Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
TPHA0M002706.21ON37737719570.0
KNAG0M011706.21ON3393724496e-52
TBLA0G010506.21ON3503704272e-48
TPHA0J003406.21ON3383764234e-48
Skud_15.1686.21ON3483634211e-47
Smik_15.1766.21ON3453624201e-47
YOR007C (SGT2)6.21ON3463614201e-47
CAGL0E02739g6.21ON3433674192e-47
Kpol_1037.266.21ON3423704157e-47
Suva_15.1826.21ON3463604034e-45
Kpol_1032.86.21ON3433744027e-45
KAFR0L004106.21ON3313493921e-43
NCAS0H008306.21ON3383723922e-43
SAKL0E01210g6.21ON3233733884e-43
TDEL0G044806.21ON3433723895e-43
ZYRO0C07788g6.21ON3343683825e-42
Kwal_56.224336.21ON3223603666e-40
NDAI0D008106.21ON3493883686e-40
Ecym_30256.21ON3183623606e-39
TBLA0A072706.21ON3733793559e-38
KLTH0C11220g6.21ON3273643231e-33
KLLA0D01155g6.21ON3353802994e-30
ACR005W6.21ON3272642969e-30
NCAS0D026706.21ON3513722372e-21
NDAI0I022406.21ON3503972321e-20
SAKL0F03102g3.481ON513921792e-13
TBLA0C039503.481ON512921721e-12
Kpol_505.413.481ON513921712e-12
TPHA0D032203.481ON513971674e-12
AAR083C3.481ON5381231666e-12
KNAG0A079003.481ON512891658e-12
NDAI0B057903.481ON523931632e-11
TBLA0I023106.328ON116921502e-11
TPHA0D028805.617ON5851171613e-11
KLTH0F14542g3.481ON5131101587e-11
NDAI0F009105.617ON5831101587e-11
CAGL0D05060g3.481ON510861552e-10
CAGL0H08195g5.617ON5831061533e-10
NCAS0F034903.481ON512921524e-10
ZYRO0B04224g3.481ON513921515e-10
Kwal_55.199355.617ON5932141499e-10
Skud_7.4323.481ON513861499e-10
Smik_6.2153.481ON513861481e-09
Ecym_44133.481ON5101451471e-09
TDEL0D055003.481ON512831471e-09
Suva_8.805.617ON5862071471e-09
YGR123C (PPT1)3.481ON513861452e-09
Skud_15.1925.617ON5891981444e-09
TBLA0E033005.617ON5821361426e-09
KLLA0A07062g5.617ON5811031418e-09
Kpol_1018.695.617ON5901171418e-09
YOR027W (STI1)5.617ON5891121419e-09
KAFR0B066103.481ON511861409e-09
Smik_15.2055.617ON5892071411e-08
Ecym_55825.617ON5842011401e-08
NCAS0G008105.617ON5841201401e-08
KLLA0B10912g3.481ON512951391e-08
Kwal_55.211753.481ON5111051392e-08
AEL224W5.617ON5801391373e-08
Suva_7.4083.481ON513861363e-08
KNAG0B032005.617ON5791171321e-07
ZYRO0A05676g5.617ON5721031311e-07
KAFR0C058905.617ON5751051302e-07
SAKL0G07084g5.617ON5851031266e-07
KLTH0E02178g5.617ON5931031222e-06
KLLA0F24046g2.152ON604951195e-06
KNAG0A039508.506ON3861271176e-06
TDEL0A048405.617ON576971178e-06
KNAG0I025206.328ON117961071e-05
YCR060W (TAH1)6.328ON111951033e-05
Suva_3.956.328ON111921034e-05
NCAS0A00490singletonON6201011114e-05
Smik_3.1596.328ON115911026e-05
YBR155W (CNS1)8.506ON3851161052e-04
Suva_15.3142.152ON644891043e-04
KAFR0J025706.328ON12184973e-04
ADR230W5.689ON6851671034e-04
Smik_2.2958.506ON385991025e-04
TBLA0H033808.506ON3751071015e-04
NDAI0I004406.328ON12884956e-04
CAGL0K09240g6.328ON14283940.001
KAFR0E029808.506ON380165980.001
Ecym_25598.506ON370128980.001
KLLA0B09966g8.506ON370146980.001
Suva_4.4058.506ON385116970.002
ABR131W2.152ON59495980.002
NCAS0E024907.412ON809108970.002
Skud_8.1782.152ON63889960.003
NDAI0E040407.412ON783100960.003
YHR117W (TOM71)2.152ON63989950.004
Ecym_82042.152ON59786940.004
Kwal_27.118908.506ON33488930.005
KLLA0C08910g6.328ON11598880.005
CAGL0H07425g8.506ON380103930.005
NCAS0D045006.328ON12181870.006
Smik_8.1952.152ON635106920.009
CAGL0L12936g2.152ON600105910.010
TPHA0E007407.412ON74695910.013
Skud_3.1356.328ON11859840.015
SAKL0A01672g6.328ON12875830.025
NCAS0B024008.506ON380111870.027
TDEL0B013108.506ON380104870.029
SAKL0H10934g8.506ON380110870.030
TPHA0L014208.506ON37496860.037
TPHA0D038606.328ON12082800.055
Ecym_40315.689ON688105850.062
KLTH0B05170g2.152ON59395840.070
KAFR0F007202.152ON60897840.071
ZYRO0F08624g8.506ON379127840.072
NDAI0F028102.152ON60989840.087
NCAS0B070102.152ON62591830.096
TBLA0C055302.152ON61061830.10
NCAS0C044903.32ON918103820.13
Ecym_20906.328ON17262790.15
KLTH0E11748g8.506ON378103810.16
KNAG0H035302.152ON61461810.17
Skud_2.2828.506ON385116800.20
Skud_13.379na 1ON45075800.21
Ecym_80647.313ON371224800.23
KLLA0B03520g7.546ON140193810.23
NDAI0B043402.152ON66483800.26
SAKL0E10956g2.152ON60095790.34
Suva_2.347.412ON763104790.34
Kpol_1050.1127.546ON136093790.36
SAKL0F12936g7.412ON63289780.37
YMR210Wna 1ON44975780.37
YBL084C (CDC27)7.412ON758104780.41
TDEL0A074306.328ON12457730.46
Smik_13.418na 1ON44875770.48
KAFR0C018505.352ON64657770.48
Smik_2.367.412ON751104780.49
Kwal_33.147672.152ON59491770.50
Kwal_27.107407.412ON62889770.53
CAGL0E01573g3.32ON90483770.54
NDAI0C052908.506ON379112760.55
Smik_2.2073.295ON97968770.61
ABR206W5.72ON61474760.64
KAFR0L018707.412ON71295760.67
Kpol_1028.516.328ON11789720.69
ZYRO0G06512g2.152ON60484760.72
CAGL0L04048g2.152ON58764760.78
Skud_2.247.412ON769100760.84
AGL268C8.506ON379127750.86
Kpol_513.28.506ON374110750.87
Ecym_50925.72ON62674741.2
AAR054C6.328ON13366701.2
TPHA0B039701.456ON396102731.3
NCAS0G024802.152ON59691741.4
CAGL0I00616g6.89ON191144721.4
CAGL0C01903g7.412ON769103731.7
AGL294W7.412ON65688731.8
SAKL0D07436gsingletonON737119731.9
KAFR0K002106.233ON1088144732.0
KLTH0C06204g7.412ON62789722.1
NDAI0J001307.546ON140396722.6
NDAI0A073703.35ON79267704.1
Ecym_71427.412ON67584704.3
NDAI0A028607.313ON371108694.4
Kpol_1018.1067.412ON753138704.4
KLLA0F05093g7.313ON372118695.0
TPHA0E011105.352ON693120695.2
Skud_14.2112.152ON61795695.3
YBR074W3.295ON97668695.4
ZYRO0B03828g7.412ON727100695.6
ZYRO0C02970g3.32ON89697695.8
TDEL0C027207.412ON700212686.0
Kpol_1048.212.152ON59761686.5
KNAG0A012903.32ON91899686.8
Kwal_55.218395.689ON69061687.3
TDEL0E027505.352ON56470687.4
TDEL0B051402.152ON59987678.0
CAGL0K05511g5.680ON72767678.4
TPHA0A052905.72ON666116679.4
Suva_14.2192.152ON61795679.5
KAFR0B007707.458ON295128669.8
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= TPHA0M00270
         (377 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

TPHA0M00270 Chr13 complement(53640..54773) [1134 bp, 377 aa] {ON...   758   0.0  
KNAG0M01170 Chr13 complement(211476..212495) [1020 bp, 339 aa] {...   177   6e-52
TBLA0G01050 Chr7 complement(262407..263459) [1053 bp, 350 aa] {O...   169   2e-48
TPHA0J00340 Chr10 complement(76166..77182) [1017 bp, 338 aa] {ON...   167   4e-48
Skud_15.168 Chr15 complement(298955..300001) [1047 bp, 348 aa] {...   166   1e-47
Smik_15.176 Chr15 complement(306259..307296) [1038 bp, 345 aa] {...   166   1e-47
YOR007C Chr15 complement(338938..339978) [1041 bp, 346 aa] {ON} ...   166   1e-47
CAGL0E02739g Chr5 complement(259023..260054) [1032 bp, 343 aa] {...   166   2e-47
Kpol_1037.26 s1037 complement(59590..60618) [1029 bp, 342 aa] {O...   164   7e-47
Suva_15.182 Chr15 complement(313413..314453) [1041 bp, 346 aa] {...   159   4e-45
Kpol_1032.8 s1032 complement(15762..16793) [1032 bp, 343 aa] {ON...   159   7e-45
KAFR0L00410 Chr12 complement(75459..76454) [996 bp, 331 aa] {ON}...   155   1e-43
NCAS0H00830 Chr8 complement(151809..152825) [1017 bp, 338 aa] {O...   155   2e-43
SAKL0E01210g Chr5 complement(93267..94238) [972 bp, 323 aa] {ON}...   154   4e-43
TDEL0G04480 Chr7 (813648..814679) [1032 bp, 343 aa] {ON} Anc_6.2...   154   5e-43
ZYRO0C07788g Chr3 (589880..590884) [1005 bp, 334 aa] {ON} simila...   151   5e-42
Kwal_56.22433 s56 complement(124778..125746) [969 bp, 322 aa] {O...   145   6e-40
NDAI0D00810 Chr4 complement(181659..182708) [1050 bp, 349 aa] {O...   146   6e-40
Ecym_3025 Chr3 complement(50289..51245) [957 bp, 318 aa] {ON} si...   143   6e-39
TBLA0A07270 Chr1 complement(1811640..1812761) [1122 bp, 373 aa] ...   141   9e-38
KLTH0C11220g Chr3 (920972..921955) [984 bp, 327 aa] {ON} similar...   129   1e-33
KLLA0D01155g Chr4 complement(104847..105854) [1008 bp, 335 aa] {...   119   4e-30
ACR005W Chr3 (363355..364338) [984 bp, 327 aa] {ON} Syntenic hom...   118   9e-30
NCAS0D02670 Chr4 complement(512529..513584) [1056 bp, 351 aa] {O...    96   2e-21
NDAI0I02240 Chr9 (512140..513192) [1053 bp, 350 aa] {ON} Anc_6.2...    94   1e-20
SAKL0F03102g Chr6 (258266..259807) [1542 bp, 513 aa] {ON} highly...    74   2e-13
TBLA0C03950 Chr3 complement(950339..951877) [1539 bp, 512 aa] {O...    71   1e-12
Kpol_505.41 s505 complement(91130..92671) [1542 bp, 513 aa] {ON}...    70   2e-12
TPHA0D03220 Chr4 complement(662868..664409) [1542 bp, 513 aa] {O...    69   4e-12
AAR083C Chr1 complement(492375..493991) [1617 bp, 538 aa] {ON} S...    69   6e-12
KNAG0A07900 Chr1 complement(1258164..1259702) [1539 bp, 512 aa] ...    68   8e-12
NDAI0B05790 Chr2 complement(1406039..1407610) [1572 bp, 523 aa] ...    67   2e-11
TBLA0I02310 Chr9 (528067..528417) [351 bp, 116 aa] {ON} Anc_6.32...    62   2e-11
TPHA0D02880 Chr4 (599288..601045) [1758 bp, 585 aa] {ON} Anc_5.6...    67   3e-11
KLTH0F14542g Chr6 complement(1191800..1193341) [1542 bp, 513 aa]...    65   7e-11
NDAI0F00910 Chr6 complement(223205..224956) [1752 bp, 583 aa] {ON}     65   7e-11
CAGL0D05060g Chr4 complement(486065..487597) [1533 bp, 510 aa] {...    64   2e-10
CAGL0H08195g Chr8 complement(804418..806169) [1752 bp, 583 aa] {...    64   3e-10
NCAS0F03490 Chr6 complement(698757..700295) [1539 bp, 512 aa] {O...    63   4e-10
ZYRO0B04224g Chr2 (350069..351610) [1542 bp, 513 aa] {ON} highly...    63   5e-10
Kwal_55.19935 s55 (182767..184548) [1782 bp, 593 aa] {ON} YOR027...    62   9e-10
Skud_7.432 Chr7 complement(715852..717393) [1542 bp, 513 aa] {ON...    62   9e-10
Smik_6.215 Chr6 complement(354154..355695) [1542 bp, 513 aa] {ON...    62   1e-09
Ecym_4413 Chr4 complement(856330..857862) [1533 bp, 510 aa] {ON}...    61   1e-09
TDEL0D05500 Chr4 complement(991567..993105) [1539 bp, 512 aa] {O...    61   1e-09
Suva_8.80 Chr8 (142691..144451) [1761 bp, 586 aa] {ON} YOR027W (...    61   1e-09
YGR123C Chr7 complement(736662..738203) [1542 bp, 513 aa] {ON}  ...    60   2e-09
Skud_15.192 Chr15 (340847..342616) [1770 bp, 589 aa] {ON} YOR027...    60   4e-09
TBLA0E03300 Chr5 complement(827677..829425) [1749 bp, 582 aa] {O...    59   6e-09
KLLA0A07062g Chr1 complement(636546..638291) [1746 bp, 581 aa] {...    59   8e-09
Kpol_1018.69 s1018 (197149..198921) [1773 bp, 590 aa] {ON} (1971...    59   8e-09
YOR027W Chr15 (381053..382822) [1770 bp, 589 aa] {ON}  STI1Hsp90...    59   9e-09
KAFR0B06610 Chr2 (1372434..1373969) [1536 bp, 511 aa] {ON} Anc_3...    59   9e-09
Smik_15.205 Chr15 (346899..348668) [1770 bp, 589 aa] {ON} YOR027...    59   1e-08
Ecym_5582 Chr5 complement(1195544..1197298) [1755 bp, 584 aa] {O...    59   1e-08
NCAS0G00810 Chr7 complement(138192..139946) [1755 bp, 584 aa] {O...    59   1e-08
KLLA0B10912g Chr2 (955948..957486) [1539 bp, 512 aa] {ON} simila...    58   1e-08
Kwal_55.21175 s55 complement(716457..717992) [1536 bp, 511 aa] {...    58   2e-08
AEL224W Chr5 (207712..209454) [1743 bp, 580 aa] {ON} Syntenic ho...    57   3e-08
Suva_7.408 Chr7 complement(706942..708483) [1542 bp, 513 aa] {ON...    57   3e-08
KNAG0B03200 Chr2 complement(619530..621269) [1740 bp, 579 aa] {O...    55   1e-07
ZYRO0A05676g Chr1 (459999..461717) [1719 bp, 572 aa] {ON} highly...    55   1e-07
KAFR0C05890 Chr3 (1165932..1167659) [1728 bp, 575 aa] {ON} Anc_5...    55   2e-07
SAKL0G07084g Chr7 (580004..581761) [1758 bp, 585 aa] {ON} highly...    53   6e-07
KLTH0E02178g Chr5 (194914..196695) [1782 bp, 593 aa] {ON} highly...    52   2e-06
KLLA0F24046g Chr6 (2240454..2242268) [1815 bp, 604 aa] {ON} simi...    50   5e-06
KNAG0A03950 Chr1 complement(529620..530780) [1161 bp, 386 aa] {O...    50   6e-06
TDEL0A04840 Chr1 (851520..853250) [1731 bp, 576 aa] {ON} Anc_5.6...    50   8e-06
KNAG0I02520 Chr9 complement(487699..488052) [354 bp, 117 aa] {ON...    46   1e-05
YCR060W Chr3 (224399..224734) [336 bp, 111 aa] {ON}  TAH1Compone...    44   3e-05
Suva_3.95 Chr3 (137419..137754) [336 bp, 111 aa] {ON} YCR060W (R...    44   4e-05
NCAS0A00490 Chr1 complement(76652..78514) [1863 bp, 620 aa] {ON}       47   4e-05
Smik_3.159 Chr3 (222475..222822) [348 bp, 115 aa] {ON} YCR060W (...    44   6e-05
YBR155W Chr2 (549771..550928) [1158 bp, 385 aa] {ON}  CNS1TPR-co...    45   2e-04
Suva_15.314 Chr15 (544646..546580) [1935 bp, 644 aa] {ON} YHR117...    45   3e-04
KAFR0J02570 Chr10 (488372..488737) [366 bp, 121 aa] {ON} Anc_6.3...    42   3e-04
ADR230W Chr4 (1103275..1105332) [2058 bp, 685 aa] {ON} Syntenic ...    44   4e-04
Smik_2.295 Chr2 (535786..536943) [1158 bp, 385 aa] {ON} YBR155W ...    44   5e-04
TBLA0H03380 Chr8 (829314..830441) [1128 bp, 375 aa] {ON} Anc_8.5...    44   5e-04
NDAI0I00440 Chr9 complement(89650..90036) [387 bp, 128 aa] {ON} ...    41   6e-04
CAGL0K09240g Chr11 complement(914042..914470) [429 bp, 142 aa] {...    41   0.001
KAFR0E02980 Chr5 (596891..598033) [1143 bp, 380 aa] {ON} Anc_8.5...    42   0.001
Ecym_2559 Chr2 (1089202..1090314) [1113 bp, 370 aa] {ON} similar...    42   0.001
KLLA0B09966g Chr2 complement(872760..873872) [1113 bp, 370 aa] {...    42   0.001
Suva_4.405 Chr4 (719015..720172) [1158 bp, 385 aa] {ON} YBR155W ...    42   0.002
ABR131W Chr2 (641631..643415) [1785 bp, 594 aa] {ON} Syntenic ho...    42   0.002
NCAS0E02490 Chr5 complement(493779..496208) [2430 bp, 809 aa] {O...    42   0.002
Skud_8.178 Chr8 (316128..318044) [1917 bp, 638 aa] {ON} YHR117W ...    42   0.003
NDAI0E04040 Chr5 (900685..903036) [2352 bp, 783 aa] {ON} Anc_7.4...    42   0.003
YHR117W Chr8 (342349..344268) [1920 bp, 639 aa] {ON}  TOM71Mitoc...    41   0.004
Ecym_8204 Chr8 complement(419900..421693) [1794 bp, 597 aa] {ON}...    41   0.004
Kwal_27.11890 s27 (990685..991689) [1005 bp, 334 aa] {ON} YBR155...    40   0.005
KLLA0C08910g Chr3 complement(781726..782073) [348 bp, 115 aa] {O...    39   0.005
CAGL0H07425g Chr8 (725307..726449) [1143 bp, 380 aa] {ON} highly...    40   0.005
NCAS0D04500 Chr4 (855490..855855) [366 bp, 121 aa] {ON} Anc_6.32...    38   0.006
Smik_8.195 Chr8 (318688..320595) [1908 bp, 635 aa] {ON} YHR117W ...    40   0.009
CAGL0L12936g Chr12 (1382623..1384425) [1803 bp, 600 aa] {ON} sim...    40   0.010
TPHA0E00740 Chr5 complement(142456..144696) [2241 bp, 746 aa] {O...    40   0.013
Skud_3.135 Chr3 (208664..209020) [357 bp, 118 aa] {ON} YCR060W (...    37   0.015
SAKL0A01672g Chr1 complement(154932..155318) [387 bp, 128 aa] {O...    37   0.025
NCAS0B02400 Chr2 complement(402763..403905) [1143 bp, 380 aa] {O...    38   0.027
TDEL0B01310 Chr2 complement(234307..235449) [1143 bp, 380 aa] {O...    38   0.029
SAKL0H10934g Chr8 complement(945834..946976) [1143 bp, 380 aa] {...    38   0.030
TPHA0L01420 Chr12 (293980..295104) [1125 bp, 374 aa] {ON} Anc_8....    38   0.037
TPHA0D03860 Chr4 (807913..808275) [363 bp, 120 aa] {ON} Anc_6.32...    35   0.055
Ecym_4031 Chr4 complement(73900..75966) [2067 bp, 688 aa] {ON} s...    37   0.062
KLTH0B05170g Chr2 (427608..429389) [1782 bp, 593 aa] {ON} simila...    37   0.070
KAFR0F00720 Chr6 complement(141181..143007) [1827 bp, 608 aa] {O...    37   0.071
ZYRO0F08624g Chr6 (691992..693131) [1140 bp, 379 aa] {ON} simila...    37   0.072
NDAI0F02810 Chr6 (690977..692806) [1830 bp, 609 aa] {ON} Anc_2.1...    37   0.087
NCAS0B07010 Chr2 (1332351..1334228) [1878 bp, 625 aa] {ON} Anc_2...    37   0.096
TBLA0C05530 Chr3 complement(1338666..1340498) [1833 bp, 610 aa] ...    37   0.10 
NCAS0C04490 Chr3 complement(919665..922421) [2757 bp, 918 aa] {O...    36   0.13 
Ecym_2090 Chr2 complement(163340..163858) [519 bp, 172 aa] {ON} ...    35   0.15 
KLTH0E11748g Chr5 (1043203..1044339) [1137 bp, 378 aa] {ON} simi...    36   0.16 
KNAG0H03530 Chr8 (657450..659294) [1845 bp, 614 aa] {ON} Anc_2.1...    36   0.17 
Skud_2.282 Chr2 (517201..518358) [1158 bp, 385 aa] {ON} YBR155W ...    35   0.20 
Skud_13.379 Chr13 (661288..662640) [1353 bp, 450 aa] {ON} YMR210...    35   0.21 
Ecym_8064 Chr8 (137359..138474) [1116 bp, 371 aa] {ON} similar t...    35   0.23 
KLLA0B03520g Chr2 (317409..321614) [4206 bp, 1401 aa] {ON} simil...    36   0.23 
NDAI0B04340 Chr2 (1087851..1089845) [1995 bp, 664 aa] {ON} Anc_2...    35   0.26 
SAKL0E10956g Chr5 (916623..918425) [1803 bp, 600 aa] {ON} simila...    35   0.34 
Suva_2.34 Chr2 complement(63832..65304,65365..66183) [2292 bp, 7...    35   0.34 
Kpol_1050.112 s1050 (249717..252797,252855..252863,252906..25389...    35   0.36 
SAKL0F12936g Chr6 (1016829..1018727) [1899 bp, 632 aa] {ON} simi...    35   0.37 
YMR210W Chr13 (687516..688865) [1350 bp, 449 aa] {ON} Putative a...    35   0.37 
YBL084C Chr2 complement(67169..69445) [2277 bp, 758 aa] {ON}  CD...    35   0.41 
TDEL0A07430 Chr1 (1296631..1297005) [375 bp, 124 aa] {ON} Anc_6....    33   0.46 
Smik_13.418 Chr13 (671591..672937) [1347 bp, 448 aa] {ON} YMR210...    34   0.48 
KAFR0C01850 Chr3 (369596..371536) [1941 bp, 646 aa] {ON} Anc_5.3...    34   0.48 
Smik_2.36 Chr2 complement(61159..63414) [2256 bp, 751 aa] {ON} Y...    35   0.49 
Kwal_33.14767 s33 complement(809994..811778) [1785 bp, 594 aa] {...    34   0.50 
Kwal_27.10740 s27 complement(476617..478503) [1887 bp, 628 aa] {...    34   0.53 
CAGL0E01573g Chr5 complement(149084..151798) [2715 bp, 904 aa] {...    34   0.54 
NDAI0C05290 Chr3 (1224979..1226118) [1140 bp, 379 aa] {ON} Anc_8...    34   0.55 
Smik_2.207 Chr2 (368052..370991) [2940 bp, 979 aa] {ON} YBR074W ...    34   0.61 
ABR206W Chr2 (787387..789231) [1845 bp, 614 aa] {ON} Syntenic ho...    34   0.64 
KAFR0L01870 Chr12 (345757..347895) [2139 bp, 712 aa] {ON} Anc_7....    34   0.67 
Kpol_1028.51 s1028 complement(123535..123888) [354 bp, 117 aa] {...    32   0.69 
ZYRO0G06512g Chr7 complement(515759..517573) [1815 bp, 604 aa] {...    34   0.72 
CAGL0L04048g Chr12 (476407..478170) [1764 bp, 587 aa] {ON} simil...    34   0.78 
Skud_2.24 Chr2 complement(50790..53099) [2310 bp, 769 aa] {ON} Y...    34   0.84 
AGL268C Chr7 complement(205872..207011) [1140 bp, 379 aa] {ON} S...    33   0.86 
Kpol_513.2 s513 (1962..3086) [1125 bp, 374 aa] {ON} (1962..3086)...    33   0.87 
Ecym_5092 Chr5 complement(208478..210358) [1881 bp, 626 aa] {ON}...    33   1.2  
AAR054C Chr1 complement(440706..441107) [402 bp, 133 aa] {ON} Sy...    32   1.2  
TPHA0B03970 Chr2 (938053..939243) [1191 bp, 396 aa] {ON} Anc_1.4...    33   1.3  
NCAS0G02480 Chr7 complement(440105..441895) [1791 bp, 596 aa] {O...    33   1.4  
CAGL0I00616g Chr9 (46130..46705) [576 bp, 191 aa] {ON} similar t...    32   1.4  
CAGL0C01903g Chr3 complement(199487..201796) [2310 bp, 769 aa] {...    33   1.7  
AGL294W Chr7 (154711..156681) [1971 bp, 656 aa] {ON} Syntenic ho...    33   1.8  
SAKL0D07436g Chr4 complement(609760..611973) [2214 bp, 737 aa] {...    33   1.9  
KAFR0K00210 Chr11 (52344..55610) [3267 bp, 1088 aa] {ON} Anc_6.2...    33   2.0  
KLTH0C06204g Chr3 complement(538533..540416) [1884 bp, 627 aa] {...    32   2.1  
NDAI0J00130 Chr10 complement(10432..14643) [4212 bp, 1403 aa] {O...    32   2.6  
NDAI0A07370 Chr1 complement(1675941..1678319) [2379 bp, 792 aa] ...    32   4.1  
Ecym_7142 Chr7 complement(287110..289137) [2028 bp, 675 aa] {ON}...    32   4.3  
NDAI0A02860 Chr1 complement(641401..642516) [1116 bp, 371 aa] {O...    31   4.4  
Kpol_1018.106 s1018 (280224..282485) [2262 bp, 753 aa] {ON} (280...    32   4.4  
KLLA0F05093g Chr6 complement(502635..503753) [1119 bp, 372 aa] {...    31   5.0  
TPHA0E01110 Chr5 (228116..230197) [2082 bp, 693 aa] {ON} Anc_5.3...    31   5.2  
Skud_14.211 Chr14 complement(388749..390602) [1854 bp, 617 aa] {...    31   5.3  
YBR074W Chr2 (386286..389216) [2931 bp, 976 aa] {ON} Putative me...    31   5.4  
ZYRO0B03828g Chr2 (318153..320336) [2184 bp, 727 aa] {ON} simila...    31   5.6  
ZYRO0C02970g Chr3 (230414..233104) [2691 bp, 896 aa] {ON} simila...    31   5.8  
TDEL0C02720 Chr3 (477529..479631) [2103 bp, 700 aa] {ON} Anc_7.4...    31   6.0  
Kpol_1048.21 s1048 complement(67975..69768) [1794 bp, 597 aa] {O...    31   6.5  
KNAG0A01290 Chr1 complement(27911..30667) [2757 bp, 918 aa] {ON}...    31   6.8  
Kwal_55.21839 s55 (998426..1000498) [2073 bp, 690 aa] {ON} YOR08...    31   7.3  
TDEL0E02750 Chr5 (529920..531614) [1695 bp, 564 aa] {ON} Anc_5.3...    31   7.4  
TDEL0B05140 Chr2 complement(904626..906425) [1800 bp, 599 aa] {O...    30   8.0  
CAGL0K05511g Chr11 complement(539944..542127) [2184 bp, 727 aa] ...    30   8.4  
TPHA0A05290 Chr1 complement(1198497..1200497) [2001 bp, 666 aa] ...    30   9.4  
Suva_14.219 Chr14 complement(395316..397169) [1854 bp, 617 aa] {...    30   9.5  
KAFR0B00770 Chr2 (149822..150709) [888 bp, 295 aa] {ON} Anc_7.45...    30   9.8  

>TPHA0M00270 Chr13 complement(53640..54773) [1134 bp, 377 aa] {ON}
           Anc_6.21 YOR007C
          Length = 377

 Score =  758 bits (1957), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 377/377 (100%), Positives = 377/377 (100%)

Query: 1   MNTTDQEIASIIVDYFNKCITSGKLNQDNVDSLNVAIDCIADVFDVDKDLISNILKTAYR 60
           MNTTDQEIASIIVDYFNKCITSGKLNQDNVDSLNVAIDCIADVFDVDKDLISNILKTAYR
Sbjct: 1   MNTTDQEIASIIVDYFNKCITSGKLNQDNVDSLNVAIDCIADVFDVDKDLISNILKTAYR 60

Query: 61  SNDLLTYLPNGKRSALNLDKKNTTINVSVQTKDKINAYNDLSRNKDDINVPVKVIEDIEE 120
           SNDLLTYLPNGKRSALNLDKKNTTINVSVQTKDKINAYNDLSRNKDDINVPVKVIEDIEE
Sbjct: 61  SNDLLTYLPNGKRSALNLDKKNTTINVSVQTKDKINAYNDLSRNKDDINVPVKVIEDIEE 120

Query: 121 TKETKVSNDDMKKAEKLKEKGNEEMKAKQYSKAIGSYSDAIKLYPTNFNYYNNRALAYIK 180
           TKETKVSNDDMKKAEKLKEKGNEEMKAKQYSKAIGSYSDAIKLYPTNFNYYNNRALAYIK
Sbjct: 121 TKETKVSNDDMKKAEKLKEKGNEEMKAKQYSKAIGSYSDAIKLYPTNFNYYNNRALAYIK 180

Query: 181 ANNFDHAIIDANKSIEIDSKIHPTNFKAYYRLGLAKYEIGDYEGSLAAFKRMIEIAQENN 240
           ANNFDHAIIDANKSIEIDSKIHPTNFKAYYRLGLAKYEIGDYEGSLAAFKRMIEIAQENN
Sbjct: 181 ANNFDHAIIDANKSIEIDSKIHPTNFKAYYRLGLAKYEIGDYEGSLAAFKRMIEIAQENN 240

Query: 241 KGDEITKQMDADYEKAKEKVQELFFMQITKSTGKEGSGNSVNDGPKRKVTLNDILNMAGN 300
           KGDEITKQMDADYEKAKEKVQELFFMQITKSTGKEGSGNSVNDGPKRKVTLNDILNMAGN
Sbjct: 241 KGDEITKQMDADYEKAKEKVQELFFMQITKSTGKEGSGNSVNDGPKRKVTLNDILNMAGN 300

Query: 301 NLNIIMSNPLFKEVVEQLLASNPQAKQQFDNVMNDPRVRQMKENVNSDSMSNIPILKDLF 360
           NLNIIMSNPLFKEVVEQLLASNPQAKQQFDNVMNDPRVRQMKENVNSDSMSNIPILKDLF
Sbjct: 301 NLNIIMSNPLFKEVVEQLLASNPQAKQQFDNVMNDPRVRQMKENVNSDSMSNIPILKDLF 360

Query: 361 YSLLNTTVYEENLNGKK 377
           YSLLNTTVYEENLNGKK
Sbjct: 361 YSLLNTTVYEENLNGKK 377

>KNAG0M01170 Chr13 complement(211476..212495) [1020 bp, 339 aa] {ON}
           Anc_6.21 YOR007C
          Length = 339

 Score =  177 bits (449), Expect = 6e-52,   Method: Compositional matrix adjust.
 Identities = 118/372 (31%), Positives = 197/372 (52%), Gaps = 55/372 (14%)

Query: 1   MNTTDQEIASIIVDYFNKCITSGKLNQDNVDSLNVAIDCIADVFDVDKDLISNILKTAYR 60
           M  +++E++S+I+DY NK ++  +++ D++DSLNVAIDC+ +VF V+KD +S  +++ + 
Sbjct: 1   MAYSNKEVSSLIIDYLNKVVSKAEVSADDIDSLNVAIDCLTEVFGVEKDTLSATIESKFN 60

Query: 61  SNDLLTYLPNGKRSALNLDK-KNTTINVSVQTKDKINAYNDLSRNKDDINVPVKVIEDIE 119
              L   L    ++A N D+ K  T+                      IN+P       +
Sbjct: 61  GKSLTELLDAASQNAGNTDECKTETVK---------------------INIP-------Q 92

Query: 120 ETKETKVSNDDMKKAEKLKEKGNEEMKAKQYSKAIGSYSDAIKLYPTNFNYYNNRALAYI 179
           E  ETK       KAE LK +GN+ + +K Y  A+  Y++AIK+ PTN  Y+ NRA AY 
Sbjct: 93  EDAETKA------KAEALKLEGNKAVASKDYDLAVEKYTEAIKILPTNAVYFANRAAAYT 146

Query: 180 KANNFDHAIIDANKSIEIDSKIHPTNFKAYYRLGLAKYEIGDYEGSLAAFKRMIEIAQEN 239
            + N+D A+ DA ++I++D    P   K Y RL  AKY   ++E SL A+K+++EI  E 
Sbjct: 147 NSQNYDEAVKDAEEAIKLD----PAYSKGYSRLAYAKYVQENFEESLEAYKKVLEI--EG 200

Query: 240 NKGDEITKQMDADYEKAKEKVQELFFMQITKSTGKEGSGNSVNDGPKRKVTLNDILNMAG 299
           +   E+TK+    YE AK++V+E   + + KS   E +G   N  P       D  ++  
Sbjct: 201 DSATEVTKR---GYETAKKRVEE--SLNLEKSVPTESAGGQTN--PAAGGGFPDFSSLMS 253

Query: 300 NNLNIIMSNPLFKEVVEQLLASNPQAKQQFDNVMNDPRVRQMKENVNS------DSMSNI 353
             L  +M+NP   +  + ++ SNP A ++  ++M +P ++QM E            M N 
Sbjct: 254 GGLEGLMNNPQMMQAAQSMM-SNPGAMEKIQSMMQNPAIQQMAEQFKGGNTPDFSEMMNN 312

Query: 354 PILKDLFYSLLN 365
           P ++++  SL +
Sbjct: 313 PAVRNMASSLFS 324

>TBLA0G01050 Chr7 complement(262407..263459) [1053 bp, 350 aa] {ON}
           Anc_6.21 YOR007C
          Length = 350

 Score =  169 bits (427), Expect = 2e-48,   Method: Compositional matrix adjust.
 Identities = 117/370 (31%), Positives = 189/370 (51%), Gaps = 53/370 (14%)

Query: 1   MNTTDQEIASIIVDYFNKCITSGKLNQDNVDSLNVAIDCIADVFDVDKDLISNILKTAYR 60
           M+ ++++IA+++VD+ +  I    ++ DN DSLNVAIDCI + F+ +KD + + L + + 
Sbjct: 1   MSYSNKDIANLLVDFLSTAIEKKAVSSDNADSLNVAIDCITEAFEFEKDDVKSTLASKFG 60

Query: 61  SNDLLTYLPNGKRSALNLDKKNTTINVSVQTKDKINAYNDLSRNKDDINVPVKVIEDIEE 120
              L T L +   +A         I VS+  KD+                        EE
Sbjct: 61  GKSL-TELLDAATNAKGRSSSPEDIKVSISDKDE------------------------EE 95

Query: 121 TKETKVSNDDMKKAEKLKEKGNEEMKAKQYSKAIGSYSDAIKLYPTNFNYYNNRALAYIK 180
            KE         KAE LK +GN+ M AK Y+ A+  Y+ AIKL PT   YY NRA AY  
Sbjct: 96  DKELAA------KAEALKLEGNKAMAAKDYNLAVEKYNAAIKLVPTKAVYYANRAAAYSS 149

Query: 181 ANNFDHAIIDANKSIEIDSKIHPTNFKAYYRLGLAKYEIGDYEGSLAAFKRMIEIAQENN 240
              +D AI DA  +I    K+ P   K Y RLG AK+  G  + +L A+K+ +E+     
Sbjct: 150 QEKYDEAIKDAESAI----KVEPNWSKGYSRLGFAKFAQGKSQEALEAYKKALEV----- 200

Query: 241 KGDEITKQMDADYEKAKEKVQELFFMQITKSTGKEGSGNSVNDGPKRKVTLNDILNMAGN 300
            GD+ T  M  DYE AK+KV++   ++ + +     S ++   G      + D+ +M G 
Sbjct: 201 DGDKATDIMKRDYETAKKKVEQSLNVEKSATPSASASASASAGG------MPDMASMLGG 254

Query: 301 NLNIIMSNPLFKEVVEQLLASNPQAKQQFDNVMNDPRVRQMKENVNSDSMSNI------P 354
            L   ++NP   +  +Q++ SNP+A +Q +++M +P +RQM EN++S S   +      P
Sbjct: 255 GLGSFLNNPQIMQAAQQMM-SNPRAMEQMESMMQNPSIRQMAENLSSGSSEGMGDFMNNP 313

Query: 355 ILKDLFYSLL 364
            ++++  +L 
Sbjct: 314 AIREMASNLF 323

>TPHA0J00340 Chr10 complement(76166..77182) [1017 bp, 338 aa] {ON}
           Anc_6.21 YOR007C
          Length = 338

 Score =  167 bits (423), Expect = 4e-48,   Method: Compositional matrix adjust.
 Identities = 128/376 (34%), Positives = 190/376 (50%), Gaps = 70/376 (18%)

Query: 1   MNTTDQEIASIIVDYFNKCITSGKLNQDNVDSLNVAIDCIADVFDVDKDLISNILKTAYR 60
           M  +++EIA++IVDY N  +   +++ DN DSLNVA+DCIA+ F+ ++D + + +K+A+ 
Sbjct: 1   MAASNKEIAALIVDYLNNVVDKKEVSGDNADSLNVAMDCIAEAFEFERDSVKDTVKSAFN 60

Query: 61  SNDLLTYLPNGKRSALNLDKKNTTINVSVQTKDKINAYNDLSRNKDDINVPVKVIEDIEE 120
            N L ++L     SA N    +  +N++    D                         EE
Sbjct: 61  GNGLTSFLSG---SATN----DIQVNIADDAAD-------------------------EE 88

Query: 121 TKETKVSNDDMKKAEKLKEKGNEEMKAKQYSKAIGSYSDAIKLYPTNFNYYNNRALAYIK 180
            K T         AE LK +GN+ M  K Y  AI  YS+AI++ PTN  YY NRA AY  
Sbjct: 89  QKAT---------AEGLKLEGNKAMATKDYESAIKKYSEAIEVLPTNAVYYANRAAAYSS 139

Query: 181 ANNFDHAIIDANKSIEIDSKIHPTNFKAYYRLGLAKYEIGDYEGSLAAFKRMIEIAQENN 240
              +D A+ DA  +I    K++PT  K Y RLG AK+  G  E +L A+K++++I     
Sbjct: 140 LKKYDDAVNDAESAI----KVNPTYSKGYSRLGFAKFAQGKVEDALDAYKKVLDI----- 190

Query: 241 KGDEITKQMDADYEKAKEKVQELFFMQITKSTGKEGSGNSVND------GPKRKVTLNDI 294
           +GD+ T  M  DYE AK+KV++   + + K T KE    S  D      G        D+
Sbjct: 191 EGDKATDIMKRDYETAKKKVEQ--SLNLEKVTPKEAETESNADAGTGAAGMGGMGGFPDL 248

Query: 295 LNMAGNNLNIIMS----NPLFKEVVEQLLASNPQAKQQFDNVMNDPRVRQMKENVNS--- 347
            +M G  L   +     NP   +  +Q++  NP A QQ +++M +P VRQM EN  S   
Sbjct: 249 SSMLGGGLGGGLGDLLKNPQIMQAAQQMM-QNPNAMQQMESMMQNPAVRQMAENFASGEG 307

Query: 348 ----DSMSNIPILKDL 359
                +M N P LKD+
Sbjct: 308 TPDLSAMMNNPDLKDM 323

>Skud_15.168 Chr15 complement(298955..300001) [1047 bp, 348 aa] {ON}
           YOR007C (REAL)
          Length = 348

 Score =  166 bits (421), Expect = 1e-47,   Method: Compositional matrix adjust.
 Identities = 124/363 (34%), Positives = 187/363 (51%), Gaps = 49/363 (13%)

Query: 1   MNTTDQEIASIIVDYFNKCITSGKLNQDNVDSLNVAIDCIADVFDVDKDLISNILK-TAY 59
           M+ +  EIAS+IV+YF+  +   ++++D+ DSLNVA+DCI++ F  +++ + +IL+ + +
Sbjct: 1   MSASKGEIASLIVNYFSSIVEKKEISEDSADSLNVAMDCISEAFGFEREAVPSILENSEF 60

Query: 60  RSNDLLTYLPNGKRSALNLDKKNTTINVSVQTKDKINAYNDLSRNKDDI-NVPVKVIEDI 118
           +  +L   L             N+T  VS  TK            KDD  NV V + E+ 
Sbjct: 61  KGQNLTDLL-------------NSTSRVSESTK------------KDDAQNVEVNIPEED 95

Query: 119 EETKETKVSNDDMKKAEKLKEKGNEEMKAKQYSKAIGSYSDAIKLYPTNFNYYNNRALAY 178
            E K          KAE LK +GN+ M  K Y  AI  Y++AIK+ PTN  YY NRA A+
Sbjct: 96  AEIK---------AKAEDLKMQGNKAMANKDYELAINKYTEAIKVLPTNAIYYANRAAAH 146

Query: 179 IKANNFDHAIIDANKSIEIDSKIHPTNFKAYYRLGLAKYEIGDYEGSLAAFKRMIEIAQE 238
                +D A+ DA  +I ID    PT F+ Y RLG AKY  G  E +L A+K++++I   
Sbjct: 147 SSLKGYDEAVEDAESAISID----PTYFRGYSRLGFAKYAQGKPEEALEAYKKVLDI--- 199

Query: 239 NNKGDEITKQMDADYEKAKEKV-QELFFMQITKSTGKEGSGNSVNDGPKRKVTLNDILNM 297
             +GD  T+ M  DYE AK+KV Q L   +      ++   N+          L D+ ++
Sbjct: 200 --EGDNATEAMKRDYESAKKKVEQSLNLEKTVPEQSRDADANADASQGAGTSGLPDLGSL 257

Query: 298 AGNNLNIIMSNPLFKEVVEQLLASNPQAKQQFDNVMNDPRVRQMKENVNSDSMSNIPILK 357
            G  L  +M+NP   +  ++++ SNP A Q    +M DP ++QM E   S      P L 
Sbjct: 258 LGGGLGGLMNNPQLMQAAQKMM-SNPGAMQNIQKMMQDPNIKQMAEGFTSG--GGAPNLS 314

Query: 358 DLF 360
           DL 
Sbjct: 315 DLM 317

>Smik_15.176 Chr15 complement(306259..307296) [1038 bp, 345 aa] {ON}
           YOR007C (REAL)
          Length = 345

 Score =  166 bits (420), Expect = 1e-47,   Method: Compositional matrix adjust.
 Identities = 121/362 (33%), Positives = 180/362 (49%), Gaps = 49/362 (13%)

Query: 1   MNTTDQEIASIIVDYFNKCITSGKLNQDNVDSLNVAIDCIADVFDVDKDLISNIL-KTAY 59
           M  + +EIA++IV+YF+  +   ++++D  DSLNVA+DCI++ F  ++D  S IL K+ +
Sbjct: 1   MLASKEEIAALIVNYFSSIVEKKEISEDGADSLNVAMDCISEAFGFERDAASGILGKSEF 60

Query: 60  RSNDLLTYLPNGKRSALNLDKKNTTINVSVQTKDKINAYNDLSRNKDDINVPVKVIEDIE 119
           +   L   L N    A   ++K+   NV                   ++N+P       E
Sbjct: 61  KGKSLADVL-NSASKASESNEKDDAQNV-------------------EVNIP-------E 93

Query: 120 ETKETKVSNDDMKKAEKLKEKGNEEMKAKQYSKAIGSYSDAIKLYPTNFNYYNNRALAYI 179
           E  ETK       KAE LK +GN+ M  K Y  AI  Y++AI++ PTN  YY NRA A+ 
Sbjct: 94  EDAETKA------KAEDLKMQGNKAMANKDYELAINKYTEAIQVLPTNAIYYANRAAAHS 147

Query: 180 KANNFDHAIIDANKSIEIDSKIHPTNFKAYYRLGLAKYEIGDYEGSLAAFKRMIEIAQEN 239
               +D A+ DA  SI ID    P+ F+ Y RLG AKY  G  E +L A+K++++I    
Sbjct: 148 SLREYDEAVKDAESSISID----PSYFRGYSRLGFAKYAQGKPEEALEAYKKVLDI---- 199

Query: 240 NKGDEITKQMDADYEKAKEKV-QELFFMQITKSTGKEGSGNSVNDGPKRKVTLNDILNMA 298
            +GD  T+ M  DYE AK+KV Q L   +      ++   N+        +     L   
Sbjct: 200 -EGDNATEAMKRDYESAKKKVEQSLNLEKAVPEQSRDADANASQGAGSSGLPDLGSLLG- 257

Query: 299 GNNLNIIMSNPLFKEVVEQLLASNPQAKQQFDNVMNDPRVRQMKENVNSDSMSNIPILKD 358
              L  +M+NP   +  ++++ SNP A Q    +M DP +RQM E   S      P L D
Sbjct: 258 -GGLGGLMNNPQLMQAAQKMM-SNPGAMQNIQKMMQDPSIRQMAEGFTSG--GGAPNLSD 313

Query: 359 LF 360
           L 
Sbjct: 314 LM 315

>YOR007C Chr15 complement(338938..339978) [1041 bp, 346 aa] {ON}
           SGT2Glutamine-rich cytoplasmic protein that serves as a
           scaffold for binding Get4/5p and other proteins required
           to mediate posttranslational insertion of tail-anchored
           proteins into the ER membrane; has similarity to human
           cochaperone SGT
          Length = 346

 Score =  166 bits (420), Expect = 1e-47,   Method: Compositional matrix adjust.
 Identities = 119/361 (32%), Positives = 184/361 (50%), Gaps = 47/361 (13%)

Query: 1   MNTTDQEIASIIVDYFNKCITSGKLNQDNVDSLNVAIDCIADVFDVDKDLISNIL-KTAY 59
           M+ + +EIA++IV+YF+  +   ++++D  DSLNVA+DCI++ F  +++ +S IL K+ +
Sbjct: 1   MSASKEEIAALIVNYFSSIVEKKEISEDGADSLNVAMDCISEAFGFEREAVSGILGKSEF 60

Query: 60  RSNDLLTYLPNGKRSALNLDKKNTTINVSVQTKDKINAYNDLSRNKDDINVPVKVIEDIE 119
           +   L   L +  R   + +KK+   NV                   +IN+P    ED  
Sbjct: 61  KGQHLADILNSASRVPES-NKKDDAENV-------------------EINIP----EDDA 96

Query: 120 ETKETKVSNDDMKKAEKLKEKGNEEMKAKQYSKAIGSYSDAIKLYPTNFNYYNNRALAYI 179
           ETK          KAE LK +GN+ M  K Y  AI  Y++AIK+ PTN  YY NRA A+ 
Sbjct: 97  ETK---------AKAEDLKMQGNKAMANKDYELAINKYTEAIKVLPTNAIYYANRAAAHS 147

Query: 180 KANNFDHAIIDANKSIEIDSKIHPTNFKAYYRLGLAKYEIGDYEGSLAAFKRMIEIAQEN 239
               +D A+ DA  +I ID    P+ F+ Y RLG AKY  G  E +L A+K++++I    
Sbjct: 148 SLKEYDQAVKDAESAISID----PSYFRGYSRLGFAKYAQGKPEEALEAYKKVLDI---- 199

Query: 240 NKGDEITKQMDADYEKAKEKVQELFFMQITKSTGKEGSGNSVNDGPKRKVTLNDILNMAG 299
            +GD  T+ M  DYE AK+KV++   ++ T       +    + G       +    +  
Sbjct: 200 -EGDNATEAMKRDYESAKKKVEQSLNLEKTVPEQSRDADVDASQGASAGGLPDLGSLLG- 257

Query: 300 NNLNIIMSNPLFKEVVEQLLASNPQAKQQFDNVMNDPRVRQMKENVNSDSMSNIPILKDL 359
             L  +M+NP   +  ++++ SNP A Q    +M DP +RQM E   S      P L DL
Sbjct: 258 GGLGGLMNNPQLMQAAQKMM-SNPGAMQNIQKMMQDPSIRQMAEGFASG--GGTPNLSDL 314

Query: 360 F 360
            
Sbjct: 315 M 315

>CAGL0E02739g Chr5 complement(259023..260054) [1032 bp, 343 aa] {ON}
           similar to uniprot|Q12118 Saccharomyces cerevisiae
           YOR007c SGT2
          Length = 343

 Score =  166 bits (419), Expect = 2e-47,   Method: Compositional matrix adjust.
 Identities = 122/367 (33%), Positives = 185/367 (50%), Gaps = 58/367 (15%)

Query: 6   QEIASIIVDYFNKCITSGKLNQDNVDSLNVAIDCIADVFDVDKDLISNILKTAYRSNDLL 65
           +E+A++I+ Y    +    + +D +DS+NVAIDCIA+ F+V++  + ++LK +  S  L 
Sbjct: 3   KEVAAVIIKYLEGVVAEKAVGEDYLDSVNVAIDCIAESFEVERGDVDSVLKQSGISKGLE 62

Query: 66  TYLPNGKRSALNLDKKNTTINVSVQTKDKINAYNDLSRNKDDINVPVKVIEDIEETKETK 125
             L   K  A             V+++D              +N+P        E  ETK
Sbjct: 63  ECLECMKGGA-------------VKSEDV------------KVNIPA-------EDAETK 90

Query: 126 VSNDDMKKAEKLKEKGNEEMKAKQYSKAIGSYSDAIKLYPTNFNYYNNRALAYIKANNFD 185
                  KAE LK +GN+ M  K +  AI  YS+AI++ PTN  YY NRA A+     +D
Sbjct: 91  A------KAEALKLEGNKAMAGKDFELAIAKYSEAIEVLPTNAIYYANRAAAHSSLKQYD 144

Query: 186 HAIIDANKSIEIDSKIHPTNFKAYYRLGLAKYEIGDYEGSLAAFKRMIEIAQENNKGDEI 245
            A++DA K+IEID    P   K Y RLG AKY     E +L A+K+++++     +GD+ 
Sbjct: 145 EAVVDAEKAIEID----PAYSKGYSRLGFAKYAQNKPEEALEAYKKVMDL-----EGDKA 195

Query: 246 TKQMDADYEKAKEKVQELFFMQITKSTGKEGSGNSVNDGPKRKVTLNDILNMAGNNLNII 305
           T  M  DYE AK+KV++   ++ T       SG     G        D  +M    L+ +
Sbjct: 196 TDIMKRDYETAKKKVEQSLNLEKTPDARGADSGAGAGAGAGGAGGF-DFSSMLSGGLSGL 254

Query: 306 MSNPLFKEVVEQLLASNPQAKQQFDNVMNDPRVRQMKENVNS--------DSMSNIPILK 357
           M+NP   +  +Q++ SNPQA QQ  ++M DP +RQM E   S        D MSN P L+
Sbjct: 255 MNNPQIMQAAQQMM-SNPQALQQMQSMMQDPSIRQMAEQFTSGNGTPNMDDLMSN-PALR 312

Query: 358 DLFYSLL 364
           ++  S+ 
Sbjct: 313 NMASSMF 319

>Kpol_1037.26 s1037 complement(59590..60618) [1029 bp, 342 aa] {ON}
           complement(59590..60618) [1029 nt, 343 aa]
          Length = 342

 Score =  164 bits (415), Expect = 7e-47,   Method: Compositional matrix adjust.
 Identities = 116/370 (31%), Positives = 196/370 (52%), Gaps = 55/370 (14%)

Query: 1   MNTTDQEIASIIVDYFNKCITSGKLNQDNVDSLNVAIDCIADVFDVDKDLISNILKTAYR 60
           M+ ++++IA++I+D+ +  +   ++++DN DSLNVA+DCIA+ F+ ++D ++ ++K++++
Sbjct: 1   MSVSNKDIAALIIDFLSTVVDKNEVSEDNADSLNVAMDCIAEAFEFERDSVAGVVKSSFQ 60

Query: 61  SNDLLTYLPNGKRSALNLDKKNTTINVSVQTKDKINAYNDLSRNKDDINVPVKVIEDIEE 120
            N L +YL NG  SA                          +    D  V V V ED  E
Sbjct: 61  GNSLSSYL-NGSTSASA------------------------ATTTADETVKVNVTEDDTE 95

Query: 121 TKETKVSNDDMKKAEKLKEKGNEEMKAKQYSKAIGSYSDAIKLYPTNFNYYNNRALAYIK 180
             E          AE LK +GN+ M  K Y  AI  Y++AI   PTN  Y+ NRA AY  
Sbjct: 96  ASEA---------AEALKLEGNKAMAGKDYELAIKKYTEAIATLPTNAVYFANRAAAYSS 146

Query: 181 ANNFDHAIIDANKSIEIDSKIHPTNFKAYYRLGLAKYEIGDYEGSLAAFKRMIEIAQENN 240
              +D A+ DAN +I    KI+PT  K Y RLG AK+  G  E +L A+K++++I     
Sbjct: 147 LKKYDEAVEDANSAI----KINPTYSKGYSRLGFAKFAQGKAEDALEAYKKVLDI----- 197

Query: 241 KGDEITKQMDADYEKAKEKVQELFFMQITKSTG---KEGSGNSVNDGPKRKVTLNDILNM 297
           +GD+ T+ M  DYE AK+KV++   ++ +  +G    E    S  D       + D  +M
Sbjct: 198 EGDKATEMMKRDYETAKKKVEQSLNLEKSTVSGNATAESDSASAADPFAGMGGMPDFSSM 257

Query: 298 -AGNNLNIIMSNPLFKEVVEQLLASNPQAKQQFDNVMNDPRVRQMKENVNS-------DS 349
             G  L  +++NP   +  +Q++  +P+A +Q +++M +P V+QM +  +S        +
Sbjct: 258 LGGGGLGNLLNNPQLMQAAQQMM-QDPEAMKQVESMMQNPSVKQMADQFSSGNGTPDFSA 316

Query: 350 MSNIPILKDL 359
           + N P ++D+
Sbjct: 317 LMNDPSIRDM 326

>Suva_15.182 Chr15 complement(313413..314453) [1041 bp, 346 aa] {ON}
           YOR007C (REAL)
          Length = 346

 Score =  159 bits (403), Expect = 4e-45,   Method: Compositional matrix adjust.
 Identities = 119/360 (33%), Positives = 185/360 (51%), Gaps = 45/360 (12%)

Query: 1   MNTTDQEIASIIVDYFNKCITSGKLNQDNVDSLNVAIDCIADVFDVDKDLISNILKTAYR 60
           M+ + +EIAS+IV+YF+  +   ++++D+ DSLNVA+DCI++ F  ++D +S+IL  +  
Sbjct: 1   MSASKEEIASLIVNYFSSIVEKKEVSEDSADSLNVAMDCISEAFGFERDAVSSILDKSTF 60

Query: 61  SNDLLTYLPNGKRSALNLDKKNTTINVSVQTKDKINAYNDLSRNKDDINVPVKVIEDIEE 120
               L  L +         KK+   NV                   ++N+P       EE
Sbjct: 61  KGQSLNNLLSSSSKLPESGKKDDAQNV-------------------EVNIP-------EE 94

Query: 121 TKETKVSNDDMKKAEKLKEKGNEEMKAKQYSKAIGSYSDAIKLYPTNFNYYNNRALAYIK 180
             ETK       KAE+LK +GN+ M  K+Y  AI  Y++AI + PTN  YY NRA A+  
Sbjct: 95  DAETKA------KAEELKIQGNKAMANKEYELAIKKYTEAIDVLPTNAIYYANRAAAHSS 148

Query: 181 ANNFDHAIIDANKSIEIDSKIHPTNFKAYYRLGLAKYEIGDYEGSLAAFKRMIEIAQENN 240
              +D AI DA  +I +D    P+ F+ Y RLG AKY  G  E +L A+K++++I     
Sbjct: 149 LKEYDEAIKDAESAISVD----PSYFRGYSRLGFAKYAQGKPEEALEAYKKVLDI----- 199

Query: 241 KGDEITKQMDADYEKAKEKVQELFFMQITKSTGKEGSGNSVNDGPKRKVTLNDILNMAGN 300
           +GD  T  M  DYE AK++V++   ++ T +  +     +          L D+ ++ G 
Sbjct: 200 EGDNATDAMKRDYESAKKRVEQSLNLEKT-APEQPRDAGANAGQGAGAGGLPDLGSLLGG 258

Query: 301 NLNIIMSNPLFKEVVEQLLASNPQAKQQFDNVMNDPRVRQMKENVNSDSMSNIPILKDLF 360
            L  +M+NP   +  ++++ SNP A Q   N+M DP +RQM E   S      P L DL 
Sbjct: 259 GLGGLMNNPQLMQAAQKMM-SNPGAMQNIQNMMQDPSIRQMAEGFTSG--GGTPNLSDLM 315

>Kpol_1032.8 s1032 complement(15762..16793) [1032 bp, 343 aa] {ON}
           complement(15762..16793) [1032 nt, 344 aa]
          Length = 343

 Score =  159 bits (402), Expect = 7e-45,   Method: Compositional matrix adjust.
 Identities = 125/374 (33%), Positives = 196/374 (52%), Gaps = 61/374 (16%)

Query: 1   MNTTDQEIASIIVDYFNKCITSGKLNQDNVDSLNVAIDCIADVFDVDKDLISNILKTAYR 60
           M+  +++  ++IV+Y +K I   ++++DN +SLNVAIDCI+DVF++D      I+   + 
Sbjct: 1   MSLNNKDFGALIVNYLHKIIDGKEVSEDNAESLNVAIDCISDVFELDPTSEEKIINDVFN 60

Query: 61  SNDLLTYLPNGKRSALNLDKKNTTINVSVQTKDKINAYNDLSRNKDDINVPVKVIEDIEE 120
            +DL T    G    L L       NVS                         V+E   E
Sbjct: 61  KSDLKTITLKG----LGLQ------NVS------------------------DVVE--LE 84

Query: 121 TKETKVSNDDMKKAEKLKEKGNEEMKAKQYSKAIGSYSDAIKLYPTNFNYYNNRALAYIK 180
            K  ++S D  K+AE LK +GN++M  K Y  AI  YS AI++YP+N  YY+NRA AY  
Sbjct: 85  VKNEEISEDKKKEAEALKLEGNKQMSLKNYKSAIDKYSKAIEIYPSNPFYYSNRAAAYQM 144

Query: 181 ANNFDHAIIDANKSIEIDSKIHPTNFKAYYRLGLAKYEIGDYEGSLAAFKRMIEIAQENN 240
             +F +A++DAN +I++D    PT  KAY RLG AK   G+ E ++ AFK+++E+     
Sbjct: 145 IEDFTNAVLDANTAIKLD----PTYSKAYSRLGAAKLAEGNNEDAVHAFKKVLEL----- 195

Query: 241 KGDEITKQMDADYEKAKEKVQELFFMQITKSTGKEGSGNSVNDGPKRKVTLNDILNMAGN 300
           +GD+ T+ M  DYE AK+ VQ   F+ + K+         +N        L DI  + G+
Sbjct: 196 EGDKSTEVMKNDYENAKKLVQT--FVTLNKNVPDPSGPPPLN----TTDVLTDIATVLGS 249

Query: 301 NLNIIMSNP-LFKEVVEQLLASNPQAKQQFDNVMNDPRVRQMKENVN--------SDSMS 351
           +   +M+N  + +   + +   NP+  QQ + +M +P VRQ  ENV         SD ++
Sbjct: 250 SFGSLMNNTQMMQRAQQMMQTQNPEMMQQVEGLMQNPVVRQFAENVANGNGPGGLSDVLN 309

Query: 352 NIPILKDLFYSLLN 365
           N P +K++   L+N
Sbjct: 310 N-PSVKEVANGLMN 322

>KAFR0L00410 Chr12 complement(75459..76454) [996 bp, 331 aa] {ON}
           Anc_6.21 YOR007C
          Length = 331

 Score =  155 bits (392), Expect = 1e-43,   Method: Compositional matrix adjust.
 Identities = 118/349 (33%), Positives = 185/349 (53%), Gaps = 56/349 (16%)

Query: 1   MNTTDQEIASIIVDYFNKCITSGKLNQDNVDSLNVAIDCIADVFDVDKDLISNILKTAYR 60
           M  +++EI+++IVDY  K      +++D  DSLNVAIDCI D F+ ++D  S ++K+ + 
Sbjct: 1   MPLSNKEISTLIVDYLVKVTEKNDVSEDVKDSLNVAIDCITDSFEFERDSTSGLIKSKFY 60

Query: 61  SNDLLTYLPNGKRSALNLDKKNTTINVSVQTKDKINAYNDLSRNKDDINVPVKVIEDIEE 120
           +  L   L   + +  N  K+N T+NV    KD                       ++E 
Sbjct: 61  NLSLPELL---EVAMENSAKENVTVNV---PKD-----------------------ELEN 91

Query: 121 TKETKVSNDDMKKAEKLKEKGNEEMKAKQYSKAIGSYSDAIKLYPTNFNYYNNRALAYIK 180
            +ETKV      KAEKLK +GN+ M  K +  AI  YS+AI + P N  YY NRA AY  
Sbjct: 92  DEETKV------KAEKLKLEGNKAMAMKDFDLAIAKYSEAISISPNNAIYYANRAAAYSS 145

Query: 181 ANNFDHAIIDANKSIEIDSKIHPTNFKAYYRLGLAKYEIGDYEGSLAAFKRMIEIAQENN 240
             +F+ A  DA  +I +D    P   K Y RLG AKY +   E +L A+K+++++     
Sbjct: 146 LKDFEKATEDAESAIRVD----PNYSKGYSRLGFAKYALNKPEEALEAYKKVLDL----- 196

Query: 241 KGDEITKQMDADYEKAKEKVQELFFMQITKSTGKEGS-----GNSVNDGPKRKVTLNDIL 295
           +GD+ T+ M  DYE AK++V++   ++  +ST KE S      N+   G        D+ 
Sbjct: 197 EGDKATEIMKRDYETAKKRVEQSLNLEKKESTPKEESVTESAANAAAGG------FPDMS 250

Query: 296 NMAGNNLNIIMSNPLFKEVVEQLLASNPQAKQQFDNVMNDPRVRQMKEN 344
           +M G  LN +++NP   +  +Q++ S+P A  +  ++M +P +RQM EN
Sbjct: 251 SMLGGGLNGLLNNPQLMQAAQQMM-SDPNAMSKIQSMMQNPSIRQMAEN 298

>NCAS0H00830 Chr8 complement(151809..152825) [1017 bp, 338 aa] {ON}
           Anc_6.21 YOR007C
          Length = 338

 Score =  155 bits (392), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 110/372 (29%), Positives = 187/372 (50%), Gaps = 59/372 (15%)

Query: 1   MNTTDQEIASIIVDYFNKCITSGKLNQDNVDSLNVAIDCIADVFDVDKDLISNILKTAYR 60
           M+ +++E+ S+IVD+ +  I + ++++D+ DSLNVAIDCI + F+ ++D ++  L+  + 
Sbjct: 1   MSLSNKEVGSLIVDFLSTVIKNKEISEDSADSLNVAIDCITESFEFERDTVAQTLQDKFS 60

Query: 61  SNDLLTYLPNGKRSALNLDKKNTTINVSVQTKDKINAYNDLSRNKDDINVPVKVIEDIEE 120
              L   L +   ++   +K+ +                        +N+PV       E
Sbjct: 61  GKTLKEILSSASATSTGSEKEESV----------------------KVNIPV-------E 91

Query: 121 TKETKVSNDDMKKAEKLKEKGNEEMKAKQYSKAIGSYSDAIKLYPTNFNYYNNRALAYIK 180
             E K +      AE  K +GN+ M AK Y  AI  YS+AIK  PTN  YY NRA AY  
Sbjct: 92  DAEIKAT------AESFKLEGNKAMAAKDYRLAIEKYSEAIKTLPTNVIYYANRAAAYSS 145

Query: 181 ANNFDHAIIDANKSIEIDSKIHPTNFKAYYRLGLAKYEIGDYEGSLAAFKRMIEIAQENN 240
              +D+AI DA K+IEID    P   K Y RL  AKY +   E +L  +K+++++     
Sbjct: 146 VKEYDNAIKDAEKAIEID----PAYSKGYSRLAFAKYALNKPEEALEYYKKVLDM----- 196

Query: 241 KGDEITKQMDADYEKAKEKVQELFFMQITKSTGKEGSGNSVNDGPKRKVTLNDILNMAG- 299
           +GD+ T  M  D+E AK +V+    ++ + +T  E S  S    P      + + +M+  
Sbjct: 197 EGDKATPAMKRDFEMAKNRVESSMNLEKSSTTTPEPS-RSAGQQPANPFAGSGMPDMSSL 255

Query: 300 -------NNLNIIMSNPLFKEVVEQLLASNPQAKQQFDNVMNDPRVRQMKENVNS----- 347
                    L+  ++NP   +  +Q++ S+P + Q+   +M +P +R+M +N+ S     
Sbjct: 256 FGNGGGMGGLSSFLNNPQVMQAAQQMM-SDPNSMQKMQEMMQNPNLREMAQNLASGDANL 314

Query: 348 DSMSNIPILKDL 359
           D + N P +KD+
Sbjct: 315 DDLMNNPSVKDM 326

>SAKL0E01210g Chr5 complement(93267..94238) [972 bp, 323 aa] {ON}
           similar to uniprot|Q12118 Saccharomyces cerevisiae
           YOR007C SGT2 Glutamine-rich cytoplasmic protein of
           unknown function contains tetratricopeptide (TPR)
           repeats which often mediate protein-protein interactions
           conserved in human and C. elegans
          Length = 323

 Score =  154 bits (388), Expect = 4e-43,   Method: Compositional matrix adjust.
 Identities = 117/373 (31%), Positives = 191/373 (51%), Gaps = 60/373 (16%)

Query: 1   MNTTDQEIASIIVDYFNKCITSGKLNQDNVDSLNVAIDCIADVFDVDKDLISNILKTAYR 60
           M  +++EIA++IVD+ +  +    +++D  DSLNVAIDCI++ F+ ++D +S I+K ++ 
Sbjct: 1   MAQSNKEIAALIVDFLSSTVEKNAVSEDYADSLNVAIDCISEAFEFERDAVSEIVKNSFD 60

Query: 61  SNDLLTYLPNGKRSALNLDKKNTTINVSVQTKDKINAYNDLSRNKDDINVPVKVIEDIEE 120
           +  L   L   K +A  L  ++  + V                     N+P        E
Sbjct: 61  NRKLDELL---KSAATALPTQSEPVKV---------------------NIPA-------E 89

Query: 121 TKETKVSNDDMKKAEKLKEKGNEEMKAKQYSKAIGSYSDAIKLYPTNFNYYNNRALAYIK 180
              TK       KAE LK +GN+ M +K +  AI  Y++AI++ P+N  YY NRA AY  
Sbjct: 90  DANTKA------KAEDLKLQGNKAMASKDFETAIKKYTEAIEVLPSNAVYYANRAAAYSS 143

Query: 181 ANNFDHAIIDANKSIEIDSKIHPTNFKAYYRLGLAKYEIGDYEGSLAAFKRMIEIAQENN 240
              ++ ++ DA  +I    K++P+  K Y RLG AKY +G  E +L A+K +++I     
Sbjct: 144 LKKYEESVQDAESAI----KVNPSYSKGYSRLGFAKYALGKPEEALEAYKTVLDI----- 194

Query: 241 KGDEITKQMDADYEKAKEKVQELFFMQITKSTGKEGSGNSVNDGPKRKVTLNDILNMAGN 300
           +GD+ T  M  DYE AK KV++   ++ +  T  +   +S + G        D+ ++ G 
Sbjct: 195 EGDKATDVMKRDYETAKRKVEQSLNLEKSVPTQTDEQESSTDAGAGAS-GFPDMASLLGG 253

Query: 301 NLNIIMSNPLFKEVVEQLLASNPQAKQQFDNVMNDPRVRQMKENVNS--------DSMSN 352
            L  +++NP      ++L+  NP A    D +M +P VRQM EN +S        D MSN
Sbjct: 254 GLGGLLNNPQVMSAAQKLM-QNPGA---MDEMMKNPAVRQMAENFSSGGGTPNLGDLMSN 309

Query: 353 IPILKDLFYSLLN 365
            P +KD+  +L  
Sbjct: 310 -PAIKDMAKNLFG 321

>TDEL0G04480 Chr7 (813648..814679) [1032 bp, 343 aa] {ON} Anc_6.21
           YOR007C
          Length = 343

 Score =  154 bits (389), Expect = 5e-43,   Method: Compositional matrix adjust.
 Identities = 120/372 (32%), Positives = 189/372 (50%), Gaps = 55/372 (14%)

Query: 1   MNTTDQEIASIIVDYFNKCITSGKLNQDNVDSLNVAIDCIADVFDVDKDLISNILKTAYR 60
           M+ +++E+AS+IVDY ++ +    ++++ +DSLNVAIDCI + F+V K       K  + 
Sbjct: 1   MSPSNKEVASLIVDYLSQLVEKKAVSEEAIDSLNVAIDCIGESFEVQK----GDSKAVFG 56

Query: 61  SNDLLTYLPNGKRSALNLDKKNTTINVSVQTKDKINAYNDLSRNKDDINVPVKVIEDIEE 120
              L+  L N   S+    +  TT   S++                 +N+P        E
Sbjct: 57  GKGLVELLQNESGSS---SETATTQAESIK-----------------VNIPA-------E 89

Query: 121 TKETKVSNDDMKKAEKLKEKGNEEMKAKQYSKAIGSYSDAIKLYPTNFNYYNNRALAYIK 180
             ETK       KAE LK +GN+ M  K +  AI  YSDAI++ PTN  YY NRA A+  
Sbjct: 90  DAETKA------KAETLKLEGNKAMACKDFDLAIKKYSDAIEVLPTNAVYYANRAAAHSS 143

Query: 181 ANNFDHAIIDANKSIEIDSKIHPTNFKAYYRLGLAKYEIGDYEGSLAAFKRMIEIAQENN 240
              ++ AI DA  +I+ D    PT  K Y RLG AK+ +G  E +L A+K++++I     
Sbjct: 144 MKAYEEAIKDAESAIKTD----PTYSKGYSRLGYAKFALGQAEDALEAYKKVLDI----- 194

Query: 241 KGDEITKQMDADYEKAKEKVQELFFMQITKSTGKEGSGNSVNDGPKRKVTLNDILNMAGN 300
           +GD+ +  M  DYE AK+KV++   ++    T +    ++   G        D  +M G 
Sbjct: 195 EGDKASDVMKRDYETAKKKVEQSLDLEKKPET-QARGADAGAGGAGGSGGFGDFASMLGG 253

Query: 301 NLNIIMSNPLFKEVVEQLLASNPQAKQQFDNVMNDPRVRQMKEN-VNSDSMSNI------ 353
            L  +++NP   +  +Q++  NPQA  Q +++M +P VRQM EN    + M N+      
Sbjct: 254 GLGGLLNNPQLMQAAQQMM-QNPQAMSQMESMMQNPGVRQMAENFAQGNGMPNMGDLMNN 312

Query: 354 PILKDLFYSLLN 365
           P L+D+  SL  
Sbjct: 313 PALRDMAGSLFG 324

>ZYRO0C07788g Chr3 (589880..590884) [1005 bp, 334 aa] {ON} similar
           to uniprot|Q12118 Saccharomyces cerevisiae YOR007C SGT2
           Glutamine-rich cytoplasmic protein of unknown function
           contains tetratricopeptide (TPR) repeats which often
           mediate protein-protein interactions conserved in human
           and C. elegans
          Length = 334

 Score =  151 bits (382), Expect = 5e-42,   Method: Compositional matrix adjust.
 Identities = 116/368 (31%), Positives = 176/368 (47%), Gaps = 63/368 (17%)

Query: 1   MNTTDQEIASIIVDYFNKCITSGKLNQDNVDSLNVAIDCIADVFDVDKDLISNILKTAYR 60
           M  ++++I+S+IVDY    +    +++D++DSLNVAI+CI + F ++K   S     A+ 
Sbjct: 1   MAPSNKDISSLIVDYLADVVDKKSVSEDSIDSLNVAIECITEAFGIEKGSSS----AAFG 56

Query: 61  SNDLLTYLPNGKRSALNLDKKNTTINVSVQTKDKINAYNDLSRNKDDINVPVKVIEDIEE 120
             +L   L  G   A +   +N  +N+                                E
Sbjct: 57  GKNLAELLSAGA-GAPSSQGENVKVNIPA------------------------------E 85

Query: 121 TKETKVSNDDMKKAEKLKEKGNEEMKAKQYSKAIGSYSDAIKLYPTNFNYYNNRALAYIK 180
             E K       KAE LK +GN+ M  K Y  AI  YS+AI + PTN  YY NRA A+  
Sbjct: 86  DAELK------SKAESLKLEGNKAMAGKDYELAIKKYSEAISVVPTNAVYYANRAAAHSS 139

Query: 181 ANNFDHAIIDANKSIEIDSKIHPTNFKAYYRLGLAKYEIGDYEGSLAAFKRMIEIAQENN 240
             N+D AI DA  ++++DS       K Y RLG AK+  G  E +L A+K++++I     
Sbjct: 140 LKNYDEAIKDAESAVKVDSSYS----KGYSRLGYAKFAQGKSEEALEAYKKVLDI----- 190

Query: 241 KGDEITKQMDADYEKAKEKVQELFFMQIT--KSTGKEGSGNSVNDGPKRKVTLNDILNMA 298
           +GD  T  M  DYE AK KV++   +  T    T   G+G      P       D+ +M 
Sbjct: 191 EGDSATDVMKRDYETAKRKVEQALELNKTDETETSDRGTGEPAGANPGGGF---DLSSML 247

Query: 299 GNNLNIIMSNPLFKEVVEQLLASNPQAKQQFDNVMNDPRVRQMKENV-------NSDSMS 351
           G  L  +++NP   +  +Q++  NPQA  Q + +M +P VRQM E         N + + 
Sbjct: 248 GGGLGGLLNNPQVMQAAQQMM-QNPQAMSQMETMMQNPNVRQMAEKFAGGNGTPNLNDIM 306

Query: 352 NIPILKDL 359
           N P L+D+
Sbjct: 307 NNPALRDM 314

>Kwal_56.22433 s56 complement(124778..125746) [969 bp, 322 aa] {ON}
           YOR007C (SGT2) - small glutamine-rich tetratricopeptide
           repeat containing protein [contig 185] FULL
          Length = 322

 Score =  145 bits (366), Expect = 6e-40,   Method: Compositional matrix adjust.
 Identities = 109/360 (30%), Positives = 181/360 (50%), Gaps = 56/360 (15%)

Query: 1   MNTTDQEIASIIVDYFNKCITSGKLNQDNVDSLNVAIDCIADVFDVDKDLISNILKTAYR 60
           M+ +++++A++IVD+ +  + + ++++D VDSLNVAIDCI + F+ D++ ++  L+  + 
Sbjct: 1   MSPSNKDLANLIVDFLSHTVENKEVSEDYVDSLNVAIDCITEAFEFDRESVATTLEKTFA 60

Query: 61  SNDLLTYLPNGKRSALNLDKKNTTINVSVQTKDKINAYNDLSRNKDDINVPVKVIEDIEE 120
              L                K      SV +     +          +N+PV       E
Sbjct: 61  GRSL----------------KQVVEAASVGSSSPQESVK--------VNIPV-------E 89

Query: 121 TKETKVSNDDMKKAEKLKEKGNEEMKAKQYSKAIGSYSDAIKLYPTNFNYYNNRALAYIK 180
             ETK       KAE LK +GN+ M AK + +A+  YS+AI++ PTN  YY NRA A+  
Sbjct: 90  DAETKA------KAESLKLEGNKAMAAKDFEQAVLKYSEAIQVLPTNAVYYANRAAAHSS 143

Query: 181 ANNFDHAIIDANKSIEIDSKIHPTNFKAYYRLGLAKYEIGDYEGSLAAFKRMIEIAQENN 240
              ++ A+ DA  +I    K++P+  K Y RLG A+Y +G  E +L A+K++++I     
Sbjct: 144 LKKYEEAVKDAEDAI----KVNPSYSKGYSRLGFAQYALGKPEEALDAYKKVLDI----- 194

Query: 241 KGDEITKQMDADYEKAKEKVQELFFMQITKSTGKEGSGNSVNDGPKRKVTLNDILNMAGN 300
           +G+  T  M  DY+ A +KV +   + + KS     +             L DI +M G 
Sbjct: 195 EGEAATDAMKRDYDTAMKKVGQ--SLNVEKSA--PAATRDGAGSATGSGGLPDISSMLGG 250

Query: 301 NLNIIMSNPLFKEVVEQLLASNPQAKQQFDNVMNDPRVRQMKENVNSDSMSNIPILKDLF 360
            L  +++NP   +  +Q++  NP A Q+   VMN+P V+QM E   S      P + DL 
Sbjct: 251 GLGGLLNNPQLMQAAQQMM-QNPNAMQE---VMNNPAVKQMAEKFQSG--GGTPSMADLM 304

>NDAI0D00810 Chr4 complement(181659..182708) [1050 bp, 349 aa] {ON}
           Anc_6.21 YOR007C
          Length = 349

 Score =  146 bits (368), Expect = 6e-40,   Method: Compositional matrix adjust.
 Identities = 113/388 (29%), Positives = 197/388 (50%), Gaps = 59/388 (15%)

Query: 1   MNTTDQEIASIIVDYFNKCITSGKLNQDNVDSLNVAIDCIADVFDVDKDLISNILKTAYR 60
           M+  +++I ++IVD+ +  I   ++++DN DSLNVA+DCI++  + D++++   +K  + 
Sbjct: 1   MSLNNKDIGALIVDFLSTIIEKNEVSEDNADSLNVAMDCISEALEFDREVVPETIKNKFN 60

Query: 61  SNDLLTYLPNGKRSALNLDKKNTTINVSVQTKDKINAYNDLSRNKDDINVPVKVIEDIEE 120
              L+  L               T N +++ ++ +           ++N+PV       E
Sbjct: 61  GKTLVDIL---------NTTSTATANTTIEKEESV-----------EVNIPV-------E 93

Query: 121 TKETKVSNDDMKKAEKLKEKGNEEMKAKQYSKAIGSYSDAIKLYPTNFNYYNNRALAYIK 180
             E K +      AE  K +GN+ M  K +  A+  Y++AIK+ PTN  YY NRA A+  
Sbjct: 94  DAEIKAN------AEAFKLEGNKAMAMKDFHLAVEKYTEAIKILPTNAIYYANRAAAHSS 147

Query: 181 ANNFDHAIIDANKSIEIDSKIHPTNFKAYYRLGLAKYEIGDYEGSLAAFKRMIEIAQENN 240
              F+ AI DA  +I+ID    P+  K Y RL  AKY +G +E +L ++K++++I     
Sbjct: 148 LKEFEEAIKDAESAIKID----PSYSKGYSRLAFAKYGLGKHEEALESYKKVLDI----- 198

Query: 241 KGDEITKQMDADYEKAKEKVQELFFMQITKS---------TGKEGSGNSVND--GPKRKV 289
           +GD  T  M  DYE AK++V+E   ++ +K+         T +   GN+ N   G    +
Sbjct: 199 EGDNATAGMKRDYETAKKRVEESMNVEKSKTPEQGQGQQQTNESAQGNAPNPFAGGMPDM 258

Query: 290 TLNDILNMAGNNLNIIMSNPLFKEVVEQLLASNPQAKQQFDNVMNDPRVRQMKENV---N 346
           +        G  L  ++SNP F    ++L+ S+P A QQ  ++M+DP +R +  N    N
Sbjct: 259 SSLFGGAGMGGGLGSLLSNPDFMSTAQKLM-SDPNAMQQVQSMMSDPSMRDLANNFKNGN 317

Query: 347 SD--SMSNIPILKDLFYSLLNTTVYEEN 372
           +D   + N P ++++  +L      EEN
Sbjct: 318 TDMNDIMNNPAIRNMASNLFKGNPSEEN 345

>Ecym_3025 Chr3 complement(50289..51245) [957 bp, 318 aa] {ON}
           similar to Ashbya gossypii ACR005W
          Length = 318

 Score =  143 bits (360), Expect = 6e-39,   Method: Compositional matrix adjust.
 Identities = 111/362 (30%), Positives = 187/362 (51%), Gaps = 62/362 (17%)

Query: 1   MNTTDQEIASIIVDYFNKCITSGK-LNQDNVDSLNVAIDCIADVFDVDKDLISNILKTAY 59
           M  +++EIA++IV + +   TS K + ++ VDSLNVAIDCIA+ F+++++  + I+  AY
Sbjct: 1   MPGSNKEIAALIVQFLS---TSTKDVQEEYVDSLNVAIDCIAEAFEIEREDSNEIVSKAY 57

Query: 60  RSNDLLTYLPNGKRSALNLDKKNTTINVSVQTKDKINAYNDLSRNKDDINVPVKVIEDIE 119
               L+  + +G            T++ S  T            N  D + P +V E   
Sbjct: 58  NGRGLVDLVKSGA--------SEPTLSSSEPTG-----------NNTDAHAP-EVAE--- 94

Query: 120 ETKETKVSNDDMKKAEKLKEKGNEEMKAKQYSKAIGSYSDAIKLYPTNFNYYNNRALAYI 179
                        +AE LK +GN+   AK +  A+  Y++AI+L P N  +Y NRA AY 
Sbjct: 95  -------------RAENLKLEGNKAFAAKDFEGAVKKYTEAIELMPNNAVFYGNRAAAYS 141

Query: 180 KANNFDHAIIDANKSIEIDSKIHPTNFKAYYRLGLAKYEIGDYEGSLAAFKRMIEIAQEN 239
               F+ A+ DA  ++    +I+P+  + Y RLGLAKY +G  E ++ A+K++++I    
Sbjct: 142 SFKKFEEAVRDAESAV----RINPSYSRGYSRLGLAKYALGKPEEAMEAYKKVLDI---- 193

Query: 240 NKGDEITKQMDADYEKAKEKVQELFFMQ-ITKSTGKEGSGNSVNDGPKRKVTLNDILNMA 298
            +GD  T+ M  DYE AK+KV+E   ++ + K   ++ S  S   G        D+ +M 
Sbjct: 194 -EGDNATEAMKRDYESAKKKVEESLNLEALPKGEEQQTSEGSSAGG------FPDLSSML 246

Query: 299 GNNLNIIMSNPLFKEVVEQLLASNPQAKQQFDNVMNDPRVRQMKENVNSDSMSNIPILKD 358
           G  L  +++NP   +  ++++  NP A Q+   +MN+P ++QM +N  S      P L D
Sbjct: 247 GGGLGGLLNNPQVMQAAQKMM-QNPSAMQE---MMNNPAIKQMAQNFASG--GGTPNLGD 300

Query: 359 LF 360
           + 
Sbjct: 301 MM 302

>TBLA0A07270 Chr1 complement(1811640..1812761) [1122 bp, 373 aa]
           {ON} Anc_6.21 YOR007C
          Length = 373

 Score =  141 bits (355), Expect = 9e-38,   Method: Compositional matrix adjust.
 Identities = 110/379 (29%), Positives = 205/379 (54%), Gaps = 38/379 (10%)

Query: 1   MNTT---DQEIASIIVDYFNKCITSGKLNQDNVDSLNVAIDCIADVFDVDKDLISNILKT 57
           M+TT   D+++A +IV++    I+  +++QDN+DSLNVAIDCI   +++++  IS+ L  
Sbjct: 1   MSTTQINDKDVACLIVNFLENVISKKEISQDNIDSLNVAIDCIQQCYNLNEAYISSSLIL 60

Query: 58  AYRSNDLLTYLPN----------GKRSALNLDKKNTTINVSVQTKDKINAYNDLSRNKDD 107
            +  +DL + L N            +    L  + +++N SV+ K++ N  ND   N + 
Sbjct: 61  KFSKSDLTSILNNFAKNNYKNITSTKETTPLTLEPSSLNESVK-KNQSNISND---NNEK 116

Query: 108 INVPVKVIEDIEETKETKVSNDDMKKAEKLKEKGNEEMKAKQYSKAIGSYSDAIKLYPTN 167
           I++      ++ +T +   S+ D + A+  K++GN  M ++ Y KAI  Y++AI  YP +
Sbjct: 117 ISI------NLNDTSKNNFSDKDKQIADTFKDEGNRLMFSEDYKKAIECYTNAISKYPCD 170

Query: 168 FNYYNNRALAYIKANNFDHAIIDANKSIEIDSKIHPTNF-KAYYRLGLAKYEIGDYEGSL 226
             YY+NR++AY+K N+++ AI DAN  I ID+     NF KAY RL   K +   Y  +L
Sbjct: 171 PIYYSNRSVAYLKVNDYESAINDANFCISIDA-----NFSKAYIRLANIKVQQHQYIDAL 225

Query: 227 AAFKRMIEIAQENNKGDEITKQMDADYEKAKEKVQ-ELFFMQITKSTGKEGSGNSVNDGP 285
             +K+ IE+ +     D + +++  ++E  K KVQ ++   +I+          +  +  
Sbjct: 226 DYYKKFIELNK-----DSVPEKITREFEDLKLKVQTDISLREISNDHSNNNYNENSYNST 280

Query: 286 KRKVTLNDILNMAGNNLNIIMSNPLFKEVVEQLLASNPQAKQQFDNVMNDPRVRQMKENV 345
           K    +  IL   G+    ++SNP+ ++++ +++ +NP A +    V+ +P ++ + +N 
Sbjct: 281 KNSPDIGSIL---GDGFAALLSNPMLQQMIFKIIQNNPDAAKNIGYVLANPAMKNLLQNF 337

Query: 346 NSDSMSNIPILKDLFYSLL 364
            + S  +  +  DL  SLL
Sbjct: 338 KNGSAFDKKLFMDLLDSLL 356

>KLTH0C11220g Chr3 (920972..921955) [984 bp, 327 aa] {ON} similar to
           uniprot|Q12118 Saccharomyces cerevisiae YOR007C SGT2
           Glutamine-rich cytoplasmic protein of unknown function
           contains tetratricopeptide (TPR) repeats which often
           mediate protein-protein interactions conserved in human
           and C. elegans
          Length = 327

 Score =  129 bits (323), Expect = 1e-33,   Method: Compositional matrix adjust.
 Identities = 104/364 (28%), Positives = 170/364 (46%), Gaps = 59/364 (16%)

Query: 1   MNTTDQEIASIIVDYFNKCITSGKLNQDNVDSLNVAIDCIADVFDVDKDLISNILKTAYR 60
           MN T +E+AS+I+DY  +     ++ +D +DSLNVAIDC+ + F+V+K+  S++++ ++ 
Sbjct: 1   MNPTKKELASLIIDYLCRTAEGKEIGEDYIDSLNVAIDCVTEAFEVEKESASSVIEKSFG 60

Query: 61  SNDLLTYLPNGKRSALNLDKKNTTINVSVQTKDKINAYNDLSRNKDDINVPVKVIEDIEE 120
              L           +    K  T       K               +N+PV       E
Sbjct: 61  GQSL--------EQIVGASSKGPTATQQEPVK---------------VNIPV-------E 90

Query: 121 TKETKVSNDDMKKAEKLKEKGNEEMKAKQYSKAIGSYSDAIKLYPTNFNYYNNRALAYIK 180
             E K       KAE LK +GN+ M  K +  AI  YS+AI+  P+N  Y+ NRA AY  
Sbjct: 91  DAEIKA------KAEALKLEGNKAMATKDFEHAISKYSEAIRTLPSNAVYFANRAAAYSS 144

Query: 181 ANNFDHAIIDANKSIEIDSKIHPTNFKAYYRLGLAKYEIGDYEGSLAAFKRMIEIAQENN 240
              +  A+ DA  +I    K++P+  K Y RLG A+Y +G  E +L A+K++++I     
Sbjct: 145 LKKYAEAVEDAEAAI----KVNPSYSKGYSRLGFAQYALGRPEEALDAYKKVLDI----- 195

Query: 241 KGDEITKQMDADYEKAKEKVQELFFMQITKSTGKEGSGNSVNDGPKRKVTLNDILNMAGN 300
           +G   T  M  DY+ A +KV++   ++ +              G        DI +M G 
Sbjct: 196 EGSNATDAMKRDYDTAMKKVEQSLNVERSAPAASNAESPDAAGG----SGFPDIASMLGG 251

Query: 301 NLNIIMS----NPLFKEVVEQLLASNPQAKQQFDNVMNDPRVRQMKENVNSDSMSNIPIL 356
            L   +     NP   +  +Q++  NP A Q+   +M++P ++QM +   S      P +
Sbjct: 252 GLGGGLGGLLKNPQVMQAAQQMM-QNPNAMQE---MMSNPAIKQMADKFQSG--GGTPSM 305

Query: 357 KDLF 360
            DL 
Sbjct: 306 ADLM 309

>KLLA0D01155g Chr4 complement(104847..105854) [1008 bp, 335 aa] {ON}
           similar to uniprot|Q12118 Saccharomyces cerevisiae
           YOR007C SGT2 Glutamine-rich cytoplasmic protein of
           unknown function contains tetratricopeptide (TPR)
           repeats which often mediate protein-protein interactions
           conserved in human and C. elegans
          Length = 335

 Score =  119 bits (299), Expect = 4e-30,   Method: Compositional matrix adjust.
 Identities = 107/380 (28%), Positives = 177/380 (46%), Gaps = 89/380 (23%)

Query: 1   MNTTDQEIASIIVDYFNKCITSGKLNQDNVDSLNVAIDCIADVFDVDKDLISNILKTAYR 60
           M+ +++EIA++IVD+ +   +S  +N+D VDSLNVAIDCI + F  ++D   +++   + 
Sbjct: 1   MSLSNKEIAALIVDFLSSSSSS--VNEDYVDSLNVAIDCITEAFQFERDETDSLISGPF- 57

Query: 61  SNDLLTYLPNGKRSALNLDKKNTTINVSVQTKDKINAYNDLSRNKDDINVPVKVIEDIEE 120
                    NGK+    L    ++  VS +                    PVKV   +E+
Sbjct: 58  ---------NGKKLPELLASAPSSGGVSGE--------------------PVKVHIPVED 88

Query: 121 TKETKVSNDDMKKAEKLKEKGNEEMKAKQYSKAIGSYSDAIKLYPTNFNYYNNRALAYIK 180
                 +        +LK +GN+ M AK++ +AI  Y+ AI++ P+N  YY+NRA AY  
Sbjct: 89  AAAKAKAE-------ELKLQGNKAMAAKKFDEAIEKYTAAIEVSPSNAVYYSNRAAAYSS 141

Query: 181 ANNFDHAIIDANKSIEIDSKIHPTNFKAYYRLGLAKYEIGDYEGSLAAFKRMIEIAQENN 240
              ++ A+ DA ++IE+D    PT  K + RLG AKY +   E +L A+K++++I     
Sbjct: 142 LKQYEQAVKDAEQAIEVD----PTYSKGFSRLGFAKYALNKPEEALDAYKKVLDI----- 192

Query: 241 KGDEITKQMDADYEKAKEKVQELFFMQITKSTGKEGSGNSVND----------------- 283
           +G++ T  M  DYE AK+KV+    M + KS+    S   V+D                 
Sbjct: 193 EGEKATDVMKRDYETAKKKVET--SMNLEKSS-TSASSEDVSDKSATEGPGAGAGGLPDL 249

Query: 284 ------------------GPKRKVTLNDILNMAGNNLNIIMSNPLFKEVVEQLLASNPQA 325
                              P+       ++   G  +  +MSNP  K++  Q   S+   
Sbjct: 250 SSLLGGGGLGGGLGALLNNPQVMQAAEKMMQNPG-LMQDMMSNPAMKQMANQF--SSGGG 306

Query: 326 KQQFDNVMNDPRVRQMKENV 345
                 +MNDP +R M +N+
Sbjct: 307 MPDLSQMMNDPSIRDMAKNM 326

>ACR005W Chr3 (363355..364338) [984 bp, 327 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YOR007C (SGT2)
          Length = 327

 Score =  118 bits (296), Expect = 9e-30,   Method: Compositional matrix adjust.
 Identities = 84/264 (31%), Positives = 127/264 (48%), Gaps = 57/264 (21%)

Query: 1   MNTTDQEIASIIVDYFNKCITSGK-LNQDNVDSLNVAIDCIADVFDVDKDLISNILKTAY 59
           M+ ++++IA++IVD+     TS K + +D  DSL VAIDCI + F++       ++    
Sbjct: 1   MSPSNKDIAALIVDFLT---TSAKTVGEDYEDSLKVAIDCITEAFELGPGEADTLVSEKC 57

Query: 60  RSNDLLTYLPNGKRSALNLDKKNTTINVSVQTKDKINAYNDLSRNKDDINVPVKVIEDIE 119
               L   L  G                                           +    
Sbjct: 58  GGRSLSQLLTTG-------------------------------------------MAHTS 74

Query: 120 ETKETKVSNDDMKK-AEKLKEKGNEEMKAKQYSKAIGSYSDAIKLYPTNFNYYNNRALAY 178
           +  E KV+ +++KK AE LK +GN  M AK Y  AI  Y+ AI++ PT+  YY NRA AY
Sbjct: 75  DAGEPKVAAEELKKEAEALKLEGNRAMAAKDYETAIQKYTAAIEVLPTDAVYYANRAAAY 134

Query: 179 IKANNFDHAIIDANKSIEIDSKIHPTNFKAYYRLGLAKYEIGDYEGSLAAFKRMIEIAQE 238
                ++ A+ DA K+ ++DS       K + RLG AKY +G +E +L A+KR+++I   
Sbjct: 135 SSLQQYEKAVEDAEKATKVDSSYS----KGFSRLGYAKYALGRHEEALEAYKRVLDI--- 187

Query: 239 NNKGDEITKQMDADYEKAKEKVQE 262
             +GD  T+ M  DYE AK KV+E
Sbjct: 188 --EGDNATEAMRRDYESAKRKVEE 209

>NCAS0D02670 Chr4 complement(512529..513584) [1056 bp, 351 aa] {ON}
           Anc_6.21 YOR007C
          Length = 351

 Score = 95.9 bits (237), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 91/372 (24%), Positives = 163/372 (43%), Gaps = 95/372 (25%)

Query: 1   MNTTDQEIASIIVDYFNKCITSGKLNQDNVDSLNVAIDCIADVFDVDKDLISNILKTAYR 60
           M+ +++EIAS IV Y +  I +G++ +D  +S++VAI+CI D FD+ +++ ++       
Sbjct: 1   MSLSNKEIASRIVSYLSSLIRTGQVTEDYAESISVAIECIRDSFDLQEEVSAD------- 53

Query: 61  SNDLLTYLPNGKRSALNLDKKNTTINVSVQTKDKINAYNDLSRNKDDINVPVKVIEDIEE 120
            +DL T L                 N++++ + K++                        
Sbjct: 54  -SDLATVL---------------LANLNLEPEPKLS------------------------ 73

Query: 121 TKETKVSNDDMKKAEKLKEKGNEEMKAKQYSKAIGSYSDAIKL-----YPTNFNYYNNRA 175
            KE ++ N+   +A KLK +GN+ ++ + Y  AI  Y+ AI L      P +  Y +N++
Sbjct: 74  EKERELVNE---QAIKLKLEGNKAVERENYKDAIDKYTRAIDLLKKNGLPVDRGYLSNKS 130

Query: 176 LAYIKANNFDHAIIDANKSIEIDSKIHPTNFKAYYRLGLAKYEIGDYEGSLAAFKRMIEI 235
           LA  K+  ++ A  DA   I+ID    PT  K Y RL  AK     YE ++ A+K+++++
Sbjct: 131 LALTKSGRYEEACDDALACIKID----PTFSKGYSRLAEAKIGQNKYEDAMNAYKQVLDL 186

Query: 236 AQENNKGDEITKQMDADYEKAKEKVQELFFMQITKSTGKEGSGNSVN------------- 282
                +G++ T  M  D+E  K+K + L F     S        + N             
Sbjct: 187 -----EGNKATDTMKRDFEITKQKFETLNFSTHIDSGSATPISEAANKYPPKDEEIRTRS 241

Query: 283 -----DGPKRKVTLND-------------ILNMAGNNLNIIMSNPLFKEVVEQLLASNPQ 324
                D P  +   N+             I  + GN +  I++NP  +  +      NP 
Sbjct: 242 SLVKVDVPAEQTNTNEEHSTPNTNTPRFNIAQLIGNGIGTILNNPQVQLALSHFAQRNPD 301

Query: 325 AKQQFDNVMNDP 336
           A ++   + N+P
Sbjct: 302 AARKVQEISNNP 313

>NDAI0I02240 Chr9 (512140..513192) [1053 bp, 350 aa] {ON} Anc_6.21
           YOR007C
          Length = 350

 Score = 94.0 bits (232), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 106/397 (26%), Positives = 172/397 (43%), Gaps = 110/397 (27%)

Query: 1   MNTTDQEIASIIVDYFNKCITSGKLNQDNVDSLNVAIDCIADVFDVDKDLISNILKTAYR 60
           M+ T ++ AS+I+ Y +    +  L++D  +SL VAI CI + F +D D    IL T+ +
Sbjct: 1   MSLTKEQTASLIISYLSYLTNNNVLDEDKKESLRVAITCIGESFSLDGD----ILPTSLK 56

Query: 61  SNDLLTYLPNGKRSALNLDKKNTTINVSVQTKDKINAYNDLSRNKDDINVPVKVIEDIEE 120
              L T L                                    ++++N        +E 
Sbjct: 57  ERTLKTIL------------------------------------QENLNT-------LEA 73

Query: 121 TKETKVSNDDMKKAEKLKEKGNEEMKAKQYSKAIGSYSDAIKLYPTNFNYYNNRALAYIK 180
           T+  K+ N++   AE LK++GNE M   QY +AI  Y++AI+ +  N  YY+NR+LAY K
Sbjct: 74  TQ--KIHNEE---AEALKKEGNEAMIEGQYEEAIKKYTEAIQ-FSKNVAYYSNRSLAYSK 127

Query: 181 ANNFDHAIIDANKSIEIDSKIHPTNFKAYYRLGLAKYEIGDYEGSLAAFKRMIEIAQENN 240
              ++ A+ DA  +I ID    P+  KAY RLG AK      E  + A+KR I++     
Sbjct: 128 LGRYEDAVNDATLAINID----PSFSKAYSRLGYAKCCQDKLEDGMTAYKRAIDL----- 178

Query: 241 KGDEITKQMDADYEKAKEKVQEL----------FFMQITKSTGKEGSGNSV--------- 281
           +G   +K +  DYE A+ K ++L             ++T     E + N           
Sbjct: 179 EGTNASKTLYDDYEDARFKYEQLKKNDDSEERKSIKEVTSEECPEKNNNQDEGFTAVNHY 238

Query: 282 ---NDGPKRKVTLNDILNMAGNNLNIIMSNPLFKEVVEQLLASNPQAKQQFDNVMNDPRV 338
              ND   ++ T  +  + A +  NI            +LL S          +MN+P++
Sbjct: 239 AQNNDNKSKEETKEENRSQAADLSNIA-----------RLLGSG------VGGLMNNPQL 281

Query: 339 RQM---KENVNSDSMSNI------PILKDLFYSLLNT 366
           +QM     N N D+   +      P+L+     L+NT
Sbjct: 282 KQMVFQAINDNPDASRQVKDVLNNPLLRTTLSELMNT 318

>SAKL0F03102g Chr6 (258266..259807) [1542 bp, 513 aa] {ON} highly
           similar to uniprot|P53043 Saccharomyces cerevisiae
           YGR123C
          Length = 513

 Score = 73.6 bits (179), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 41/92 (44%), Positives = 60/92 (65%), Gaps = 4/92 (4%)

Query: 124 TKVSNDDMKKAEKLKEKGNEEMKAKQYSKAIGSYSDAIKLYPTNFNYYNNRALAYIKANN 183
           +  S++D+ KA + K +GN  +K K +SKA   YS AI+L  T   Y++NRA A++K +N
Sbjct: 2   SSASDEDVNKALEFKNQGNVFIKGKNFSKAAELYSKAIELDGTQSIYFSNRAFAHLKLDN 61

Query: 184 FDHAIIDANKSIEIDSKIHPTNFKAYYRLGLA 215
           F  A+ D NK+IE+D    P N KAY+R GL+
Sbjct: 62  FQTALNDCNKAIELD----PKNVKAYHRRGLS 89

>TBLA0C03950 Chr3 complement(950339..951877) [1539 bp, 512 aa] {ON}
           Anc_3.481 YGR123C
          Length = 512

 Score = 70.9 bits (172), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 39/92 (42%), Positives = 58/92 (63%), Gaps = 4/92 (4%)

Query: 124 TKVSNDDMKKAEKLKEKGNEEMKAKQYSKAIGSYSDAIKLYPTNFNYYNNRALAYIKANN 183
           TK S  D  KA + K +GN+ +K + Y  AI  Y++AIKL  T   Y++NRA+ ++K +N
Sbjct: 2   TKPSAADAAKALEFKNRGNDAIKTQDYPGAIELYTEAIKLDDTVSIYFSNRAMGHLKMDN 61

Query: 184 FDHAIIDANKSIEIDSKIHPTNFKAYYRLGLA 215
           F   I D +K++EID    P N KAY+R G++
Sbjct: 62  FQSGINDCDKALEID----PKNIKAYHRRGMS 89

>Kpol_505.41 s505 complement(91130..92671) [1542 bp, 513 aa] {ON}
           complement(91130..92671) [1542 nt, 514 aa]
          Length = 513

 Score = 70.5 bits (171), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 41/92 (44%), Positives = 59/92 (64%), Gaps = 4/92 (4%)

Query: 124 TKVSNDDMKKAEKLKEKGNEEMKAKQYSKAIGSYSDAIKLYPTNFNYYNNRALAYIKANN 183
           T  + +D+ KA + K +GN  +K + YSKAI  Y+ AI+L P    +Y+NRALA +K +N
Sbjct: 2   TSPTAEDIAKAVEFKNEGNVFIKEQNYSKAIELYTKAIELDPNQSIFYSNRALAQLKLDN 61

Query: 184 FDHAIIDANKSIEIDSKIHPTNFKAYYRLGLA 215
           F  A  D N+++ +DSK    N KAY+R GLA
Sbjct: 62  FQSAYNDCNEALTLDSK----NVKAYHRRGLA 89

>TPHA0D03220 Chr4 complement(662868..664409) [1542 bp, 513 aa] {ON}
           Anc_3.481 YGR123C
          Length = 513

 Score = 68.9 bits (167), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 39/97 (40%), Positives = 58/97 (59%), Gaps = 4/97 (4%)

Query: 127 SNDDMKKAEKLKEKGNEEMKAKQYSKAIGSYSDAIKLYPTNFNYYNNRALAYIKANNFDH 186
           S +D+  A   K KGNE +K   Y  AI  YS AI L  T   Y++NRALA++K +NF  
Sbjct: 5   SQEDIATALDFKNKGNEYIKKSDYDSAIEFYSKAIALDSTQSIYFSNRALAHLKQDNFYS 64

Query: 187 AIIDANKSIEIDSKIHPTNFKAYYRLGLAKYEIGDYE 223
           A++D + ++++D    P N KAY+R GL+   I ++ 
Sbjct: 65  AVVDCDNALKLD----PKNIKAYHRRGLSYVGILEFR 97

>AAR083C Chr1 complement(492375..493991) [1617 bp, 538 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YGR123C
           (PPT1)
          Length = 538

 Score = 68.6 bits (166), Expect = 6e-12,   Method: Compositional matrix adjust.
 Identities = 43/123 (34%), Positives = 71/123 (57%), Gaps = 10/123 (8%)

Query: 128 NDDMKKAEKL--KEKGNEEMKAKQYSKAIGSYSDAIKLYPTNFNYYNNRALAYIKANNFD 185
            D M  A  L  K +GNE +KAK Y++A+ +Y+ AI+   T   +++NRALA +K + F 
Sbjct: 30  RDSMTAATALDYKNEGNEWVKAKDYARAVEAYTRAIEADGTQSIFFSNRALANLKLDRFQ 89

Query: 186 HAIIDANKSIEIDSKIHPTNFKAYYRLGLAKYEIGDYEGSLAAFKRMIEIAQENNKGDEI 245
            A+ D+ ++IE+D+     N KAY+R GLA   + ++  +    KR +E+      GDE 
Sbjct: 90  SALEDSARAIELDA----GNVKAYHRRGLAHCGLLEWGPA----KRDLEVVVRAKPGDEA 141

Query: 246 TKQ 248
            ++
Sbjct: 142 VRR 144

>KNAG0A07900 Chr1 complement(1258164..1259702) [1539 bp, 512 aa]
           {ON} Anc_3.481 YGR123C
          Length = 512

 Score = 68.2 bits (165), Expect = 8e-12,   Method: Compositional matrix adjust.
 Identities = 39/89 (43%), Positives = 59/89 (66%), Gaps = 4/89 (4%)

Query: 127 SNDDMKKAEKLKEKGNEEMKAKQYSKAIGSYSDAIKLYPTNFNYYNNRALAYIKANNFDH 186
           S  D + A K K++GN  +K++ Y KAI  Y+ AI+L  T+  +Y+NRALA++K +NF  
Sbjct: 5   SKPDAEAALKFKDEGNVYIKSQDYQKAIELYTKAIELDSTSSIFYSNRALAHLKLDNFQS 64

Query: 187 AIIDANKSIEIDSKIHPTNFKAYYRLGLA 215
           A+ D N +I++D+     N KAY+R GLA
Sbjct: 65  ALHDCNDAIKLDN----NNIKAYHRRGLA 89

>NDAI0B05790 Chr2 complement(1406039..1407610) [1572 bp, 523 aa]
           {ON} Anc_3.481
          Length = 523

 Score = 67.4 bits (163), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 36/93 (38%), Positives = 60/93 (64%), Gaps = 4/93 (4%)

Query: 124 TKVSNDDMKKAEKLKEKGNEEMKAKQYSKAIGSYSDAIKLYPTNFNYYNNRALAYIKANN 183
           T  + +  ++A  LK +GN+ +K K+Y+KA+  Y+ AI+L  T   +++NRALA +K +N
Sbjct: 3   TTPTTEAAQQAIDLKNEGNKYIKEKKYTKAVEYYTKAIELDSTQSIFFSNRALAQLKLDN 62

Query: 184 FDHAIIDANKSIEIDSKIHPTNFKAYYRLGLAK 216
           F   + D N ++E+D    P N KAY+R GL++
Sbjct: 63  FQSCLDDCNSALELD----PKNIKAYHRRGLSQ 91

>TBLA0I02310 Chr9 (528067..528417) [351 bp, 116 aa] {ON} Anc_6.328
           YCR060W
          Length = 116

 Score = 62.4 bits (150), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 38/92 (41%), Positives = 53/92 (57%), Gaps = 3/92 (3%)

Query: 135 EKLKEKGNEEMKAKQYSKAIGSYSDAIKLYPTNFNYYNNRALAYIKANNFDHAIIDANKS 194
           E+LK KGN   K   YS+AI  Y+  I + P+N   Y+N+A+A +KA+ FD AI    K 
Sbjct: 4   EELKAKGNISFKNGSYSEAISWYNRCISIDPSNPIGYSNKAMALLKADRFDEAITTCEKG 63

Query: 195 IEIDSKIHPTNF---KAYYRLGLAKYEIGDYE 223
           +++ SK  P N    K  YRL  AK  + DY+
Sbjct: 64  LQLISKEDPENLIKQKLEYRLQSAKSSLRDYQ 95

>TPHA0D02880 Chr4 (599288..601045) [1758 bp, 585 aa] {ON} Anc_5.617
           YOR027W
          Length = 585

 Score = 66.6 bits (161), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 40/117 (34%), Positives = 66/117 (56%), Gaps = 5/117 (4%)

Query: 134 AEKLKEKGNEEMKAKQYSKAIGSYSDAIKLYP-TNFNYYNNRALAYIKANNFDHAIIDAN 192
           A++ K++GN    AK+Y KA+  +S AI++ P  N   Y+NR+  Y     F  A+ DAN
Sbjct: 5   ADEYKQQGNTAFSAKEYEKAVDLFSKAIEVSPEPNHVLYSNRSACYTSLKKFTDALNDAN 64

Query: 193 KSIEIDSKIHPTNFKAYYRLGLAKYEIGDYEGSLAAFKRMIEIAQENNKGDEITKQM 249
           +     +KI+PT  K Y R+G A Y +GD + +  ++K+ +E+   N    E  +Q+
Sbjct: 65  EC----TKINPTWSKGYNRVGAAHYGLGDLDEAEKSYKKALELDASNKVAQEGLEQV 117

 Score = 52.4 bits (124), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 54/211 (25%), Positives = 95/211 (45%), Gaps = 36/211 (17%)

Query: 132 KKAEKLKEKGNEEMKAKQYSKAIGSYSDAIKLYPTNFNYYNNRALAYIKANNFDHAIIDA 191
           +KAE+ + +G +     Q+  A+ +Y++ I   P +   Y+NRA A  K  +F  AI D 
Sbjct: 390 EKAEEARIQGKDFFNKGQWPDAVKAYTEMIARAPDDARAYSNRAAALSKLMSFPEAISDC 449

Query: 192 NKSIEIDSKIHPTNFKAYYRLGLAKYEIGDYEGSLAAFKRMIEIAQ----ENNKGDEITK 247
            K++E D    P   KAY R   A+  I +Y  +L      ++IA+    E N G  I  
Sbjct: 450 EKALEKD----PNFVKAYIRKATAQIAIKEYSSAL----ETLDIARSKDTELNNGSNI-- 499

Query: 248 QMDADYEKAKEKVQELFFMQITKSTGKEGSGNSVNDGPKRKVTLNDILNMAGNNLNIIMS 307
                      ++ +L+     K+T +     S N+ P++         M    +  IM 
Sbjct: 500 ----------REINQLY----AKATQQRFEPASSNETPEQTYQ----RAMKDPEVAAIMQ 541

Query: 308 NPLFKEVVEQLLASNPQAKQQFDNVMNDPRV 338
           +P+ + +++Q   +NP A Q+    M +P +
Sbjct: 542 DPVMQSILQQ-AQTNPAALQEH---MKNPEI 568

 Score = 32.3 bits (72), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 22/59 (37%), Positives = 32/59 (54%), Gaps = 5/59 (8%)

Query: 180 KANNFDHAIIDANKSIEIDSKIHPTNFKAYYRLGLAKYEIGDYEGSLAAFKRMIEIAQE 238
           KA+ FD AI   +K+ E+ + I   N KA      A+YE GDYE ++   +  IE  +E
Sbjct: 270 KAHKFDEAIEHYDKAWELHNDITYLNNKA-----AAQYEKGDYETTIKTLEDAIEKGRE 323

>KLTH0F14542g Chr6 complement(1191800..1193341) [1542 bp, 513 aa]
           {ON} highly similar to uniprot|P53043 Saccharomyces
           cerevisiae YGR123C
          Length = 513

 Score = 65.5 bits (158), Expect = 7e-11,   Method: Compositional matrix adjust.
 Identities = 39/110 (35%), Positives = 66/110 (60%), Gaps = 4/110 (3%)

Query: 126 VSNDDMKKAEKLKEKGNEEMKAKQYSKAIGSYSDAIKLYPTNFNYYNNRALAYIKANNFD 185
           VS +  +KA + K +GN  +K K+Y +A+  YS AI+L  T   +++NRA + +K +NF 
Sbjct: 4   VSEEAAQKALEFKNQGNAFIKEKKYPEAVEYYSKAIELDDTQSIFFSNRAFSRLKLDNFL 63

Query: 186 HAIIDANKSIEIDSKIHPTNFKAYYRLGLAKYEIGDYEGSLAAFKRMIEI 235
            A+ D NKSIE+D    P N KA +R GL+   + ++  +    K ++++
Sbjct: 64  TALEDCNKSIELD----PKNIKAIHRRGLSYVGLLEFSKARKDLKTILQV 109

>NDAI0F00910 Chr6 complement(223205..224956) [1752 bp, 583 aa] {ON}
          Length = 583

 Score = 65.5 bits (158), Expect = 7e-11,   Method: Compositional matrix adjust.
 Identities = 39/110 (35%), Positives = 65/110 (59%), Gaps = 5/110 (4%)

Query: 134 AEKLKEKGNEEMKAKQYSKAIGSYSDAIKLYPT-NFNYYNNRALAYIKANNFDHAIIDAN 192
           A++ K++GN    +K ++KAI  ++ AI++ PT N   Y+NR+ AY  A  F  A+ DA 
Sbjct: 5   ADEYKQQGNAAFTSKDFNKAIELFTKAIEVSPTPNHVLYSNRSAAYTSAKQFQEALNDAT 64

Query: 193 KSIEIDSKIHPTNFKAYYRLGLAKYEIGDYEGSLAAFKRMIEIAQENNKG 242
           + +    KI+PT  K Y RLG A++ +G+ E +   +K  +++   NNK 
Sbjct: 65  ECV----KINPTWSKGYNRLGAAEFGLGNLEEAEKNYKEALKLDNNNNKA 110

 Score = 49.3 bits (116), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 55/213 (25%), Positives = 90/213 (42%), Gaps = 36/213 (16%)

Query: 130 DMKKAEKLKEKGNEEMKAKQYSKAIGSYSDAIKLYPTNFNYYNNRALAYIKANNFDHAII 189
           D +KAE+ + +G E      +  A+ +YS+ IK  P +   Y+NRA A  K  +F  AI 
Sbjct: 385 DPEKAEEARLEGKEYFTKGDWPNAVKAYSEMIKRAPEDARGYSNRAAALSKLMSFPEAIK 444

Query: 190 DANKSIEIDSKIHPTNFKAYYRLGLAKYEIGDYEGSLAAFKRMIEIAQENNKG---DEIT 246
           D + +I+ D    P   +AY R   A+  I +Y  +L   +         N G   +EI 
Sbjct: 445 DCDNAIKKD----PNFVRAYIRKATAQIAIKEYANALDTLEEAKSKDSSVNNGANSNEIM 500

Query: 247 K-QMDADYEKAKEKVQELFFMQITKSTGKEGSGNSVNDGPKRKVTLNDILNMAGNNLNII 305
           + QM A         QE F       T +E    ++ D                  +  I
Sbjct: 501 RLQMKA--------TQERFQAPTGNETPEETYKRAMQDP----------------EVAAI 536

Query: 306 MSNPLFKEVVEQLLASNPQAKQQFDNVMNDPRV 338
           M +P+ + +++Q   +NP A Q+    M +P +
Sbjct: 537 MQDPVMQSILQQ-AQTNPAALQEH---MKNPEI 565

 Score = 40.4 bits (93), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 36/136 (26%), Positives = 72/136 (52%), Gaps = 13/136 (9%)

Query: 133 KAEKLKEKGNEEMKAKQYSKAIGSYSDAIKLYPTNFNYYNNRALAYIKANNFDHAI---- 188
           +A++ K +GN+  KA ++ +AI  Y+ A  L   +  Y NNR+ A  +  +F+ AI    
Sbjct: 254 EADEAKVEGNKLYKAHKFDEAIEQYNKAWALN-KDITYLNNRSAAEFEKGDFETAIATLN 312

Query: 189 --IDANKSIEIDSKIHPTNFKAYYRLGLAKYEIGDYEGSLAAFKRMIEIAQENNKGDEIT 246
             +D  + +  D KI     K++ R+G A ++ GD + S+  +++ +    E+   D +T
Sbjct: 313 EAVDQGRELRADYKIIA---KSFARIGNAYHKKGDLKKSIDYYQKSL---TEHRTADILT 366

Query: 247 KQMDADYEKAKEKVQE 262
           K  + + E  K++ ++
Sbjct: 367 KLRNCEKELKKQEAEQ 382

>CAGL0D05060g Chr4 complement(486065..487597) [1533 bp, 510 aa] {ON}
           highly similar to uniprot|P53043 Saccharomyces
           cerevisiae YGR123c PPT1 protein ser/thr phosphatase
          Length = 510

 Score = 64.3 bits (155), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 37/86 (43%), Positives = 53/86 (61%), Gaps = 4/86 (4%)

Query: 130 DMKKAEKLKEKGNEEMKAKQYSKAIGSYSDAIKLYPTNFNYYNNRALAYIKANNFDHAII 189
           D  KA + K +GN  +K + Y+KAI  Y  AI+L  T   Y++NRAL ++K +NF  A  
Sbjct: 5   DADKALEYKNEGNACVKVQDYAKAIEKYDKAIELDDTQSVYFSNRALCHLKLDNFQCASQ 64

Query: 190 DANKSIEIDSKIHPTNFKAYYRLGLA 215
           D +K++ +D    P N KAY+R GLA
Sbjct: 65  DCDKALALD----PKNVKAYHRRGLA 86

>CAGL0H08195g Chr8 complement(804418..806169) [1752 bp, 583 aa] {ON}
           highly similar to uniprot|P15705 Saccharomyces
           cerevisiae YOR027w STI1
          Length = 583

 Score = 63.5 bits (153), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 38/106 (35%), Positives = 60/106 (56%), Gaps = 5/106 (4%)

Query: 131 MKKAEKLKEKGNEEMKAKQYSKAIGSYSDAIKLYPT-NFNYYNNRALAYIKANNFDHAII 189
           M  A++ K++GN    AK Y KAI  +S AI++  T N  +Y+NR+  Y     F  A+ 
Sbjct: 1   MTTADEYKQQGNAAFVAKDYEKAIDLFSKAIEVSETPNHVFYSNRSACYASLKKFPEALN 60

Query: 190 DANKSIEIDSKIHPTNFKAYYRLGLAKYEIGDYEGSLAAFKRMIEI 235
           DA + +    KI+PT  K Y RLG A   +GD + +  ++K+ +E+
Sbjct: 61  DAEECV----KINPTWSKGYNRLGAAHLGLGDLDEAEGSYKKALEL 102

 Score = 48.5 bits (114), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 29/95 (30%), Positives = 50/95 (52%), Gaps = 4/95 (4%)

Query: 132 KKAEKLKEKGNEEMKAKQYSKAIGSYSDAIKLYPTNFNYYNNRALAYIKANNFDHAIIDA 191
           +KAE+ + +G +      +  A+ +Y++ IK  P +   Y+NRA A  K  +F  AI D 
Sbjct: 388 EKAEEARLEGKDYFTKGDWPNAVKAYTEMIKRAPEDARGYSNRAAALSKLMSFPEAIEDC 447

Query: 192 NKSIEIDSKIHPTNFKAYYRLGLAKYEIGDYEGSL 226
           NK+IE D    P   +AY R   A+  + ++  ++
Sbjct: 448 NKAIEKD----PNFIRAYIRKATAQIAVKEFAAAI 478

 Score = 33.9 bits (76), Expect = 0.81,   Method: Compositional matrix adjust.
 Identities = 34/132 (25%), Positives = 65/132 (49%), Gaps = 16/132 (12%)

Query: 141 GNEEMKAKQYSKAIGSYSDAIKLYPTNFNYYNNRALAYIKANNFDHAIIDANKSIEIDSK 200
           GN+  KA+Q+ +AI  Y  A  L+  +  Y NNR+ A  +  + + A+   ++++E   +
Sbjct: 263 GNKAYKARQFDEAIAHYDAAWNLH-QDITYLNNRSAAEFEKGDAETALKTLDEAVEKGRE 321

Query: 201 IHPTNF----KAYYRLGLAKYE-------IGDYEGSLAAFKRMIEIAQENNKGDEITKQM 249
           +  T++    K++ R+G   ++       I  Y+ SL   +    + +  N   E+ KQ 
Sbjct: 322 MR-TDYKLIAKSFARMGNVHHKTNNLKKAIEFYQKSLTEHRTPEILTKLRNTEKELKKQE 380

Query: 250 DADY---EKAKE 258
             +Y   EKA+E
Sbjct: 381 AEEYINPEKAEE 392

>NCAS0F03490 Chr6 complement(698757..700295) [1539 bp, 512 aa] {ON}
           Anc_3.142 YDL047W
          Length = 512

 Score = 63.2 bits (152), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 36/92 (39%), Positives = 54/92 (58%), Gaps = 4/92 (4%)

Query: 124 TKVSNDDMKKAEKLKEKGNEEMKAKQYSKAIGSYSDAIKLYPTNFNYYNNRALAYIKANN 183
           T    D  ++A   K +GN  +K + Y KAI  YS AI+L PT   +++NRALA +K +N
Sbjct: 2   TSAFADAKEQAVAFKNEGNTYIKEQNYMKAIELYSQAIELDPTQSIFFSNRALAQLKLDN 61

Query: 184 FDHAIIDANKSIEIDSKIHPTNFKAYYRLGLA 215
           F   + D + ++ +D    P N KAY+R GL+
Sbjct: 62  FQSCMNDCDVALRLD----PKNIKAYHRRGLS 89

>ZYRO0B04224g Chr2 (350069..351610) [1542 bp, 513 aa] {ON} highly
           similar to uniprot|P53043 Saccharomyces cerevisiae
           YGR123C
          Length = 513

 Score = 62.8 bits (151), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 36/92 (39%), Positives = 61/92 (66%), Gaps = 4/92 (4%)

Query: 124 TKVSNDDMKKAEKLKEKGNEEMKAKQYSKAIGSYSDAIKLYPTNFNYYNNRALAYIKANN 183
           + +S  D  KA + K++GN+ +K + + KA   Y+ AI+L  T   +++NRALA++K +N
Sbjct: 2   SSISAADSAKALEYKDQGNDFVKKQDFIKAAELYTKAIELDDTKSIFFSNRALAHLKQDN 61

Query: 184 FDHAIIDANKSIEIDSKIHPTNFKAYYRLGLA 215
           F  ++ D +K++E+DSK    N KAY+R GL+
Sbjct: 62  FQLSLNDCDKALELDSK----NIKAYHRRGLS 89

>Kwal_55.19935 s55 (182767..184548) [1782 bp, 593 aa] {ON} YOR027W
           (STI1) - Heat shock protein also induced by canavanine
           and entry into stationary phase [contig 159] FULL
          Length = 593

 Score = 62.0 bits (149), Expect = 9e-10,   Method: Compositional matrix adjust.
 Identities = 62/214 (28%), Positives = 99/214 (46%), Gaps = 43/214 (20%)

Query: 134 AEKLKEKGNEEMKAKQYSKAIGSYSDAIKLYPT-NFNYYNNRALAYIKANNFDHAIIDAN 192
           AE+ K++GN    AK + KA   +S AI+   T N   Y+NR+  Y     F  A+ DA 
Sbjct: 3   AEEFKKQGNAAFVAKDFEKAAELFSKAIESSETPNHVLYSNRSACYTSLKKFKEALEDAE 62

Query: 193 KSIEIDSKIHPTNFKAYYRLGLAKYEIGDYEGSLAAFKRMIEIAQENNKGDEITKQMDAD 252
           + +    KI+PT  K Y R+G A+Y +G+ + +   +K+ +EI   N    E  +Q+   
Sbjct: 63  ECV----KINPTWSKGYNRVGAAQYGLGNLDDAEKEYKKALEIDSSNKAAQEGLEQVQ-K 117

Query: 253 YEKAKEKVQELFFMQITKSTGKEGSGNSVNDGPKRKVTLNDILNMAGNNLNIIMSNPLFK 312
            + A+++  +L F Q+                       ND      N +  + SNP   
Sbjct: 118 TQNARQQQPDLGFGQL----------------------FND-----PNMIEKLKSNPKTA 150

Query: 313 EVVE--QLLA------SNPQAKQQFDNVMNDPRV 338
           E+++  QL++      SNPQ   Q   VM DPR+
Sbjct: 151 ELMKDPQLVSKVLQFQSNPQMMGQ--EVMKDPRM 182

 Score = 45.4 bits (106), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 53/205 (25%), Positives = 93/205 (45%), Gaps = 25/205 (12%)

Query: 130 DMKKAEKLKEKGNEEMKAKQYSKAIGSYSDAIKLYPTNFNYYNNRALAYIKANNFDHAII 189
           D +KAE+ + +G E      +  A+ +Y++ IK  P +   Y+NRA    K  +F  AI 
Sbjct: 397 DPEKAEEARLQGKEFFTKGDWPSAVSAYTEMIKRAPEDARGYSNRAAVLAKLMSFPDAIK 456

Query: 190 DANKSIEIDSKIHPTNFKAYYRLGLAKYEIGDYEGSL----AAFKRMIEIAQENNKGDEI 245
           D + +I  D    P   +AY R   A+  + ++  ++    AA  + +EI    NKG   
Sbjct: 457 DCDVAISKD----PNFVRAYIRKASAQIAVREFAPAMETLDAARAKDLEI----NKGAN- 507

Query: 246 TKQMDADYEKAKEKVQELFFMQITKSTGKEGSGNSVNDGPKRKVTLND-----ILNMAGN 300
            ++++  Y KA    Q+ F  +    T ++    ++ D P+    + D     IL+ A  
Sbjct: 508 AREIEQLYVKAS---QQRFKPEDPNETPEQAYARALKD-PEVAAIMQDPVMQSILSQAQQ 563

Query: 301 N---LNIIMSNPLFKEVVEQLLASN 322
           N   L   M NP     ++ L+A+ 
Sbjct: 564 NPAALQEHMKNPAVFSKIQTLIAAG 588

 Score = 40.0 bits (92), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 37/146 (25%), Positives = 71/146 (48%), Gaps = 21/146 (14%)

Query: 94  KINAYNDLSRNKDDINVPVKVIEDIEETKETKVSNDDMKKAEKLKEKGNEEMKAKQYSKA 153
           K  A +DLS + D + V            E +   D   KA+  K +GN+  KA+++ +A
Sbjct: 238 KSTAESDLSADADKMEV-----------DEPEPEQDSKAKADAEKAEGNKYYKARKFDEA 286

Query: 154 IGSYSDAIKLYPTNFNYYNNRALAYIKANNFDHAI------IDANKSIEIDSKIHPTNFK 207
           I  Y+ A  L+  +  Y NNR+ A  +  +++ AI      +D  + +  D K+     K
Sbjct: 287 IEHYNKAWDLH-RDVTYLNNRSAAEYEKGDYEQAIKTLTEAVDQGREMRADYKLI---SK 342

Query: 208 AYYRLGLAKYEIGDYEGSLAAFKRMI 233
           ++ R+G A  ++ D + ++  ++R +
Sbjct: 343 SFARIGNAYLKMDDLKKAIEFYQRSL 368

>Skud_7.432 Chr7 complement(715852..717393) [1542 bp, 513 aa] {ON}
           YGR123C (REAL)
          Length = 513

 Score = 62.0 bits (149), Expect = 9e-10,   Method: Compositional matrix adjust.
 Identities = 35/86 (40%), Positives = 54/86 (62%), Gaps = 4/86 (4%)

Query: 130 DMKKAEKLKEKGNEEMKAKQYSKAIGSYSDAIKLYPTNFNYYNNRALAYIKANNFDHAII 189
           D  KA + K +GN  +K K + KAI  Y++AI L  T   Y++NRAL++ K +NF  A+ 
Sbjct: 8   DRVKAHERKNEGNVLVKEKHFLKAIEKYTEAIDLDSTQTIYFSNRALSHFKVDNFQSALN 67

Query: 190 DANKSIEIDSKIHPTNFKAYYRLGLA 215
           D +++I++D    P N KAY+R  L+
Sbjct: 68  DCDEAIKLD----PKNIKAYHRRALS 89

>Smik_6.215 Chr6 complement(354154..355695) [1542 bp, 513 aa] {ON}
           YGR123C (REAL)
          Length = 513

 Score = 61.6 bits (148), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 35/86 (40%), Positives = 53/86 (61%), Gaps = 4/86 (4%)

Query: 130 DMKKAEKLKEKGNEEMKAKQYSKAIGSYSDAIKLYPTNFNYYNNRALAYIKANNFDHAII 189
           D  KA + K +GN  +K K + KAI  Y++AI L  T   Y++NRA A+ K +NF  A+ 
Sbjct: 8   DCAKALERKNEGNVFVKEKHFLKAIEKYTEAIDLDATQSIYFSNRAFAHFKVDNFQSALN 67

Query: 190 DANKSIEIDSKIHPTNFKAYYRLGLA 215
           D +++I++D    P N KAY+R  L+
Sbjct: 68  DCDEAIKLD----PKNIKAYHRRALS 89

>Ecym_4413 Chr4 complement(856330..857862) [1533 bp, 510 aa] {ON}
           similar to Ashbya gossypii AAR083C
          Length = 510

 Score = 61.2 bits (147), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 45/145 (31%), Positives = 79/145 (54%), Gaps = 10/145 (6%)

Query: 131 MKKAEKLKEKGNEEMKAKQYSKAIGSYSDAIKLYPTNFNYYNNRALAYIKANNFDHAIID 190
           + +A + K++GN+ + +K Y +AI +Y+ AI+L      +++NRALA +K + F  A+ D
Sbjct: 6   VPEALEYKDQGNKFVASKDYGQAIEAYTKAIELDGCQSIFFSNRALANLKLDRFQSALED 65

Query: 191 ANKSIEIDSKIHPTNFKAYYRLGLAKYEIGDYEGSLAAFKRMIEIAQENNKGDEITKQMD 250
           ++K+IE+DS    +N K Y+R G+A   + D+     + KR +E+      G+   K+  
Sbjct: 66  SSKAIELDS----SNVKGYHRRGMAYAGLQDF----ISAKRDLEVVLRVKPGEATAKRTL 117

Query: 251 ADYEKAKEKVQELFFMQITKSTGKE 275
              E+   +  E F   I  S G E
Sbjct: 118 LACERMIRR--ERFEKAIRASGGNE 140

>TDEL0D05500 Chr4 complement(991567..993105) [1539 bp, 512 aa] {ON}
           Anc_3.481 YGR123C
          Length = 512

 Score = 61.2 bits (147), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 34/83 (40%), Positives = 56/83 (67%), Gaps = 4/83 (4%)

Query: 133 KAEKLKEKGNEEMKAKQYSKAIGSYSDAIKLYPTNFNYYNNRALAYIKANNFDHAIIDAN 192
           +A KLK +GN  +K + ++KAI  Y+ AI L  T   Y++NRALA++K +NF  ++ D +
Sbjct: 11  EALKLKNEGNIFIKKQDFTKAIDLYTKAIGLDSTQSIYFSNRALAHLKLDNFQSSLNDCD 70

Query: 193 KSIEIDSKIHPTNFKAYYRLGLA 215
           +++++D    P N KAY+R GL+
Sbjct: 71  EALKLD----PKNAKAYHRRGLS 89

>Suva_8.80 Chr8 (142691..144451) [1761 bp, 586 aa] {ON} YOR027W
           (REAL)
          Length = 586

 Score = 61.2 bits (147), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 59/207 (28%), Positives = 93/207 (44%), Gaps = 28/207 (13%)

Query: 132 KKAEKLKEKGNEEMKAKQYSKAIGSYSDAIKLYPTNFNYYNNRALAYIKANNFDHAIIDA 191
           +KAE+ + +G E      +  A+ +Y++ IK  P +   Y+NRA A  K  +F  AI D 
Sbjct: 391 EKAEEARLEGKEYFTKSDWPNAVKAYTEMIKRSPEDARGYSNRAAALAKLMSFPEAIADC 450

Query: 192 NKSIEIDSKIHPTNFKAYYRLGLAKYEIGDYEGSLAAFKRMIEIAQENNKGDEITKQMDA 251
           NK+IE D    P   +AY R   A+  + ++ G+L           E N G    K++D 
Sbjct: 451 NKAIEKD----PNFVRAYIRKATAQIAVQEFAGALETLDAARTKDAEVNNGAS-AKEIDQ 505

Query: 252 DYEKAKEKVQELFFMQITKSTGKEGSGNSVNDGPKRKVTLNDILNMAGNNLNIIMSNPLF 311
            Y KA    Q+ F         + G+G   ND P+          M    +  IM +P+ 
Sbjct: 506 LYYKAS---QQRF---------QSGTG---NDSPEETYQ----RAMKDPEVAAIMQDPVM 546

Query: 312 KEVVEQLLASNPQAKQQFDNVMNDPRV 338
           + +++Q    NP A Q+    M +P V
Sbjct: 547 QSILQQ-AQQNPAALQEH---MKNPEV 569

 Score = 54.7 bits (130), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 34/103 (33%), Positives = 57/103 (55%), Gaps = 5/103 (4%)

Query: 134 AEKLKEKGNEEMKAKQYSKAIGSYSDAIKLY-PTNFNYYNNRALAYIKANNFDHAIIDAN 192
           A++ K++GN    AK Y KAI  ++ AI++    N   Y+NR+  Y     F  A+ DA 
Sbjct: 5   ADEYKQQGNAAFTAKDYGKAIDLFTKAIEVSEAPNHVLYSNRSACYTSLKKFTDALNDAT 64

Query: 193 KSIEIDSKIHPTNFKAYYRLGLAKYEIGDYEGSLAAFKRMIEI 235
           + +    KI+P+  K Y RLG A   +GD + + + +K+ +E+
Sbjct: 65  ECV----KINPSWSKGYNRLGAAHLGLGDLDDAESNYKKALEL 103

 Score = 51.6 bits (122), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 42/122 (34%), Positives = 68/122 (55%), Gaps = 15/122 (12%)

Query: 119 EETKETK---VSNDDMK-KAEKLKEKGNEEMKAKQYSKAIGSYSDAIKLYPTNFNYYNNR 174
           EETKE +   V  DD K +A+K K +GN+  KA+Q+ +AI  Y+ A +L+  +  Y NNR
Sbjct: 240 EETKEAEPMEVDEDDSKVEADKEKAEGNKFYKARQFEEAIEHYNKAWELH-RDITYLNNR 298

Query: 175 ALAYIKANNFDHAI------IDANKSIEIDSKIHPTNFK----AYYRLGLAKYEIGDYEG 224
           A A  +  +++ AI      ++  + +  D K+   +F     AY++LG  K  I +Y+ 
Sbjct: 299 AAAEYEKGDYETAIATLTDAVEQGREMRADYKVISKSFARIGNAYHKLGDLKKTIDNYQK 358

Query: 225 SL 226
           SL
Sbjct: 359 SL 360

 Score = 33.5 bits (75), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 25/76 (32%), Positives = 35/76 (46%), Gaps = 15/76 (19%)

Query: 178 YIKANNFDHAIIDANKSIEIDSKIHPTNFKAYYRLGLAKYEIGDYEGSLAAFKRMIEIAQ 237
           + KA  F+ AI   NK+ E+   I   N +A      A+YE GDYE ++A     +E  +
Sbjct: 269 FYKARQFEEAIEHYNKAWELHRDITYLNNRA-----AAEYEKGDYETAIATLTDAVEQGR 323

Query: 238 ENNKGDEITKQMDADY 253
           E          M ADY
Sbjct: 324 E----------MRADY 329

>YGR123C Chr7 complement(736662..738203) [1542 bp, 513 aa] {ON}
           PPT1Protein serine/threonine phosphatase, regulates
           Hsp90 chaperone by affecting its ATPase and cochaperone
           binding activities; has similarity to human phosphatase
           PP5; present in both the nucleus and cytoplasm;
           expressed during logarithmic growth
          Length = 513

 Score = 60.5 bits (145), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 35/86 (40%), Positives = 53/86 (61%), Gaps = 4/86 (4%)

Query: 130 DMKKAEKLKEKGNEEMKAKQYSKAIGSYSDAIKLYPTNFNYYNNRALAYIKANNFDHAII 189
           D  KA + K +GN  +K K + KAI  Y++AI L  T   Y++NRA A+ K +NF  A+ 
Sbjct: 8   DRAKALERKNEGNVFVKEKHFLKAIEKYTEAIDLDSTQSIYFSNRAFAHFKVDNFQSALN 67

Query: 190 DANKSIEIDSKIHPTNFKAYYRLGLA 215
           D +++I++D    P N KAY+R  L+
Sbjct: 68  DCDEAIKLD----PKNIKAYHRRALS 89

>Skud_15.192 Chr15 (340847..342616) [1770 bp, 589 aa] {ON} YOR027W
           (REAL)
          Length = 589

 Score = 60.1 bits (144), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 57/198 (28%), Positives = 89/198 (44%), Gaps = 17/198 (8%)

Query: 133 KAEKLKEKGNEEMKAKQYSKAIGSYSDAIKLYPTNFNYYNNRALAYIKANNFDHAIIDAN 192
           KAE+ + +G E      +  A+ +Y++ IK  P +   Y+NRA A  K  +F  AI D N
Sbjct: 395 KAEEARLEGKEYFTKSDWPNAVKAYTEMIKRAPEDARGYSNRAAALAKLMSFPEAIADCN 454

Query: 193 KSIEIDSKIHPTNFKAYYRLGLAKYEIGDYEGSLAAFKRMIEIAQENNKGDEITKQMDAD 252
           K+IE D    P   +AY R+  A+  + ++  +L           E NKG    K++D  
Sbjct: 455 KAIEKD----PNFVRAYIRMAAAQIAVKEFAAALETLDVARTKDAEVNKGAS-AKEIDQL 509

Query: 253 YEKAKEKVQELFFMQITKSTGKEGSGNSVNDGPKRKVTLND-----ILNMAGNN---LNI 304
           Y KA    Q+ F       T +E    ++ D P+    + D     IL  A  N   L  
Sbjct: 510 YYKAS---QQRFQPDTGSETPEETYQRAMKD-PEVAAIMQDPVMQSILQQAQQNPAALQE 565

Query: 305 IMSNPLFKEVVEQLLASN 322
            M NP   + ++ L+A+ 
Sbjct: 566 HMKNPAVFKKIQTLIAAG 583

 Score = 54.7 bits (130), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 61/237 (25%), Positives = 112/237 (47%), Gaps = 44/237 (18%)

Query: 134 AEKLKEKGNEEMKAKQYSKAIGSYSDAIKLYPTNFN-YYNNRALAYIKANNFDHAIIDAN 192
           A++ K++GN    AK Y  AI  ++ AI++  T  +  ++NR+  Y     F  A+ DAN
Sbjct: 5   ADEYKQQGNAAFTAKNYDGAIELFTKAIEVSETPSHVLFSNRSACYTSLKKFSDALNDAN 64

Query: 193 KSIEIDSKIHPTNFKAYYRLGLAKYEIGDYEGSLAAFKRMIEIAQENNKGDEITKQMDAD 252
           + +    KI+P+  K Y RLG A   +GD + + + +K+ +E              +DA+
Sbjct: 65  ECV----KINPSWSKGYNRLGAAHLGLGDLDEAESDYKKALE--------------LDAN 106

Query: 253 YEKAKEKVQELFFMQITKSTGKEGSGNSVNDGPKRKVTLNDILNMAGN-NLNIIMSNPLF 311
            + AK+ ++++   Q  +    +     +   P      N I N+  N   + +M +P  
Sbjct: 107 NKAAKDGLEQVHRTQQARQAQPDLGLTQLFADP------NLIENLKKNPKTSEMMKDP-- 158

Query: 312 KEVVEQLLA--SNPQAKQQFDNVMNDPRVRQ-----------MKENVNSDSMSNIPI 355
            ++V +L++   NPQA  Q  ++ +DPR+             M +   S+SM N P+
Sbjct: 159 -QLVAKLISYKMNPQAIGQ--DLFSDPRLMTIMATLMGVDLNMGDTSESNSMPNEPV 212

 Score = 44.7 bits (104), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 45/150 (30%), Positives = 75/150 (50%), Gaps = 14/150 (9%)

Query: 88  SVQTKDKINAYNDLSRNKDDINVPVKVIEDIEETKETKVSNDDMK-KAEKLKEKGNEEMK 146
           S Q KD  +     ++N+     P +  +D EE +  +V  D+ K +A+  K +GN+  K
Sbjct: 217 SEQKKDAESPAVPTTKNESSSTAPQQ--KDAEEPEPMEVDEDNSKAEADNEKAEGNKFYK 274

Query: 147 AKQYSKAIGSYSDAIKLYPTNFNYYNNRALAYIKANNFDHAIIDANKSIE------IDSK 200
           A Q+ +AI  Y+ A +L+  +  Y NNRA A  +  +++  I   N ++E       D K
Sbjct: 275 AHQFDEAIEHYNRAWELH-KDITYLNNRAAAEYEKGDYETVIATLNDAVEKGRDMRADYK 333

Query: 201 IHPTNFK----AYYRLGLAKYEIGDYEGSL 226
           +   +F     AY++LG  K  I  Y+ SL
Sbjct: 334 VISKSFARIGNAYHKLGDLKKTIEYYQKSL 363

 Score = 32.0 bits (71), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 26/76 (34%), Positives = 36/76 (47%), Gaps = 15/76 (19%)

Query: 178 YIKANNFDHAIIDANKSIEIDSKIHPTNFKAYYRLGLAKYEIGDYEGSLAAFKRMIEIAQ 237
           + KA+ FD AI   N++ E+   I   N +A      A+YE GDYE  +A     +E   
Sbjct: 272 FYKAHQFDEAIEHYNRAWELHKDITYLNNRA-----AAEYEKGDYETVIATLNDAVE--- 323

Query: 238 ENNKGDEITKQMDADY 253
              KG    + M ADY
Sbjct: 324 ---KG----RDMRADY 332

>TBLA0E03300 Chr5 complement(827677..829425) [1749 bp, 582 aa] {ON}
           Anc_5.617 YOR027W
          Length = 582

 Score = 59.3 bits (142), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 39/136 (28%), Positives = 72/136 (52%), Gaps = 9/136 (6%)

Query: 134 AEKLKEKGNEEMKAKQYSKAIGSYSDAIKLYPT-NFNYYNNRALAYIKANNFDHAIIDAN 192
           A++ K++GN    AK Y +AI  ++ AI++  T N   Y+NR+  Y     F   + DAN
Sbjct: 5   AQEYKDQGNAAFVAKNYDEAIEKFTKAIEVSETPNHVLYSNRSACYTSKKQFVKGLEDAN 64

Query: 193 KSIEIDSKIHPTNFKAYYRLGLAKYEIGDYEGSLAAFKRMIEIAQENNKG----DEITKQ 248
           + +    KI+PT  K Y R+G A + +GD + +  A+K+ +E+   N        ++T+ 
Sbjct: 65  ECV----KINPTWSKGYNRVGAAHFGMGDLDEAEKAYKKALELDSSNKAAHDGLSQVTRA 120

Query: 249 MDADYEKAKEKVQELF 264
            +A + +    + ++F
Sbjct: 121 QEARHSQPDMGLGKIF 136

 Score = 48.1 bits (113), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 52/207 (25%), Positives = 92/207 (44%), Gaps = 28/207 (13%)

Query: 132 KKAEKLKEKGNEEMKAKQYSKAIGSYSDAIKLYPTNFNYYNNRALAYIKANNFDHAIIDA 191
           +KAE+ + +G E      +  A+ +Y++ I   P++   Y+NRA A  K  +F  AI D 
Sbjct: 387 EKAEEARLEGKEYFTKGDWPNAVKAYTEMIARDPSDARGYSNRAAALSKLMSFPEAITDC 446

Query: 192 NKSIEIDSKIHPTNFKAYYRLGLAKYEIGDYEGSLAAFKRMIEIAQENNKGDEITKQMDA 251
           N +IE D    P   +AY R   A+  I D+  ++           E N G   ++++D 
Sbjct: 447 NTAIEKD----PNFIRAYIRKATAQIAIKDFVPAIETLDAARTKDAELNNGAN-SREIDQ 501

Query: 252 DYEKAKEKVQELFFMQITKSTGKEGSGNSVNDGPKRKVTLNDILNMAGNNLNIIMSNPLF 311
            Y KA    Q+ F              ++ N+ P++         M    +  IM +P+ 
Sbjct: 502 LYLKAN---QQRF------------QPSNANETPEQTYE----RAMKDPEVAAIMQDPVM 542

Query: 312 KEVVEQLLASNPQAKQQFDNVMNDPRV 338
           + +++Q   +NP A Q+    M +P +
Sbjct: 543 QSILQQ-AQTNPAALQEH---MKNPEI 565

>KLLA0A07062g Chr1 complement(636546..638291) [1746 bp, 581 aa] {ON}
           highly similar to uniprot|P15705 Saccharomyces
           cerevisiae YOR027W STI1 Heat shock protein also induced
           by canavanine and entry into stationary phase
          Length = 581

 Score = 58.9 bits (141), Expect = 8e-09,   Method: Compositional matrix adjust.
 Identities = 34/103 (33%), Positives = 62/103 (60%), Gaps = 5/103 (4%)

Query: 134 AEKLKEKGNEEMKAKQYSKAIGSYSDAIKLYP-TNFNYYNNRALAYIKANNFDHAIIDAN 192
           A++ K++GN+   +K Y+KAI  ++ AI++    N   ++NR+  Y    +F  A+ DAN
Sbjct: 3   ADQFKQEGNQAFASKDYAKAIELFTKAIEVSEQPNHVLFSNRSACYASNKDFVKALDDAN 62

Query: 193 KSIEIDSKIHPTNFKAYYRLGLAKYEIGDYEGSLAAFKRMIEI 235
           + +    KI+P+  K Y RLG A Y +GD + +  ++K+ +E+
Sbjct: 63  ECV----KINPSWAKGYNRLGAAHYGLGDLDEAEQSYKKALEL 101

 Score = 57.0 bits (136), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 62/202 (30%), Positives = 93/202 (46%), Gaps = 19/202 (9%)

Query: 130 DMKKAEKLKEKGNEEMKAKQYSKAIGSYSDAIKLYPTNFNYYNNRALAYIKANNFDHAII 189
           D +KAE+ + +G E      + KA+ +Y++ IK  P +   Y+NRA A  K  +F  AI 
Sbjct: 385 DPEKAEEARLQGKEYFTKADWPKAVEAYTEMIKRNPNDARGYSNRAAALSKLMSFADAIR 444

Query: 190 DANKSIEIDSKIHPTNFKAYYRLGLAKYEIGDYEGSLAAFKRMIEIAQENNKGDEITKQM 249
           D +K+IE D    P   +AY R    +  I DY G++           E N G   T+++
Sbjct: 445 DCDKAIEKD----PNFVRAYIRKATGQIAIKDYAGAIETLDSARTKDAEVNSGAN-TREI 499

Query: 250 DADYEKAKEKVQELFFMQITKSTGKEGSGNSVNDGPKRKVTLND-----ILNMAGNN--- 301
           D  Y KA    Q  F       T +E    +  D P+    L D     IL+ A  N   
Sbjct: 500 DQLYIKAS---QARFEPANANETPEEAYARATKD-PEVASILQDPVMQSILSQAQQNPAA 555

Query: 302 LNIIMSNP-LFKEVVEQLLASN 322
           L   M NP +FK+ ++ L+A+ 
Sbjct: 556 LQEHMRNPDVFKK-IQTLIAAG 576

 Score = 44.3 bits (103), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 33/109 (30%), Positives = 58/109 (53%), Gaps = 11/109 (10%)

Query: 128 NDDMKKAEKLKEKGNEEMKAKQYSKAIGSYSDAIKLYPTNFNYYNNRALAYIKANNFDHA 187
           +DD  KAE  K +GN+  K +++ +AI  Y++A + +  +  Y NNRA A  +  +++ A
Sbjct: 249 DDDKSKAEAAKAEGNKLYKQRKFDEAIEKYNEAWETH-NDITYLNNRAAAEYEKGDYEAA 307

Query: 188 I------IDANKSIEIDSKIHPTNFK----AYYRLGLAKYEIGDYEGSL 226
           I      ++  + +  D K+   +F     +Y++LG  K  I  YE SL
Sbjct: 308 IETLTKAVEQGRELRADYKVISKSFARMGNSYHKLGDLKKAIDYYEKSL 356

>Kpol_1018.69 s1018 (197149..198921) [1773 bp, 590 aa] {ON}
           (197149..198921) [1773 nt, 591 aa]
          Length = 590

 Score = 58.9 bits (141), Expect = 8e-09,   Method: Compositional matrix adjust.
 Identities = 38/117 (32%), Positives = 63/117 (53%), Gaps = 5/117 (4%)

Query: 134 AEKLKEKGNEEMKAKQYSKAIGSYSDAIKLYP-TNFNYYNNRALAYIKANNFDHAIIDAN 192
           A++ K++GN    AK Y KAI  +S AI +    N   Y+NR+  Y     F +A+ DA 
Sbjct: 5   ADEYKQQGNAAFVAKDYDKAIDLFSKAIDVSEQPNHVLYSNRSACYTSLKKFVNALKDAE 64

Query: 193 KSIEIDSKIHPTNFKAYYRLGLAKYEIGDYEGSLAAFKRMIEIAQENNKGDEITKQM 249
           + +    KI+P+  K Y R+G A + +GD + + A +K+ +E+   N    E  +Q+
Sbjct: 65  ECV----KINPSWSKGYNRVGAAHFGMGDLDEAEAGYKKALELDASNKAAQEGLEQV 117

 Score = 50.8 bits (120), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 54/211 (25%), Positives = 94/211 (44%), Gaps = 36/211 (17%)

Query: 132 KKAEKLKEKGNEEMKAKQYSKAIGSYSDAIKLYPTNFNYYNNRALAYIKANNFDHAIIDA 191
           +KAE+ + +G +      +  A+ +Y++ IK  P +   Y+NRA    K  +F  AI D 
Sbjct: 395 EKAEEARLEGKDYFTKGDWPNAVKAYTEMIKRAPEDARGYSNRAAVLSKLMSFPEAIDDC 454

Query: 192 NKSIEIDSKIHPTNFKAYYRLGLAKYEIGDYEGSL----AAFKRMIEIAQENNKGDEITK 247
           NK+IE D    P   +AY R   A+  + ++  +L    AA  +  E+ +  N     T+
Sbjct: 455 NKAIEKD----PNFVRAYIRKATAQIAVREFSSALETLDAARSKDAEVNKSAN-----TR 505

Query: 248 QMDADYEKAKEKVQELFFMQITKSTGKEGSGNSVNDGPKRKVTLNDILNMAGNNLNIIMS 307
           ++D  Y KA    Q+ F              N  N+ P++         M    +  IM 
Sbjct: 506 EIDQLYIKAS---QQRF------------QPNDSNESPEQTYE----RAMKDPEVAAIMQ 546

Query: 308 NPLFKEVVEQLLASNPQAKQQFDNVMNDPRV 338
           +P+ + +++Q    NP A Q+    M +P +
Sbjct: 547 DPVMQSILQQ-AQQNPAALQEH---MKNPEI 573

 Score = 31.2 bits (69), Expect = 5.4,   Method: Compositional matrix adjust.
 Identities = 22/102 (21%), Positives = 55/102 (53%), Gaps = 10/102 (9%)

Query: 138 KEKGNEEMKAKQYSKAIGSYSDAIKLYPTNFNYYNNRALAYIKANNFDHAI------IDA 191
           K +GN+  KA+Q+ +A+  Y++A + +  +  Y NNR+ A  +  +++ +I      ++ 
Sbjct: 267 KAEGNKLYKARQFDEAVAKYNEAWEAH-NDITYLNNRSAAEFEKGDYETSIKTLEEAVEK 325

Query: 192 NKSIEIDSKIHPTNFKAYYRLGLAKYEIGDYEGSLAAFKRMI 233
            + +  D K+     K++ R+G    ++ D + ++  +K+ +
Sbjct: 326 GREMRADYKVIA---KSFARMGNCYTKLNDLKKAIDFYKKSL 364

>YOR027W Chr15 (381053..382822) [1770 bp, 589 aa] {ON}  STI1Hsp90
           cochaperone, interacts with the Ssa group of the
           cytosolic Hsp70 chaperones and activates Ssa1p ATPase
           activity; interacts with Hsp90 chaperones and inhibits
           their ATPase activity; homolog of mammalian Hop
          Length = 589

 Score = 58.9 bits (141), Expect = 9e-09,   Method: Compositional matrix adjust.
 Identities = 38/112 (33%), Positives = 61/112 (54%), Gaps = 5/112 (4%)

Query: 134 AEKLKEKGNEEMKAKQYSKAIGSYSDAIKLYPT-NFNYYNNRALAYIKANNFDHAIIDAN 192
           A++ K++GN    AK Y KAI  ++ AI++  T N   Y+NR+  Y     F  A+ DAN
Sbjct: 5   ADEYKQQGNAAFTAKDYDKAIELFTKAIEVSETPNHVLYSNRSACYTSLKKFSDALNDAN 64

Query: 193 KSIEIDSKIHPTNFKAYYRLGLAKYEIGDYEGSLAAFKRMIEIAQENNKGDE 244
           + +    KI+P+  K Y RLG A   +GD + + + +K+ +E+   N    E
Sbjct: 65  ECV----KINPSWSKGYNRLGAAHLGLGDLDEAESNYKKALELDASNKAAKE 112

 Score = 57.4 bits (137), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 55/207 (26%), Positives = 90/207 (43%), Gaps = 28/207 (13%)

Query: 132 KKAEKLKEKGNEEMKAKQYSKAIGSYSDAIKLYPTNFNYYNNRALAYIKANNFDHAIIDA 191
           +KAE+ + +G E      +  A+ +Y++ IK  P +   Y+NRA A  K  +F  AI D 
Sbjct: 394 EKAEEARLEGKEYFTKSDWPNAVKAYTEMIKRAPEDARGYSNRAAALAKLMSFPEAIADC 453

Query: 192 NKSIEIDSKIHPTNFKAYYRLGLAKYEIGDYEGSLAAFKRMIEIAQENNKGDEITKQMDA 251
           NK+IE D    P   +AY R   A+  + +Y  +L           E N G    +++D 
Sbjct: 454 NKAIEKD----PNFVRAYIRKATAQIAVKEYASALETLDAARTKDAEVNNGSS-AREIDQ 508

Query: 252 DYEKAKEKVQELFFMQITKSTGKEGSGNSVNDGPKRKVTLNDILNMAGNNLNIIMSNPLF 311
            Y KA    Q+ F    +  T +E    ++ D                  +  IM +P+ 
Sbjct: 509 LYYKAS---QQRFQPGTSNETPEETYQRAMKDP----------------EVAAIMQDPVM 549

Query: 312 KEVVEQLLASNPQAKQQFDNVMNDPRV 338
           + +++Q    NP A Q+    M +P V
Sbjct: 550 QSILQQ-AQQNPAALQEH---MKNPEV 572

 Score = 51.6 bits (122), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 48/182 (26%), Positives = 97/182 (53%), Gaps = 10/182 (5%)

Query: 77  NLDKKNTTINVSVQTKDKINAYNDLSRNKDDINVPVKVIEDIEETKETKVSNDDMK-KAE 135
           ++ K+  T   + Q KD     +  +  ++    P K  E+ +E++  +V  DD K +A+
Sbjct: 206 SMPKEPETSKSTEQKKDAEPQSDSTTSKENSSKAPQK--EESKESEPMEVDEDDSKIEAD 263

Query: 136 KLKEKGNEEMKAKQYSKAIGSYSDAIKLYPTNFNYYNNRALAYIKANNFDHAIIDANKSI 195
           K K +GN+  KA+Q+ +AI  Y+ A +L+  +  Y NNRA A  +   ++ AI   N ++
Sbjct: 264 KEKAEGNKFYKARQFDEAIEHYNKAWELH-KDITYLNNRAAAEYEKGEYETAISTLNDAV 322

Query: 196 EIDSKI---HPTNFKAYYRLGLAKYEIGDYEGSLAAFKRMIEIAQENNKGDEITKQMDAD 252
           E   ++   +    K++ R+G A +++GD + ++  +++ +    E+   D +TK  +A+
Sbjct: 323 EQGREMRADYKVISKSFARIGNAYHKLGDLKKTIEYYQKSL---TEHRTADILTKLRNAE 379

Query: 253 YE 254
            E
Sbjct: 380 KE 381

>KAFR0B06610 Chr2 (1372434..1373969) [1536 bp, 511 aa] {ON}
           Anc_3.481 YGR123C
          Length = 511

 Score = 58.5 bits (140), Expect = 9e-09,   Method: Compositional matrix adjust.
 Identities = 34/86 (39%), Positives = 55/86 (63%), Gaps = 4/86 (4%)

Query: 130 DMKKAEKLKEKGNEEMKAKQYSKAIGSYSDAIKLYPTNFNYYNNRALAYIKANNFDHAII 189
           D + A   K++GN+ +K + + +A   Y+ AI+  PT   +Y+NRALA +K +NF +A+ 
Sbjct: 5   DTELATSYKDEGNKFLKQQDFQRANELYTKAIETDPTQSIFYSNRALANLKLDNFMNALN 64

Query: 190 DANKSIEIDSKIHPTNFKAYYRLGLA 215
           D   +IE++S    +N KAY+R GLA
Sbjct: 65  DCTNAIELNS----SNLKAYHRRGLA 86

>Smik_15.205 Chr15 (346899..348668) [1770 bp, 589 aa] {ON} YOR027W
           (REAL)
          Length = 589

 Score = 58.9 bits (141), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 51/207 (24%), Positives = 97/207 (46%), Gaps = 28/207 (13%)

Query: 132 KKAEKLKEKGNEEMKAKQYSKAIGSYSDAIKLYPTNFNYYNNRALAYIKANNFDHAIIDA 191
           +KAE+ + +G +      +  A+ +Y++ IK  P +   Y+NRA A  K  +F  AI D 
Sbjct: 394 EKAEEARLEGKDYFTKSDWPNAVKAYTEMIKRAPEDARGYSNRAAALAKLMSFPEAIADC 453

Query: 192 NKSIEIDSKIHPTNFKAYYRLGLAKYEIGDYEGSLAAFKRMIEIAQENNKGDEITKQMDA 251
           NK+IE D    P   +AY R   A+  + +Y  +L      ++ A+        TK  D 
Sbjct: 454 NKAIEKD----PNFVRAYIRKATAQIAVQEYAAAL----ETLDAAR--------TKDADV 497

Query: 252 DYEKAKEKVQELFFMQITKSTGKEGSGNSVNDGPKRKVTLNDILNMAGNNLNIIMSNPLF 311
           +   +  ++ +L++ + ++   + G+GN   +   ++        M    +  IM +P+ 
Sbjct: 498 NNGASSREIDQLYY-KASQQRFQPGTGNETPEETYQRA-------MKDPEVAAIMQDPVM 549

Query: 312 KEVVEQLLASNPQAKQQFDNVMNDPRV 338
           + +++Q    NP A Q+    M +P V
Sbjct: 550 QSILQQ-AQQNPAALQEH---MKNPEV 572

 Score = 53.9 bits (128), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 50/183 (27%), Positives = 98/183 (53%), Gaps = 12/183 (6%)

Query: 77  NLDKKNTTINVSVQTKDKINAYNDLSRNKDDINVPVKVIEDIEETKETKVSNDDMK-KAE 135
           ++ K+  T   + Q KD  +  N  +  +D  N P +  E+ +E+   +V  DD K +A+
Sbjct: 206 SMPKEPETNKSAEQKKDSESQNNPTTEKEDSSNTPQR--EENKESDPMEVDEDDSKAEAD 263

Query: 136 KLKEKGNEEMKAKQYSKAIGSYSDAIKLYPTNFNYYNNRALAYIKANNFDHAIIDANKSI 195
           K K +GN+  KA+Q+ +AI  Y+ A +L+  +  Y NNRA A  +   +  AI   N ++
Sbjct: 264 KEKAEGNKFYKARQFDEAIEHYNKAWELH-RDITYLNNRAAAEYEKGEYKTAIATLNDAV 322

Query: 196 EIDSKIHPTNFK----AYYRLGLAKYEIGDYEGSLAAFKRMIEIAQENNKGDEITKQMDA 251
           E   ++   ++K    ++ R+G A +++GD + ++  +++ +    E+   D +TK  +A
Sbjct: 323 EQGREMR-ADYKVISRSFARIGNAYHKLGDLKKTIEYYQKSL---TEHRTADILTKLRNA 378

Query: 252 DYE 254
           + E
Sbjct: 379 EKE 381

 Score = 52.8 bits (125), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 35/103 (33%), Positives = 56/103 (54%), Gaps = 5/103 (4%)

Query: 134 AEKLKEKGNEEMKAKQYSKAIGSYSDAIKLYPT-NFNYYNNRALAYIKANNFDHAIIDAN 192
           A++ K++GN    AK Y KAI  ++ AI++  T N   Y+NR+  Y     F  A+ DA 
Sbjct: 5   ADEYKQQGNSAFTAKDYDKAIELFTKAIEVSKTPNHVLYSNRSACYASLKKFSDALNDAK 64

Query: 193 KSIEIDSKIHPTNFKAYYRLGLAKYEIGDYEGSLAAFKRMIEI 235
           + I I+    P+  K Y RLG A   +GD + +   +K+ +E+
Sbjct: 65  ECININ----PSWSKGYNRLGAAHLGLGDLDEAENNYKKALEL 103

>Ecym_5582 Chr5 complement(1195544..1197298) [1755 bp, 584 aa] {ON}
           similar to Ashbya gossypii AEL224W
          Length = 584

 Score = 58.5 bits (140), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 60/201 (29%), Positives = 91/201 (45%), Gaps = 17/201 (8%)

Query: 130 DMKKAEKLKEKGNEEMKAKQYSKAIGSYSDAIKLYPTNFNYYNNRALAYIKANNFDHAII 189
           D +KAEK +  G E      +  A+ +YS+ I   P +   Y+NRA A  K  +F  AI 
Sbjct: 388 DPEKAEKARLDGKEYFTKGDWPSAVKAYSEMIMRAPHDARGYSNRAAALSKLMSFPDAIK 447

Query: 190 DANKSIEIDSKIHPTNFKAYYRLGLAKYEIGDYEGSLAAFKRMIEIAQENNKGDEITKQM 249
           D +K+IEID    P+  +AY R   A+  + +Y  ++           E N G  I +++
Sbjct: 448 DCDKAIEID----PSFVRAYIRKATAQIAVQEYSAAIETLDVARTKDAEVNNGSSI-REI 502

Query: 250 DADYEKAKEKVQELFFMQITKSTGKEGSGNSVNDGPKRKVTLND-----ILNMAGNN--- 301
           D  Y KA    Q+ F    T  + +E    +V D P+    L D     IL  A  N   
Sbjct: 503 DQLYVKA---TQQRFQPANTNESPEETYARAVKD-PEVASILQDPVMQSILAQAQQNPAA 558

Query: 302 LNIIMSNPLFKEVVEQLLASN 322
           L   M NP   + ++ L+A+ 
Sbjct: 559 LQEHMKNPEVFKKMQTLIAAG 579

 Score = 50.4 bits (119), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 31/106 (29%), Positives = 59/106 (55%), Gaps = 5/106 (4%)

Query: 131 MKKAEKLKEKGNEEMKAKQYSKAIGSYSDAIK-LYPTNFNYYNNRALAYIKANNFDHAII 189
           M  AE+ K++GN    AK + +A+  +++AI+     N   Y+NR+ AY     FD A+ 
Sbjct: 1   MTSAEEYKKEGNAAFVAKDFKRAVELFTNAIQESEEPNHVLYSNRSGAYASLKKFDEALS 60

Query: 190 DANKSIEIDSKIHPTNFKAYYRLGLAKYEIGDYEGSLAAFKRMIEI 235
           DA + ++I +       K + RLG A + +G+ + +  ++K+ +E+
Sbjct: 61  DATECVKIKADWS----KGHNRLGAAHFGLGNLDEAEESYKKALEL 102

 Score = 44.7 bits (104), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 35/107 (32%), Positives = 55/107 (51%), Gaps = 11/107 (10%)

Query: 130 DMKKAEKLKEKGNEEMKAKQYSKAIGSYSDAIKLYPTNFNYYNNRALAYIKANNFDHAII 189
           D + AEK K +GN+  K +++ +AI  Y +A  L   +  Y NNRA A  +  +++ AI 
Sbjct: 254 DRENAEKAKAEGNQLYKQRKFDEAIAKYEEAWNLQ-KDITYLNNRAAAEYEKGDYNSAIK 312

Query: 190 DANKSIE------IDSKIHPTNFK----AYYRLGLAKYEIGDYEGSL 226
             N+++E       D K+   +F     AYY+L   K  +  YE SL
Sbjct: 313 TLNEAVEQGRELRADYKVIAKSFARLGNAYYKLDEVKKAVEYYEKSL 359

>NCAS0G00810 Chr7 complement(138192..139946) [1755 bp, 584 aa] {ON}
           Anc_5.617
          Length = 584

 Score = 58.5 bits (140), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 37/120 (30%), Positives = 63/120 (52%), Gaps = 5/120 (4%)

Query: 131 MKKAEKLKEKGNEEMKAKQYSKAIGSYSDAIKLYPT-NFNYYNNRALAYIKANNFDHAII 189
           M  A++LK+KGN    +K ++ AI  +++AI    T N   Y+NR+  Y     F  A+ 
Sbjct: 1   MSTADELKQKGNAAFASKDFTGAIEYFTEAIAASTTPNHVLYSNRSACYTSLKQFQEALN 60

Query: 190 DANKSIEIDSKIHPTNFKAYYRLGLAKYEIGDYEGSLAAFKRMIEIAQENNKGDEITKQM 249
           DA + +    KI+P   K Y R+G A   +GD + + + +K+ +E+   N    E  +Q+
Sbjct: 61  DAQQCV----KINPDWSKGYNRMGAAHLGLGDLDDAESNYKKALELDSNNKAASEGLEQV 116

 Score = 53.5 bits (127), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 58/202 (28%), Positives = 90/202 (44%), Gaps = 25/202 (12%)

Query: 132 KKAEKLKEKGNEEMKAKQYSKAIGSYSDAIKLYPTNFNYYNNRALAYIKANNFDHAIIDA 191
           +KAE+ + +G E      +  A+ +Y++ IK  P +   Y+NRA A  K  +F  AI D 
Sbjct: 388 EKAEEARLEGKEYFTKSDWPNAVKAYTEMIKRAPEDARGYSNRAAALAKLMSFPEAIKDC 447

Query: 192 NKSIEIDSKIHPTNFKAYYRLGLAKYEIGDYEGSLAAFKRMIEIAQENNKG---DEITK- 247
            K+IE D    P   +AY R   A+  I D+  +L   +   +   E N G   +EI K 
Sbjct: 448 EKAIEKD----PNFVRAYLRKATAQIAIKDFVKALETLEEAKKKDDEVNNGASSNEIMKL 503

Query: 248 QMDADYEKAKEKVQELFFMQITKSTGKEGSGNSVNDGPKRKVTLND-----ILNMAGNN- 301
           QM A         QE F       T +E    ++ D P+    + D     IL  A N+ 
Sbjct: 504 QMKA--------TQERFQAPTGNETPEETYKRAMQD-PEVAAIMQDPVMQSILQQAQNDP 554

Query: 302 --LNIIMSNPLFKEVVEQLLAS 321
             L   M NP   + ++ L+++
Sbjct: 555 AALQEHMKNPEISKKIQVLVSA 576

 Score = 33.9 bits (76), Expect = 0.81,   Method: Compositional matrix adjust.
 Identities = 32/128 (25%), Positives = 64/128 (50%), Gaps = 11/128 (8%)

Query: 140 KGNEEMKAKQYSKAIGSYSDAIKLYPTNFNYYNNRALAYIKANNFDHAIIDANKSIEIDS 199
           +GN+  K+ ++ +AI  Y+ A  L+  +  Y NNR+ A  +  +F+ A+   N+++E   
Sbjct: 262 EGNKLYKSHKFDEAIAEYNKAWDLH-KDITYLNNRSAAEFEKGDFETAMNTLNEAVEQGR 320

Query: 200 KIHPTNFKAYYRLGLAKY-EIGDYEGSLAAFKRMIEIAQ----ENNKGDEITKQMDADYE 254
           ++     +A Y+L    +  +G+        K+ IE  Q    E+   D +TK    + E
Sbjct: 321 EL-----RADYKLIAKSFARMGNAYSKQKNLKKAIEYYQKSLTEHRTADILTKLRTCEKE 375

Query: 255 KAKEKVQE 262
             K++++E
Sbjct: 376 LKKQEIEE 383

>KLLA0B10912g Chr2 (955948..957486) [1539 bp, 512 aa] {ON} similar
           to uniprot|P53043 Saccharomyces cerevisiae YGR123C
          Length = 512

 Score = 58.2 bits (139), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 37/95 (38%), Positives = 58/95 (61%), Gaps = 6/95 (6%)

Query: 121 TKETKVSNDDMKKAEKLKEKGNEEMKAKQYSKAIGSYSDAIKLYPTNFNYYNNRALAYIK 180
           T+E K  N +  KA +LK +GN+ +K K Y+KA   Y+ AI+  P N   Y+NRA   +K
Sbjct: 2   TEEVKACNPE--KALELKNEGNKFVKEKLYAKAAEYYTKAIEHDPENTILYSNRAFTNLK 59

Query: 181 ANNFDHAIIDANKSIEIDSKIHPTNFKAYYRLGLA 215
            +NF  ++ DA ++IE+D+     N KAY+R  ++
Sbjct: 60  LDNFQSSLDDAKRAIELDN----NNLKAYHRRAMS 90

>Kwal_55.21175 s55 complement(716457..717992) [1536 bp, 511 aa] {ON}
           YGR123C (PPT1) - serine/threonine phosphatase [contig
           295] FULL
          Length = 511

 Score = 58.2 bits (139), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 38/105 (36%), Positives = 60/105 (57%), Gaps = 10/105 (9%)

Query: 126 VSNDDMKKAEKLKEKGNEEMKAKQYSKAIGSYSDAIKLYPTNFNYYNNRALAYIKANNFD 185
           V+ +  ++A + K +GN  +K K+Y +A+  YS AI+L  T   Y++NRA + ++ +NF 
Sbjct: 2   VTQEAAQQALEFKNQGNAYVKEKKYQEAVEYYSKAIELDDTQSIYFSNRAFSRLRLDNFL 61

Query: 186 HAIIDANKSIEIDSKIHPTNFKAYYRLGLAKYEIGDYEGSLAAFK 230
            A  D +K+I +D    P N KA +R GL+      Y G L  FK
Sbjct: 62  TAQEDCDKAIALD----PKNIKAIHRRGLS------YVGLLEFFK 96

>AEL224W Chr5 (207712..209454) [1743 bp, 580 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YOR027W (STI1)
          Length = 580

 Score = 57.4 bits (137), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 41/139 (29%), Positives = 70/139 (50%), Gaps = 6/139 (4%)

Query: 131 MKKAEKLKEKGNEEMKAKQYSKAIGSYSDAIKLYP-TNFNYYNNRALAYIKANNFDHAII 189
           M  AE+ K++GN    AK + KAI  +  AI++    N   Y+NR+  Y     F  A+ 
Sbjct: 1   MTTAEEYKKEGNSAFAAKDFEKAIELFGKAIEVSEQPNHVLYSNRSACYASMRKFREALA 60

Query: 190 DANKSIEIDSKIHPTNFKAYYRLGLAKYEIGDYEGSLAAFKRMIEIAQENNKGDEITKQM 249
           DA + +    +I P   K + RLG A Y +GD + +  ++K+ +E+   N    +   Q+
Sbjct: 61  DAQECV----RIKPDWSKGHNRLGAAHYGLGDLDEAEESYKKALELDSSNKAAQDGLAQV 116

Query: 250 DADYEKAKEKVQELFFMQI 268
            A  ++  E+  +L F Q+
Sbjct: 117 QATQQQRMEQP-DLGFGQM 134

 Score = 53.9 bits (128), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 56/201 (27%), Positives = 91/201 (45%), Gaps = 17/201 (8%)

Query: 130 DMKKAEKLKEKGNEEMKAKQYSKAIGSYSDAIKLYPTNFNYYNNRALAYIKANNFDHAII 189
           D +KAE+ + +G E      +  A+ +Y++ IK  P +   Y+NRA A  K  +F  AI 
Sbjct: 384 DPEKAEEARLQGKEYFTNADWPNAVKAYTEMIKRAPEDARGYSNRAAALAKLMSFPDAIK 443

Query: 190 DANKSIEIDSKIHPTNFKAYYRLGLAKYEIGDYEGSLAAFKRMIEIAQENNKGDEITKQM 249
           D + +I+ D    P   +AY R   A+  + +Y  ++       E   E N G   T+++
Sbjct: 444 DCDMAIQKD----PNFVRAYIRKATAQIAVQEYAAAIETLDTAREKDAEVNNGSN-TREI 498

Query: 250 DADYEKAKEKVQELFFMQITKSTGKEGSGNSVNDGPKRKVTLND-----ILNMAGNN--- 301
           D  Y KA    Q+ F       + +E    +V D P+    L D     IL+ A  N   
Sbjct: 499 DQLYIKA---TQQRFQPANANESPEETYARAVKD-PEVAAILQDPVMQSILSQAQQNPAA 554

Query: 302 LNIIMSNPLFKEVVEQLLASN 322
           L   M NP   + ++ L+A+ 
Sbjct: 555 LQEHMKNPQVFKKIQTLIAAG 575

 Score = 53.1 bits (126), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 38/109 (34%), Positives = 59/109 (54%), Gaps = 11/109 (10%)

Query: 128 NDDMKKAEKLKEKGNEEMKAKQYSKAIGSYSDAIKLYPTNFNYYNNRALAYIKANNFDHA 187
           N+D  KAE+ K KGNE  K +Q+ +AI +Y  A  L+  +  Y NNRA A  +  +++ A
Sbjct: 248 NNDRSKAEEAKAKGNELYKKRQFDEAIANYEKAWDLH-KDITYLNNRAAAEYEKGDYESA 306

Query: 188 IIDANKSIEIDSKI---HPTNFKAYYRLGLAKYEIGD-------YEGSL 226
           I    K++E   ++   +    K++ RLG A Y++ D       YE SL
Sbjct: 307 IKTLEKAVEEGRELRADYKVIAKSFARLGNAHYKLADLKKAIEYYEKSL 355

>Suva_7.408 Chr7 complement(706942..708483) [1542 bp, 513 aa] {ON}
           YGR123C (REAL)
          Length = 513

 Score = 57.0 bits (136), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 33/86 (38%), Positives = 51/86 (59%), Gaps = 4/86 (4%)

Query: 130 DMKKAEKLKEKGNEEMKAKQYSKAIGSYSDAIKLYPTNFNYYNNRALAYIKANNFDHAII 189
           D   A + K +GN  +K K + KAI  Y+ AI L  T   Y++NRA A+ K +NF  A+ 
Sbjct: 8   DRANALERKNEGNVFIKEKHFLKAIEKYTQAIDLDSTQSIYFSNRAFAHFKVDNFQSALN 67

Query: 190 DANKSIEIDSKIHPTNFKAYYRLGLA 215
           D ++++++D    P N KAY+R  L+
Sbjct: 68  DCDEALKLD----PKNIKAYHRRALS 89

>KNAG0B03200 Chr2 complement(619530..621269) [1740 bp, 579 aa] {ON}
           Anc_5.617 YOR027W
          Length = 579

 Score = 55.5 bits (132), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 36/117 (30%), Positives = 68/117 (58%), Gaps = 5/117 (4%)

Query: 134 AEKLKEKGNEEMKAKQYSKAIGSYSDAIKLYPT-NFNYYNNRALAYIKANNFDHAIIDAN 192
           A++ K++GN    AK+Y +A+  ++ AI++  T N   Y+NR+ +Y     F+ A+ DA 
Sbjct: 5   ADEYKQQGNSAFAAKKYDEAVDLFTKAIEVSETPNHVLYSNRSASYASEQKFNEALKDA- 63

Query: 193 KSIEIDSKIHPTNFKAYYRLGLAKYEIGDYEGSLAAFKRMIEIAQENNKGDEITKQM 249
             +E  +KI+P+  K Y R G A + +G+ + + A++K+ +E+   N    E  +Q+
Sbjct: 64  --LEC-TKINPSWAKGYTREGAAHFGMGNLDDAEASYKKALELDANNKIAKEGIEQI 117

 Score = 52.4 bits (124), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 54/198 (27%), Positives = 88/198 (44%), Gaps = 15/198 (7%)

Query: 132 KKAEKLKEKGNEEMKAKQYSKAIGSYSDAIKLYPTNFNYYNNRALAYIKANNFDHAIIDA 191
           +KAE+ + +G E      +  A+ +Y++ IK  P +   Y+NRA A  K  +F  AI D 
Sbjct: 383 EKAEEARLEGKEYFTKGDWPSAVKAYTEMIKRAPEDARGYSNRAAALSKLMSFPDAISDC 442

Query: 192 NKSIEIDSKIHPTNFKAYYRLGLAKYEIGDYEGSLAAFKRMIEIAQENNKGDEITKQMDA 251
           NK+IE D    P   +AY R   A+  + D+  ++           E N G    +++D 
Sbjct: 443 NKAIEKD----PNFVRAYIRKATAQIAVKDFSYAIETLDAARTKDAEVNGGAN-AREIDQ 497

Query: 252 DYEKAKEKVQELFFMQITKSTGKEGSGNSVNDGPKRKV----TLNDILNMAGNN---LNI 304
            Y KA    Q+ F       T ++    ++ D    K+     L  IL  A N+   L  
Sbjct: 498 LYMKA---AQQRFQPATGDETPEQTYERAMRDPEVAKIMQDPVLQSILQQAQNDPAALQE 554

Query: 305 IMSNPLFKEVVEQLLASN 322
            M NP   + ++ L+A+ 
Sbjct: 555 HMKNPEIFKKIQTLIAAG 572

 Score = 44.3 bits (103), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 40/118 (33%), Positives = 59/118 (50%), Gaps = 12/118 (10%)

Query: 120 ETKETKVSNDDMK-KAEKLKEKGNEEMKAKQYSKAIGSYSDAIKLYPTNFNYYNNRALAY 178
           E +   V  D+ K  AE+ K +GN+  KA+ + +AI  Y+ A +L   N  Y NNR+ A 
Sbjct: 236 EAESMDVDQDESKVAAEEAKVEGNKAYKARNFDEAIACYNKAWEL-DNNITYLNNRSAAE 294

Query: 179 IKANNFDHAIIDANKSIE------IDSKIHPTNFK----AYYRLGLAKYEIGDYEGSL 226
            +   +D AI   N++IE       D KI   +F     AY ++G  K  I  Y+ SL
Sbjct: 295 FEKGEYDTAINTLNEAIEKGREMRADYKIIAKSFARIGNAYVKMGNLKEAINHYQKSL 352

>ZYRO0A05676g Chr1 (459999..461717) [1719 bp, 572 aa] {ON} highly
           similar to uniprot|P15705 Saccharomyces cerevisiae
           YOR027W STI1 Heat shock protein also induced by
           canavanine and entry into stationary phase
          Length = 572

 Score = 55.1 bits (131), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 33/103 (32%), Positives = 58/103 (56%), Gaps = 5/103 (4%)

Query: 134 AEKLKEKGNEEMKAKQYSKAIGSYSDAIKLYPT-NFNYYNNRALAYIKANNFDHAIIDAN 192
           A++ K++GN    AK Y KAI  ++ AI++  T N   Y+NR+  Y     F+ A+ DA 
Sbjct: 3   ADEFKQQGNAAFLAKDYVKAIDLFTKAIEVSETPNHVLYSNRSACYASNKKFEEALKDAE 62

Query: 193 KSIEIDSKIHPTNFKAYYRLGLAKYEIGDYEGSLAAFKRMIEI 235
           + +    KI P+  K Y R+G A++ +   + +  ++KR +E+
Sbjct: 63  ECV----KISPSWSKGYNRVGAAQFGLSQLDEAEKSYKRALEL 101

 Score = 49.3 bits (116), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 34/125 (27%), Positives = 63/125 (50%), Gaps = 5/125 (4%)

Query: 132 KKAEKLKEKGNEEMKAKQYSKAIGSYSDAIKLYPTNFNYYNNRALAYIKANNFDHAIIDA 191
           +KAE+ + +G E      +  A+ +Y++ +K  P +   ++NRA A  K  +F  AI D 
Sbjct: 378 EKAEEARLQGKEFFTKGDWPNAVKAYTEMVKRAPQDARGFSNRAAALAKLMSFPEAIEDC 437

Query: 192 NKSIEIDSKIHPTNFKAYYRLGLAKYEIGDYEGSLAAFKRMIEIAQENNKGDEITKQMDA 251
           NK++ ID    P   +AY R   A+  + ++  ++       E   + NKG  + +++D 
Sbjct: 438 NKAVSID----PNFVRAYIRKATAQIAVKEFAAAIETLNIAREKDAQVNKGANV-REIDQ 492

Query: 252 DYEKA 256
            + KA
Sbjct: 493 LHAKA 497

 Score = 46.6 bits (109), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 31/103 (30%), Positives = 58/103 (56%), Gaps = 4/103 (3%)

Query: 134 AEKLKEKGNEEMKAKQYSKAIGSYSDAIKLYPTNFNYYNNRALAYIKANNFDHAIIDANK 193
           AE  K +GN+  KA+Q+ +AI  Y+ A +L+  +  Y NNR+ A  +  ++D AI   N 
Sbjct: 246 AEAEKAEGNKLYKARQFEEAIEHYNKAWELH-KDITYLNNRSAAEFEKGDYDTAIKTLND 304

Query: 194 SIEIDSKI---HPTNFKAYYRLGLAKYEIGDYEGSLAAFKRMI 233
           ++E   ++   + T  K++ R+G A Y++ D   ++  + R +
Sbjct: 305 AVEQGRELRADYKTIAKSFARIGNAYYKLKDLRKAIEHYNRSL 347

>KAFR0C05890 Chr3 (1165932..1167659) [1728 bp, 575 aa] {ON}
           Anc_5.617 YOR027W
          Length = 575

 Score = 54.7 bits (130), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 35/105 (33%), Positives = 59/105 (56%), Gaps = 5/105 (4%)

Query: 132 KKAEKLKEKGNEEMKAKQYSKAIGSYSDAIKLYPT-NFNYYNNRALAYIKANNFDHAIID 190
           K A++ K++GN    AK Y KAI +++ AI++  T N   Y+NR+ AY  +  ++ A+ D
Sbjct: 3   KTADEYKQEGNTAFVAKDYQKAIDAFTKAIEVSETPNHVLYSNRSAAYTSSKQYEQALSD 62

Query: 191 ANKSIEIDSKIHPTNFKAYYRLGLAKYEIGDYEGSLAAFKRMIEI 235
           A++ I    KI+P+  K Y R G A   +  YE +   +   ++I
Sbjct: 63  ADECI----KINPSWAKGYTRKGAALQGLHKYEEAEQCYNETLKI 103

 Score = 54.7 bits (130), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 34/111 (30%), Positives = 59/111 (53%), Gaps = 8/111 (7%)

Query: 132 KKAEKLKEKGNEEMKAKQYSKAIGSYSDAIKLYPTNFNYYNNRALAYIKANNFDHAIIDA 191
           +KAE+ + +G E      +  A+ SY++ IK  P +   Y+NRA A  K  +F  AI D 
Sbjct: 383 EKAEEARLEGKEYFTKADWPNAVKSYTEMIKRAPDDARGYSNRAAALAKLMSFPDAISDC 442

Query: 192 NKSIEIDSKIHPTNFKAYYRLGLAKYEIGDYEGSLAAFKRMIEIAQENNKG 242
           NK+IE D    P+  +AY R    +  + ++ G++      +++A+E + G
Sbjct: 443 NKAIEKD----PSFIRAYLRKATCQIAVKEFAGAI----ETLDLARERDDG 485

 Score = 40.4 bits (93), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 39/140 (27%), Positives = 70/140 (50%), Gaps = 12/140 (8%)

Query: 133 KAEKLKEKGNEEMKAKQYSKAIGSYSDAIKLYPTNFNYYNNRALAYIKANNFDHAI---- 188
           +A+K K +GN+  KA+Q+ +AI  Y+ A + +  +  Y NNR+ A  +  +++  I    
Sbjct: 250 EADKAKAEGNKAYKARQFDEAISHYNQAWETF-KDITYLNNRSAAEYEKGDYETCIKTLT 308

Query: 189 --IDANKSIEIDSKIHPTNFK----AYYRLGLAKYEIGDYEGSLAAFKRMIEIAQENNKG 242
             ++  + +  D KI   +F     AY +L   K  I  Y+ SL    R  +I  +  K 
Sbjct: 309 EAVENARELRTDYKIVAKSFARMGNAYAKLDDLKKAIEYYQKSLTEH-RTPDILSKLRKA 367

Query: 243 DEITKQMDADYEKAKEKVQE 262
           ++  KQ +A+   + EK +E
Sbjct: 368 EKDLKQQEAEAYLSPEKAEE 387

>SAKL0G07084g Chr7 (580004..581761) [1758 bp, 585 aa] {ON} highly
           similar to uniprot|P15705 Saccharomyces cerevisiae
           YOR027W STI1 Heat shock protein also induced by
           canavanine and entry into stationary phase
          Length = 585

 Score = 53.1 bits (126), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 31/103 (30%), Positives = 56/103 (54%), Gaps = 5/103 (4%)

Query: 134 AEKLKEKGNEEMKAKQYSKAIGSYSDAIKLYP-TNFNYYNNRALAYIKANNFDHAIIDAN 192
           A++ K++GN    AK + KAI  ++ AI++    N   Y+NR+  Y     F+ A+ DA 
Sbjct: 3   ADEYKQQGNAAFAAKDFEKAIELFTKAIEVSEKPNHVLYSNRSACYTSTKQFNKALEDAK 62

Query: 193 KSIEIDSKIHPTNFKAYYRLGLAKYEIGDYEGSLAAFKRMIEI 235
           + + I+    P   K Y R+G A + +GD + +   +K+ +E+
Sbjct: 63  QCVNIN----PAWSKGYNRVGAAHFGLGDLDEAEQGYKKALEL 101

 Score = 47.0 bits (110), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 30/93 (32%), Positives = 47/93 (50%), Gaps = 4/93 (4%)

Query: 130 DMKKAEKLKEKGNEEMKAKQYSKAIGSYSDAIKLYPTNFNYYNNRALAYIKANNFDHAII 189
           D +KAE+ + +G E      +  A+ SY++ IK  P +   Y+NRA A  K  +F  AI 
Sbjct: 389 DPEKAEEARLQGKEYFTKGDWPNAVKSYTEMIKRAPEDARGYSNRAAALSKLMSFPEAIK 448

Query: 190 DANKSIEIDSKIHPTNFKAYYRLGLAKYEIGDY 222
           D N +I  D    P   +AY R   A+  + ++
Sbjct: 449 DCNVAISKD----PNFIRAYIRKATAQIAVREF 477

 Score = 40.8 bits (94), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 40/139 (28%), Positives = 68/139 (48%), Gaps = 14/139 (10%)

Query: 133 KAEKLKEKGNEEMKAKQYSKAIGSYSDAIKLYPTNFNYYNNRALAYIKANNFDHAI---- 188
           KA+  K +GN+  KA+++ +AI  YS A +L+  +  Y NNRA A  +   ++ AI    
Sbjct: 258 KADAEKAEGNKFYKARKFDEAIEHYSKAWELH-KDITYLNNRAAAEYEKGEYETAIKTLT 316

Query: 189 --IDANKSIEIDSKIHPTNFK----AYYRLGLAKYEIGDYEGSLAAFKRMIEIAQENNKG 242
             ++  + +  D K+   +F     +Y++L   K  I  Y+ SL   +    + +  N  
Sbjct: 317 EAVEQGRELRADYKVISKSFARIGNSYHKLNELKKAIEFYQKSLTEHRTPEILTKLRNCE 376

Query: 243 DEITKQMDADY---EKAKE 258
            E+ KQ    Y   EKA+E
Sbjct: 377 KELKKQETEAYIDPEKAEE 395

>KLTH0E02178g Chr5 (194914..196695) [1782 bp, 593 aa] {ON} highly
           similar to uniprot|P15705 Saccharomyces cerevisiae
           YOR027W STI1 Heat shock protein also induced by
           canavanine and entry into stationary phase
          Length = 593

 Score = 51.6 bits (122), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 33/103 (32%), Positives = 55/103 (53%), Gaps = 5/103 (4%)

Query: 134 AEKLKEKGNEEMKAKQYSKAIGSYSDAIKLY-PTNFNYYNNRALAYIKANNFDHAIIDAN 192
           AE+ K++GN    AK Y KA   ++ AI+     N   Y+NR+  +     F+ A+ DAN
Sbjct: 3   AEEFKKQGNAAFVAKDYEKASELFTKAIEASEAPNHVLYSNRSACFTSLKKFNEALNDAN 62

Query: 193 KSIEIDSKIHPTNFKAYYRLGLAKYEIGDYEGSLAAFKRMIEI 235
           + +    KI+P   K Y R+G A + +G  + +   +K+ +EI
Sbjct: 63  ECV----KINPAWSKGYNRVGAAYFGLGKLDEAEQGYKKALEI 101

 Score = 45.4 bits (106), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 51/201 (25%), Positives = 88/201 (43%), Gaps = 17/201 (8%)

Query: 130 DMKKAEKLKEKGNEEMKAKQYSKAIGSYSDAIKLYPTNFNYYNNRALAYIKANNFDHAII 189
           D +KAE+ + +G E      +  A+ +Y++  K  P +   Y+NRA A  K  +F  AI 
Sbjct: 397 DPEKAEEARLQGKEYFTKGDWPNAVKAYTEMTKRAPEDARGYSNRAAALAKLMSFPEAIK 456

Query: 190 DANKSIEIDSKIHPTNFKAYYRLGLAKYEIGDYEGSLAAFKRMIEIAQENNKGDEITKQM 249
           D + +I  D    P   +AY R   A+  + ++  ++           E N G  + +++
Sbjct: 457 DCDMAISKD----PNFIRAYIRKATAQIAVREFASAIETLDAARAKDTELNNGANV-REI 511

Query: 250 DADYEKAKEKVQELFFMQITKSTGKEGSGNSVNDGPKRKVTLND-----ILNMAGNN--- 301
           D  Y KA    Q+ F  Q    T ++    ++ D P+    + D     IL+ A  N   
Sbjct: 512 DQLYIKAS---QQRFQPQDPNETPEQAYARALKD-PEVASIMQDPVMQSILSQAQQNPAA 567

Query: 302 LNIIMSNPLFKEVVEQLLASN 322
           L   M NP     ++ L+A+ 
Sbjct: 568 LQEHMKNPEVFNKIQTLIAAG 588

 Score = 38.9 bits (89), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 42/148 (28%), Positives = 74/148 (50%), Gaps = 14/148 (9%)

Query: 120 ETKETKVSNDDMKKAEKLKEKGNEEMKAKQYSKAIGSYSDAIKLYPTNFNYYNNRALAYI 179
           E  E +   D  K A+  K +GN+  KA+++ +AI  Y+ A  L+  +  Y NNR+ A  
Sbjct: 253 EVDEPQPEQDSKKNADAEKAEGNKFYKARKFDEAIEHYNKAWDLH-KDVTYLNNRSAAEY 311

Query: 180 KANNFDHAIIDANKSIEIDSKIHPTNFKAYYRLGLAKY-EIGDYEGSLAAFKRMIEIAQ- 237
           +  +++ AI    +++E   ++     +A Y+L    +  IG+    L  FK+ IE  Q 
Sbjct: 312 EKGDYEQAIKTLTEAVEQGREM-----RADYKLISKSFARIGNAYLKLEDFKKAIEFYQK 366

Query: 238 ---ENNKGDEITKQMDADYEKAKEKVQE 262
              E+   D +TK  + + E   +KV+E
Sbjct: 367 SLTEHRTPDILTKLRNCEKE---QKVRE 391

>KLLA0F24046g Chr6 (2240454..2242268) [1815 bp, 604 aa] {ON} similar
           to uniprot|P07213 Saccharomyces cerevisiae YNL121C TOM70
           Translocase of Outer Mitochondrial membrane 70 kDa
           mitochondrial specialized import receptor of the outer
           membrane
          Length = 604

 Score = 50.4 bits (119), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 33/95 (34%), Positives = 51/95 (53%), Gaps = 5/95 (5%)

Query: 132 KKAEKLKEKGNEEMKAKQYSKAIGSYSDAIKLYPTNFNYYNNRALAYIKANNFDHAIIDA 191
           K A  LK+KGNE  KAK + KAI  Y+ AI L   +  +Y+NR+ AY+  NNF+  + D 
Sbjct: 102 KYALALKDKGNEFFKAKDFEKAIEYYTLAISL-KEDPVFYSNRSAAYVSINNFEKVVEDT 160

Query: 192 NKSIEIDSKIHPTNFKAYYRLGLAKYEIGDYEGSL 226
             ++    K+ P   K + R   A   +G +  ++
Sbjct: 161 TAAL----KLKPDYSKCWLRRASAYENLGQFSDAM 191

>KNAG0A03950 Chr1 complement(529620..530780) [1161 bp, 386 aa] {ON}
           Anc_8.506 YBR155W
          Length = 386

 Score = 49.7 bits (117), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 33/127 (25%), Positives = 62/127 (48%), Gaps = 8/127 (6%)

Query: 117 DIEETKETKVSNDDMKKAEKLKEKGNEEMKAKQYSKAIGSYSDAIKLY----PTNFNYYN 172
           ++E  K      +  + AE  K + N+  K K++  A   Y+  IK++      N + + 
Sbjct: 68  ELEALKALAYEGEPHEIAENFKNQANDLYKVKRFRDARELYTKGIKVFCEDKSINESLFA 127

Query: 173 NRALAYIKANNFDHAIIDANKSIEIDSKIHPTNFKAYYRLGLAKYEIGDYEGSLAAFKRM 232
           NRA   ++  N+   + D  K++EI+    P N K +YR+G A   +G ++ +  A    
Sbjct: 128 NRAACELELKNYRSCVADCQKAMEIN----PMNLKCFYRMGKAFLALGKFKEAHDAVSFG 183

Query: 233 IEIAQEN 239
           ++I +EN
Sbjct: 184 LKIDEEN 190

>TDEL0A04840 Chr1 (851520..853250) [1731 bp, 576 aa] {ON} Anc_5.617
           YOR027W
          Length = 576

 Score = 49.7 bits (117), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 29/97 (29%), Positives = 51/97 (52%), Gaps = 4/97 (4%)

Query: 130 DMKKAEKLKEKGNEEMKAKQYSKAIGSYSDAIKLYPTNFNYYNNRALAYIKANNFDHAII 189
           D +KAE+ + +G E      +  A+ +Y++ IK  P +   Y+NRA A  K  +F  AI 
Sbjct: 378 DPEKAEEARLEGKEYFSKADWPNAVKAYTEMIKRSPQDARGYSNRAAALAKLMSFPEAIA 437

Query: 190 DANKSIEIDSKIHPTNFKAYYRLGLAKYEIGDYEGSL 226
           D +++IE D    P   +AY R   A+  + ++  ++
Sbjct: 438 DCDRAIEKD----PNFIRAYIRKASAQIAVKEFAAAV 470

 Score = 47.0 bits (110), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 42/138 (30%), Positives = 71/138 (51%), Gaps = 14/138 (10%)

Query: 134 AEKLKEKGNEEMKAKQYSKAIGSYSDAIKLYPTNFNYYNNRALAYIKANNFDHAI----- 188
           AE+ K +GN+  KA+++ +AI  Y+ A +L+  +  Y NNRA A  +  +++ AI     
Sbjct: 248 AEEEKAEGNKFYKARKFDEAIEHYNKAWELH-KDITYLNNRAAAEYEKGDYETAIATLTN 306

Query: 189 -IDANKSIEIDSKIHPTNFK----AYYRLGLAKYEIGDYEGSLAAFKRMIEIAQENNKGD 243
            +D  + +  D K+   +F     AY++LG  K  I  Y+ SL   +    + +  N   
Sbjct: 307 AVDEGREMRADYKVIAKSFARIGNAYHKLGDLKKSINFYQKSLTEHRSADVLNKLRNAEK 366

Query: 244 EITKQMDADY---EKAKE 258
           E+ KQ   +Y   EKA+E
Sbjct: 367 ELKKQEAEEYVDPEKAEE 384

 Score = 46.6 bits (109), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 32/115 (27%), Positives = 56/115 (48%), Gaps = 5/115 (4%)

Query: 131 MKKAEKLKEKGNEEMKAKQYSKAIGSYSDAIKLYP-TNFNYYNNRALAYIKANNFDHAII 189
           M  A++ K++GN    AK Y KA   +  AI +    N   Y+NR+  Y     F   + 
Sbjct: 1   MTSADEYKQQGNAAFVAKDYEKAAELFGKAIDVSEQPNHVLYSNRSACYTSLKKFAEGLK 60

Query: 190 DANKSIEIDSKIHPTNFKAYYRLGLAKYEIGDYEGSLAAFKRMIEIAQENNKGDE 244
           DA + +    KI+P   K Y R+G A++ + + E +  ++++ +E+   N    E
Sbjct: 61  DAEECV----KINPGWSKGYNRVGAAQFGLNNLEDAEKSYQKALELDSANKAAKE 111

>KNAG0I02520 Chr9 complement(487699..488052) [354 bp, 117 aa] {ON}
           Anc_6.328 YCR060W
          Length = 117

 Score = 45.8 bits (107), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 31/96 (32%), Positives = 44/96 (45%), Gaps = 3/96 (3%)

Query: 131 MKKAEKLKEKGNEEMKAKQYSKAIGSYSDAIKLYPTNFNYYNNRALAYIKANNFDHAIID 190
           M   E +KE+GN   +   +S A   Y   I L P N   Y+NRA+A IK   F   I  
Sbjct: 1   MDTFETVKEQGNVAFRNSNFSSAAEYYGKCICLEPENPIGYSNRAMALIKLQKFSETIDT 60

Query: 191 ANKS---IEIDSKIHPTNFKAYYRLGLAKYEIGDYE 223
             +    +E + K  P   K  YRL LA+  +  ++
Sbjct: 61  CQRGLGKLEDNEKDEPIRKKLLYRLHLAQESLNKFQ 96

>YCR060W Chr3 (224399..224734) [336 bp, 111 aa] {ON}  TAH1Component
           of the conserved R2TP complex (Rvb1-Rvb2-Tah1-Pih1);
           contains a single TPR domain with at least two TPR
           motifs; R2TP complex interacts with Hsp90 (Hsp82p and
           Hsc82p) to mediate assembly large protein complexes such
           as box C/D snoRNPs and RNA polymerase II
          Length = 111

 Score = 44.3 bits (103), Expect = 3e-05,   Method: Composition-based stats.
 Identities = 29/95 (30%), Positives = 44/95 (46%), Gaps = 2/95 (2%)

Query: 131 MKKAEKLKEKGNEEMKAKQYSKAIGSYSDAIKLYPTNFNYYNNRALAYIKANNFDHAIID 190
           M + EK KE+GN   K   Y +A+  Y   I   P N   Y+N+A+A IK   +  AI  
Sbjct: 1   MSQFEKQKEQGNSLFKQGLYREAVHCYDQLITAQPQNPVGYSNKAMALIKLGEYTQAIQM 60

Query: 191 ANKSIEIDSKIHPTNFKA--YYRLGLAKYEIGDYE 223
             + +   S       ++   YRL LA+  +G  +
Sbjct: 61  CQQGLRYTSTAEHVAIRSKLQYRLELAQGAVGSVQ 95

>Suva_3.95 Chr3 (137419..137754) [336 bp, 111 aa] {ON} YCR060W
           (REAL)
          Length = 111

 Score = 44.3 bits (103), Expect = 4e-05,   Method: Composition-based stats.
 Identities = 29/92 (31%), Positives = 44/92 (47%), Gaps = 2/92 (2%)

Query: 131 MKKAEKLKEKGNEEMKAKQYSKAIGSYSDAIKLYPTNFNYYNNRALAYIKANNFDHAIID 190
           M + E+ KE+GNE  K   Y  AIG Y   I   P N   ++N+A+A IK      AI  
Sbjct: 1   MMQFERDKEEGNELYKQGLYRDAIGCYDRLIAAQPQNPVGHSNKAMALIKLGEHAQAIEA 60

Query: 191 ANKSIEIDSKIHPTNFKA--YYRLGLAKYEIG 220
             + +++ +       +A   YRL LA+  + 
Sbjct: 61  CQQGLQLAASPQHAALRAKLLYRLQLAQAAVA 92

>NCAS0A00490 Chr1 complement(76652..78514) [1863 bp, 620 aa] {ON} 
          Length = 620

 Score = 47.4 bits (111), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 30/101 (29%), Positives = 53/101 (52%), Gaps = 4/101 (3%)

Query: 130 DMKKAEKLKEKGNEEMKAKQYSKAIGSYSDAIKLYPTNFNYYNNRALAYIKANNFDHAII 189
           D++K E+ + +G +    ++Y KA+  Y++ IK  PT+   + NRA  + K       I 
Sbjct: 425 DLQKFEEARIEGKQHFLNREYFKAMKCYTEMIKTNPTSPVGWCNRAAVFEKLLTCPQVID 484

Query: 190 DANKSIEIDSKIHPTNFKAYYRLGLAKYEIGDYEGSLAAFK 230
           D +K+I +D    P+  KAY R G A+    D + +L  ++
Sbjct: 485 DCDKAISVD----PSYIKAYVRKGFAQITERDLDEALETWE 521

 Score = 45.4 bits (106), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 30/107 (28%), Positives = 58/107 (54%), Gaps = 5/107 (4%)

Query: 134 AEKLKEKGNEEMKAKQYSKAIGSYSDAIKLYPTNFN-YYNNRALAYIKANNFDHAIIDAN 192
           +++LKE GN+  K K Y +A+  ++ A+    TN +  Y+NRA A+I   ++  A+ D  
Sbjct: 8   SQELKELGNKTYKEKGYEQAVHYFTSALSQPSTNKHILYSNRAAAHIGLKHYAEALEDGK 67

Query: 193 KSIEIDSKIHPTNFKAYYRLGLAKYEIGDYEGSLAAFKRMIEIAQEN 239
             +E+     P   K Y R+G+A   +   + +   FK+ +++ ++N
Sbjct: 68  NCVELA----PNWDKGYSRVGVAYLGLQKLDEAEENFKKALQLNEQN 110

 Score = 35.4 bits (80), Expect = 0.22,   Method: Compositional matrix adjust.
 Identities = 30/139 (21%), Positives = 69/139 (49%), Gaps = 9/139 (6%)

Query: 100 DLSRNKDDINVPVK--VIEDIEETKETKVSNDDMKKAEKLKEK---GNEEMKAKQYSKAI 154
           ++S  + D+N  ++  V   ++E  + K+S ++ +K  +  E+   GN+  K + + +AI
Sbjct: 256 EMSFTEPDMNEDIRKHVRSQMKEKSQQKLSPEETEKKRRADEEKRIGNDLYKKRNFKEAI 315

Query: 155 GSYSDAIKLYPTNFNYYNNRALAYIKANNFDHAIIDANKSIEIDSKIHPTN---FKAYYR 211
             Y+ A   +  +  Y NN   A  +  ++ + +    +++      +P      K+Y R
Sbjct: 316 IHYTKAWNTF-QDITYLNNIGAAQFERGDYGNVLKSLGQAVFFAEHTNPEPQVLAKSYIR 374

Query: 212 LGLAKYEIGDYEGSLAAFK 230
           +G A + I D+E ++ A++
Sbjct: 375 MGNAYHRIWDHEHAITAYE 393

>Smik_3.159 Chr3 (222475..222822) [348 bp, 115 aa] {ON} YCR060W
           (REAL)
          Length = 115

 Score = 43.9 bits (102), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 31/91 (34%), Positives = 43/91 (47%), Gaps = 2/91 (2%)

Query: 135 EKLKEKGNEEMKAKQYSKAIGSYSDAIKLYPTNFNYYNNRALAYIKANNFDHAIIDANKS 194
           EK KE GN   K   Y +A+ SY   I   P N   Y+N+A+A IK   + HAI    + 
Sbjct: 9   EKEKELGNALFKQGLYREAVDSYDQLITAQPQNPVGYSNKAMALIKLAEYTHAIQTCQEG 68

Query: 195 IE--IDSKIHPTNFKAYYRLGLAKYEIGDYE 223
           +   +  +      K  YRL L++ E G  E
Sbjct: 69  LRYALGPEHAAIRSKLQYRLKLSQTEAGSIE 99

>YBR155W Chr2 (549771..550928) [1158 bp, 385 aa] {ON}
           CNS1TPR-containing co-chaperone; binds both Hsp82p
           (Hsp90) and Ssa1p (Hsp70) and stimulates the ATPase
           activity of SSA1, ts mutants reduce Hsp82p function
           while over expression suppresses the phenotypes of an
           HSP82 ts allele and a cpr7 deletion
          Length = 385

 Score = 45.1 bits (105), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 33/116 (28%), Positives = 56/116 (48%), Gaps = 8/116 (6%)

Query: 117 DIEETKETKVSNDDMKKAEKLKEKGNEEMKAKQYSKAIGSYSDAIKLY----PTNFNYYN 172
           ++E  K      +  + AE  K++GNE  KAK++  A   YS  + +       N + Y 
Sbjct: 66  ELEALKALAYEGEPHEIAENFKKQGNELYKAKRFKDARELYSKGLAVECEDKSINESLYA 125

Query: 173 NRALAYIKANNFDHAIIDANKSIEIDSKIHPTNFKAYYRLGLAKYEIGDYEGSLAA 228
           NRA   ++  N+   I D +K++     I+P N K YYR   A +++   E + +A
Sbjct: 126 NRAACELELKNYRRCIEDCSKAL----TINPKNVKCYYRTSKAFFQLNKLEEAKSA 177

>Suva_15.314 Chr15 (544646..546580) [1935 bp, 644 aa] {ON} YHR117W
           (REAL)
          Length = 644

 Score = 44.7 bits (104), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 29/89 (32%), Positives = 45/89 (50%), Gaps = 4/89 (4%)

Query: 134 AEKLKEKGNEEMKAKQYSKAIGSYSDAIKLYPTNFNYYNNRALAYIKANNFDHAIIDANK 193
           A +LK+KGN    AK +  AI  Y  AI+L P +  +Y+N +  YI   + D  +    K
Sbjct: 131 AVQLKDKGNHFFTAKSFGDAIKYYQYAIELDPNDPVFYSNISACYISTGDLDKVVEYTTK 190

Query: 194 SIEIDSKIHPTNFKAYYRLGLAKYEIGDY 222
           ++E    I P + KA  R   A   +G++
Sbjct: 191 ALE----IKPDHSKALLRRASANESLGNF 215

>KAFR0J02570 Chr10 (488372..488737) [366 bp, 121 aa] {ON} Anc_6.328
           YCR060W
          Length = 121

 Score = 42.0 bits (97), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 31/84 (36%), Positives = 43/84 (51%), Gaps = 4/84 (4%)

Query: 137 LKEKGNEEMKAKQYSKAIGSYSDAIKLYPTNFNYYNNRALAYIKANNFDHAII---DANK 193
            K +GN+  K   Y+ AI SY   I++ P N   Y+N+A+A IKAN    A+    D  K
Sbjct: 6   FKTEGNQYFKEGNYASAIKSYEKCIEINPENPIGYSNKAMALIKANKNQEAVRTCQDGLK 65

Query: 194 SIEIDSKIHPT-NFKAYYRLGLAK 216
            +  +   H T   K  YRL LA+
Sbjct: 66  RVSKNDATHETIQKKLEYRLELAE 89

>ADR230W Chr4 (1103275..1105332) [2058 bp, 685 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YOR080W (DIA2)
          Length = 685

 Score = 44.3 bits (103), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 42/167 (25%), Positives = 80/167 (47%), Gaps = 19/167 (11%)

Query: 164 YPTNFNYYNNRALAYIKANNFDHAIIDANKSIEIDSKIHPTNFKAYYRLGLAKYEIGDYE 223
           +P  F   +NRA  + K N  D A+ DA   I +D+     N K Y R G    ++G YE
Sbjct: 66  HPRFFVLLDNRAATFEKLNKLDRALADAAYMITVDA----YNLKGYIRRGKVLQKLGRYE 121

Query: 224 GSLAAFKRMIEIAQENNKGDEI---TKQMDADYEKAKEKVQELFFMQITKSTGKEGSGNS 280
            +L  ++  ++ A E  K   I    K +D  Y + +  ++EL  +Q    + +  +  +
Sbjct: 122 EALQVYENGLKQAGEAEKTHAIHAPQKFLDIVY-RQRSTIKEL--LQSRARSSRSLTQQT 178

Query: 281 VNDGP--KRKVTLNDIL-----NMAGNNLNIIMSNPLFKEVVEQLLA 320
           V   P  KR  T++ ++     + +   ++ I + P+  E++E+++A
Sbjct: 179 VAKEPKLKRPATIDSLMPGKKRSSSKAKIDYIATLPV--EIIERIMA 223

>Smik_2.295 Chr2 (535786..536943) [1158 bp, 385 aa] {ON} YBR155W
           (REAL)
          Length = 385

 Score = 43.9 bits (102), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 30/99 (30%), Positives = 49/99 (49%), Gaps = 8/99 (8%)

Query: 134 AEKLKEKGNEEMKAKQYSKAIGSYSDAIKLY----PTNFNYYNNRALAYIKANNFDHAII 189
           AE  K++GNE  KAK++  A   Y+  I +       N + + NRA   ++  N+   I 
Sbjct: 83  AENFKKQGNELYKAKRFKDARELYTKGIAVECEDKSINESLFANRAACELELKNYRRCIE 142

Query: 190 DANKSIEIDSKIHPTNFKAYYRLGLAKYEIGDYEGSLAA 228
           D +K++     I+P N K YYR   A + +   E + +A
Sbjct: 143 DCSKAL----TINPKNIKCYYRTSKAFFSLSKLEEAKSA 177

>TBLA0H03380 Chr8 (829314..830441) [1128 bp, 375 aa] {ON} Anc_8.506
           YBR155W
          Length = 375

 Score = 43.5 bits (101), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 33/107 (30%), Positives = 50/107 (46%), Gaps = 8/107 (7%)

Query: 137 LKEKGNEEMKAKQYSKAIGSYSDAIKLY----PTNFNYYNNRALAYIKANNFDHAIIDAN 192
            K +GNE  K KQY  A   Y+  I +       N + Y NRA   ++  NF   I D  
Sbjct: 77  FKNRGNEFYKLKQYRDAREVYTKGIDVKCDDDKINESLYANRAACELELKNFRKCIEDCK 136

Query: 193 KSIEIDSKIHPTNFKAYYRLGLAKYEIGDYEGSLAAFKRMIEIAQEN 239
           K++  + K    N K YYR+G A   +  ++ S  + +  ++I  EN
Sbjct: 137 KALSFNVK----NIKCYYRMGKAFLSVDRFDESKESIEFGLKIDSEN 179

>NDAI0I00440 Chr9 complement(89650..90036) [387 bp, 128 aa] {ON}
           Anc_6.328 YCR060W
          Length = 128

 Score = 41.2 bits (95), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 29/84 (34%), Positives = 43/84 (51%), Gaps = 4/84 (4%)

Query: 137 LKEKGNEEMKAKQYSKAIGSYSDAIKLYPTNFNYYNNRALAYIKANNFDHAIIDANKSIE 196
           LK++GN   +   Y++A G Y   IKL PTN   Y+N+A++ IK  N   A+    + ++
Sbjct: 6   LKQEGNTFFQKGDYAQANGYYDQCIKLEPTNPIGYSNKAMSLIKQGNHGLAVETCQEGLK 65

Query: 197 IDS----KIHPTNFKAYYRLGLAK 216
             S    +      K  YRL LAK
Sbjct: 66  YTSSSTKEATTIKRKLEYRLELAK 89

>CAGL0K09240g Chr11 complement(914042..914470) [429 bp, 142 aa] {ON}
           weakly similar to uniprot|P25638 Saccharomyces
           cerevisiae YCR060w
          Length = 142

 Score = 40.8 bits (94), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 31/83 (37%), Positives = 40/83 (48%), Gaps = 5/83 (6%)

Query: 135 EKLKEKGNEEMKAKQYSKAIGSYSDAIKLYPTNFNYYNNRALAYIKANNFDHA--IIDAN 192
           +  K+ GNE  K  +Y  AI  Y   I L PTN   Y+N A+AY+K    D A    +  
Sbjct: 36  QHFKDIGNEHFKKGEYDLAIEQYRKCISLEPTNAVGYSNLAMAYLKNRCPDEAKTACEMG 95

Query: 193 KSIEIDSKIHPTNFKAYYRLGLA 215
            S   D+K+     K  YRL LA
Sbjct: 96  LSYCKDTKLRQ---KLQYRLELA 115

>KAFR0E02980 Chr5 (596891..598033) [1143 bp, 380 aa] {ON} Anc_8.506
           YBR155W
          Length = 380

 Score = 42.4 bits (98), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 43/165 (26%), Positives = 69/165 (41%), Gaps = 32/165 (19%)

Query: 117 DIEETKETKVSNDDMKKAEKLKEKGNEEMKAKQYSKAIGSYSDAIKL----YPTNFNYYN 172
           ++E  K      +  + AE  K +GN+  K K++  A   Y+  I++       N + Y 
Sbjct: 61  ELEALKALAYEGEPHEIAENFKNQGNDLYKVKRFRDAREIYTKGIEMKCDVAKINESLYA 120

Query: 173 NRALAYIKANNFDHAIIDANKSIEIDSKIHPTNFKAYYRLGLAKYEIGDYEGSLAAFKRM 232
           NRA   ++  NF   I D   ++      +P N K Y+R+G A   I  +E +    +  
Sbjct: 121 NRAACQLELKNFRSCISDCKTAL----TYNPKNIKCYFRMGKAFTAINKFESA----RES 172

Query: 233 IEIAQE---------------NNKGDEITKQMDADYEKAKEKVQE 262
           IE  Q+                NK +EI K     YE+ K K Q+
Sbjct: 173 IEFGQKIDNDNKSFENLLNIIKNKEEEIRK-----YEEKKLKAQQ 212

>Ecym_2559 Chr2 (1089202..1090314) [1113 bp, 370 aa] {ON} similar to
           Ashbya gossypii AGL268C
          Length = 370

 Score = 42.4 bits (98), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 33/128 (25%), Positives = 60/128 (46%), Gaps = 8/128 (6%)

Query: 117 DIEETKETKVSNDDMKKAEKLKEKGNEEMKAKQYSKAIGSYSDAIKLY----PTNFNYYN 172
           ++E  K      +  + A   K +GN+  K K+Y  A   YS  I++       N + Y 
Sbjct: 62  ELEALKALAYEGEPHEVAANFKNQGNDLYKVKRYKDARTMYSKGIEVKCEDDSINGSLYL 121

Query: 173 NRALAYIKANNFDHAIIDANKSIEIDSKIHPTNFKAYYRLGLAKYEIGDYEGSLAAFKRM 232
           NRA   ++  NF   I D  K++  ++K      KA+YR+G A +++   E +  +    
Sbjct: 122 NRAACELELRNFRSCINDCKKALNFNAKC----VKAFYRMGQAYFKLKKLEEAKGSVLFG 177

Query: 233 IEIAQENN 240
           +++  +NN
Sbjct: 178 LKLDSQNN 185

>KLLA0B09966g Chr2 complement(872760..873872) [1113 bp, 370 aa] {ON}
           similar to uniprot|P33313 Saccharomyces cerevisiae
           YBR155W CNS1 cyclophilin seven suppressor component of
           Hsp90p chaperone machinery
          Length = 370

 Score = 42.4 bits (98), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 35/146 (23%), Positives = 67/146 (45%), Gaps = 8/146 (5%)

Query: 117 DIEETKETKVSNDDMKKAEKLKEKGNEEMKAKQYSKAIGSYSDAIKL----YPTNFNYYN 172
           ++E  K      +  + A   K +GN+  K K++  A   Y  A+ +       N + Y 
Sbjct: 53  ELEALKAMAYEGEPHEIATNFKNQGNDLYKGKRFKDARAMYLKALDVKCDVLSINESLYL 112

Query: 173 NRALAYIKANNFDHAIIDANKSIEIDSKIHPTNFKAYYRLGLAKYEIGDYEGSLAAFKRM 232
           N A   ++  N+   I    +++++++K    N KA++R+G A  E+G +E SL A +  
Sbjct: 113 NLAACELEIKNYRSCINYCREALKLNAK----NVKAFFRIGKAYLELGRFEDSLEAVQVG 168

Query: 233 IEIAQENNKGDEITKQMDADYEKAKE 258
           + +  EN     I  +     ++ KE
Sbjct: 169 LAVDPENGALKSIQSKATEKLKRKKE 194

>Suva_4.405 Chr4 (719015..720172) [1158 bp, 385 aa] {ON} YBR155W
           (REAL)
          Length = 385

 Score = 42.0 bits (97), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 29/116 (25%), Positives = 56/116 (48%), Gaps = 8/116 (6%)

Query: 117 DIEETKETKVSNDDMKKAEKLKEKGNEEMKAKQYSKAIGSYSDAIKLY----PTNFNYYN 172
           ++E  K      +  + AE  K++GNE  KAK++  A   Y+  + +       N + + 
Sbjct: 66  ELEALKALAYEGEPHEIAENFKKQGNELYKAKRFKDARELYTKGVAVECEDKSINESLFA 125

Query: 173 NRALAYIKANNFDHAIIDANKSIEIDSKIHPTNFKAYYRLGLAKYEIGDYEGSLAA 228
           NRA   ++  N+   + D  K++     I+P N K YYR+  + +++   E + +A
Sbjct: 126 NRAACELELKNYRKCVEDCGKAL----TINPKNIKCYYRISKSFFQLRKLEEAKSA 177

>ABR131W Chr2 (641631..643415) [1785 bp, 594 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YNL121C (TOM70) and
           YHR117W (TOM71)
          Length = 594

 Score = 42.4 bits (98), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 29/95 (30%), Positives = 48/95 (50%), Gaps = 5/95 (5%)

Query: 132 KKAEKLKEKGNEEMKAKQYSKAIGSYSDAIKLYPTNFNYYNNRALAYIKANNFDHAIIDA 191
           K A  LK+KGNE  K ++Y +AI  Y  A+KL   +  +Y+NR+  Y+  N  +  + D 
Sbjct: 93  KYAMALKDKGNECFKDQRYEEAIKFYDCALKL-KEDPVFYSNRSACYVPLNKLEKVVEDT 151

Query: 192 NKSIEIDSKIHPTNFKAYYRLGLAKYEIGDYEGSL 226
             ++    K+ P   K   R   A   +G+Y  ++
Sbjct: 152 TAAL----KLKPDYSKCLLRRATANESLGNYADAM 182

>NCAS0E02490 Chr5 complement(493779..496208) [2430 bp, 809 aa] {ON}
           Anc_7.412 YBL084C
          Length = 809

 Score = 42.0 bits (97), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 33/108 (30%), Positives = 54/108 (50%), Gaps = 6/108 (5%)

Query: 133 KAEKLKEKGNEEMKAKQYSKAIGSYSDAIKLYPTNFNY-YNNRALAYIKANNFDHAIIDA 191
           K E     GN     K + +AI ++  A KL P NF Y Y  +   Y+  +++D A    
Sbjct: 589 KPETWCAVGNLFSLQKDHDEAIRAFDKATKLDP-NFVYAYTLQGHEYLSMDSYDTAKTFY 647

Query: 192 NKSIEIDSKIHPTNFKAYYRLGLAKYEIGDYEGSLAAFKRMIEIAQEN 239
            K+I  D  +H  ++ AYY +G+   ++G+YE +L  F++   I   N
Sbjct: 648 RKAISND--LH--HYNAYYGMGMCSMKLGEYEQALVYFEKARSINPSN 691

 Score = 32.7 bits (73), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 31/133 (23%), Positives = 55/133 (41%), Gaps = 4/133 (3%)

Query: 117 DIEETKETKVSNDDMKKAEKLKEKGNEEMKAKQYSKAIGSYSDAIKLYPTNFNYYNNRAL 176
           D  +T   K  ++D+         G   MK  +Y +A+  +  A  + P+N        +
Sbjct: 641 DTAKTFYRKAISNDLHHYNAYYGMGMCSMKLGEYEQALVYFEKARSINPSNAILICCCGV 700

Query: 177 AYIKANNFDHAIIDANKSIEIDSKIHPTNFKAYYRLGLAKYEIGDYEGSLAAFKRMIEIA 236
              K  N + A+       E+  +I PT+  A ++     Y +  Y  +L AF+ +I+IA
Sbjct: 701 TMEKLGNQEKAL----NYYELACQIQPTSSLAKFKRAHLLYSMAKYTQALDAFEELIKIA 756

Query: 237 QENNKGDEITKQM 249
            E      I  Q+
Sbjct: 757 PEEATVQFILGQL 769

>Skud_8.178 Chr8 (316128..318044) [1917 bp, 638 aa] {ON} YHR117W
           (REAL)
          Length = 638

 Score = 41.6 bits (96), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 27/89 (30%), Positives = 45/89 (50%), Gaps = 4/89 (4%)

Query: 134 AEKLKEKGNEEMKAKQYSKAIGSYSDAIKLYPTNFNYYNNRALAYIKANNFDHAIIDANK 193
           A +LK+KGN    +K +  AI  Y  AI+L P +  +Y+N +  YI   + +  +    K
Sbjct: 125 AVQLKDKGNHFFTSKNFDDAIKYYQHAIELDPNDPVFYSNMSACYISTGDLNKVVEYTTK 184

Query: 194 SIEIDSKIHPTNFKAYYRLGLAKYEIGDY 222
           ++E    I P + KA  R   A   +G++
Sbjct: 185 ALE----IKPDHSKALLRRASANESLGNF 209

>NDAI0E04040 Chr5 (900685..903036) [2352 bp, 783 aa] {ON} Anc_7.412
           YBL084C
          Length = 783

 Score = 41.6 bits (96), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 30/100 (30%), Positives = 52/100 (52%), Gaps = 6/100 (6%)

Query: 141 GNEEMKAKQYSKAIGSYSDAIKLYPTNFNY-YNNRALAYIKANNFDHAIIDANKSIEIDS 199
           GN     K + +AI ++    KL PT F Y Y  +A  Y+  ++FD A     K++  DS
Sbjct: 572 GNLFSLQKDHKEAIKAFEKVTKLDPT-FTYGYTLQAHEYLSDDSFDLAKNYFRKAVSTDS 630

Query: 200 KIHPTNFKAYYRLGLAKYEIGDYEGSLAAFKRMIEIAQEN 239
           +    ++ AYY +G+   ++G++E +L  F++   I   N
Sbjct: 631 Q----HYNAYYGIGMCSMKLGEFEHALLYFEKARSINPSN 666

>YHR117W Chr8 (342349..344268) [1920 bp, 639 aa] {ON}
           TOM71Mitochondrial outer membrane protein with
           similarity to Tom70p; probable minor component of the
           TOM (translocase of outer membrane) complex responsible
           for recognition and import of mitochondrially directed
           proteins
          Length = 639

 Score = 41.2 bits (95), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 28/89 (31%), Positives = 45/89 (50%), Gaps = 4/89 (4%)

Query: 134 AEKLKEKGNEEMKAKQYSKAIGSYSDAIKLYPTNFNYYNNRALAYIKANNFDHAIIDANK 193
           A +LK +GN    AK +++AI  Y  AI+L P    +Y+N +  YI   + +  I    K
Sbjct: 127 AVQLKNRGNHFFTAKNFNEAIKYYQYAIELDPNEPVFYSNISACYISTGDLEKVIEFTTK 186

Query: 194 SIEIDSKIHPTNFKAYYRLGLAKYEIGDY 222
           ++E    I P + KA  R   A   +G++
Sbjct: 187 ALE----IKPDHSKALLRRASANESLGNF 211

>Ecym_8204 Chr8 complement(419900..421693) [1794 bp, 597 aa] {ON}
           similar to Ashbya gossypii ABR131W
          Length = 597

 Score = 40.8 bits (94), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 25/86 (29%), Positives = 45/86 (52%), Gaps = 5/86 (5%)

Query: 137 LKEKGNEEMKAKQYSKAIGSYSDAIKLYPTNFNYYNNRALAYIKANNFDHAIIDANKSIE 196
           +K+KGNE  K K+Y +AI  YS A++L   +  +Y+NR+  ++  N  +  + D   ++E
Sbjct: 101 MKDKGNECFKEKKYEEAIKYYSCALRL-KKDPVFYSNRSACWVPLNKLEKVVEDTTAALE 159

Query: 197 IDSKIHPTNFKAYYRLGLAKYEIGDY 222
               + P   K   R   A   +G++
Sbjct: 160 ----LKPDYSKCLLRRATANESLGNF 181

>Kwal_27.11890 s27 (990685..991689) [1005 bp, 334 aa] {ON} YBR155W
           (CNS1) - component of Hsp90p chaperone machinery [contig
           27] FULL
          Length = 334

 Score = 40.4 bits (93), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 25/88 (28%), Positives = 45/88 (51%), Gaps = 8/88 (9%)

Query: 134 AEKLKEKGNEEMKAKQYSKAIGSYSDAIKLY----PTNFNYYNNRALAYIKANNFDHAII 189
           AE  K +GNE  K K+Y  A   Y+  I++       N + ++NRA   ++  N+   + 
Sbjct: 78  AENFKNQGNELYKVKRYKDAREIYNKGIEIKCDSNKINESLFSNRAACELELKNYRRCVN 137

Query: 190 DANKSIEIDSKIHPTNFKAYYRLGLAKY 217
           D  ++++ +    PTN K +YR+  A +
Sbjct: 138 DCRQALQFN----PTNIKCFYRIARAFF 161

>KLLA0C08910g Chr3 complement(781726..782073) [348 bp, 115 aa] {ON}
           similar to uniprot|P25638 Saccharomyces cerevisiae
           YCR060W TAH1 HSP90 cofactor interacts with Hsp82p Pih1p
           Rvb1 and Rvb2 contains a single TPR domain with at least
           two TPR motifs
          Length = 115

 Score = 38.5 bits (88), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 30/98 (30%), Positives = 46/98 (46%), Gaps = 10/98 (10%)

Query: 131 MKKAEKLKEKGNEEMKAKQYSKAIGSYSDAIKLYPTNFNYYNNRALAYIKANNFDHA--- 187
           M   E+ K KGN   K   ++ A+  Y  AI   PTN   Y+N A+A IK NN+  A   
Sbjct: 1   MPSFEEFKIKGNTAYKQNNFTDAVNFYKKAITYDPTNPVGYSNCAMALIKLNNYADASQM 60

Query: 188 ----IIDANKSIEIDSKIHPTNFKAYYRLGLAKYEIGD 221
               +   N+  + D+K+     K  +RL +   ++ D
Sbjct: 61  CQRGLFYVNEQTDNDNKVRK---KLQWRLNVCSEQLKD 95

>CAGL0H07425g Chr8 (725307..726449) [1143 bp, 380 aa] {ON} highly
           similar to uniprot|P33313 Saccharomyces cerevisiae
           YBR155w CNS1
          Length = 380

 Score = 40.4 bits (93), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 28/103 (27%), Positives = 50/103 (48%), Gaps = 8/103 (7%)

Query: 117 DIEETKETKVSNDDMKKAEKLKEKGNEEMKAKQYSKAIGSYSDAI----KLYPTNFNYYN 172
           ++E  K      +  + AE  K++GN+  K K++  A   YS  I    ++   N + Y 
Sbjct: 64  ELEALKALAYEGEPHEIAENFKKQGNDLYKVKRFRDARELYSKGIDVKCQVNTINESLYA 123

Query: 173 NRALAYIKANNFDHAIIDANKSIEIDSKIHPTNFKAYYRLGLA 215
           NRA   ++  N+   I D  ++++++    P N K YYR+  A
Sbjct: 124 NRAACELEIKNYRRCINDCKQALQLN----PKNIKCYYRIAKA 162

 Score = 30.8 bits (68), Expect = 5.3,   Method: Compositional matrix adjust.
 Identities = 20/62 (32%), Positives = 28/62 (45%), Gaps = 4/62 (6%)

Query: 144 EMKAKQYSKAIGSYSDAIKLYPTNFNYYNNRALAYIKANNFDHAIIDANKSIEIDSKIHP 203
           E++ K Y + I     A++L P N   Y   A A+      D A+    +SIE   KI  
Sbjct: 129 ELEIKNYRRCINDCKQALQLNPKNIKCYYRIAKAFTALERLDEAL----ESIEFGEKIDN 184

Query: 204 TN 205
           TN
Sbjct: 185 TN 186

>NCAS0D04500 Chr4 (855490..855855) [366 bp, 121 aa] {ON} Anc_6.328
           YCR060W
          Length = 121

 Score = 38.1 bits (87), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 28/81 (34%), Positives = 38/81 (46%), Gaps = 2/81 (2%)

Query: 138 KEKGNEEMKAKQYSKAIGSYSDAIKLYPTNFNYYNNRALAYIKANNFDHAIIDANKSI-- 195
           K +GN   K   Y+ A   Y   I   PTN   Y+N+A++ IK  +FD AI   N  +  
Sbjct: 7   KTEGNRLFKLGDYTAANKFYDLCIMEEPTNPIGYSNKAMSLIKQEHFDQAIRTCNTGLLY 66

Query: 196 EIDSKIHPTNFKAYYRLGLAK 216
             D +      K  YRL LA+
Sbjct: 67  SSDPEHEAIKRKLQYRLELAQ 87

>Smik_8.195 Chr8 (318688..320595) [1908 bp, 635 aa] {ON} YHR117W
           (REAL)
          Length = 635

 Score = 40.0 bits (92), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 31/106 (29%), Positives = 51/106 (48%), Gaps = 5/106 (4%)

Query: 117 DIEETKETKVSNDDMKKAEKLKEKGNEEMKAKQYSKAIGSYSDAIKLYPTNFNYYNNRAL 176
           DI + K   +S      A +LK KGN     K +++AI  Y  AI+L P +  +Y+N + 
Sbjct: 108 DISQLKGLTLSQKQTY-AVQLKNKGNHFFTTKNFTEAIKYYQCAIELDPNDPVFYSNISA 166

Query: 177 AYIKANNFDHAIIDANKSIEIDSKIHPTNFKAYYRLGLAKYEIGDY 222
            YI   + +  +    K++EI     P + KA  R   A   +G++
Sbjct: 167 CYISTGDLNKVLEYTTKALEIK----PDHSKALLRRASANESLGNF 208

>CAGL0L12936g Chr12 (1382623..1384425) [1803 bp, 600 aa] {ON}
           similar to uniprot|P07213 Saccharomyces cerevisiae
           YNL121c TOM70 or uniprot|P38825 Saccharomyces cerevisiae
           YHR117w TOM7
          Length = 600

 Score = 39.7 bits (91), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 31/105 (29%), Positives = 54/105 (51%), Gaps = 11/105 (10%)

Query: 126 VSNDDMKK--AEKLKEKGNEEMKAKQYSKAIGSYSDAIKLY--PTNFNYYNNRALAYIKA 181
            S++D KK  A  LK+KGN   K K++  AI  Y+ AIKL+  P    +++N +  Y+  
Sbjct: 83  ASSEDQKKVYATALKDKGNALFKEKRFEDAIEFYNHAIKLHEDPV---FHSNISACYVSL 139

Query: 182 NNFDHAIIDANKSIEIDSKIHPTNFKAYYRLGLAKYEIGDYEGSL 226
            + D  +  + +++E    + P   KA  R   A   +G Y+ ++
Sbjct: 140 GDLDKVVESSTRALE----LKPDYSKALLRRASAYENMGRYQDAM 180

>TPHA0E00740 Chr5 complement(142456..144696) [2241 bp, 746 aa] {ON}
           Anc_7.412 YBL084C
          Length = 746

 Score = 39.7 bits (91), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 27/95 (28%), Positives = 46/95 (48%), Gaps = 4/95 (4%)

Query: 141 GNEEMKAKQYSKAIGSYSDAIKLYPTNFNYYNNRALAYIKANNFDHAIIDANKSIEIDSK 200
           GN     K + +AI ++  A ++ P     Y  +   Y  +++FD A     K+I  D  
Sbjct: 535 GNFLSLQKNHHEAIKAFEKATQVDPKFAYAYTLQGHEYTSSDSFDVAKRCYRKAIACD-- 592

Query: 201 IHPTNFKAYYRLGLAKYEIGDYEGSLAAFKRMIEI 235
             P ++ AYY LG+   ++G YE +L  F++   I
Sbjct: 593 --PGHYNAYYGLGMVSMKLGQYEEALLFFEKARSI 625

>Skud_3.135 Chr3 (208664..209020) [357 bp, 118 aa] {ON} YCR060W
           (REAL)
          Length = 118

 Score = 37.0 bits (84), Expect = 0.015,   Method: Composition-based stats.
 Identities = 22/59 (37%), Positives = 30/59 (50%)

Query: 130 DMKKAEKLKEKGNEEMKAKQYSKAIGSYSDAIKLYPTNFNYYNNRALAYIKANNFDHAI 188
           +M   EK K++GN   K   Y +A+ SY   I   P N   Y+N+A+A IK      AI
Sbjct: 4   NMTSFEKDKQQGNALFKQGLYLEAVDSYDRLIAAQPQNPVGYSNKAMALIKLGEHAQAI 62

>SAKL0A01672g Chr1 complement(154932..155318) [387 bp, 128 aa] {ON}
           similar to uniprot|P25638 Saccharomyces cerevisiae
           YCR060W TAH1 HSP90
          Length = 128

 Score = 36.6 bits (83), Expect = 0.025,   Method: Compositional matrix adjust.
 Identities = 25/75 (33%), Positives = 36/75 (48%), Gaps = 3/75 (4%)

Query: 131 MKKAEKLKEKGNEEMKAKQYSKAIGSYSDAIKLYPTNFNYYNNRALAYIKANNFDHAIID 190
           M+  + LK KGN   K   Y  A+  Y  AI   P+N   Y+N A+  IK   +  A+  
Sbjct: 1   MEDFDTLKAKGNVFFKKCDYETAVLYYQKAITADPSNPIGYSNNAMGLIKLEKWSEAVDA 60

Query: 191 ANKSIEIDSKIHPTN 205
            NK +++   I P N
Sbjct: 61  CNKGLKM---ICPEN 72

>NCAS0B02400 Chr2 complement(402763..403905) [1143 bp, 380 aa] {ON}
           Anc_8.506 YBR155W
          Length = 380

 Score = 38.1 bits (87), Expect = 0.027,   Method: Compositional matrix adjust.
 Identities = 28/111 (25%), Positives = 51/111 (45%), Gaps = 8/111 (7%)

Query: 117 DIEETKETKVSNDDMKKAEKLKEKGNEEMKAKQYSKAIGSYSDAIKLY----PTNFNYYN 172
           ++E  K      +  + AE  K +GN+    K++ +A   Y+  I++       N   + 
Sbjct: 63  ELEALKALAYEGEPHEVAENFKNQGNDLFTVKRFREARDIYNKGIEIKCENDKINEALFA 122

Query: 173 NRALAYIKANNFDHAIIDANKSIEIDSKIHPTNFKAYYRLGLAKYEIGDYE 223
           NRA   ++  N+   I D   ++ ++    P N K YYR+G A Y + + E
Sbjct: 123 NRAACQLELKNYRSCINDCKHALTLN----PKNIKCYYRMGKAFYLLNNIE 169

>TDEL0B01310 Chr2 complement(234307..235449) [1143 bp, 380 aa] {ON}
           Anc_8.506 YBR155W
          Length = 380

 Score = 38.1 bits (87), Expect = 0.029,   Method: Compositional matrix adjust.
 Identities = 27/104 (25%), Positives = 49/104 (47%), Gaps = 8/104 (7%)

Query: 116 EDIEETKETKVSNDDMKKAEKLKEKGNEEMKAKQYSKAIGSYSDAIKL----YPTNFNYY 171
           +++E  K      +  + A   K +GN+  KAK++  A   Y+  I++       N + Y
Sbjct: 60  QELEALKALAYEGEPHEIAGNFKNQGNDLYKAKRFKDARELYNKGIEIKCDDTSINESLY 119

Query: 172 NNRALAYIKANNFDHAIIDANKSIEIDSKIHPTNFKAYYRLGLA 215
            NRA   ++  N+   + D   +++ +    P N K YYR+G A
Sbjct: 120 ANRAACELEIKNYRRCLNDCKTALQYN----PKNLKCYYRMGKA 159

>SAKL0H10934g Chr8 complement(945834..946976) [1143 bp, 380 aa] {ON}
           similar to uniprot|P33313 Saccharomyces cerevisiae
           YBR155W CNS1 cyclophilin seven suppressor component of
           Hsp90p chaperone machinery
          Length = 380

 Score = 38.1 bits (87), Expect = 0.030,   Method: Compositional matrix adjust.
 Identities = 26/110 (23%), Positives = 52/110 (47%), Gaps = 8/110 (7%)

Query: 118 IEETKETKVSNDDMKKAEKLKEKGNEEMKAKQYSKAIGSYSDAIKLY----PTNFNYYNN 173
           +E  K      +  + AE  K +GN+  +A++Y  A   Y+  ++++      N + + N
Sbjct: 64  LEALKALAYEGEPHEIAENFKNQGNDLYRARRYKDARELYNKGVEVHCDDDAINESLFLN 123

Query: 174 RALAYIKANNFDHAIIDANKSIEIDSKIHPTNFKAYYRLGLAKYEIGDYE 223
           RA   ++  N    I D  +++    + +P N K +YR+G A + +   E
Sbjct: 124 RAACELELKNHRRCINDCKEAL----RYNPKNVKCFYRMGRAFFSLNKLE 169

>TPHA0L01420 Chr12 (293980..295104) [1125 bp, 374 aa] {ON} Anc_8.506
           YBR155W
          Length = 374

 Score = 37.7 bits (86), Expect = 0.037,   Method: Compositional matrix adjust.
 Identities = 29/96 (30%), Positives = 44/96 (45%), Gaps = 8/96 (8%)

Query: 134 AEKLKEKGNEEMKAKQYSKAIGSYSDAIKLYPTNFN----YYNNRALAYIKANNFDHAII 189
           AE  K++GNE  K KQY  A   Y   I++   N       + N+A   ++  N+   I 
Sbjct: 74  AENFKKQGNEAYKLKQYRNARVLYERGIEVNCNNDKINELLFVNKAACELEMKNYRSCIN 133

Query: 190 DANKSIEIDSKIHPTNFKAYYRLGLAKYEIGDYEGS 225
           D  K++      +P N K Y+R+  A   I  Y+ S
Sbjct: 134 DCKKALS----FNPLNVKCYFRMAKAFSAIEKYDES 165

>TPHA0D03860 Chr4 (807913..808275) [363 bp, 120 aa] {ON} Anc_6.328
           YCR060W
          Length = 120

 Score = 35.4 bits (80), Expect = 0.055,   Method: Compositional matrix adjust.
 Identities = 24/82 (29%), Positives = 36/82 (43%), Gaps = 1/82 (1%)

Query: 135 EKLKEKGNEEMKAKQYSKAIGSYSDAIKLYPTNFNYYNNRALAYIKANNFDHAIIDANKS 194
           E+ KE+GN   K   Y  A   Y   + + P N   Y+N+A+A IK   +   +    K 
Sbjct: 4   EQYKEEGNRNFKEGSYKVAAELYQKCVDIEPENPIGYSNKAMALIKLGRYTEVVELCRKG 63

Query: 195 IEIDSKIHPTNFKAY-YRLGLA 215
           +        T +K   YRL +A
Sbjct: 64  LTFTPNTTDTVYKKLNYRLEMA 85

>Ecym_4031 Chr4 complement(73900..75966) [2067 bp, 688 aa] {ON}
           similar to Ashbya gossypii ADR230W
          Length = 688

 Score = 37.4 bits (85), Expect = 0.062,   Method: Compositional matrix adjust.
 Identities = 27/105 (25%), Positives = 44/105 (41%), Gaps = 34/105 (32%)

Query: 139 EKGNEEMKAKQYSKAIGSYSDAIKL------------------------------YPTNF 168
           E G +  + ++Y KAIG +  A+KL                              +P   
Sbjct: 11  ELGIKCFQYQEYQKAIGLFGKALKLARSYSDDTLESMRENLGIRKRCLHDPNRTYHPRYL 70

Query: 169 NYYNNRALAYIKANNFDHAIIDANKSIEIDSKIHPTNFKAYYRLG 213
              +NRA ++ + NN   A+IDA++ I++D+     N K Y R G
Sbjct: 71  ILLDNRAASWERINNLGKALIDADRMIKVDA----YNLKGYIRKG 111

>KLTH0B05170g Chr2 (427608..429389) [1782 bp, 593 aa] {ON} similar
           to uniprot|P07213 Saccharomyces cerevisiae YNL121C TOM70
           Translocase of Outer Mitochondrial membrane 70 kDa
           mitochondrial specialized import receptor of the outer
           membrane
          Length = 593

 Score = 37.0 bits (84), Expect = 0.070,   Method: Compositional matrix adjust.
 Identities = 28/95 (29%), Positives = 48/95 (50%), Gaps = 5/95 (5%)

Query: 132 KKAEKLKEKGNEEMKAKQYSKAIGSYSDAIKLYPTNFNYYNNRALAYIKANNFDHAIIDA 191
           K A  LK+KGNE  K K+Y +AI  YS AI++   +  +Y+NR+  Y+     +  + D 
Sbjct: 93  KYAMGLKDKGNEFFKNKKYDEAIQYYSWAIEV-KEDPVFYSNRSACYVSLGQQEKVVEDT 151

Query: 192 NKSIEIDSKIHPTNFKAYYRLGLAKYEIGDYEGSL 226
             ++    K+ P   K   R   A   +G++  ++
Sbjct: 152 TAAL----KLKPDYSKCLLRRASANESLGNFADAM 182

>KAFR0F00720 Chr6 complement(141181..143007) [1827 bp, 608 aa] {ON}
           Anc_2.152 YHR117W
          Length = 608

 Score = 37.0 bits (84), Expect = 0.071,   Method: Compositional matrix adjust.
 Identities = 30/97 (30%), Positives = 47/97 (48%), Gaps = 9/97 (9%)

Query: 132 KKAEKLKEKGNEEMKAKQYSKAIGSYSDAIKLY--PTNFNYYNNRALAYIKANNFDHAII 189
           K A +LK+KGNE  K K Y  A+  Y  A+ L   P    +Y+N +  Y+  N  D  I 
Sbjct: 106 KWAIELKDKGNEYFKEKDYENALKFYDFALILKKDPV---FYSNMSACYVSLNELDKVIE 162

Query: 190 DANKSIEIDSKIHPTNFKAYYRLGLAKYEIGDYEGSL 226
            + K++E    + P   KA  R   A  ++ +Y  ++
Sbjct: 163 MSTKALE----LKPDYSKALLRRATANEQLENYSDAM 195

>ZYRO0F08624g Chr6 (691992..693131) [1140 bp, 379 aa] {ON} similar
           to uniprot|P33313 Saccharomyces cerevisiae YBR155W CNS1
           cyclophilin seven suppressor component of Hsp90p
           chaperone machinery
          Length = 379

 Score = 37.0 bits (84), Expect = 0.072,   Method: Compositional matrix adjust.
 Identities = 31/127 (24%), Positives = 57/127 (44%), Gaps = 8/127 (6%)

Query: 117 DIEETKETKVSNDDMKKAEKLKEKGNEEMKAKQYSKAIGSYSDAIKLY----PTNFNYYN 172
           ++E  K      +  + AE  K + N+  KAK++ +A   Y   I++       N + + 
Sbjct: 61  ELEALKALAYDGEPHEVAENFKNQANDLYKAKRFKEAREVYKKGIEIKCNDDKVNESLFA 120

Query: 173 NRALAYIKANNFDHAIIDANKSIEIDSKIHPTNFKAYYRLGLAKYEIGDYEGSLAAFKRM 232
           N A   ++  NF   I    K+++ +    P N K YYR+  A Y++   + +  + K  
Sbjct: 121 NLAACELEIKNFRRCINLCQKALQFN----PKNMKCYYRIAKAFYQLNKLDEAKESVKFG 176

Query: 233 IEIAQEN 239
           + I  EN
Sbjct: 177 LTIDSEN 183

>NDAI0F02810 Chr6 (690977..692806) [1830 bp, 609 aa] {ON} Anc_2.152
           YHR117W
          Length = 609

 Score = 37.0 bits (84), Expect = 0.087,   Method: Compositional matrix adjust.
 Identities = 29/89 (32%), Positives = 43/89 (48%), Gaps = 5/89 (5%)

Query: 134 AEKLKEKGNEEMKAKQYSKAIGSYSDAIKLYPTNFNYYNNRALAYIKANNFDHAIIDANK 193
           A  LK+KGNE  K  ++  AI  Y  A+KL      YY+N +  Y     ++  I  A K
Sbjct: 110 AMALKDKGNELFKTSKFEDAIKYYHYALKLKDDPI-YYSNISACYASLLQYEKVIEYATK 168

Query: 194 SIEIDSKIHPTNFKAYYRLGLAKYEIGDY 222
           ++    K+ PT  K   R  LA   +G++
Sbjct: 169 AL----KLRPTFSKVLMRRALAYEAMGNF 193

 Score = 32.0 bits (71), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 18/42 (42%), Positives = 21/42 (50%)

Query: 149 QYSKAIGSYSDAIKLYPTNFNYYNNRALAYIKANNFDHAIID 190
           QY K I   + A+KL PT       RALAY    NF  A+ D
Sbjct: 158 QYEKVIEYATKALKLRPTFSKVLMRRALAYEAMGNFGDAMFD 199

>NCAS0B07010 Chr2 (1332351..1334228) [1878 bp, 625 aa] {ON}
           Anc_2.152
          Length = 625

 Score = 36.6 bits (83), Expect = 0.096,   Method: Compositional matrix adjust.
 Identities = 28/91 (30%), Positives = 46/91 (50%), Gaps = 5/91 (5%)

Query: 136 KLKEKGNEEMKAKQYSKAIGSYSDAIKLYPTNFNYYNNRALAYIKANNFDHAIIDANKSI 195
           +LK+KGN+  KAK Y+ AI  Y+ A+ L      +Y+N +  Y+     D  I  + K++
Sbjct: 124 QLKDKGNKYFKAKDYTNAIKYYNLALDLNKDPI-FYSNISACYVSLGQLDKVIESSTKAL 182

Query: 196 EIDSKIHPTNFKAYYRLGLAKYEIGDYEGSL 226
           E++    P   KA  R   A   + +Y  +L
Sbjct: 183 ELN----PNYSKALLRRASANESLENYSDAL 209

>TBLA0C05530 Chr3 complement(1338666..1340498) [1833 bp, 610 aa]
           {ON} Anc_2.152 YHR117W
          Length = 610

 Score = 36.6 bits (83), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 22/61 (36%), Positives = 36/61 (59%), Gaps = 1/61 (1%)

Query: 137 LKEKGNEEMKAKQYSKAIGSYSDAIKLYPTNFNYYNNRALAYIKANNFDHAIIDANKSIE 196
           LK+KGN   KA ++ +AI  Y+ AI+L   N  +Y+N +  Y+  N  +  I   NK++E
Sbjct: 114 LKDKGNSLFKADKFEEAIKYYNWAIEL-KENPIFYSNLSACYVSLNKLEEIIKYCNKALE 172

Query: 197 I 197
           +
Sbjct: 173 L 173

>NCAS0C04490 Chr3 complement(919665..922421) [2757 bp, 918 aa] {ON}
           Anc_3.32 YNL313C
          Length = 918

 Score = 36.2 bits (82), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 23/103 (22%), Positives = 50/103 (48%), Gaps = 4/103 (3%)

Query: 141 GNEEMKAKQYSKAIGSYSDAIKLYPTNFNYYNNRALAYIKANNFDHAIIDANKSIEIDSK 200
           G   ++  +   A  ++S  + L PT+   ++N + AY++ N    A     +SI  DS+
Sbjct: 651 GCVALECNKMEVAAEAFSRCVSLDPTHAMAWSNLSAAYVELNKLKEAFSCLKRSIACDSQ 710

Query: 201 IHPTNFKAYYRLGLAKYEIGDYEGSLAAFKRMIEIAQENNKGD 243
               N++ +    L   ++ +++  L A K+++ I + N  G+
Sbjct: 711 ---RNWRIWENYMLVSAKLNEWDDVLIACKQLVNI-RRNKSGE 749

 Score = 32.3 bits (72), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 19/93 (20%), Positives = 41/93 (44%), Gaps = 4/93 (4%)

Query: 148 KQYSKAIGSYSDAIKLYPTNFNYYNNRALAYIKANNFDHAIIDANKSIEIDSKIHPTNFK 207
           + Y+  +   +D+++ YP NF  +       ++ N  + A    ++ + +D    PT+  
Sbjct: 624 RNYNLTLKHLNDSLRRYPLNFETWYFYGCVALECNKMEVAAEAFSRCVSLD----PTHAM 679

Query: 208 AYYRLGLAKYEIGDYEGSLAAFKRMIEIAQENN 240
           A+  L  A  E+   + + +  KR I    + N
Sbjct: 680 AWSNLSAAYVELNKLKEAFSCLKRSIACDSQRN 712

>Ecym_2090 Chr2 complement(163340..163858) [519 bp, 172 aa] {ON}
           similar to Ashbya gossypii AAR054C
          Length = 172

 Score = 35.0 bits (79), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 23/62 (37%), Positives = 30/62 (48%)

Query: 134 AEKLKEKGNEEMKAKQYSKAIGSYSDAIKLYPTNFNYYNNRALAYIKANNFDHAIIDANK 193
           AE LK KGN   K   Y  AI  Y  A  L  +N  Y++N A A IK   +  A+   +K
Sbjct: 41  AEDLKVKGNTFFKNGDYETAILYYEKACALDSSNPIYFSNMATALIKLERWQEAVNACDK 100

Query: 194 SI 195
            +
Sbjct: 101 GL 102

>KLTH0E11748g Chr5 (1043203..1044339) [1137 bp, 378 aa] {ON} similar
           to uniprot|P33313 Saccharomyces cerevisiae YBR155W CNS1
           cyclophilin seven suppressor component of Hsp90p
           chaperone machinery
          Length = 378

 Score = 35.8 bits (81), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 26/103 (25%), Positives = 49/103 (47%), Gaps = 8/103 (7%)

Query: 117 DIEETKETKVSNDDMKKAEKLKEKGNEEMKAKQYSKAIGSYSDAIKL----YPTNFNYYN 172
           ++E  K      +  + AE  K +GN+  +AK+Y  A   Y+  I +       N + ++
Sbjct: 61  ELEALKALAYEGEPHEVAENFKNQGNDLYRAKRYKDAREIYNRGIDIKCDDSKVNESLFS 120

Query: 173 NRALAYIKANNFDHAIIDANKSIEIDSKIHPTNFKAYYRLGLA 215
           NRA   ++  N+   + D  ++++ + K    N K YYR+  A
Sbjct: 121 NRAACELELKNYRRCVNDCKRALQYNVK----NIKCYYRIAKA 159

>KNAG0H03530 Chr8 (657450..659294) [1845 bp, 614 aa] {ON} Anc_2.152
           YHR117W
          Length = 614

 Score = 35.8 bits (81), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 20/61 (32%), Positives = 36/61 (59%), Gaps = 1/61 (1%)

Query: 137 LKEKGNEEMKAKQYSKAIGSYSDAIKLYPTNFNYYNNRALAYIKANNFDHAIIDANKSIE 196
           LK+KGNE  K K   +AI  Y  A++ +  +  +Y N +  Y+  N+F+  + + NK++E
Sbjct: 109 LKDKGNELFKEKAVEEAIKYYQWALE-FKKDPVFYANISACYVSLNDFEKVLENCNKALE 167

Query: 197 I 197
           +
Sbjct: 168 L 168

>Skud_2.282 Chr2 (517201..518358) [1158 bp, 385 aa] {ON} YBR155W
           (REAL)
          Length = 385

 Score = 35.4 bits (80), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 29/116 (25%), Positives = 54/116 (46%), Gaps = 8/116 (6%)

Query: 117 DIEETKETKVSNDDMKKAEKLKEKGNEEMKAKQYSKAIGSYSDAIKLYP----TNFNYYN 172
           ++E  K      +  + A   K++GNE  KAK++  A   Y   + +       N + + 
Sbjct: 66  ELEALKALAYEGEPHEIAGGFKKQGNELYKAKRFKDARELYIKGLNVECEDKFINESLFA 125

Query: 173 NRALAYIKANNFDHAIIDANKSIEIDSKIHPTNFKAYYRLGLAKYEIGDYEGSLAA 228
           N+A   ++  N+   I D +K++ I+    P N K YYR   A +++   E + +A
Sbjct: 126 NKAACELELKNYRRCIEDCSKALSIN----PKNTKCYYRTSKAFFQLNKLEEAKSA 177

>Skud_13.379 Chr13 (661288..662640) [1353 bp, 450 aa] {ON} YMR210W
           (REAL)
          Length = 450

 Score = 35.4 bits (80), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 23/75 (30%), Positives = 42/75 (56%), Gaps = 4/75 (5%)

Query: 292 NDILNMAGNNLNIIMSNPLFKEVVEQLLASNPQAKQQFDNVMNDPRV--RQMKENV-NSD 348
           +++L M  N+L+++  NP FK ++EQ L    +  +QFDN++  P    +  +E   N+ 
Sbjct: 287 HNLLRMVRNHLSVLEENPNFKAIIEQNLKKI-RTVRQFDNLLTGPMFGYKNAEEYYKNAS 345

Query: 349 SMSNIPILKDLFYSL 363
           S   IP ++  F +L
Sbjct: 346 SYKRIPGIRTPFIAL 360

>Ecym_8064 Chr8 (137359..138474) [1116 bp, 371 aa] {ON} similar to
           Ashbya gossypii ADR087C
          Length = 371

 Score = 35.4 bits (80), Expect = 0.23,   Method: Compositional matrix adjust.
 Identities = 55/224 (24%), Positives = 89/224 (39%), Gaps = 46/224 (20%)

Query: 70  NGKRSALNLDKKNTTINVSVQTKDKINAYNDLSRNKDDINVPVKVIEDIEETK------- 122
            GKR    ++K+ TT +   + + +I    D     +D  VP     D+E+T        
Sbjct: 144 QGKRVVRLIEKQKTTGSDKPEQEVRIE---DCGVLPNDYQVPA----DVEQTPADEYGDN 196

Query: 123 -ETKVSNDD----------MKKAEKLKEKGNEEMKAKQYSKAIGSYSDAIKL----YPTN 167
            E  +++DD          MK  E +KE G  + K++ Y  A   Y          +P  
Sbjct: 197 YEENLADDDKIDINSFASVMKAVETVKEIGTAQFKSQNYPVATAKYEKCAGFLDDYFPEE 256

Query: 168 FNYYNNRALAYIKANNFDHAIIDANKSIE-------IDSKIHPTNF------KAYYRLGL 214
            +  + + +  +K +   +  I A KS E           +H TN       KA YR GL
Sbjct: 257 LSNEDTQTIGKLKTSIQLNISISALKSQEYAKVLPAATKVLHGTNADDKAKAKALYRRGL 316

Query: 215 AKYEIGDYEGSLAAFKRMIEIAQENNKGDEITKQMDADYEKAKE 258
           A Y + D E +L      +E+A     GD    +  +D +K K+
Sbjct: 317 AYYHLKDPEMALTD----LELAATYQAGDAAVMKAISDAKKLKQ 356

>KLLA0B03520g Chr2 (317409..321614) [4206 bp, 1401 aa] {ON} similar
           to uniprot|P17883 Saccharomyces cerevisiae YPR189W SKI3
           dsRNA virus protection family member contains 8 copies
           of the tetratricopeptide (TPR) domain
          Length = 1401

 Score = 35.8 bits (81), Expect = 0.23,   Method: Compositional matrix adjust.
 Identities = 19/93 (20%), Positives = 47/93 (50%), Gaps = 4/93 (4%)

Query: 141 GNEEMKAKQYSKAIGSYSDAIKLYPTNFNYYNNRALAYIKANNFDHAIIDANKSIEIDSK 200
           G   ++ + Y+++I  +  +I++  ++   +     AY+     + +I    K +E+D  
Sbjct: 676 GMSCLERQLYAESIEWFQSSIRVSSSDVESWVGLGQAYLNCGRVEASIKVFKKVLELDEN 735

Query: 201 IHPTNFKAYYRLGLAKYEIGDYEGSLAAFKRMI 233
            H     A+Y L +A   +G+++ S+  F+R++
Sbjct: 736 HH----FAWYFLAIALSALGEFDRSIEIFERLV 764

>NDAI0B04340 Chr2 (1087851..1089845) [1995 bp, 664 aa] {ON}
           Anc_2.152 YHR117W
          Length = 664

 Score = 35.4 bits (80), Expect = 0.26,   Method: Compositional matrix adjust.
 Identities = 26/83 (31%), Positives = 45/83 (54%), Gaps = 3/83 (3%)

Query: 117 DIEETKETKVSNDDMKK--AEKLKEKGNEEMKAKQYSKAIGSYSDAIKLYPTNFNYYNNR 174
           D  E  +   +N+++K   A++LK KGN+  K+K    AI  Y  A++L   +  +Y+N 
Sbjct: 139 DFNEINKLIANNENLKSKFAKELKNKGNQYFKSKDNENAIKYYEYALRL-DQDPVFYSNI 197

Query: 175 ALAYIKANNFDHAIIDANKSIEI 197
           +  Y   N  D  I  +NK++E+
Sbjct: 198 SACYFAMNQLDKVIESSNKALEL 220

>SAKL0E10956g Chr5 (916623..918425) [1803 bp, 600 aa] {ON} similar
           to uniprot|P07213 Saccharomyces cerevisiae YNL121C TOM70
           Translocase of Outer Mitochondrial membrane 70 kDa
           mitochondrial specialized import receptor of the outer
           membrane
          Length = 600

 Score = 35.0 bits (79), Expect = 0.34,   Method: Compositional matrix adjust.
 Identities = 26/95 (27%), Positives = 47/95 (49%), Gaps = 5/95 (5%)

Query: 132 KKAEKLKEKGNEEMKAKQYSKAIGSYSDAIKLYPTNFNYYNNRALAYIKANNFDHAIIDA 191
           K A  LK+KGNE  K K++  AI  Y+ A++L   +  +Y+NR+  Y+     +  + D 
Sbjct: 100 KYAMGLKDKGNEFFKEKKFDDAIKYYNLALEL-KKDPVFYSNRSACYVSMGQLEKVVEDT 158

Query: 192 NKSIEIDSKIHPTNFKAYYRLGLAKYEIGDYEGSL 226
             ++++ S       K   R   A   +G+Y  ++
Sbjct: 159 TAALKLKSDYS----KCLLRRASANESLGNYADAM 189

>Suva_2.34 Chr2 complement(63832..65304,65365..66183) [2292 bp, 763
           aa] {ON} YBL084C (REAL)
          Length = 763

 Score = 35.0 bits (79), Expect = 0.34,   Method: Compositional matrix adjust.
 Identities = 30/104 (28%), Positives = 48/104 (46%), Gaps = 6/104 (5%)

Query: 133 KAEKLKEKGNEEMKAKQYSKAIGSYSDAIKLYPTNFNY-YNNRALAYIKANNFDHAIIDA 191
           K E     GN     K +  AI ++  A +L P NF Y Y  +   +   ++ D A    
Sbjct: 544 KPETWCCIGNLLSLQKDHDAAIKAFEKATQLDP-NFAYAYTLQGHEHSSNDSSDSAKTCY 602

Query: 192 NKSIEIDSKIHPTNFKAYYRLGLAKYEIGDYEGSLAAFKRMIEI 235
            K++  D    P ++ AYY LG +  ++G YE +L  F++   I
Sbjct: 603 RKALACD----PQHYNAYYGLGTSSMKLGQYEEALLYFEKARSI 642

>Kpol_1050.112 s1050 (249717..252797,252855..252863,252906..253898)
           [4083 bp, 1360 aa] {ON}
           (249717..252797,252855..252863,252906..253898) [4083 nt,
           1361 aa]
          Length = 1360

 Score = 35.0 bits (79), Expect = 0.36,   Method: Compositional matrix adjust.
 Identities = 22/93 (23%), Positives = 44/93 (47%), Gaps = 4/93 (4%)

Query: 141 GNEEMKAKQYSKAIGSYSDAIKLYPTNFNYYNNRALAYIKANNFDHAIIDANKSIEIDSK 200
           G   ++ +Q S AI  +  A+++ P N   +     +Y+     + +I    K+ E+D  
Sbjct: 675 GIANLERQQESDAIEWFQSALRIEPNNVESWVGLGQSYLSCGRIEASIRVFEKATELD-- 732

Query: 201 IHPTNFKAYYRLGLAKYEIGDYEGSLAAFKRMI 233
             P +  A Y    +  E+G+Y  S++ F+ +I
Sbjct: 733 --PDHLYAKYFTAQSLSEMGEYVKSISIFEEII 763

>SAKL0F12936g Chr6 (1016829..1018727) [1899 bp, 632 aa] {ON} similar
           to uniprot|Q751K0 Ashbya gossypii AGL294W AGL294Wp and
           some similarites with YBL084C uniprot|P38042
           Saccharomyces cerevisiae YBL084C CDC27 Subunit of the
           Anaphase-Promoting Complex/Cyclosome (APC/C) which is a
           ubiquitin-protein ligase required for degradation of
           anaphase inhibitors including mitotic cyclins during the
           metaphase/anaphase transition
          Length = 632

 Score = 34.7 bits (78), Expect = 0.37,   Method: Compositional matrix adjust.
 Identities = 27/89 (30%), Positives = 44/89 (49%), Gaps = 6/89 (6%)

Query: 148 KQYSKAIGSYSDAIKLYPTNFNY-YNNRALAYIKANNFDHAIIDANKSIEIDSKIHPTNF 206
           K + +AI S+  A +L P  F Y Y  +   Y   + FD A     K++  +S+    ++
Sbjct: 428 KDHDEAIKSFQKATQLDP-RFTYAYTLQGHEYSSNDAFDTAKTCYRKALATNSQ----HY 482

Query: 207 KAYYRLGLAKYEIGDYEGSLAAFKRMIEI 235
            A Y LG+   ++G YE SL  F++   I
Sbjct: 483 NASYGLGMCCLKLGQYEESLLHFQKAHSI 511

>YMR210W Chr13 (687516..688865) [1350 bp, 449 aa] {ON} Putative
           acyltransferase with similarity to Eeb1p and Eht1p, has
           a minor role in medium-chain fatty acid ethyl ester
           biosynthesis; may be involved in lipid metabolism and
           detoxification
          Length = 449

 Score = 34.7 bits (78), Expect = 0.37,   Method: Compositional matrix adjust.
 Identities = 23/75 (30%), Positives = 42/75 (56%), Gaps = 4/75 (5%)

Query: 292 NDILNMAGNNLNIIMSNPLFKEVVEQLLASNPQAKQQFDNVMNDPRV--RQMKENV-NSD 348
           +++L M  N+L+ +  NP FK+V+E+ L    +  +QFDN++  P    +  +E   N+ 
Sbjct: 286 HNLLRMVRNHLSTLEENPDFKDVIEKHLKKI-RTVRQFDNLLTGPMFGYKNAEEYYKNAS 344

Query: 349 SMSNIPILKDLFYSL 363
           S   IP ++  F +L
Sbjct: 345 SYKRIPGIRTPFIAL 359

>YBL084C Chr2 complement(67169..69445) [2277 bp, 758 aa] {ON}
           CDC27Subunit of the Anaphase-Promoting Complex/Cyclosome
           (APC/C), which is a ubiquitin-protein ligase required
           for degradation of anaphase inhibitors, including
           mitotic cyclins, during the metaphase/anaphase
           transition
          Length = 758

 Score = 34.7 bits (78), Expect = 0.41,   Method: Compositional matrix adjust.
 Identities = 30/104 (28%), Positives = 48/104 (46%), Gaps = 6/104 (5%)

Query: 133 KAEKLKEKGNEEMKAKQYSKAIGSYSDAIKLYPTNFNY-YNNRALAYIKANNFDHAIIDA 191
           K E     GN     K +  AI ++  A +L P NF Y Y  +   +   ++ D A    
Sbjct: 539 KPETWCCIGNLLSLQKDHDAAIKAFEKATQLDP-NFAYAYTLQGHEHSSNDSSDSAKTCY 597

Query: 192 NKSIEIDSKIHPTNFKAYYRLGLAKYEIGDYEGSLAAFKRMIEI 235
            K++  D    P ++ AYY LG +  ++G YE +L  F++   I
Sbjct: 598 RKALACD----PQHYNAYYGLGTSAMKLGQYEEALLYFEKARSI 637

>TDEL0A07430 Chr1 (1296631..1297005) [375 bp, 124 aa] {ON} Anc_6.328
           YCR060W
          Length = 124

 Score = 32.7 bits (73), Expect = 0.46,   Method: Composition-based stats.
 Identities = 18/57 (31%), Positives = 29/57 (50%)

Query: 131 MKKAEKLKEKGNEEMKAKQYSKAIGSYSDAIKLYPTNFNYYNNRALAYIKANNFDHA 187
           M   E+LK +GN   + + Y+ A+  Y   ++   TN   ++NRA+  IK N    A
Sbjct: 1   MDSFERLKAQGNSCYQQQDYAGALRWYDQCLEADATNPIAHSNRAMCLIKLNRSQEA 57

>Smik_13.418 Chr13 (671591..672937) [1347 bp, 448 aa] {ON} YMR210W
           (REAL)
          Length = 448

 Score = 34.3 bits (77), Expect = 0.48,   Method: Compositional matrix adjust.
 Identities = 23/75 (30%), Positives = 41/75 (54%), Gaps = 4/75 (5%)

Query: 292 NDILNMAGNNLNIIMSNPLFKEVVEQLLASNPQAKQQFDNVMNDPRV--RQMKENV-NSD 348
           +++L M  N+L+++  NP FK  +EQ L    +  +QFDN++  P    +  +E   N+ 
Sbjct: 285 HNLLRMVRNHLSVLEENPNFKTTIEQNLKKI-RTVKQFDNLLTGPMFGYKNAEEYYKNAS 343

Query: 349 SMSNIPILKDLFYSL 363
           S   IP ++  F +L
Sbjct: 344 SYKRIPGIRTPFIAL 358

>KAFR0C01850 Chr3 (369596..371536) [1941 bp, 646 aa] {ON} Anc_5.352
           YDR320C
          Length = 646

 Score = 34.3 bits (77), Expect = 0.48,   Method: Compositional matrix adjust.
 Identities = 16/57 (28%), Positives = 31/57 (54%)

Query: 166 TNFNYYNNRALAYIKANNFDHAIIDANKSIEIDSKIHPTNFKAYYRLGLAKYEIGDY 222
           + +N YN+R  ++ K  ++  A+ +  KS+    + HP    AY  +  A+ +IG+Y
Sbjct: 355 SGYNEYNSRGSSFFKNGDYISALEEYEKSLNTLPQSHPLRIIAYSNITAAELKIGEY 411

>Smik_2.36 Chr2 complement(61159..63414) [2256 bp, 751 aa] {ON}
           YBL084C (REAL)
          Length = 751

 Score = 34.7 bits (78), Expect = 0.49,   Method: Compositional matrix adjust.
 Identities = 30/104 (28%), Positives = 48/104 (46%), Gaps = 6/104 (5%)

Query: 133 KAEKLKEKGNEEMKAKQYSKAIGSYSDAIKLYPTNFNY-YNNRALAYIKANNFDHAIIDA 191
           K E     GN     K +  AI ++  A +L P NF Y Y  +   +   ++ D A    
Sbjct: 532 KPETWCCVGNLLSLQKDHDAAIKAFEKATQLDP-NFAYAYTLQGHEHSSNDSSDSAKTCY 590

Query: 192 NKSIEIDSKIHPTNFKAYYRLGLAKYEIGDYEGSLAAFKRMIEI 235
            K++  D    P ++ AYY LG +  ++G YE +L  F++   I
Sbjct: 591 RKALACD----PQHYNAYYGLGTSSMKLGQYEEALLYFEKARSI 630

 Score = 30.4 bits (67), Expect = 9.9,   Method: Compositional matrix adjust.
 Identities = 26/135 (19%), Positives = 51/135 (37%), Gaps = 28/135 (20%)

Query: 141 GNEEMKAKQYSKAIGSYSDAIKLYPTNFNY------------YNNRALAYIKANNFDHAI 188
           G   MK  QY +A+  +  A  + P N               Y  +AL Y          
Sbjct: 608 GTSSMKLGQYEEALLYFEKARSINPVNVVLICCCGGSLEKLGYKEKALQYY--------- 658

Query: 189 IDANKSIEIDSKIHPTNFKAYYRLGLAKYEIGDYEGSLAAFKRMIEIAQENNKGDEITKQ 248
                  E+   + PT+  + Y++G   Y +  Y  +L  F+ ++++  ++     +  Q
Sbjct: 659 -------ELACHLQPTSSLSKYKMGQLLYSMTRYSVALQTFEELVKLVPDDATAHYLLGQ 711

Query: 249 MDADYEKAKEKVQEL 263
                 + K+ ++EL
Sbjct: 712 TYRIVGRKKDAIKEL 726

>Kwal_33.14767 s33 complement(809994..811778) [1785 bp, 594 aa] {ON}
           YHR117W (TOM71) - 71-kDa component of the protein
           translocase of the outer membrane of mitochondria
           [contig 101] FULL
          Length = 594

 Score = 34.3 bits (77), Expect = 0.50,   Method: Compositional matrix adjust.
 Identities = 27/91 (29%), Positives = 44/91 (48%), Gaps = 5/91 (5%)

Query: 132 KKAEKLKEKGNEEMKAKQYSKAIGSYSDAIKLYPTNFNYYNNRALAYIKANNFDHAIIDA 191
           K A  LK+KGNE  K KQ+  A+  YS AI++   +  +Y+NR+  Y+     +  + D 
Sbjct: 94  KFAMGLKDKGNEFFKNKQFEDALKYYSLAIEV-KEDPVFYSNRSACYVSLGQQEKVVEDT 152

Query: 192 NKSIEIDSKIHPTNFKAYYRLGLAKYEIGDY 222
             ++    K+ P   K   R   A   +G +
Sbjct: 153 TAAL----KLKPDYSKCLLRRASANESLGKF 179

>Kwal_27.10740 s27 complement(476617..478503) [1887 bp, 628 aa] {ON}
           YBL084C (CDC27) - component of the anaphase-promoting
           complex [contig 33] FULL
          Length = 628

 Score = 34.3 bits (77), Expect = 0.53,   Method: Compositional matrix adjust.
 Identities = 24/89 (26%), Positives = 46/89 (51%), Gaps = 6/89 (6%)

Query: 148 KQYSKAIGSYSDAIKLYPTNFNY-YNNRALAYIKANNFDHAIIDANKSIEIDSKIHPTNF 206
           K + ++I ++  + +L P+ F Y Y  +   Y   + FD A+    K++  +S+    ++
Sbjct: 424 KDHEESIKAFQRSTQLDPS-FTYAYTLQGHEYSSNDAFDTAMTCYRKALASNSQ----HY 478

Query: 207 KAYYRLGLAKYEIGDYEGSLAAFKRMIEI 235
            AYY LG+   ++G YE  L  F++   I
Sbjct: 479 NAYYGLGMCSLKLGQYEECLLHFEKARSI 507

>CAGL0E01573g Chr5 complement(149084..151798) [2715 bp, 904 aa] {ON}
           similar to uniprot|P42842 Saccharomyces cerevisiae
           YNL313c
          Length = 904

 Score = 34.3 bits (77), Expect = 0.54,   Method: Compositional matrix adjust.
 Identities = 21/83 (25%), Positives = 42/83 (50%), Gaps = 3/83 (3%)

Query: 153 AIGSYSDAIKLYPTNFNYYNNRALAYIKANNFDHAIIDANKSIEIDSKIHPTNFKAYYRL 212
           A  +++    L PT+   ++N + AY++      A     ++I  DS+    N++ +   
Sbjct: 652 AAEAFTRCTALDPTHAMSWSNLSAAYVQQGKLKEAHSCLKQAISSDSQ---KNWRIWENF 708

Query: 213 GLAKYEIGDYEGSLAAFKRMIEI 235
            L   ++ ++E  LAA K++IEI
Sbjct: 709 LLVSVKLDEWEDVLAACKQLIEI 731

>NDAI0C05290 Chr3 (1224979..1226118) [1140 bp, 379 aa] {ON}
           Anc_8.506 YBR155W
          Length = 379

 Score = 33.9 bits (76), Expect = 0.55,   Method: Compositional matrix adjust.
 Identities = 26/112 (23%), Positives = 50/112 (44%), Gaps = 9/112 (8%)

Query: 117 DIEETKETKVSNDDMKKAEKLKEKGNEEMKAKQYSKAIGSYSDAIKL-----YPTNFNYY 171
           ++E  K      +  + AE  K +GN+  KAK++  A   Y   I++          + +
Sbjct: 59  ELEALKALAYEGEPHEIAENFKNQGNDLYKAKRFKDARDVYLKGIQIENNKDVKIKESLF 118

Query: 172 NNRALAYIKANNFDHAIIDANKSIEIDSKIHPTNFKAYYRLGLAKYEIGDYE 223
            N+A   ++  NF   I D   +++++    P N K Y+R+  A + +   E
Sbjct: 119 ANKAACELELKNFRRCINDCKNALQLN----PKNVKCYFRMTRAFFALDKLE 166

>Smik_2.207 Chr2 (368052..370991) [2940 bp, 979 aa] {ON} YBR074W
           (REAL)
          Length = 979

 Score = 34.3 bits (77), Expect = 0.61,   Method: Compositional matrix adjust.
 Identities = 21/68 (30%), Positives = 35/68 (51%), Gaps = 3/68 (4%)

Query: 5   DQEIASIIVDYFNKCITSGKLNQDNV---DSLNVAIDCIADVFDVDKDLISNILKTAYRS 61
           DQ+   I V +F K +T G L+ DN+   D L+V+I C    +D +  +    ++     
Sbjct: 891 DQDAYHIAVQWFPKILTDGDLDDDNLSLKDELSVSISCYWGDYDSESVVNGTAVRKIPAF 950

Query: 62  NDLLTYLP 69
           ++LL Y P
Sbjct: 951 DELLNYAP 958

>ABR206W Chr2 (787387..789231) [1845 bp, 614 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YHR166C (CDC23)
          Length = 614

 Score = 33.9 bits (76), Expect = 0.64,   Method: Compositional matrix adjust.
 Identities = 25/74 (33%), Positives = 40/74 (54%), Gaps = 5/74 (6%)

Query: 148 KQYSKAIGSYSDAIKLYPTNFNYYNNRALAYIKANNFDHAIIDANKSIEIDSKIHPTNFK 207
           +Q+ KAI  +  A+ L  T  N +      +++  N  HA I+  +   +D  I+P +FK
Sbjct: 398 QQHEKAIMYFRRALTLNKTCTNAWTLMGHEFVEMKN-SHAAIECYRR-AVD--INPCDFK 453

Query: 208 AYYRLGLAKYEIGD 221
           A+Y LG A YE+ D
Sbjct: 454 AWYGLGQA-YEVLD 466

>KAFR0L01870 Chr12 (345757..347895) [2139 bp, 712 aa] {ON} Anc_7.412
           YBL084C
          Length = 712

 Score = 33.9 bits (76), Expect = 0.67,   Method: Compositional matrix adjust.
 Identities = 28/95 (29%), Positives = 46/95 (48%), Gaps = 6/95 (6%)

Query: 141 GNEEMKAKQYSKAIGSYSDAIKLYPTNFNYYNNRALAYIKANNFDHAIIDANKSIEIDSK 200
           GN     K + +AI +++ A +L P     Y  +   Y    +FD A     K++  DS+
Sbjct: 501 GNHFSLQKDHDEAIKAFNKATELDPRFAYAYTLQGHEYASNESFDTARTFYRKALACDSQ 560

Query: 201 IHPTNFKAYYRLGLAKYEIGDYEGSLAAFK--RMI 233
               ++ AYY LG    + G+++ SL  F+  RMI
Sbjct: 561 ----HYNAYYGLGTCDSQNGNHDRSLLFFEKARMI 591

>Kpol_1028.51 s1028 complement(123535..123888) [354 bp, 117 aa] {ON}
           complement(123535..123888) [354 nt, 118 aa]
          Length = 117

 Score = 32.3 bits (72), Expect = 0.69,   Method: Compositional matrix adjust.
 Identities = 26/89 (29%), Positives = 41/89 (46%), Gaps = 7/89 (7%)

Query: 135 EKLKEKGNEEMKAKQYSKAIGSYSDAIKLYPTNFNYYNNRALAYIKANNFDHAIIDANKS 194
           E+ K  GN   K   Y KA+  Y   I++ P N   Y+N A++ IK   +  A+      
Sbjct: 4   EEYKTTGNTYFKDGNYLKAVEYYKKCIEVEPENPIGYSNSAMSLIKLTKYTEALESCGTG 63

Query: 195 I----EIDSKIHPTNFKAYYRLGLAKYEI 219
           +    + DS+++    K  YR  LA  E+
Sbjct: 64  LKYVNDADSQVYK---KLQYRYNLADTEL 89

>ZYRO0G06512g Chr7 complement(515759..517573) [1815 bp, 604 aa] {ON}
           similar to uniprot|P07213 Saccharomyces cerevisiae
           YNL121C TOM70 Translocase of Outer Mitochondrial
           membrane 70 kDa mitochondrial specialized import
           receptor of the outer membrane
          Length = 604

 Score = 33.9 bits (76), Expect = 0.72,   Method: Compositional matrix adjust.
 Identities = 26/84 (30%), Positives = 42/84 (50%), Gaps = 9/84 (10%)

Query: 114 VIEDIEETKETKVSNDDMKKAEKLKEKGNEEMKAKQYSKAIGSYSDAIKLYPTNFNYYNN 173
           V E  EE KE+  +         LK+KGNE  K K Y  A+  Y  A+ L   +  +Y+N
Sbjct: 94  VAEMSEEQKESWST--------ALKDKGNEFFKQKDYDNALKYYDYALTL-KKDPVFYSN 144

Query: 174 RALAYIKANNFDHAIIDANKSIEI 197
            +  Y+  N  D  + ++ K++E+
Sbjct: 145 ISACYVSMNQLDKVVENSTKALEL 168

>CAGL0L04048g Chr12 (476407..478170) [1764 bp, 587 aa] {ON} similar
           to uniprot|P07213 Saccharomyces cerevisiae YNL121c TOM70
           or uniprot|P38825 Saccharomyces cerevisiae YHR117w TOM7
          Length = 587

 Score = 33.9 bits (76), Expect = 0.78,   Method: Compositional matrix adjust.
 Identities = 22/64 (34%), Positives = 35/64 (54%), Gaps = 1/64 (1%)

Query: 134 AEKLKEKGNEEMKAKQYSKAIGSYSDAIKLYPTNFNYYNNRALAYIKANNFDHAIIDANK 193
           A +LK++GN   K K Y  AI  Y  A++L   +  +Y+N A  YI   +   AI   +K
Sbjct: 86  ASELKKRGNAYFKVKDYENAINYYKFALQL-KNDPVFYSNMAACYISLEHNKEAIEACSK 144

Query: 194 SIEI 197
           ++E+
Sbjct: 145 ALEL 148

>Skud_2.24 Chr2 complement(50790..53099) [2310 bp, 769 aa] {ON}
           YBL084C (REAL)
          Length = 769

 Score = 33.9 bits (76), Expect = 0.84,   Method: Compositional matrix adjust.
 Identities = 29/100 (29%), Positives = 48/100 (48%), Gaps = 6/100 (6%)

Query: 133 KAEKLKEKGNEEMKAKQYSKAIGSYSDAIKLYPTNFNY-YNNRALAYIKANNFDHAIIDA 191
           K E     GN     K +  AI ++  A +L P NF Y Y  +   +   ++ D A    
Sbjct: 550 KPETWCCIGNLLSLQKDHDAAIKAFEKATQLDP-NFAYAYTLQGHEHSSNDSSDSAKTCY 608

Query: 192 NKSIEIDSKIHPTNFKAYYRLGLAKYEIGDYEGSLAAFKR 231
            K++  DS+    ++ AYY LG +  ++G YE +L  F++
Sbjct: 609 RKALACDSQ----HYNAYYGLGTSSMKLGQYEEALLYFEK 644

>AGL268C Chr7 complement(205872..207011) [1140 bp, 379 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YBR155W
           (CNS1)
          Length = 379

 Score = 33.5 bits (75), Expect = 0.86,   Method: Compositional matrix adjust.
 Identities = 30/127 (23%), Positives = 58/127 (45%), Gaps = 8/127 (6%)

Query: 117 DIEETKETKVSNDDMKKAEKLKEKGNEEMKAKQYSKAIGSYSDAIKLYPTNFNYYN---- 172
           ++E  K      +  + AE  K +GN+  K K++  A   Y+  I++   +         
Sbjct: 60  ELEALKALAYDGEPHEVAENFKNQGNDLYKVKRFRDARVMYNKGIEVKCDDAGISELLLL 119

Query: 173 NRALAYIKANNFDHAIIDANKSIEIDSKIHPTNFKAYYRLGLAKYEIGDYEGSLAAFKRM 232
           NRA   ++  N+   I D  +++    K++P N KA++R+G A  ++   E +  A    
Sbjct: 120 NRAACELELKNYRRCINDCREAL----KLNPKNPKAFFRIGKAFLQLDKLEEAAEAVDFG 175

Query: 233 IEIAQEN 239
           + +  EN
Sbjct: 176 LRVDTEN 182

>Kpol_513.2 s513 (1962..3086) [1125 bp, 374 aa] {ON} (1962..3086)
           [1125 nt, 375 aa]
          Length = 374

 Score = 33.5 bits (75), Expect = 0.87,   Method: Compositional matrix adjust.
 Identities = 28/110 (25%), Positives = 49/110 (44%), Gaps = 8/110 (7%)

Query: 134 AEKLKEKGNEEMKAKQYSKAIGSYSDAIKLYP----TNFNYYNNRALAYIKANNFDHAII 189
           A   K +GN+  K K++  A   Y+ AI +       N + Y NRA   ++  N+   I 
Sbjct: 74  AGNFKNQGNDLYKVKRFRDARELYNKAIDVKCDDDKINESLYANRAACELELKNYRRCIN 133

Query: 190 DANKSIEIDSKIHPTNFKAYYRLGLAKYEIGDYEGSLAAFKRMIEIAQEN 239
           D   ++     ++P N K Y+R+  A   I  ++    A +  ++   EN
Sbjct: 134 DCKMAL----SLNPKNIKCYFRMAKAFLAIEKFDDCKEAIQFGLKFDLEN 179

>Ecym_5092 Chr5 complement(208478..210358) [1881 bp, 626 aa] {ON}
           similar to Ashbya gossypii ABR206W
          Length = 626

 Score = 33.1 bits (74), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 24/74 (32%), Positives = 40/74 (54%), Gaps = 5/74 (6%)

Query: 148 KQYSKAIGSYSDAIKLYPTNFNYYNNRALAYIKANNFDHAIIDANKSIEIDSKIHPTNFK 207
           +Q+ KAI  +  A+ L  +  N +      +++  N  HA I+  +   +D  I+P +FK
Sbjct: 410 QQHEKAIMYFRRALTLNKSCTNAWTLMGHEFVETKN-SHAAIECYRR-AVD--INPCDFK 465

Query: 208 AYYRLGLAKYEIGD 221
           A+Y LG A YE+ D
Sbjct: 466 AWYGLGQA-YEVLD 478

>AAR054C Chr1 complement(440706..441107) [402 bp, 133 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YCR060W
          Length = 133

 Score = 31.6 bits (70), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 16/66 (24%), Positives = 36/66 (54%)

Query: 132 KKAEKLKEKGNEEMKAKQYSKAIGSYSDAIKLYPTNFNYYNNRALAYIKANNFDHAIIDA 191
           + ++ L+ KGN+     +Y  A+  Y +A    P+N  +  N ++A +K   ++ A+   
Sbjct: 6   RNSDHLRSKGNDLYSKGEYETAVLYYKNASLAEPSNPVHLANMSMALLKLERWEDALSAC 65

Query: 192 NKSIEI 197
           ++++EI
Sbjct: 66  DRALEI 71

>TPHA0B03970 Chr2 (938053..939243) [1191 bp, 396 aa] {ON} Anc_1.456
           YJR032W
          Length = 396

 Score = 32.7 bits (73), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 27/102 (26%), Positives = 49/102 (48%), Gaps = 12/102 (11%)

Query: 171 YNNRALAYIKANNFDHAIIDANKSIEIDSKIHPTNFKAYYRLGLAKYEIGDYEGSLAAFK 230
           Y N +L Y     +D  +  AN  +++D+       KAYYR G +      YE +LA++K
Sbjct: 295 YLNMSLNYYNLKMYDECMTYANYLLDLDNIPDIDQAKAYYRRGNSYLMKKRYEDALASYK 354

Query: 231 RMIEIAQENNKGDEITKQ--------MDADYEKAKEKVQELF 264
               + +E N  D++  Q        ++A+ EK ++ + + F
Sbjct: 355 ----LCKEKNPEDKVIDQKIESVKSLIEANIEKTRKNLSKFF 392

>NCAS0G02480 Chr7 complement(440105..441895) [1791 bp, 596 aa] {ON}
           Anc_2.152
          Length = 596

 Score = 33.1 bits (74), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 31/91 (34%), Positives = 45/91 (49%), Gaps = 6/91 (6%)

Query: 128 NDDMKK--AEKLKEKGNEEMKAKQYSKAIGSYSDAIKLYPTNFNYYNNRALAYIKANNFD 185
           ND  K+  A  LKEKGN   K K +  AI  Y+ A+ L   +  YY+N +  Y    N++
Sbjct: 87  NDKTKEEWAGALKEKGNALFKKKDFENAIKYYTFALSL-KEDPVYYSNISACYSSLLNYE 145

Query: 186 HAIIDANKSIEID---SKIHPTNFKAYYRLG 213
             I  A K++ +    SK+      AY +LG
Sbjct: 146 KVIEMATKALALRPDYSKVLVRRANAYEKLG 176

>CAGL0I00616g Chr9 (46130..46705) [576 bp, 191 aa] {ON} similar to
           uniprot|P39742 Saccharomyces cerevisiae YLR292c SEC72
          Length = 191

 Score = 32.3 bits (72), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 37/144 (25%), Positives = 65/144 (45%), Gaps = 21/144 (14%)

Query: 127 SNDDMKKAEKLKEKGNEEMKAKQYSKAIGSYSDAIKLYPTNFNYYNNRA-----LAYIKA 181
           SN+  K  + L E G +  K K++ +A+ S + AI++       +   A     L Y+  
Sbjct: 48  SNESTKMIQNLFENGAQHAKMKKFPEALKSVTLAIEMAQRKRTPWEAFAVQLNELHYLMR 107

Query: 182 NNFDHAI-----IDANKSIEI---DSKIHPTNFKAYYRLGLAKYEIGDYEGSLAAFKRMI 233
           N  D ++     ++A + +E     + IHP  F    R   A   +G  E +    +R +
Sbjct: 108 NKVDLSLTQQRYLEALQDLEFLLNTALIHPETF---IRKCDALVNLGQLEEARITCERGL 164

Query: 234 EIAQENNKGD----EITKQMDADY 253
            +A E+ K      EIT+++ ADY
Sbjct: 165 SLAPEDTKLKAMMFEITRRL-ADY 187

>CAGL0C01903g Chr3 complement(199487..201796) [2310 bp, 769 aa] {ON}
           similar to uniprot|P38042 Saccharomyces cerevisiae
           YBL084c CDC27 subunit of anaphase-promoting complex
          Length = 769

 Score = 32.7 bits (73), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 27/103 (26%), Positives = 46/103 (44%), Gaps = 4/103 (3%)

Query: 133 KAEKLKEKGNEEMKAKQYSKAIGSYSDAIKLYPTNFNYYNNRALAYIKANNFDHAIIDAN 192
           K E     GN     K +  AI ++  A K+ P     Y  +       ++FD A     
Sbjct: 550 KPETWCCVGNYLSLKKDHEDAIEAFEKATKIDPKFAYAYTLQGHECSSNDSFDAAKKCFR 609

Query: 193 KSIEIDSKIHPTNFKAYYRLGLAKYEIGDYEGSLAAFKRMIEI 235
           K+I  D    P ++ AYY +G+   ++G Y+ +L  F++  +I
Sbjct: 610 KAIACD----PRHYNAYYGMGIYSMKLGHYDEALLYFEKARQI 648

>AGL294W Chr7 (154711..156681) [1971 bp, 656 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YBL084C (CDC27)
          Length = 656

 Score = 32.7 bits (73), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 22/88 (25%), Positives = 44/88 (50%), Gaps = 4/88 (4%)

Query: 148 KQYSKAIGSYSDAIKLYPTNFNYYNNRALAYIKANNFDHAIIDANKSIEIDSKIHPTNFK 207
           + + +AI +   A  L P     Y  +   Y   + FD+A +   K++ I+    P ++ 
Sbjct: 452 RDHDEAIKALKKATSLNPQFAYAYTLQGHEYSNNDAFDNAKMCYRKALAIN----PNHYN 507

Query: 208 AYYRLGLAKYEIGDYEGSLAAFKRMIEI 235
           A+Y LG++  ++G Y+ +L  F++   I
Sbjct: 508 AHYGLGMSCIKLGQYDEALLHFEKARSI 535

>SAKL0D07436g Chr4 complement(609760..611973) [2214 bp, 737 aa] {ON}
           some similarities with uniprot|P47050 Saccharomyces
           cerevisiae YJL047C RTT101 Cullin family member subunit
           of a complex containing ubiquitin ligase activity binds
           HRT1 and is modified by the ubiquitin like protein RUB1
           Regulator of Ty1 Transposition Regulator of Ty1
           Transposition
          Length = 737

 Score = 32.7 bits (73), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 28/119 (23%), Positives = 45/119 (37%), Gaps = 21/119 (17%)

Query: 171 YNNRALAYIKANN-------FDHAIIDANKSIEIDSKIHPTNFKAYYRLGLAKYEIGDYE 223
           + N + A I A         F  A+++    + +DS      F + Y   L  YE+    
Sbjct: 324 FCNVSFACISAGKKDSLLKWFKKAVLNKLHEVVVDSTFEIDLFGSIYVTALKNYELATST 383

Query: 224 GSLAAFKRMIEIAQENNKG------DEITKQMDADYEKAKEKVQELFFMQITKSTGKEG 276
           G       +     + N G      DE  K +D D++K         + Q+ K+ GKEG
Sbjct: 384 GHSDCIDEVFHEFIQQNYGSQTKFTDEFIKSLDRDFKKC--------YQQMEKTNGKEG 434

>KAFR0K00210 Chr11 (52344..55610) [3267 bp, 1088 aa] {ON} Anc_6.233
           YGL133W
          Length = 1088

 Score = 32.7 bits (73), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 31/144 (21%), Positives = 63/144 (43%), Gaps = 20/144 (13%)

Query: 115 IEDIEETKETKVSNDDMKKAEKLKEKGNEEMKAKQYSKAIGSY---SDAIKLYPTNFNYY 171
           ++   ET+   +   D  KA  ++  G  E K ++Y   +GS      + +  P  F+ Y
Sbjct: 661 LKHFRETQNYDIKVADTYKAHLIEIVGKLE-KLERYRDFLGSKLSNQSSARALPVGFDKY 719

Query: 172 NNRALAYIKANNFDHAIIDANKSIEIDSKIH--------PTNFKAYYRLGLAKYEIGDY- 222
            N    Y   +  +  +  +   ++++   H        P    A  RLG++K ++  + 
Sbjct: 720 GNSC--YFFTSEINRVLSLSTLPVKMERPYHHGGLWLRGPREDDALLRLGISKSQLSSWK 777

Query: 223 -----EGSLAAFKRMIEIAQENNK 241
                EG +AA K++ ++ Q+NN+
Sbjct: 778 EIALKEGKIAATKQVFKVFQKNNR 801

>KLTH0C06204g Chr3 complement(538533..540416) [1884 bp, 627 aa] {ON}
           some similarities with uniprot|P38042 Saccharomyces
           cerevisiae YBL084C CDC27 Subunit of the
           Anaphase-Promoting Complex/Cyclosome (APC/C) which is a
           ubiquitin-protein ligase required for degradation of
           anaphase inhibitors including mitotic cyclins during the
           metaphase/anaphase transition
          Length = 627

 Score = 32.3 bits (72), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 23/89 (25%), Positives = 45/89 (50%), Gaps = 6/89 (6%)

Query: 148 KQYSKAIGSYSDAIKLYPTNFNY-YNNRALAYIKANNFDHAIIDANKSIEIDSKIHPTNF 206
           K + ++I ++  + +L P+ F Y Y  +   Y   + FD A+    K++  +    P ++
Sbjct: 423 KDHEESIKAFQRSTQLDPS-FTYAYTLQGHEYSSNDAFDTAMTCYRKALGSN----PQHY 477

Query: 207 KAYYRLGLAKYEIGDYEGSLAAFKRMIEI 235
            A+Y LG+   ++G YE  L  F++   I
Sbjct: 478 NAHYGLGMCCLKLGQYEECLLHFEKARSI 506

>NDAI0J00130 Chr10 complement(10432..14643) [4212 bp, 1403 aa] {ON}
           Anc_7.546 YPR189W
          Length = 1403

 Score = 32.3 bits (72), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 22/96 (22%), Positives = 46/96 (47%), Gaps = 6/96 (6%)

Query: 141 GNEEMKAKQYSKAIGSYSDAIKLYPTNFNYYNNRALAYIKANNFDHAIIDANKSIEID-S 199
           G   ++ +Q S +I  +  AI++ P +   +     AY+     + ++    K++E+D S
Sbjct: 676 GIAYLQNQQESSSIEWFQSAIRVDPNDIESWVGLGQAYLACGRIEASMKVFEKAMELDGS 735

Query: 200 KIHPTNFKAYYRLGLAKYEIGDYEGSLAAFKRMIEI 235
            +H   FKA     LA  ++G++  S+     + E+
Sbjct: 736 HLHAQYFKA-----LALADMGEFSASIDLLTSVTEL 766

>NDAI0A07370 Chr1 complement(1675941..1678319) [2379 bp, 792 aa]
           {ON} Anc_3.35 YNL311C
          Length = 792

 Score = 31.6 bits (70), Expect = 4.1,   Method: Compositional matrix adjust.
 Identities = 21/67 (31%), Positives = 34/67 (50%), Gaps = 4/67 (5%)

Query: 223 EGSLAAFKRMIEIAQENNKGD----EITKQMDADYEKAKEKVQELFFMQITKSTGKEGSG 278
           +GS   FK++I+  Q  N  D    EI+KQ  ++YE+    +Q +  ++I  S  K+   
Sbjct: 297 DGSRDFFKKIIKGQQSINSNDLRTFEISKQFVSEYERKFYSLQRIKTLEIRASKDKKTGN 356

Query: 279 NSVNDGP 285
           N V   P
Sbjct: 357 NVVRLRP 363

>Ecym_7142 Chr7 complement(287110..289137) [2028 bp, 675 aa] {ON}
           similar to Ashbya gossypii AGL294W
          Length = 675

 Score = 31.6 bits (70), Expect = 4.3,   Method: Compositional matrix adjust.
 Identities = 21/84 (25%), Positives = 43/84 (51%), Gaps = 4/84 (4%)

Query: 148 KQYSKAIGSYSDAIKLYPTNFNYYNNRALAYIKANNFDHAIIDANKSIEIDSKIHPTNFK 207
           + + +AI +   A  L P     Y  +   Y   + FD+A +   K++ I+    P ++ 
Sbjct: 471 RDHDEAIKALKKATNLDPRFAYAYTLQGHEYSNNDAFDNAKMCYRKALAIN----PNHYN 526

Query: 208 AYYRLGLAKYEIGDYEGSLAAFKR 231
           A+Y LG++  ++G Y+ +L  F++
Sbjct: 527 AHYGLGMSCIKLGQYDEALLHFEK 550

>NDAI0A02860 Chr1 complement(641401..642516) [1116 bp, 371 aa] {ON}
           Anc_7.313
          Length = 371

 Score = 31.2 bits (69), Expect = 4.4,   Method: Compositional matrix adjust.
 Identities = 26/108 (24%), Positives = 44/108 (40%), Gaps = 17/108 (15%)

Query: 131 MKKAEKLKEKGNEEMKAKQYSKAIGSYSDAIKL----YPTNFNYYN-------------N 173
           +K  E +K  G E+ K + Y  A+  Y    K     +P + N                N
Sbjct: 216 IKAVETVKNVGTEQFKKQNYKVAMDKYKKCDKYLKEYFPEDLNEEQIAKINTLKVQVPLN 275

Query: 174 RALAYIKANNFDHAIIDANKSIEIDSKIHPTNFKAYYRLGLAKYEIGD 221
            AL+ +KA ++   +  +++ +  +        KA YR GLA Y + D
Sbjct: 276 IALSALKAQDYPTVLTASSEVLYAEGATDTAKAKALYRRGLAYYHVND 323

>Kpol_1018.106 s1018 (280224..282485) [2262 bp, 753 aa] {ON}
           (280224..282485) [2262 nt, 754 aa]
          Length = 753

 Score = 31.6 bits (70), Expect = 4.4,   Method: Compositional matrix adjust.
 Identities = 27/138 (19%), Positives = 58/138 (42%), Gaps = 6/138 (4%)

Query: 140 KGNEEMKAKQYSKAIGSYSDAIKLYPTNFNYYNNRALAYIKANNFDHAIIDANKSIEIDS 199
           +G+E      +  A   Y  A+   P ++N Y    ++ +K   +D A++   K+  I+ 
Sbjct: 575 QGHEHSSNDSFDTAKNCYRKALACDPQHYNAYYGLGMSCMKLGQYDEALLHFEKARSIN- 633

Query: 200 KIHPTNFKAYYRLGLAKYEIGDYEGSLAAFKRMIEIAQENNKGDEITKQMDADYEKAKEK 259
              P N       G+A  ++   E +L+ ++   E+   ++  +   K+    Y   +  
Sbjct: 634 ---PINVILICCCGVALEKLQYQEKALSYYELACELQPSSSLAN--FKRAHLLYSMGRYS 688

Query: 260 VQELFFMQITKSTGKEGS 277
           V   +F ++TK    E +
Sbjct: 689 VALQYFEELTKLAPDEAT 706

>KLLA0F05093g Chr6 complement(502635..503753) [1119 bp, 372 aa] {ON}
           similar to uniprot|P53691 Saccharomyces cerevisiae
           YLR216C CPR6 Peptidyl-prolyl cis-trans isomerase
           (cyclophilin) catalyzes the cis-trans isomerization of
           peptide bonds N-terminal to proline residues binds to
           Hsp82p and contributes to chaperone activity
          Length = 372

 Score = 31.2 bits (69), Expect = 5.0,   Method: Compositional matrix adjust.
 Identities = 28/118 (23%), Positives = 53/118 (44%), Gaps = 21/118 (17%)

Query: 121 TKETKVSNDD----MKKAEKLKEKGNEEMKAKQYSKAIGSYSDAIKL----YPTNF---- 168
           T ++KV  +D    +   E +KE G ++ K K +  A+  Y  + ++    +P +     
Sbjct: 203 TDDSKVDPNDVNSVLNAVEAVKEIGTKQFKEKNFEVALVKYEKSSQMLKQYFPQDLPEED 262

Query: 169 ---------NYYNNRALAYIKANNFDHAIIDANKSIEIDSKIHPTNFKAYYRLGLAKY 217
                    + + N AL  +K+ N+   +  A +++  D+    +  KA YR GLA Y
Sbjct: 263 VKKIDALRVSLFLNIALVSLKSKNYSRTLSAATEALHADNTDDKSKAKALYRRGLAYY 320

>TPHA0E01110 Chr5 (228116..230197) [2082 bp, 693 aa] {ON} Anc_5.352
           YDR320C
          Length = 693

 Score = 31.2 bits (69), Expect = 5.2,   Method: Compositional matrix adjust.
 Identities = 28/120 (23%), Positives = 49/120 (40%), Gaps = 13/120 (10%)

Query: 109 NVPVKVIEDIEETKETKVSNDDMKKAEKLKEKGNEEMKAKQYSKAIGSYSDAIKLYPTN- 167
           N+P ++ E        +  ND+  +   L + GNE++ +        S  + I +   N 
Sbjct: 339 NIPPRITE-------RQKPNDERIQDNTLLDFGNEDLSSPANVSISSSGQECIPVISINQ 391

Query: 168 -----FNYYNNRALAYIKANNFDHAIIDANKSIEIDSKIHPTNFKAYYRLGLAKYEIGDY 222
                +N + +R   Y K  ++  A     KS+   SK+HP    A   L  +  + GDY
Sbjct: 392 IELSGYNEFKDRGTEYFKKGDYVSATEQYEKSLNSLSKLHPLRIIASSNLLASLLKTGDY 451

>Skud_14.211 Chr14 complement(388749..390602) [1854 bp, 617 aa] {ON}
           YNL121C (REAL)
          Length = 617

 Score = 31.2 bits (69), Expect = 5.3,   Method: Compositional matrix adjust.
 Identities = 25/95 (26%), Positives = 46/95 (48%), Gaps = 5/95 (5%)

Query: 132 KKAEKLKEKGNEEMKAKQYSKAIGSYSDAIKLYPTNFNYYNNRALAYIKANNFDHAIIDA 191
           K A  LK+KGN+  + K+Y  AI  Y+ A++L      +Y+N +  Y+   +    +  +
Sbjct: 97  KYALALKDKGNQYFRNKKYDDAIKYYNWALELKEDPV-FYSNLSACYVSVGDLKKVVEMS 155

Query: 192 NKSIEIDSKIHPTNFKAYYRLGLAKYEIGDYEGSL 226
            K++E    I P   K   R   A   +G++  ++
Sbjct: 156 TKALE----IKPDYSKVLLRRASANEGLGNFADAM 186

>YBR074W Chr2 (386286..389216) [2931 bp, 976 aa] {ON} Putative
           metalloprotease
          Length = 976

 Score = 31.2 bits (69), Expect = 5.4,   Method: Compositional matrix adjust.
 Identities = 19/68 (27%), Positives = 33/68 (48%), Gaps = 3/68 (4%)

Query: 5   DQEIASIIVDYFNKCITSGKLNQDNV---DSLNVAIDCIADVFDVDKDLISNILKTAYRS 61
           DQE   I V +F K +T G +  D +   D L+V+I C    +D +  +    ++     
Sbjct: 888 DQETYHIGVQWFPKLLTDGNVEDDKLGTKDELSVSISCYWGEYDSESVVNGTAVRKIPAF 947

Query: 62  NDLLTYLP 69
           ++L+ Y P
Sbjct: 948 DELINYAP 955

>ZYRO0B03828g Chr2 (318153..320336) [2184 bp, 727 aa] {ON} similar
           to uniprot|P38042 Saccharomyces cerevisiae YBL084C CDC27
           Subunit of the Anaphase-Promoting Complex/Cyclosome
           (APC/C) which is a ubiquitin-protein ligase required for
           degradation of anaphase inhibitors including mitotic
           cyclins during the metaphase/anaphase transition
          Length = 727

 Score = 31.2 bits (69), Expect = 5.6,   Method: Compositional matrix adjust.
 Identities = 26/100 (26%), Positives = 47/100 (47%), Gaps = 6/100 (6%)

Query: 133 KAEKLKEKGNEEMKAKQYSKAIGSYSDAIKLYPTNFNY-YNNRALAYIKANNFDHAIIDA 191
           K +     GN     + + +AI  +  A ++ P +F Y Y  +   +   ++ D A    
Sbjct: 508 KPQTWCSLGNLYSLQRDHDEAIRYFEKATEVDP-HFAYGYTLQGHEHSSNDSIDMAKTCY 566

Query: 192 NKSIEIDSKIHPTNFKAYYRLGLAKYEIGDYEGSLAAFKR 231
            K+I  D    P ++ AYY LG+   ++G YE +L  F++
Sbjct: 567 RKAIASD----PQHYNAYYGLGMCCMKLGQYEEALLYFEK 602

>ZYRO0C02970g Chr3 (230414..233104) [2691 bp, 896 aa] {ON} similar
           to uniprot|P42842 Saccharomyces cerevisiae YNL313C
           Protein required for cell viability
          Length = 896

 Score = 31.2 bits (69), Expect = 5.8,   Method: Compositional matrix adjust.
 Identities = 19/97 (19%), Positives = 46/97 (47%), Gaps = 10/97 (10%)

Query: 139 EKGNEEMKAKQYSKAIGSYSDAIKLYPTNFNYYNNRALAYIKANNFDHAIIDANKSIEID 198
           E G  E+ A+ +S+ +        L PT+   ++N + AY++ +    A     +++  D
Sbjct: 643 ESGKMELAAEAFSRCV-------SLDPTHGAAWSNLSAAYVELDKLKEAFSCLKQAVSTD 695

Query: 199 SKIHPTNFKAYYRLGLAKYEIGDYEGSLAAFKRMIEI 235
           ++    N++ +    L   ++ +++  L A K ++ I
Sbjct: 696 AR---KNWRIWENYMLVAMKLNEWQDVLMACKNLVTI 729

>TDEL0C02720 Chr3 (477529..479631) [2103 bp, 700 aa] {ON} Anc_7.412
           YBL084C
          Length = 700

 Score = 30.8 bits (68), Expect = 6.0,   Method: Compositional matrix adjust.
 Identities = 48/212 (22%), Positives = 84/212 (39%), Gaps = 37/212 (17%)

Query: 56  KTAYRSNDLLTYLPNGKRSALNLDKKNTTINVSVQTKDKINAYNDLSRNKDDINVPVKVI 115
           + ++ SN+L+  LPN  ++   L                 N Y+ L R+ +D    +K  
Sbjct: 466 RLSHLSNELVETLPNKPQTWCCLG----------------NLYS-LQRDHEDA---IKYF 505

Query: 116 EDIEETKETKVSNDDMKKAEKLKEKGNEEMKAKQYSKAIGSYSDAIKLYPTNFNYYNNRA 175
           E     K TK+   D   A     +G+E         A   Y  A+   P ++N Y    
Sbjct: 506 E-----KATKI---DYNFAYAYTLQGHEHSSNDSIDTAKNCYRRALACDPQHYNAYYGLG 557

Query: 176 LAYIKANNFDHAIIDANKSIEIDSKIHPTNFKAYYRLGLAKYEIGDYEGSLAAFKRMIEI 235
           + Y+K   +D A++   K+  I+    P N       G+A  ++   E +L  +++  E+
Sbjct: 558 MCYMKLGQYDKALLFFEKARNIN----PVNVILICCCGVALEKLSYQEKALQYYEQACEL 613

Query: 236 AQENN----KGDEITKQMDADYEKAKEKVQEL 263
              ++    K   +   M A Y  A E  +EL
Sbjct: 614 QPSSSLAKFKKAHLLYSM-ARYSAALENFEEL 644

>Kpol_1048.21 s1048 complement(67975..69768) [1794 bp, 597 aa] {ON}
           complement(67975..69768) [1794 nt, 598 aa]
          Length = 597

 Score = 30.8 bits (68), Expect = 6.5,   Method: Compositional matrix adjust.
 Identities = 17/61 (27%), Positives = 35/61 (57%), Gaps = 1/61 (1%)

Query: 137 LKEKGNEEMKAKQYSKAIGSYSDAIKLYPTNFNYYNNRALAYIKANNFDHAIIDANKSIE 196
           LK+KGN+  K ++Y  A+  Y+ A+ L   +  +Y+N +  Y+   N +  +  + K++E
Sbjct: 102 LKDKGNQFFKEQKYEDALKYYNYALDL-KQDPVFYSNISACYVSLGNLEKVVESSTKALE 160

Query: 197 I 197
           +
Sbjct: 161 L 161

>KNAG0A01290 Chr1 complement(27911..30667) [2757 bp, 918 aa] {ON}
           Anc_3.32 YNL313C
          Length = 918

 Score = 30.8 bits (68), Expect = 6.8,   Method: Compositional matrix adjust.
 Identities = 18/99 (18%), Positives = 48/99 (48%), Gaps = 3/99 (3%)

Query: 141 GNEEMKAKQYSKAIGSYSDAIKLYPTNFNYYNNRALAYIKANNFDHAIIDANKSIEIDSK 200
           G   ++ ++   A  ++S  + L  T+   ++N + AY++      A     K++  DS+
Sbjct: 654 GCVALECERMKVAAEAFSRCVSLDDTHAMAWSNLSAAYVQLGKLKEAFSCLKKAVTSDSQ 713

Query: 201 IHPTNFKAYYRLGLAKYEIGDYEGSLAAFKRMIEIAQEN 239
               N++ +    L  + + +++ +L A K +I + +++
Sbjct: 714 ---RNWRIWENYLLVSFRLREWDDTLVACKHLITLKRDS 749

>Kwal_55.21839 s55 (998426..1000498) [2073 bp, 690 aa] {ON} YOR080W
           (DIA2) - may be involved in regulation of invasive
           growth and budding pattern [contig 126] FULL
          Length = 690

 Score = 30.8 bits (68), Expect = 7.3,   Method: Compositional matrix adjust.
 Identities = 19/61 (31%), Positives = 30/61 (49%), Gaps = 6/61 (9%)

Query: 163 LYPTNFNYYNNRALAYIKANNFDHAIIDANKSIEIDSKIHPTNFKAYYRLG--LAKYEIG 220
           ++P      +NRA  + K  +   A+ DAN+++    K  P N K Y R G  L K ++ 
Sbjct: 66  VHPRFVKLLDNRAATWEKLGDLTKALKDANRAV----KYEPYNLKCYLRKGKILQKLQLD 121

Query: 221 D 221
           D
Sbjct: 122 D 122

>TDEL0E02750 Chr5 (529920..531614) [1695 bp, 564 aa] {ON} Anc_5.352
           YDR320C
          Length = 564

 Score = 30.8 bits (68), Expect = 7.4,   Method: Compositional matrix adjust.
 Identities = 16/70 (22%), Positives = 34/70 (48%)

Query: 166 TNFNYYNNRALAYIKANNFDHAIIDANKSIEIDSKIHPTNFKAYYRLGLAKYEIGDYEGS 225
           + +  Y +R   + KA ++  A  +  KS+    + H     AY  L  A +++G+Y+  
Sbjct: 271 SGYKEYKDRGTEFFKAGDYVSASQEYEKSLNSLPQNHALRIVAYSNLTAALFKVGEYKRC 330

Query: 226 LAAFKRMIEI 235
           L+  +  +E+
Sbjct: 331 LSDIESALEM 340

>TDEL0B05140 Chr2 complement(904626..906425) [1800 bp, 599 aa] {ON}
           Anc_2.152 YHR117W
          Length = 599

 Score = 30.4 bits (67), Expect = 8.0,   Method: Compositional matrix adjust.
 Identities = 25/87 (28%), Positives = 47/87 (54%), Gaps = 11/87 (12%)

Query: 114 VIEDIEE-TKETKVSNDDMKKAEKLKEKGNEEMKAKQYSKAIGSYSDA--IKLYPTNFNY 170
           ++E+IEE ++E + +      A  LK++GNE  K K Y  A+  Y+ A  +K  P    +
Sbjct: 85  LLENIEELSQELRETY-----ATALKDRGNEFFKKKDYDNALKYYNYALVVKKDPV---F 136

Query: 171 YNNRALAYIKANNFDHAIIDANKSIEI 197
           Y+N +  Y+     D  + ++ K++E+
Sbjct: 137 YSNISACYVSLGQLDKVVENSTKALEL 163

>CAGL0K05511g Chr11 complement(539944..542127) [2184 bp, 727 aa]
           {ON} weakly similar to uniprot|Q08491 Saccharomyces
           cerevisiae YOR076c GTPase with function in 3 -to-5
           degradation of mRNA
          Length = 727

 Score = 30.4 bits (67), Expect = 8.4,   Method: Compositional matrix adjust.
 Identities = 20/67 (29%), Positives = 32/67 (47%)

Query: 168 FNYYNNRALAYIKANNFDHAIIDANKSIEIDSKIHPTNFKAYYRLGLAKYEIGDYEGSLA 227
           F + NN    +IK N+ D  I +   S ++ S I    +     + +   E+GDYE +  
Sbjct: 352 FGHSNNIKPLHIKYNDTDIIINEVPGSFDLCSTIETKRYVGNSVIIVVSAELGDYEANFD 411

Query: 228 AFKRMIE 234
             KR+IE
Sbjct: 412 MKKRLIE 418

>TPHA0A05290 Chr1 complement(1198497..1200497) [2001 bp, 666 aa]
           {ON} Anc_5.72 YHR166C
          Length = 666

 Score = 30.4 bits (67), Expect = 9.4,   Method: Compositional matrix adjust.
 Identities = 21/116 (18%), Positives = 54/116 (46%), Gaps = 4/116 (3%)

Query: 141 GNEEMKAKQYSKAIGSYSDAIKLYPTNFNYYNNRALAYIKANNFDHAIIDANKSIEIDSK 200
           G+E ++ K    AI  Y  A+ + P +F  +     AY   +   +++    K+      
Sbjct: 478 GHEFVELKNSQAAIECYRHAVDINPRDFKAWYGLGQAYEVLDMHLYSLYYFQKA----CT 533

Query: 201 IHPTNFKAYYRLGLAKYEIGDYEGSLAAFKRMIEIAQENNKGDEITKQMDADYEKA 256
           + P + + +  L     +IG++  ++ +F+R ++++   ++   +  ++   YEK+
Sbjct: 534 LKPLDKRMWQALASCYVKIGNFNDAIKSFERALQLSINTDQDSSLLYKLAEVYEKS 589

>Suva_14.219 Chr14 complement(395316..397169) [1854 bp, 617 aa] {ON}
           YNL121C (REAL)
          Length = 617

 Score = 30.4 bits (67), Expect = 9.5,   Method: Compositional matrix adjust.
 Identities = 24/95 (25%), Positives = 46/95 (48%), Gaps = 5/95 (5%)

Query: 132 KKAEKLKEKGNEEMKAKQYSKAIGSYSDAIKLYPTNFNYYNNRALAYIKANNFDHAIIDA 191
           K A  LK+KGN+  + K+Y  AI  Y+ A++L      +Y+N +  Y+   +    +  +
Sbjct: 97  KYALALKDKGNQYFRNKKYDDAIKYYNWALELKEDPV-FYSNLSACYVSVGDLKKVVEMS 155

Query: 192 NKSIEIDSKIHPTNFKAYYRLGLAKYEIGDYEGSL 226
            K++E    + P   K   R   A   +G++  ++
Sbjct: 156 TKALE----LKPDYSKVLLRRASANEGLGNFADAM 186

>KAFR0B00770 Chr2 (149822..150709) [888 bp, 295 aa] {ON} Anc_7.458
           YJR088C
          Length = 295

 Score = 30.0 bits (66), Expect = 9.8,   Method: Compositional matrix adjust.
 Identities = 31/128 (24%), Positives = 56/128 (43%), Gaps = 9/128 (7%)

Query: 134 AEKLKEKGNEEMKAKQYSKAIGSYSDAIKLYPTNFNYYNNRA-LAYIKANNFDHAIIDAN 192
           AE     G    K  Q S++I  + + + + P N+  ++  A L Y KA   D       
Sbjct: 162 AELWCYMGEIYWKMGQLSRSIYCFEEVLVIMPFNYVIFSRIAELYYYKARRLDKGKQKME 221

Query: 193 KSIEIDSK-------IHPTNFKAYYRLGLAKYEIGDYEGSL-AAFKRMIEIAQENNKGDE 244
           +S+    K       +  +  K +  +      +GD +  L  A KR++EI++ +N+ D+
Sbjct: 222 ESLNKGLKNALRSGELSESYLKGWSLVATISKLLGDKKDVLNVATKRLVEISKISNEKDK 281

Query: 245 ITKQMDAD 252
           IT +   D
Sbjct: 282 ITAEYILD 289

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.311    0.129    0.349 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 44,879,770
Number of extensions: 2239352
Number of successful extensions: 12255
Number of sequences better than 10.0: 532
Number of HSP's gapped: 12414
Number of HSP's successfully gapped: 633
Length of query: 377
Length of database: 53,481,399
Length adjustment: 111
Effective length of query: 266
Effective length of database: 40,753,473
Effective search space: 10840423818
Effective search space used: 10840423818
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.8 bits)
S2: 66 (30.0 bits)