 bp, 314 aa] {ON}
           similar to KLLA0D01243g Kluyveromyces lactis and
           DEHA0E07447g Debaryomyces hansenii
          Length = 314

 Score =  403 bits (1035), Expect = e-141,   Method: Compositional matrix adjust.
 Identities = 186/294 (63%), Positives = 232/294 (78%)

Query: 6   RSILKHFIAQEQAEGVGARVRRSIGTAKMRKFSPFLMLDHFNVIPPAGFPDHPHHGQETI 65
           RSI KHF+  EQ EGVGARVRRS+GT K R FSPFLMLD F V  PAGFPDHPHHGQETI
Sbjct: 5   RSIQKHFMTFEQEEGVGARVRRSVGTMKQRMFSPFLMLDDFYVKHPAGFPDHPHHGQETI 64

Query: 66  TYVRKGMVAHEDFTGSKGILRPGDLQFMTAGKAVCHSEMPVLMENGEILDGLQLWVDLPT 125
           TYV  GMVAHEDFTG+KG+L  GDLQFMTAGK + HSE+PV ME+GE   GLQ WVDLP 
Sbjct: 65  TYVLNGMVAHEDFTGAKGVLGKGDLQFMTAGKGIVHSEIPVQMESGEACHGLQFWVDLPK 124

Query: 126 NLKNTEPRYRDLHKENIPIAKPDENLEIEVISGKSYGIESVKDLAYTPVDFYVYKARKKG 185
           +LK  EPRYR+L  + IP+ +P+ENL ++VISGKSYG++SV+DLAYTP+  Y Y   K G
Sbjct: 125 DLKWCEPRYRNLRGDKIPVVRPNENLTVKVISGKSYGVDSVRDLAYTPIHMYHYLTNKAG 184

Query: 186 SAFTQDFSRDYNVFLYIVKGSVAIGNEVFPQHSSIFFNTDGDNVQGIVGSDDTEFAIIGG 245
           + + Q+F +++NVF+Y++KG V++G++VFP+H+++FFNTDGD V+G   +DD +FAI+GG
Sbjct: 185 TQWEQEFPKNFNVFMYVMKGKVSVGDQVFPEHTAVFFNTDGDAVKGEFATDDAQFAIMGG 244

Query: 246 QILRQETVQHGPFVEETVEKLVKVFHNYESYTGGFERALNWRSSIRNGIDESQA 299
           QIL Q+T+QHGPFVE   E L+KVF NY+    GFERA  W+SSI +GI E Q 
Sbjct: 245 QILDQQTIQHGPFVETDRESLMKVFMNYQYGINGFERAKGWQSSIIHGITEKQV 298

>NDAI0C02620 Chr3 (608649..609584) [936 bp, 311 aa] {ON} Anc_6.23
          Length = 311

 Score =  398 bits (1022), Expect = e-139,   Method: Compositional matrix adjust.
 Identities = 190/292 (65%), Positives = 230/292 (78%), Gaps = 1/292 (0%)

Query: 6   RSILKHFIAQEQAEGVGARVRRSIGTAKMRKFSPFLMLDHFNVIPPAGFPDHPHHGQETI 65
           RS+ K+FIA EQ EGVGA VRRSIG+ K R FSPFL++DHF V  PAGFPDHPHHGQETI
Sbjct: 8   RSVAKNFIAIEQEEGVGAHVRRSIGSMKQRNFSPFLLMDHFTVSHPAGFPDHPHHGQETI 67

Query: 66  TYVRKGMVAHEDFTGSKGILRPGDLQFMTAGKAVCHSEMPVLMENGEILDGLQLWVDLPT 125
           TYV  GM+AHEDFTGSKG+LRPGDLQFMTAGKA+ HSE+PV MENG    G+QLWV LP 
Sbjct: 68  TYVLNGMIAHEDFTGSKGVLRPGDLQFMTAGKAIMHSEIPVKMENGTPGIGIQLWVALPI 127

Query: 126 NLKNTEPRYRDLHKENIPIAKPDENLEIEVISGKSYGIESVKDLAYTPVDFYVYKARKKG 185
           +LKN+EPRYR+L  + IPI KP+ENL + VISGKSYG ESVKDLAYTP+D+Y++   KKG
Sbjct: 128 DLKNSEPRYRNLRGDKIPIIKPNENLTVRVISGKSYGTESVKDLAYTPIDYYIFNMNKKG 187

Query: 186 SAFTQDFSRDYNVFLYIVKGSVAIGNEVFPQHSSIFFNTDGDNVQGIVGSD-DTEFAIIG 244
             F Q+  R++N FLYI KG+V I   V+P++S++FF+TDGD+++G   +D +TEFAIIG
Sbjct: 188 VEFFQETPRNFNFFLYITKGAVEINGVVYPKYSTVFFDTDGDSIKGKSAADEETEFAIIG 247

Query: 245 GQILRQETVQHGPFVEETVEKLVKVFHNYESYTGGFERALNWRSSIRNGIDE 296
           G IL Q  +QHGPFVE   E L++VF NY+    GFERA  WRSSI +GI E
Sbjct: 248 GLILDQPILQHGPFVETDRESLLQVFKNYQYCINGFERARGWRSSIADGILE 299

>KNAG0K01400 Chr11 complement(280379..281308) [930 bp, 309 aa] {ON} 
          Length = 309

 Score =  398 bits (1022), Expect = e-139,   Method: Compositional matrix adjust.
 Identities = 184/301 (61%), Positives = 235/301 (78%)

Query: 1   MSQNTRSILKHFIAQEQAEGVGARVRRSIGTAKMRKFSPFLMLDHFNVIPPAGFPDHPHH 60
           M+Q  RS+ K F A EQAEGVGA VRRSIG  + R FSPFL+LDHF V  P+GFPDHPHH
Sbjct: 1   MAQVFRSVQKAFRALEQAEGVGALVRRSIGVRRQRNFSPFLLLDHFTVSHPSGFPDHPHH 60

Query: 61  GQETITYVRKGMVAHEDFTGSKGILRPGDLQFMTAGKAVCHSEMPVLMENGEILDGLQLW 120
           GQETITY+++GM+AHEDFTGSKGILRPGDLQFMTAGK + HSE+PVL ++ +   GLQLW
Sbjct: 61  GQETITYIQQGMIAHEDFTGSKGILRPGDLQFMTAGKGIVHSEIPVLTKDAKAAVGLQLW 120

Query: 121 VDLPTNLKNTEPRYRDLHKENIPIAKPDENLEIEVISGKSYGIESVKDLAYTPVDFYVYK 180
           VDLP N+K+  PRYR+L    IPIA+P+E+L+++VISGKSYG+ESVK+LAYTPVDFY Y 
Sbjct: 121 VDLPKNMKDCPPRYRNLRASEIPIAQPNEHLKVKVISGKSYGVESVKELAYTPVDFYHYI 180

Query: 181 ARKKGSAFTQDFSRDYNVFLYIVKGSVAIGNEVFPQHSSIFFNTDGDNVQGIVGSDDTEF 240
           + K+G  F Q+   +YN FLY+++GSV +  + +PQ+S+IF+N +G+ ++G+ G  +TEF
Sbjct: 181 SDKEGINFVQEIPENYNAFLYVMEGSVVVDGQEYPQYSTIFYNANGNAIKGVTGEKNTEF 240

Query: 241 AIIGGQILRQETVQHGPFVEETVEKLVKVFHNYESYTGGFERALNWRSSIRNGIDESQAA 300
           AII G IL Q+ VQHGPFVE + EK+ +VF NY+    GFE+A+NW SSI NGI E    
Sbjct: 241 AIIAGLILDQDIVQHGPFVETSPEKMKEVFRNYQWGINGFEKAINWESSIINGITEKDIT 300

Query: 301 N 301
           N
Sbjct: 301 N 301

>NDAI0D00830 Chr4 complement(188085..189209) [1125 bp, 374 aa] {ON}
           Anc_6.23
          Length = 374

 Score =  398 bits (1023), Expect = e-139,   Method: Compositional matrix adjust.
 Identities = 188/301 (62%), Positives = 234/301 (77%), Gaps = 3/301 (0%)

Query: 2   SQNTRSILKHFIAQEQAEGVGARVRRSIGTAKMRKFSPFLMLDHFNVIPP-AGFPDHPHH 60
           + + R+ILK+FI  EQ+EGVGARVRR+IGT +M +F PFLMLDHF V PP  GFPDHPHH
Sbjct: 69  TDDARTILKYFIPDEQSEGVGARVRRAIGTNEMPRFPPFLMLDHFKVTPPEQGFPDHPHH 128

Query: 61  GQETITYVRKGMVAHEDFTGSKGILRPGDLQFMTAGKAVCHSEMPVLMENGEILDGLQLW 120
           GQETITY+  GM+AHEDFTGSKG+LRPGDLQFMTAGK + HSEMPVLM++G    GLQLW
Sbjct: 129 GQETITYILDGMIAHEDFTGSKGVLRPGDLQFMTAGKGIVHSEMPVLMKDGRPGIGLQLW 188

Query: 121 VDLPTNLKNTEPRYRDLHKENIPIAKPDE--NLEIEVISGKSYGIESVKDLAYTPVDFYV 178
           VDLP  LKN EPRYR+L K  IPI   D+  ++ ++VISG +YG++SV+DLAYTP+ FY 
Sbjct: 189 VDLPRELKNCEPRYRNLRKNEIPIVHTDDEKHMTVKVISGNAYGVDSVRDLAYTPIHFYH 248

Query: 179 YKARKKGSAFTQDFSRDYNVFLYIVKGSVAIGNEVFPQHSSIFFNTDGDNVQGIVGSDDT 238
           Y + K G  F Q    D+NVFLY++KG+V I +++F Q++++FFN DG +++G   ++DT
Sbjct: 249 YISDKAGVEFKQSVPDDFNVFLYVMKGAVVIDDQIFKQNTAVFFNVDGHSIKGQSATNDT 308

Query: 239 EFAIIGGQILRQETVQHGPFVEETVEKLVKVFHNYESYTGGFERALNWRSSIRNGIDESQ 298
           EFAIIGG+IL Q  VQHGPFVE T E L KVF NY+    GFERA+NWRSSI +GIDE  
Sbjct: 309 EFAIIGGKILDQPLVQHGPFVETTREDLYKVFENYQQGINGFERAVNWRSSIADGIDEDT 368

Query: 299 A 299
           A
Sbjct: 369 A 369

>KLLA0D01243g Chr4 complement(108848..109783) [936 bp, 311 aa] {ON}
           conserved hypothetical protein
          Length = 311

 Score =  394 bits (1011), Expect = e-138,   Method: Compositional matrix adjust.
 Identities = 177/298 (59%), Positives = 232/298 (77%)

Query: 5   TRSILKHFIAQEQAEGVGARVRRSIGTAKMRKFSPFLMLDHFNVIPPAGFPDHPHHGQET 64
            RS+LKHF+A EQ+EG GA V+RSIGT +MR F PFLMLD+F+V PPAGFP+HPHHGQET
Sbjct: 9   VRSVLKHFVAIEQSEGAGALVKRSIGTIQMRNFPPFLMLDNFDVSPPAGFPEHPHHGQET 68

Query: 65  ITYVRKGMVAHEDFTGSKGILRPGDLQFMTAGKAVCHSEMPVLMENGEILDGLQLWVDLP 124
           ITYV +GM+AHEDFTGSKG+LR GDLQFMTAGKA+ HSE+PV M+NGE   GLQLWVDLP
Sbjct: 69  ITYVLRGMMAHEDFTGSKGVLRSGDLQFMTAGKAIVHSEIPVKMDNGESTQGLQLWVDLP 128

Query: 125 TNLKNTEPRYRDLHKENIPIAKPDENLEIEVISGKSYGIESVKDLAYTPVDFYVYKARKK 184
            ++KN EPRYRDL +E IP+A P +NL ++VISG+SYG++S+ +LAYTPV+FY + A KK
Sbjct: 129 NDIKNVEPRYRDLRREEIPLATPSDNLIVKVISGESYGVKSLTELAYTPVEFYHFIANKK 188

Query: 185 GSAFTQDFSRDYNVFLYIVKGSVAIGNEVFPQHSSIFFNTDGDNVQGIVGSDDTEFAIIG 244
            + F Q FS D++ F+YI+KGS++I ++ +P+ S+IFF  DGD ++G   SD+ EFAII 
Sbjct: 189 NTEFAQPFSDDFSSFIYIMKGSISISDQEYPESSAIFFKNDGDGIRGFTTSDNAEFAIIA 248

Query: 245 GQILRQETVQHGPFVEETVEKLVKVFHNYESYTGGFERALNWRSSIRNGIDESQAANH 302
           G+   Q+ VQ+GPFVE + E +V V  NY++   GFE A  W   I+NG+ E++   +
Sbjct: 249 GKYFNQKVVQYGPFVESSRENIVDVIQNYQNGVNGFENARTWSPVIKNGVTEAEVQQY 306

>KAFR0G02680 Chr7 (553335..554486) [1152 bp, 383 aa] {ON} Anc_6.23
          Length = 383

 Score =  389 bits (1000), Expect = e-135,   Method: Compositional matrix adjust.
 Identities = 178/294 (60%), Positives = 228/294 (77%)

Query: 6   RSILKHFIAQEQAEGVGARVRRSIGTAKMRKFSPFLMLDHFNVIPPAGFPDHPHHGQETI 65
           RSI+ HFI  E  EG GARV+RSIG+ + R+F+PFLMLD F+V PPAGFPDHPHHGQETI
Sbjct: 85  RSIINHFIPNETFEGDGARVKRSIGSHEQRRFAPFLMLDDFDVTPPAGFPDHPHHGQETI 144

Query: 66  TYVRKGMVAHEDFTGSKGILRPGDLQFMTAGKAVCHSEMPVLMENGEILDGLQLWVDLPT 125
           TYV  GM+AHEDFTG  GIL PGDLQFMTAG+ + HSE+PV MENG    GLQLWVDLP 
Sbjct: 145 TYVLSGMIAHEDFTGLNGILSPGDLQFMTAGRGIVHSEIPVTMENGGSCRGLQLWVDLPQ 204

Query: 126 NLKNTEPRYRDLHKENIPIAKPDENLEIEVISGKSYGIESVKDLAYTPVDFYVYKARKKG 185
           +LK  EPRYR+L   +IPIA P ENL++ VISGKSY +ES+ DLAYTPV  Y +   K G
Sbjct: 205 DLKTIEPRYRNLRAADIPIAMPYENLKVYVISGKSYDVESLNDLAYTPVHLYHFVTIKAG 264

Query: 186 SAFTQDFSRDYNVFLYIVKGSVAIGNEVFPQHSSIFFNTDGDNVQGIVGSDDTEFAIIGG 245
           + F Q+F +D+NVFLY++KG+V I  ++F ++++IFF+ DG++++G   +DD+EF ++GG
Sbjct: 265 TPFIQEFPKDFNVFLYVIKGAVLINEKIFKENTAIFFDVDGESIEGQFATDDSEFVLVGG 324

Query: 246 QILRQETVQHGPFVEETVEKLVKVFHNYESYTGGFERALNWRSSIRNGIDESQA 299
           +IL Q  VQ GPFVE   +KL++VF ++ESY  GFERA NW S+IR GI E++A
Sbjct: 325 EILNQPVVQQGPFVETDKQKLMQVFDDFESYRNGFERAENWESNIRKGIKEAEA 378

>CAGL0I08151g Chr9 (793917..795065) [1149 bp, 382 aa] {ON} highly
           similar to KLLA0D01243g Kluyveromyces lactis and
           DEHA0E07447g Debaryomyces hansenii and YALI0E33297g
           Yarrowia lipolytica and CA2891|CaIFS4 Candida albicans
          Length = 382

 Score =  389 bits (998), Expect = e-135,   Method: Compositional matrix adjust.
 Identities = 179/294 (60%), Positives = 224/294 (76%)

Query: 6   RSILKHFIAQEQAEGVGARVRRSIGTAKMRKFSPFLMLDHFNVIPPAGFPDHPHHGQETI 65
           RSIL HFIA EQ EGVGARVRRS+GT +MR+F+PFLMLD F V PP GFPDHPHHGQETI
Sbjct: 83  RSILTHFIAGEQEEGVGARVRRSVGTYQMRRFTPFLMLDDFTVAPPNGFPDHPHHGQETI 142

Query: 66  TYVRKGMVAHEDFTGSKGILRPGDLQFMTAGKAVCHSEMPVLMENGEILDGLQLWVDLPT 125
           TYV  GM+AHED TGSKG+L  GDLQFMTAGK + HSE+PV  ++G+   GLQLWVDLP+
Sbjct: 143 TYVTDGMIAHEDITGSKGVLLKGDLQFMTAGKGIVHSEIPVTTKDGKPCRGLQLWVDLPS 202

Query: 126 NLKNTEPRYRDLHKENIPIAKPDENLEIEVISGKSYGIESVKDLAYTPVDFYVYKARKKG 185
           ++KN +PRYR+L     P+A P+ENLE+ VISGKSYG+ES++DLAYTPV  Y + A K G
Sbjct: 203 DMKNIDPRYRNLRGNETPVAYPNENLEVRVISGKSYGVESLRDLAYTPVHLYHFLANKTG 262

Query: 186 SAFTQDFSRDYNVFLYIVKGSVAIGNEVFPQHSSIFFNTDGDNVQGIVGSDDTEFAIIGG 245
           + F QD   D+NVF+Y++KGS+ + +      SS FF+ DG+ ++G   S+D +FAII G
Sbjct: 263 TEFVQDIPEDFNVFIYVMKGSIQVNDVELTTFSSAFFDVDGNAIRGKALSEDAQFAIIAG 322

Query: 246 QILRQETVQHGPFVEETVEKLVKVFHNYESYTGGFERALNWRSSIRNGIDESQA 299
           +IL QE +QHGPFVE   EKL++VF NY+    GFE A +WRSSI +GI E +A
Sbjct: 323 RILDQEVIQHGPFVETNREKLMEVFRNYQEEKNGFENAHSWRSSIHDGISEEEA 376

>Kwal_56.22439 s56 complement(129210..130172) [963 bp, 320 aa] {ON}
           [contig 185] FULL
          Length = 320

 Score =  385 bits (988), Expect = e-134,   Method: Compositional matrix adjust.
 Identities = 177/301 (58%), Positives = 229/301 (76%)

Query: 1   MSQNTRSILKHFIAQEQAEGVGARVRRSIGTAKMRKFSPFLMLDHFNVIPPAGFPDHPHH 60
           + +  RSILK+F A EQ+EGVGA+VRRSIGT K+R F+PFLMLDHF + PPAGFPDHPHH
Sbjct: 14  LMKKARSILKYFTALEQSEGVGAKVRRSIGTQKLRNFTPFLMLDHFTIAPPAGFPDHPHH 73

Query: 61  GQETITYVRKGMVAHEDFTGSKGILRPGDLQFMTAGKAVCHSEMPVLMENGEILDGLQLW 120
           GQET+T++ +G VAHEDFTGSKG+LR GDLQFMTAGK   HSE+PV +E+G+  +G+QLW
Sbjct: 74  GQETVTHILRGAVAHEDFTGSKGVLRAGDLQFMTAGKGTVHSEIPVQLESGDPTEGIQLW 133

Query: 121 VDLPTNLKNTEPRYRDLHKENIPIAKPDENLEIEVISGKSYGIESVKDLAYTPVDFYVYK 180
           VDLP  LK+ +PRYRDL ++ IP A+    L I VISG+SYG++S+++LAYT V +Y Y 
Sbjct: 134 VDLPARLKDCQPRYRDLKRDRIPTARSKNGLNISVISGQSYGVDSIQELAYTSVHYYHYV 193

Query: 181 ARKKGSAFTQDFSRDYNVFLYIVKGSVAIGNEVFPQHSSIFFNTDGDNVQGIVGSDDTEF 240
             +   +F Q F  D+NVFLY++KG + I  + F +HSSIFF TDG +V G  GS+D EF
Sbjct: 194 FSEANISFEQVFPTDFNVFLYVLKGRLNIAGQEFSKHSSIFFKTDGSHVSGFSGSNDLEF 253

Query: 241 AIIGGQILRQETVQHGPFVEETVEKLVKVFHNYESYTGGFERALNWRSSIRNGIDESQAA 300
            + GGQIL Q  VQ+GPFVE + E++++VF NY+S T GFE+A  W SSI NGI ES  +
Sbjct: 254 ILAGGQILDQPIVQYGPFVETSKERMMEVFQNYQSGTNGFEKAAGWTSSIANGIVESDIS 313

Query: 301 N 301
           +
Sbjct: 314 D 314

>KLTH0C11154g Chr3 (916374..917291) [918 bp, 305 aa] {ON} conserved
           hypothetical protein
          Length = 305

 Score =  374 bits (960), Expect = e-130,   Method: Compositional matrix adjust.
 Identities = 179/295 (60%), Positives = 226/295 (76%)

Query: 6   RSILKHFIAQEQAEGVGARVRRSIGTAKMRKFSPFLMLDHFNVIPPAGFPDHPHHGQETI 65
           RSILK+F A EQ+EGVGA+VRRSIG+ ++R F+PFLMLDHFNV PPAGFPDHPHHGQETI
Sbjct: 5   RSILKYFTALEQSEGVGAKVRRSIGSQELRNFTPFLMLDHFNVSPPAGFPDHPHHGQETI 64

Query: 66  TYVRKGMVAHEDFTGSKGILRPGDLQFMTAGKAVCHSEMPVLMENGEILDGLQLWVDLPT 125
           TYV  GM+AHEDFTGS+G+LRPGDLQFMTAGK + HSE+PV +E+G    GLQLWVDLP 
Sbjct: 65  TYVLGGMIAHEDFTGSRGVLRPGDLQFMTAGKGIIHSEIPVELESGAPSVGLQLWVDLPM 124

Query: 126 NLKNTEPRYRDLHKENIPIAKPDENLEIEVISGKSYGIESVKDLAYTPVDFYVYKARKKG 185
           +LK+ EPRYRDL    IP  +P   LE+ VISG+SYG+ S+ +LAYTPV FY Y  RK G
Sbjct: 125 HLKDCEPRYRDLLNNEIPSVQPKAGLEVRVISGESYGVGSMSELAYTPVHFYHYITRKPG 184

Query: 186 SAFTQDFSRDYNVFLYIVKGSVAIGNEVFPQHSSIFFNTDGDNVQGIVGSDDTEFAIIGG 245
           + F Q F  ++NVF+Y++KGSV +  + F Q+SS+FFNTDG  V+G   S+++EF +IGG
Sbjct: 185 TTFEQHFPSNFNVFMYVLKGSVIVNGKTFAQYSSVFFNTDGSRVEGSGSSEESEFILIGG 244

Query: 246 QILRQETVQHGPFVEETVEKLVKVFHNYESYTGGFERALNWRSSIRNGIDESQAA 300
           ++L Q  +Q+GPFVE + + + +V  NY+S T GFERA  W SSI  G+  S  A
Sbjct: 245 EVLDQPILQYGPFVETSKQNMYEVIGNYQSGTNGFERAQGWSSSIARGVVFSDVA 299

>Skud_12.152 Chr12 complement(279947..283609) [3663 bp, 1220 aa]
           {ON} YLR084C (REAL)
          Length = 1220

 Score = 32.3 bits (72), Expect = 2.0,   Method: Composition-based stats.
 Identities = 35/154 (22%), Positives = 71/154 (46%), Gaps = 25/154 (16%)

Query: 164 ESVKDLAYTPVDFYVYKARKKGSAFTQDFSRDYNVFLYIVKGSVAIGNEVFPQHSSIFFN 223
           ES     Y P++  +   +   ++ T + ++  N  L +     A+ N  +P +SS+F +
Sbjct: 594 ESANTKEYIPLNGVLQYQKSNFTSTTSNETKIGNTTLNVF----AVDN--YPNNSSLFAD 647

Query: 224 TDGDNVQGIVGSDDTEFAIIGGQ-----ILRQETVQHGPF--VEETVEKLVKVFHNYES- 275
           T+GD +  I+G  +   +IIG       +L ++ +  G    + +T + L+ +F +  S 
Sbjct: 648 TNGDRL--ILGGTNNHISIIGLNDNLEVVLSEKQIIQGDVHGMTQTSQGLL-IFGDLLSS 704

Query: 276 --------YTGGFERALNWRSSIRNGIDESQAAN 301
                   + G FE   N+  ++ + I+ S A N
Sbjct: 705 NNQSSVLLFNGSFENVFNYSRTVNSAINISLANN 738

>Skud_5.108 Chr5 complement(165061..169077) [4017 bp, 1338 aa] {ON}
            YER008C (REAL)
          Length = 1338

 Score = 32.0 bits (71), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 32/133 (24%), Positives = 60/133 (45%), Gaps = 15/133 (11%)

Query: 97   KAVCHSEMPVLMENGEILDGLQLWVDLPTNLKNTEPRYRDLHKENIPIAKPDENLE-IEV 155
            +A+    + +   NGEIL  +   VDLP +LKN+E   R   K  + I + D + E IE+
Sbjct: 1065 QALYFERISIATTNGEILPAI---VDLPVDLKNSEDLVRST-KSLMKIKETDRSYESIEL 1120

Query: 156  ISG--KSYGIESVKDLAYTPVDFYVYKARKKGSAFTQDFSRDYNVFLYIVKGSVAIGNEV 213
            +S   +   I + + +A+   +  +  +    +A   D+ +  ++ +          N +
Sbjct: 1121 MSSSFRKLSIAATQSIAHKDGNSSINPSLSDSAALNNDYMQTISLLVN--------SNWL 1172

Query: 214  FPQHSSIFFNTDG 226
                S + FN DG
Sbjct: 1173 IEMLSMLNFNKDG 1185

>YEL015W Chr5 (126629..128284) [1656 bp, 551 aa] {ON}
           EDC3Non-essential conserved protein of unknown function,
           plays a role in mRNA decapping by specifically affecting
           the function of the decapping enzyme Dcp1p; localizes to
           cytoplasmic mRNA processing bodies
          Length = 551

 Score = 31.2 bits (69), Expect = 3.5,   Method: Compositional matrix adjust.
 Identities = 21/63 (33%), Positives = 33/63 (52%), Gaps = 1/63 (1%)

Query: 123 LPTNLKNTEPRYRDLHKENIPIAKPDENLEIEVISGKSYGIESVKDLAYTPVDFYVYKAR 182
           LP   K T  R ++  K+NIP+A P + LE+E I+ + + I S   L    V+   +  +
Sbjct: 264 LPAANKQTTIRSKNT-KQNIPMATPVQLLEMESITSEFFSINSAGLLENFAVNASFFLKQ 322

Query: 183 KKG 185
           K G
Sbjct: 323 KLG 325

>Smik_5.123 Chr5 complement(172159..176259) [4101 bp, 1366 aa] {ON}
            YER008C (REAL)
          Length = 1366

 Score = 30.8 bits (68), Expect = 5.2,   Method: Compositional matrix adjust.
 Identities = 36/156 (23%), Positives = 67/156 (42%), Gaps = 18/156 (11%)

Query: 110  NGEILDGLQLWVDLPTNLKNTEPRYRDLHKENIPIAKPDENLE-IEVISG--KSYGIESV 166
            NGEI+  +   VDLP +LKN+E  ++   K  + I   D+N E IE++S   +   + + 
Sbjct: 1106 NGEIIPAI---VDLPVDLKNSEDLFK-FTKSAMDIKDIDDNYESIELMSSSFRKLSVAAT 1161

Query: 167  KDLAYTPVDFYVYKARKKGSAFTQDFSRDYNVFLYIVKGSVAIGNEVFPQHSSIFFNTDG 226
            + +A+   +  +  +    +A   D+    ++ +          N +    S + FN DG
Sbjct: 1162 QSIAHKEGNSNINPSLSDTTALNNDYMETISLLVN--------SNWLTEMLSMLNFNKDG 1213

Query: 227  ---DNVQGIVGSDDTEFAIIGGQILRQETVQHGPFV 259
                ++Q +    D E       +LR    +   FV
Sbjct: 1214 IFDTSLQNVKKVFDVERESYASFLLRDTMPKLTAFV 1249

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.318    0.137    0.403 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 33,693,823
Number of extensions: 1522072
Number of successful extensions: 3289
Number of sequences better than 10.0: 29
Number of HSP's gapped: 3357
Number of HSP's successfully gapped: 29
Length of query: 303
Length of database: 53,481,399
Length adjustment: 109
Effective length of query: 194
Effective length of database: 40,982,805
Effective search space: 7950664170
Effective search space used: 7950664170
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 65 (29.6 bits)