Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
TPHA0M002406.16ON93993945930.0
TDEL0G045306.16ON95885722050.0
SAKL0E01078g6.16ON94884019180.0
KLTH0C11330g6.16ON94184918820.0
Kwal_56.224036.16ON94386318770.0
Ecym_30206.16ON94485618330.0
ACR010C6.16ON94583318070.0
Kpol_1032.66.16ON100461916420.0
KNAG0M011306.16ON95083816080.0
ZYRO0C07898g6.16ON97462614620.0
NCAS0H008806.16ON100470914600.0
Smik_5.266.16ON100261913491e-170
YEL061C (CIN8)6.16ON100061713451e-170
KAFR0L003706.16ON96361713271e-167
NDAI0D008706.16ON106970513301e-167
Skud_5.286.16ON99861713141e-165
Suva_5.66.16ON99961712931e-162
CAGL0B03641g6.16ON98858412711e-159
Kpol_1045.736.16ON96289512211e-152
TBLA0A072306.16ON109763312301e-151
KLLA0D01045g6.16ON96559011891e-147
SAKL0F12298g7.387ON11124539601e-112
ACR228C7.387ON11294469391e-109
KAFR0L017107.387ON11514439381e-109
Suva_2.547.387ON11104559261e-108
TDEL0C016007.387ON11054479141e-106
Ecym_46887.387ON11344449121e-105
Skud_2.417.387ON11104559071e-105
ZYRO0B03234g7.387ON11384589071e-105
NDAI0E043007.387ON11864429001e-103
NCAS0E026407.387ON11024428921e-103
Smik_2.537.387ON11134558901e-103
YBL063W (KIP1)7.387ON11114558871e-102
TPHA0E008907.387ON12325228458e-96
TPHA0J003006.16ON9826256905e-76
TBLA0D006407.387ON11424976956e-76
SAKL0G05016g5.531ON5044444842e-51
KLTH0G03850g5.531ON4733664742e-50
SAKL0G18920g2.633ON6493504728e-49
Ecym_34152.633ON6623594729e-49
ADR145C2.633ON6354754621e-47
Ecym_40665.531ON4784374503e-47
Kwal_47.186085.531ON4793554362e-45
ZYRO0D12650g5.531ON4783634292e-44
Kpol_1004.255.531ON5063574302e-44
KAFR0F042103.528ON6723454373e-44
KLLA0B00759g5.531ON4563454237e-44
ZYRO0E08668g3.528ON7783434351e-43
TBLA0C049603.528ON8014234306e-43
NCAS0E005503.528ON7843444297e-43
Kwal_47.190933.528ON8193434272e-42
KLTH0G01606g3.528ON8193434244e-42
SAKL0F01760g3.528ON8093424201e-41
Smik_7.483.528ON8053424192e-41
NDAI0I029603.528ON8683594183e-41
Suva_7.443.528ON8053424163e-41
CAGL0I07029g3.528ON7053444135e-41
Skud_7.533.528ON8053424138e-41
YGL216W (KIP3)3.528ON8053424112e-40
Kpol_423.83.528ON8063454084e-40
TDEL0D059603.528ON7333434055e-40
KNAG0B005203.528ON7233514056e-40
KLLA0A01606g3.528ON7693444031e-39
AER441C3.528ON8183424022e-39
TBLA0C053103.479ON6763703983e-39
TBLA0C039403.479ON7393523984e-39
TPHA0D034803.528ON8473433995e-39
AGR253W3.479ON7093633922e-38
KNAG0A078803.479ON7643393932e-38
Ecym_12003.528ON8333423942e-38
Kpol_1013.78.678ON6203443874e-38
CAGL0D04994g3.479ON6923383814e-37
NCAS0F034703.479ON6983603752e-36
KLLA0D05951g8.678ON6683413708e-36
KAFR0H024108.678ON6583653691e-35
Kpol_505.393.479ON6923383691e-35
SAKL0H06490g8.678ON6573423672e-35
TDEL0A062408.678ON6374403644e-35
Ecym_44073.479ON7113413646e-35
KLTH0D11286g8.678ON6783503628e-35
CAGL0M02189g8.678ON6723623592e-34
TPHA0D012708.678ON6963533592e-34
ZYRO0F07414g8.678ON6543603548e-34
NDAI0B057703.479ON7633463551e-33
Kwal_26.88068.678ON7154223531e-33
KLTH0F14498g3.479ON7023453522e-33
Kpol_1050.1033.479ON6973993493e-33
YPL155C (KIP2)8.678ON7063693396e-32
Ecym_23958.678ON6873523361e-31
TDEL0B072702.633ON6443823272e-30
NDAI0E02090singletonON6853613282e-30
Skud_16.1278.678ON7063693235e-30
ACR145W8.678ON6853743192e-29
Smik_6.3528.678ON7153713173e-29
KNAG0J017208.678ON6254513137e-29
TPHA0D041903.479ON6723373058e-28
Suva_16.1558.678ON7043653004e-27
Kpol_1019.112.633ON6474002834e-25
KAFR0B065903.479ON7061492763e-24
TPHA0D032003.479ON7241502746e-24
SAKL0F03168g3.479ON7061492721e-23
YKL079W (SMY1)2.633ON6563512664e-23
YPR141C (KAR3)3.479ON7291482658e-23
TDEL0F036403.479ON7041502649e-23
KLLA0B10956g3.479ON6901472641e-22
Skud_16.4353.479ON7291482622e-22
Smik_16.3883.479ON7291482612e-22
NCAS0C013508.678ON6552042593e-22
Suva_16.4693.479ON7311492585e-22
ZYRO0B04290g3.479ON7311532577e-22
Suva_11.1452.633ON6573732532e-21
Skud_11.1482.633ON6564302451e-20
Smik_11.1602.633ON6564052452e-20
TPHA0N016502.633ON6823742424e-20
TBLA0C018808.678ON4681482262e-18
NCAS0H031802.633ON6603702013e-15
ZYRO0E01078g2.633ON6684891971e-14
TBLA0C008002.633ON6933901906e-14
Kwal_55.21164singletonOFF5881091791e-12
Kwal_YGOB_55.211643.479ON6571091791e-12
NDAI0C004802.633ON5983721432e-08
KNAG0M025402.633ON5221071432e-08
CAGL0L05104g2.633ON6753571423e-08
TBLA0A008202.633ON8031681415e-08
KAFR0C040202.633ON6672971229e-06
KNAG0H003602.633ON6811391165e-05
NCAS0C052002.633ON5721051102e-04
NDAI0G044602.651ON113857860.18
NDAI0E050905.713ON889144810.68
NCAS0C028308.401ON87472762.6
YOR334W (MRS2)7.62ON470121743.3
ZYRO0C02926g3.34ON47473743.9
Kpol_1002.476.221ON57991726.1
KNAG0E00960singletonON22779716.3
ZYRO0B08536g4.364ON690100726.4
KLLA0A02937g2.517ON14372687.1
TDEL0H040007.51ON1665133727.2
KNAG0B018601.280ON84071727.7
TBLA0E039408.120ON57358719.5
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= TPHA0M00240
         (939 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

TPHA0M00240 Chr13 (47407..50226) [2820 bp, 939 aa] {ON} Anc_6.16...  1773   0.0  
TDEL0G04530 Chr7 complement(824970..827846) [2877 bp, 958 aa] {O...   853   0.0  
SAKL0E01078g Chr5 (80541..83387) [2847 bp, 948 aa] {ON} similar ...   743   0.0  
KLTH0C11330g Chr3 complement(931865..934690) [2826 bp, 941 aa] {...   729   0.0  
Kwal_56.22403 s56 (112080..114911) [2832 bp, 943 aa] {ON} YEL061...   727   0.0  
Ecym_3020 Chr3 (37549..40383) [2835 bp, 944 aa] {ON} similar to ...   710   0.0  
ACR010C Chr3 complement(374085..376922) [2838 bp, 945 aa] {ON} S...   700   0.0  
Kpol_1032.6 s1032 (9109..12123) [3015 bp, 1004 aa] {ON} (9109..1...   637   0.0  
KNAG0M01130 Chr13 (201705..204557) [2853 bp, 950 aa] {ON} Anc_6....   624   0.0  
ZYRO0C07898g Chr3 complement(600676..603600) [2925 bp, 974 aa] {...   567   0.0  
NCAS0H00880 Chr8 complement(160883..163897) [3015 bp, 1004 aa] {...   566   0.0  
Smik_5.26 Chr5 complement(38891..41899) [3009 bp, 1002 aa] {ON} ...   524   e-170
YEL061C Chr5 complement(36535..39537) [3003 bp, 1000 aa] {ON}  C...   522   e-170
KAFR0L00370 Chr12 (66535..69426) [2892 bp, 963 aa] {ON} Anc_6.16...   515   e-167
NDAI0D00870 Chr4 complement(195749..198958) [3210 bp, 1069 aa] {...   516   e-167
Skud_5.28 Chr5 complement(35653..38649) [2997 bp, 998 aa] {ON} Y...   510   e-165
Suva_5.6 Chr5 complement(12298..15297) [3000 bp, 999 aa] {ON} YE...   502   e-162
CAGL0B03641g Chr2 (363897..366863) [2967 bp, 988 aa] {ON} simila...   494   e-159
Kpol_1045.73 s1045 complement(169347..172235) [2889 bp, 962 aa] ...   474   e-152
TBLA0A07230 Chr1 (1803117..1806410) [3294 bp, 1097 aa] {ON} Anc_...   478   e-151
KLLA0D01045g Chr4 (91110..94007) [2898 bp, 965 aa] {ON} similar ...   462   e-147
SAKL0F12298g Chr6 complement(958588..961926) [3339 bp, 1112 aa] ...   374   e-112
ACR228C Chr3 complement(758111..761500) [3390 bp, 1129 aa] {ON} ...   366   e-109
KAFR0L01710 Chr12 complement(308820..312275) [3456 bp, 1151 aa] ...   365   e-109
Suva_2.54 Chr2 (99000..102332) [3333 bp, 1110 aa] {ON} YBL063W (...   361   e-108
TDEL0C01600 Chr3 (276912..280229) [3318 bp, 1105 aa] {ON} Anc_7....   356   e-106
Ecym_4688 Chr4 (1342239..1345643) [3405 bp, 1134 aa] {ON} simila...   355   e-105
Skud_2.41 Chr2 (85542..88874) [3333 bp, 1110 aa] {ON} YBL063W (R...   353   e-105
ZYRO0B03234g Chr2 complement(263393..266809) [3417 bp, 1138 aa] ...   353   e-105
NDAI0E04300 Chr5 complement(965403..968963) [3561 bp, 1186 aa] {...   351   e-103
NCAS0E02640 Chr5 (527838..531146) [3309 bp, 1102 aa] {ON} Anc_7....   348   e-103
Smik_2.53 Chr2 (95765..99106) [3342 bp, 1113 aa] {ON} YBL063W (R...   347   e-103
YBL063W Chr2 (101886..105221) [3336 bp, 1111 aa] {ON}  KIP1Kines...   346   e-102
TPHA0E00890 Chr5 (181328..185026) [3699 bp, 1232 aa] {ON} Anc_7....   330   8e-96
TPHA0J00300 Chr10 (65794..68742) [2949 bp, 982 aa] {ON} Anc_6.16...   270   5e-76
TBLA0D00640 Chr4 (168893..172321) [3429 bp, 1142 aa] {ON} Anc_7....   272   6e-76
SAKL0G05016g Chr7 (415990..417504) [1515 bp, 504 aa] {ON} weakly...   191   2e-51
KLTH0G03850g Chr7 (308053..309474) [1422 bp, 473 aa] {ON} some s...   187   2e-50
SAKL0G18920g Chr7 complement(1634668..1636617) [1950 bp, 649 aa]...   186   8e-49
Ecym_3415 Chr3 (782976..784964) [1989 bp, 662 aa] {ON} similar t...   186   9e-49
ADR145C Chr4 complement(959805..961712) [1908 bp, 635 aa] {ON} S...   182   1e-47
Ecym_4066 Chr4 (146761..148197) [1437 bp, 478 aa] {ON} similar t...   177   3e-47
Kwal_47.18608 s47 complement(896394..897833) [1440 bp, 479 aa] {...   172   2e-45
ZYRO0D12650g Chr4 (1071620..1073056) [1437 bp, 478 aa] {ON} some...   169   2e-44
Kpol_1004.25 s1004 (54983..56503) [1521 bp, 506 aa] {ON} (54983....   170   2e-44
KAFR0F04210 Chr6 complement(826173..828191) [2019 bp, 672 aa] {O...   172   3e-44
KLLA0B00759g Chr2 (59965..61335) [1371 bp, 456 aa] {ON} some sim...   167   7e-44
ZYRO0E08668g Chr5 complement(694586..696922) [2337 bp, 778 aa] {...   172   1e-43
TBLA0C04960 Chr3 complement(1210067..1212472) [2406 bp, 801 aa] ...   170   6e-43
NCAS0E00550 Chr5 complement(93778..96132) [2355 bp, 784 aa] {ON}...   169   7e-43
Kwal_47.19093 s47 complement(1092732..1095191) [2460 bp, 819 aa]...   169   2e-42
KLTH0G01606g Chr7 (116364..118823) [2460 bp, 819 aa] {ON} simila...   167   4e-42
SAKL0F01760g Chr6 (146659..149088) [2430 bp, 809 aa] {ON} simila...   166   1e-41
Smik_7.48 Chr7 (79575..81992) [2418 bp, 805 aa] {ON} YGL216W (REAL)   166   2e-41
NDAI0I02960 Chr9 complement(699469..702075) [2607 bp, 868 aa] {O...   165   3e-41
Suva_7.44 Chr7 (79883..82300) [2418 bp, 805 aa] {ON} YGL216W (REAL)   164   3e-41
CAGL0I07029g Chr9 (675486..677603) [2118 bp, 705 aa] {ON} simila...   163   5e-41
Skud_7.53 Chr7 (90098..92515) [2418 bp, 805 aa] {ON} YGL216W (REAL)   163   8e-41
YGL216W Chr7 (84885..87302) [2418 bp, 805 aa] {ON}  KIP3Kinesin-...   162   2e-40
Kpol_423.8 s423 (11134..13554) [2421 bp, 806 aa] {ON} (11134..13...   161   4e-40
TDEL0D05960 Chr4 complement(1079683..1081884) [2202 bp, 733 aa] ...   160   5e-40
KNAG0B00520 Chr2 (85045..87216) [2172 bp, 723 aa] {ON} Anc_3.528...   160   6e-40
KLLA0A01606g Chr1 (139355..141664) [2310 bp, 769 aa] {ON} simila...   159   1e-39
AER441C Chr5 complement(1480055..1482511) [2457 bp, 818 aa] {ON}...   159   2e-39
TBLA0C05310 Chr3 (1286959..1288989) [2031 bp, 676 aa] {ON} Anc_3...   157   3e-39
TBLA0C03940 Chr3 complement(946819..949038) [2220 bp, 739 aa] {O...   157   4e-39
TPHA0D03480 Chr4 complement(731687..734230) [2544 bp, 847 aa] {O...   158   5e-39
AGR253W Chr7 (1218744..1220873) [2130 bp, 709 aa] {ON} Syntenic ...   155   2e-38
KNAG0A07880 Chr1 complement(1254698..1256992) [2295 bp, 764 aa] ...   155   2e-38
Ecym_1200 Chr1 (402658..405159) [2502 bp, 833 aa] {ON} similar t...   156   2e-38
Kpol_1013.7 s1013 (11880..13742) [1863 bp, 620 aa] {ON} (11880.....   153   4e-38
CAGL0D04994g Chr4 complement(482176..484254) [2079 bp, 692 aa] {...   151   4e-37
NCAS0F03470 Chr6 complement(695163..697259) [2097 bp, 698 aa] {O...   149   2e-36
KLLA0D05951g Chr4 (509713..511719) [2007 bp, 668 aa] {ON} simila...   147   8e-36
KAFR0H02410 Chr8 complement(460353..462329) [1977 bp, 658 aa] {O...   146   1e-35
Kpol_505.39 s505 complement(87351..89429) [2079 bp, 692 aa] {ON}...   146   1e-35
SAKL0H06490g Chr8 complement(571300..573273) [1974 bp, 657 aa] {...   145   2e-35
TDEL0A06240 Chr1 (1092814..1094727) [1914 bp, 637 aa] {ON} Anc_8...   144   4e-35
Ecym_4407 Chr4 (846516..848651) [2136 bp, 711 aa] {ON} similar t...   144   6e-35
KLTH0D11286g Chr4 (922942..924978) [2037 bp, 678 aa] {ON} simila...   144   8e-35
CAGL0M02189g Chr13 complement(261290..263308) [2019 bp, 672 aa] ...   142   2e-34
TPHA0D01270 Chr4 (264339..266429) [2091 bp, 696 aa] {ON} Anc_8.6...   142   2e-34
ZYRO0F07414g Chr6 (600148..602112) [1965 bp, 654 aa] {ON} simila...   140   8e-34
NDAI0B05770 Chr2 complement(1400232..1402523) [2292 bp, 763 aa] ...   141   1e-33
Kwal_26.8806 s26 (950736..952883) [2148 bp, 715 aa] {ON} YPL155C...   140   1e-33
KLTH0F14498g Chr6 complement(1188459..1190567) [2109 bp, 702 aa]...   140   2e-33
Kpol_1050.103 s1050 complement(235625..237718) [2094 bp, 697 aa]...   139   3e-33
YPL155C Chr16 complement(257216..259336) [2121 bp, 706 aa] {ON} ...   135   6e-32
Ecym_2395 Chr2 complement(766148..768211) [2064 bp, 687 aa] {ON}...   134   1e-31
TDEL0B07270 Chr2 complement(1280163..1282097) [1935 bp, 644 aa] ...   130   2e-30
NDAI0E02090 Chr5 complement(423630..425687) [2058 bp, 685 aa] {O...   130   2e-30
Skud_16.127 Chr16 complement(228817..230937) [2121 bp, 706 aa] {...   129   5e-30
ACR145W Chr3 (605114..607171) [2058 bp, 685 aa] {ON} Syntenic ho...   127   2e-29
Smik_6.352 Chr6 (564913..567060) [2148 bp, 715 aa] {ON} YPL155C ...   126   3e-29
KNAG0J01720 Chr10 (314395..316272) [1878 bp, 625 aa] {ON} Anc_8....   125   7e-29
TPHA0D04190 Chr4 complement(899419..901437) [2019 bp, 672 aa] {O...   122   8e-28
Suva_16.155 Chr16 complement(266334..268448) [2115 bp, 704 aa] {...   120   4e-27
Kpol_1019.11 s1019 complement(20458..22401) [1944 bp, 647 aa] {O...   113   4e-25
KAFR0B06590 Chr2 complement(1368106..1370226) [2121 bp, 706 aa] ...   110   3e-24
TPHA0D03200 Chr4 complement(659182..661356) [2175 bp, 724 aa] {O...   110   6e-24
SAKL0F03168g Chr6 (261405..263525) [2121 bp, 706 aa] {ON} simila...   109   1e-23
YKL079W Chr11 (286603..288573) [1971 bp, 656 aa] {ON}  SMY1Prote...   107   4e-23
YPR141C Chr16 complement(815734..817923) [2190 bp, 729 aa] {ON} ...   106   8e-23
TDEL0F03640 Chr6 complement(666365..668479) [2115 bp, 704 aa] {O...   106   9e-23
KLLA0B10956g Chr2 (958985..961057) [2073 bp, 690 aa] {ON} simila...   106   1e-22
Skud_16.435 Chr16 complement(769308..771497) [2190 bp, 729 aa] {...   105   2e-22
Smik_16.388 Chr16 complement(687227..689416) [2190 bp, 729 aa] {...   105   2e-22
NCAS0C01350 Chr3 complement(246839..248806) [1968 bp, 655 aa] {O...   104   3e-22
Suva_16.469 Chr16 complement(811946..814141) [2196 bp, 731 aa] {...   103   5e-22
ZYRO0B04290g Chr2 (353283..355478) [2196 bp, 731 aa] {ON} simila...   103   7e-22
Suva_11.145 Chr11 (272862..274835) [1974 bp, 657 aa] {ON} YKL079...   102   2e-21
Skud_11.148 Chr11 (271990..273960) [1971 bp, 656 aa] {ON} YKL079...    99   1e-20
Smik_11.160 Chr11 (272801..274771) [1971 bp, 656 aa] {ON} YKL079...    99   2e-20
TPHA0N01650 Chr14 complement(356519..358567) [2049 bp, 682 aa] {...    98   4e-20
TBLA0C01880 Chr3 (441985..443391) [1407 bp, 468 aa] {ON} Anc_8.6...    92   2e-18
NCAS0H03180 Chr8 (611693..613675) [1983 bp, 660 aa] {ON} Anc_2.633     82   3e-15
ZYRO0E01078g Chr5 (73042..75048) [2007 bp, 668 aa] {ON} similar ...    80   1e-14
TBLA0C00800 Chr3 complement(165244..167325) [2082 bp, 693 aa] {O...    78   6e-14
Kwal_55.21164 s55 complement(713274..715037) [1764 bp, 588 aa] {...    74   1e-12
Kwal_YGOB_55.21164 s55 complement(713063..713220,713222..715037)...    74   1e-12
NDAI0C00480 Chr3 complement(84502..86298) [1797 bp, 598 aa] {ON}...    60   2e-08
KNAG0M02540 Chr13 (471930..473498) [1569 bp, 522 aa] {ON} Anc_2....    60   2e-08
CAGL0L05104g Chr12 complement(577023..579050) [2028 bp, 675 aa] ...    59   3e-08
TBLA0A00820 Chr1 (178283..180694) [2412 bp, 803 aa] {ON} Anc_2.6...    59   5e-08
KAFR0C04020 Chr3 (802379..804382) [2004 bp, 667 aa] {ON} Anc_2.6...    52   9e-06
KNAG0H00360 Chr8 (51965..54010) [2046 bp, 681 aa] {ON} Anc_2.633...    49   5e-05
NCAS0C05200 Chr3 (1059068..1060786) [1719 bp, 572 aa] {ON} Anc_2...    47   2e-04
NDAI0G04460 Chr7 complement(1066524..1069940) [3417 bp, 1138 aa]...    38   0.18 
NDAI0E05090 Chr5 (1168389..1171058) [2670 bp, 889 aa] {ON} Anc_5...    36   0.68 
NCAS0C02830 Chr3 (534302..536926) [2625 bp, 874 aa] {ON} Anc_8.401     34   2.6  
YOR334W Chr15 (944596..946008) [1413 bp, 470 aa] {ON}  MRS2Mitoc...    33   3.3  
ZYRO0C02926g Chr3 complement(227574..228998) [1425 bp, 474 aa] {...    33   3.9  
Kpol_1002.47 s1002 (137553..139292) [1740 bp, 579 aa] {ON} (1375...    32   6.1  
KNAG0E00960 Chr5 complement(180138..180821) [684 bp, 227 aa] {ON}      32   6.3  
ZYRO0B08536g Chr2 complement(664054..666126) [2073 bp, 690 aa] {...    32   6.4  
KLLA0A02937g Chr1 (259865..260296) [432 bp, 143 aa] {ON} some si...    31   7.1  
TDEL0H04000 Chr8 (680730..685727) [4998 bp, 1665 aa] {ON} Anc_7....    32   7.2  
KNAG0B01860 Chr2 complement(350091..352613) [2523 bp, 840 aa] {O...    32   7.7  
TBLA0E03940 Chr5 (996079..997800) [1722 bp, 573 aa] {ON}               32   9.5  

>TPHA0M00240 Chr13 (47407..50226) [2820 bp, 939 aa] {ON} Anc_6.16
           YEL061C
          Length = 939

 Score = 1773 bits (4593), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 885/939 (94%), Positives = 885/939 (94%)

Query: 1   MSADPQKIEDDTDEMNIMVAVRCRGRNKREXXXXXXXXXXXPDVMGSNEISINTSDDIVS 60
           MSADPQKIEDDTDEMNIMVAVRCRGRNKRE           PDVMGSNEISINTSDDIVS
Sbjct: 1   MSADPQKIEDDTDEMNIMVAVRCRGRNKREIKSKSSVIVSVPDVMGSNEISINTSDDIVS 60

Query: 61  GLTAQLNSKTYTVDKVFGPSANQRLIFEEIAEPLFNDFLRGYNCTVLVYGMTSTGKTYTM 120
           GLTAQLNSKTYTVDKVFGPSANQRLIFEEIAEPLFNDFLRGYNCTVLVYGMTSTGKTYTM
Sbjct: 61  GLTAQLNSKTYTVDKVFGPSANQRLIFEEIAEPLFNDFLRGYNCTVLVYGMTSTGKTYTM 120

Query: 121 TGDEKLYKGDLSDSAGIIPRVLFKLFETIEFQSDNYVIKCSFIELYNEELKDLLIDSNNT 180
           TGDEKLYKGDLSDSAGIIPRVLFKLFETIEFQSDNYVIKCSFIELYNEELKDLLIDSNNT
Sbjct: 121 TGDEKLYKGDLSDSAGIIPRVLFKLFETIEFQSDNYVIKCSFIELYNEELKDLLIDSNNT 180

Query: 181 KLKKLRIFDXXXXXXXXXXXXXXXXXHFISGMDLRKXXXXXXXXXXXXTAIQNGNASIYI 240
           KLKKLRIFD                 HFISGMDLRK            TAIQNGNASIYI
Sbjct: 181 KLKKLRIFDSNLSKSSNNNNISRQNSHFISGMDLRKNPINPINNSNDNTAIQNGNASIYI 240

Query: 241 QNLEEFHIKNAREGIQLLQKGLKYRQVASTKMNDVSSRSHTIFTINLYKEHKGEIFKISK 300
           QNLEEFHIKNAREGIQLLQKGLKYRQVASTKMNDVSSRSHTIFTINLYKEHKGEIFKISK
Sbjct: 241 QNLEEFHIKNAREGIQLLQKGLKYRQVASTKMNDVSSRSHTIFTINLYKEHKGEIFKISK 300

Query: 301 MNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSIADKNIHIPFRESKLTRLL 360
           MNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSIADKNIHIPFRESKLTRLL
Sbjct: 301 MNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSIADKNIHIPFRESKLTRLL 360

Query: 361 QDSLGGNTKTALIATISPAKLNAEETCSTLEYATKAKSIKNKPQLGSIIMKDVRLKDLNN 420
           QDSLGGNTKTALIATISPAKLNAEETCSTLEYATKAKSIKNKPQLGSIIMKDVRLKDLNN
Sbjct: 361 QDSLGGNTKTALIATISPAKLNAEETCSTLEYATKAKSIKNKPQLGSIIMKDVRLKDLNN 420

Query: 421 ELAKIKRDLTSTKQKDGVYMTQNHYKDLTNDLESYKTEIQECDRIVKSLELQNALLLKDK 480
           ELAKIKRDLTSTKQKDGVYMTQNHYKDLTNDLESYKTEIQECDRIVKSLELQNALLLKDK
Sbjct: 421 ELAKIKRDLTSTKQKDGVYMTQNHYKDLTNDLESYKTEIQECDRIVKSLELQNALLLKDK 480

Query: 481 KASNEVNKLQELNLNEMTNTLSNIQTTLEIQHKKEQILVEELAHSREKSLKMKTVIKEYS 540
           KASNEVNKLQELNLNEMTNTLSNIQTTLEIQHKKEQILVEELAHSREKSLKMKTVIKEYS
Sbjct: 481 KASNEVNKLQELNLNEMTNTLSNIQTTLEIQHKKEQILVEELAHSREKSLKMKTVIKEYS 540

Query: 541 EKEERIQSNMKSIFNDXXXXXXXXXXXXXXGIAKENLIVQTNVKDNIKLIKDDVISIVTE 600
           EKEERIQSNMKSIFND              GIAKENLIVQTNVKDNIKLIKDDVISIVTE
Sbjct: 541 EKEERIQSNMKSIFNDELIKLKELLIENLNGIAKENLIVQTNVKDNIKLIKDDVISIVTE 600

Query: 601 SQELSKKLFLEFSQQIIKETPLILEMFSSDVKKNQELNETYFANLFENLESIKQQYSKLN 660
           SQELSKKLFLEFSQQIIKETPLILEMFSSDVKKNQELNETYFANLFENLESIKQQYSKLN
Sbjct: 601 SQELSKKLFLEFSQQIIKETPLILEMFSSDVKKNQELNETYFANLFENLESIKQQYSKLN 660

Query: 661 EYFSNDFFKSNHVTIVNDHVNTTKAIIEKSVSDIFKQFQQNMEAFAEQNEKLILENLKTV 720
           EYFSNDFFKSNHVTIVNDHVNTTKAIIEKSVSDIFKQFQQNMEAFAEQNEKLILENLKTV
Sbjct: 661 EYFSNDFFKSNHVTIVNDHVNTTKAIIEKSVSDIFKQFQQNMEAFAEQNEKLILENLKTV 720

Query: 721 SSDLIQNEMNSFKEHKSEWDISFKKINHCDYLNNSYHDQMHTYLRNMKGKLQSSDEIIKK 780
           SSDLIQNEMNSFKEHKSEWDISFKKINHCDYLNNSYHDQMHTYLRNMKGKLQSSDEIIKK
Sbjct: 721 SSDLIQNEMNSFKEHKSEWDISFKKINHCDYLNNSYHDQMHTYLRNMKGKLQSSDEIIKK 780

Query: 781 HMNQIKSNVDSLNSTPKLLNTDRAIGDNYNQIISKRDKLHDHLQISLNSTQNSLLVFDEI 840
           HMNQIKSNVDSLNSTPKLLNTDRAIGDNYNQIISKRDKLHDHLQISLNSTQNSLLVFDEI
Sbjct: 781 HMNQIKSNVDSLNSTPKLLNTDRAIGDNYNQIISKRDKLHDHLQISLNSTQNSLLVFDEI 840

Query: 841 CKSIQFAFANYSKTNLQESALLKGRLFADIDPLNDTNLNKQESLTFDKGDAKLTKENNED 900
           CKSIQFAFANYSKTNLQESALLKGRLFADIDPLNDTNLNKQESLTFDKGDAKLTKENNED
Sbjct: 841 CKSIQFAFANYSKTNLQESALLKGRLFADIDPLNDTNLNKQESLTFDKGDAKLTKENNED 900

Query: 901 MSSKDENKLNNQNVTLIGLKRSHMDLNDSDSPLKSRRIE 939
           MSSKDENKLNNQNVTLIGLKRSHMDLNDSDSPLKSRRIE
Sbjct: 901 MSSKDENKLNNQNVTLIGLKRSHMDLNDSDSPLKSRRIE 939

>TDEL0G04530 Chr7 complement(824970..827846) [2877 bp, 958 aa] {ON}
           Anc_6.16 YEL061C
          Length = 958

 Score =  853 bits (2205), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 438/857 (51%), Positives = 595/857 (69%), Gaps = 15/857 (1%)

Query: 1   MSADPQKIEDDTDEMNIMVAVRCRGRNKREXXXXXXXXXXXPDVMGSNEISINTSDDIVS 60
           M A PQ   +D +E+NI VAVRCRGRN+RE           PDV GSNE+SINT+ D+  
Sbjct: 1   MVAMPQASGEDVEELNITVAVRCRGRNEREIKAKSSVVVSVPDVTGSNEVSINTTGDV-- 58

Query: 61  GLTAQLNSKTYTVDKVFGPSANQRLIFEEIAEPLFNDFLRGYNCTVLVYGMTSTGKTYTM 120
           G+TAQ+NSKTYTVD+VFGPSANQ L+F++IAEPLF DF++GYNCTVLVYGMTSTGKTYTM
Sbjct: 59  GITAQINSKTYTVDEVFGPSANQSLVFQKIAEPLFADFIKGYNCTVLVYGMTSTGKTYTM 118

Query: 121 TGDEKLYKGDLSDSAGIIPRVLFKLFETIEFQSDNYVIKCSFIELYNEELKDLLIDSNN- 179
           TGDEKLY G+LS+SAGIIPR+LFKLFET+E Q ++YV+KCSF+ELYNEELKDLL DS   
Sbjct: 119 TGDEKLYDGELSESAGIIPRILFKLFETLELQKEDYVVKCSFVELYNEELKDLLGDSQEI 178

Query: 180 TKLKKLRIFDXXXXXXXXXXXXXXXXX------------HFISGMDLRKXXXXXXXXXXX 227
              +KLRIFD                                +   LRK           
Sbjct: 179 ASSRKLRIFDSNTMSAATNSMSTGNSTKNSRNNSPRSSSELPTATFLRKRWKTAPSVTQS 238

Query: 228 XTAIQNGNASIYIQNLEEFHIKNAREGIQLLQKGLKYRQVASTKMNDVSSRSHTIFTINL 287
               Q+ NA IYIQNL++FHI NA+EGI+LLQKGLK+RQVA+TKMND SSRSHTIFTI L
Sbjct: 239 HQNSQDQNAGIYIQNLQDFHITNAKEGIKLLQKGLKHRQVATTKMNDFSSRSHTIFTITL 298

Query: 288 YKEHKGEIFKISKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSIADKNI 347
           YKE+ GEIF++SKMNLVDLAGSENISRSGAQ+QRAKEAGSINQSLLTLGRVINS+ DK++
Sbjct: 299 YKEYNGEIFRVSKMNLVDLAGSENISRSGAQHQRAKEAGSINQSLLTLGRVINSLTDKSL 358

Query: 348 HIPFRESKLTRLLQDSLGGNTKTALIATISPAKLNAEETCSTLEYATKAKSIKNKPQLGS 407
           H+PFRESKLTRLLQDSLGGNTKTALIATISPAK+N+EETCSTL+YA KAK+IKNKPQLGS
Sbjct: 359 HVPFRESKLTRLLQDSLGGNTKTALIATISPAKINSEETCSTLQYAAKAKNIKNKPQLGS 418

Query: 408 IIMKDVRLKDLNNELAKIKRDLTSTKQKDGVYMTQNHYKDLTNDLESYKTEIQECDRIVK 467
           +IMKD+ +K++  ELAKIK DL STK K+G+YM+Q++YK+LTNDLESYKTE++EC R ++
Sbjct: 419 VIMKDILVKNITGELAKIKADLLSTKSKEGIYMSQDNYKELTNDLESYKTEVKECKRAIE 478

Query: 468 SLELQNALLLKDKKASNEVNKLQELNLNEMTNTLSNIQTTLEIQHKKEQILVEELAHSRE 527
           +L  QN LLLKDKKASNEVN LQ + L  M + +S++ +  E Q+K+EQ LV   +  + 
Sbjct: 479 TLTSQNTLLLKDKKASNEVNDLQRIKLQNMRDAMSDLYSKAEKQNKREQNLVATASTLKT 538

Query: 528 KSLKMKTVIKEYSEKEERIQSNMKSIFNDXXXXXXXXXXXXXXGIAKENLIVQTNVKDNI 587
               M+++IKE+  +E  I+S M  +FN+               I ++       V+ NI
Sbjct: 539 TVGTMQSIIKEHERRERDIESKMGDLFNNEFARVKQTILSNIRDIEQQIDWENIGVQGNI 598

Query: 588 KLIKDDVISIVTESQELSKKLFLEFSQQIIKETPLILEMFSSDVKKNQELNETYFANLFE 647
             I+ ++  ++  +Q+ +  ++ +  ++I+ ETP   ++ +  V + ++L  T   +L E
Sbjct: 599 DSIRGEISKLLERAQQQTDDMYKDCVEKILDETPGHFQLAAEKVSEVEKLIATCHRDLTE 658

Query: 648 NLESIKQQYSKLNEYFSNDFFKSNHVTIVNDHVNTTKAIIEKSVSDIFKQFQQNMEAFAE 707
           NL  + ++++ L +Y ++ FFK+NH  I+  H++ T   I+ S  D+F+QF++ M+   E
Sbjct: 659 NLSDVSEEFNNLRQYLNDHFFKNNHEEILVSHIDRTYHHIQTSADDLFQQFKEMMDNHLE 718

Query: 708 QNEKLILENLKTVSSDLIQNEMNSFKEHKSEWDISFKKINHCDYLNNSYHDQMHTYLRNM 767
           +N+ L+LE+LKT + D+I+ EM  F+  K +W+ SFK IN CD +N ++ + + + L  +
Sbjct: 719 KNKDLMLESLKTATYDVIRKEMQLFEPQKKKWEDSFKYINKCDSINFAFQNGVKSPLLGI 778

Query: 768 KGKLQSSDEIIKKHMNQIKSNVDSLNSTPKLLNTDRAIGDNYNQIISKRDKLHDHLQISL 827
           K  L SS E I K + ++K  +D   S   +L+  R   + ++ I++K+  LH+ L+ S+
Sbjct: 779 KSTLGSSQEAINKTITKVKEQMDEHESPASMLSNSRVFSEQFSGILNKQSLLHESLKKSV 838

Query: 828 NSTQNSLLVFDEICKSI 844
             T +     D++ ++I
Sbjct: 839 IITSDHADAVDKLKEAI 855

>SAKL0E01078g Chr5 (80541..83387) [2847 bp, 948 aa] {ON} similar to
           uniprot|P27895 Saccharomyces cerevisiae YEL061C CIN8
           Kinesin motor protein involved in mitotic spindle
           assembly and chromosome segregation
          Length = 948

 Score =  743 bits (1918), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 395/840 (47%), Positives = 553/840 (65%), Gaps = 27/840 (3%)

Query: 9   EDDTDEMNIMVAVRCRGRNKREXXXXXXXXXXXPDVMGSNEISINTSDDIVSGLTAQLNS 68
           E++  E+NI V+VRCRGRN+RE           PDV GSNE+SINT+D++  G+TAQ+NS
Sbjct: 11  EENGQELNITVSVRCRGRNEREIKAKSSVVVTVPDVTGSNEVSINTTDEL--GITAQMNS 68

Query: 69  KTYTVDKVFGPSANQRLIFEEIAEPLFNDFLRGYNCTVLVYGMTSTGKTYTMTGDEKLYK 128
           KTYTVDKVFGPSA+Q LIF++IAEPLF+DF++GYNCTVLVYGMTSTGKTYTMTGDE+LY 
Sbjct: 69  KTYTVDKVFGPSADQSLIFKQIAEPLFDDFIKGYNCTVLVYGMTSTGKTYTMTGDERLYD 128

Query: 129 GDLSDSAGIIPRVLFKLFETIEFQSDNYVIKCSFIELYNEELKDLLIDSNNTK-LKKLRI 187
           G+LSD+AGIIPR+LFKLF+T+E Q ++Y++KCSFIELYNEELKDLL +   +  +KKLRI
Sbjct: 129 GELSDAAGIIPRILFKLFDTLETQDEDYLVKCSFIELYNEELKDLLNEPQESGVIKKLRI 188

Query: 188 FDXXXXXXXXXXXXXXXXXHFI--SGMDLR-------------KXXXXXXXXXXXXTAIQ 232
           FD                 + +  SG   R                            I 
Sbjct: 189 FDSNTTSSNSRNNSRNNSPNLVGTSGTFKRIFKTPVPYKQQQQHQQHLQQQQQQQPRLIN 248

Query: 233 NGNASIYIQNLEEFHIKNARE--------GIQLLQKGLKYRQVASTKMNDVSSRSHTIFT 284
           N   S+  Q+    +I+N +E        GI LLQ+GLK+RQVASTKMND SSRSHTIFT
Sbjct: 249 NKQQSLSEQS-SAIYIQNLQEFHITNAKDGINLLQRGLKHRQVASTKMNDFSSRSHTIFT 307

Query: 285 INLYKEHKGEIFKISKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSIAD 344
           I LYK H GE+F++SKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINS+AD
Sbjct: 308 IMLYKNHNGEVFRVSKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLAD 367

Query: 345 KNIHIPFRESKLTRLLQDSLGGNTKTALIATISPAKLNAEETCSTLEYATKAKSIKNKPQ 404
           KN HIPFRESKLTRLLQDSLGGNTKTALIATISPAK+NAEET STLEYATKAK+IKNKPQ
Sbjct: 368 KNAHIPFRESKLTRLLQDSLGGNTKTALIATISPAKINAEETSSTLEYATKAKNIKNKPQ 427

Query: 405 LGSIIMKDVRLKDLNNELAKIKRDLTSTKQKDGVYMTQNHYKDLTNDLESYKTEIQECDR 464
           LG+++MKD+ +K++  ELAKIK D  STK KDG+YMTQ+HYK+LT+DLE+YKTE+QEC R
Sbjct: 428 LGTLVMKDILVKNITRELAKIKSDFLSTKSKDGIYMTQDHYKELTSDLENYKTEVQECKR 487

Query: 465 IVKSLELQNALLLKDKKASNEVNKLQELNLNEMTNTLSNIQTTLEIQHKKEQILVEELAH 524
            ++ +  QN LLLKDK+AS+EV++LQ + +  + + ++++   ++ QHK EQ LV  +  
Sbjct: 488 EIEKMNSQNVLLLKDKRASHEVSELQRIKIKHLNDKIAHLYDKMDKQHKNEQDLVCTIHT 547

Query: 525 SREKSLKMKTVIKEYSEKEERIQSNMKSIFNDXXXXXXXXXXXXXXGIAKENLIVQTNVK 584
            ++    ++  +K   + + + +S M+ +  D               +   +      + 
Sbjct: 548 LKDAIYTVQNSLKNCEDYQLQCKSEMEDVLYDHVTSFKQSIHEQLAAMKASHSSRHLGID 607

Query: 585 DNIKLIKDDVISIVTESQELSKKLFLEFSQQIIKETPLILEMFSSDVKKNQELNETYFAN 644
            NI +I++++  ++      S  +     ++I++  P   E    D+     + ++Y   
Sbjct: 608 GNIDIIQEELSQVLESICSTSVDVCRSCVEKILESNPKHFESIRRDLLDISTVVDSYSNE 667

Query: 645 LFENLESIKQQYSKLNEYFSNDFFKSNHVTIVNDHVNTTKAIIEKSVSDIFKQFQQNMEA 704
           L +NL  I ++Y+   EY +   FK+NH   ++ HV+ T  +++KS  ++F +F++ M++
Sbjct: 668 LVKNLGDISEEYNNFREYLNEHLFKNNHEETLSIHVDKTYHMLKKSAGELFSKFKEMMDS 727

Query: 705 FAEQNEKLILENLKTVSSDLIQNEMNSFKEHKSEWDISFKKINHCDYLNNSYHDQMHTYL 764
             E+N+ L++++LKT S +++  E+  F   K +W+ S + IN CD LNN++   +   L
Sbjct: 728 HLEENKSLMIKSLKTASDEVVAKEVKLFAPVKQKWESSLENINKCDSLNNTFDSTVKDAL 787

Query: 765 RNMKGKLQSSDEIIKKHMNQIKSNVDSLNSTPKLLNTDRAIGDNYNQIISKRDKLHDHLQ 824
           R ++G ++ S E  K     +K ++   +   ++L  +  + +N N++  K   L D ++
Sbjct: 788 RRLEGNIEGSLEFSKNTAGDVKDSLKKFDGISEVLKNNTKVVNNINEVKEKHTFLRDQVE 847

>KLTH0C11330g Chr3 complement(931865..934690) [2826 bp, 941 aa] {ON}
           similar to uniprot|P27895 Saccharomyces cerevisiae
           YEL061C CIN8 Kinesin motor protein involved in mitotic
           spindle assembly and chromosome segregation
          Length = 941

 Score =  729 bits (1882), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 400/849 (47%), Positives = 557/849 (65%), Gaps = 26/849 (3%)

Query: 13  DEMNIMVAVRCRGRNKREXXXXXXXXXXXPDVMGSNEISINTSDDIVSGLTAQLNSKTYT 72
           +E+NI VAVRCRGRN++E           PDV G+NE+SINT+ D  +G+TAQ+NSKTYT
Sbjct: 5   EELNITVAVRCRGRNEKEVKAKSSVVVAVPDVTGTNEVSINTTGD--TGITAQINSKTYT 62

Query: 73  VDKVFGPSANQRLIFEEIAEPLFNDFLRGYNCTVLVYGMTSTGKTYTMTGDEKLYKGDLS 132
           VD+VFGPSA+Q LIF+ IAEPLF DF++GYNCTVLVYGMTSTGKTYTMTGDE+LY G+LS
Sbjct: 63  VDRVFGPSADQLLIFKVIAEPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDERLYDGELS 122

Query: 133 DSAGIIPRVLFKLFETIEFQSDNYVIKCSFIELYNEELKDLLIDSNNTKL-KKLRIFDXX 191
           + AGIIPRVLFKLF+ ++  +D+Y+IKCSFIELYNEELKDLL ++ ++ + +KLRIFD  
Sbjct: 123 EGAGIIPRVLFKLFDALDAHNDDYMIKCSFIELYNEELKDLLDETPDSSMPRKLRIFDSV 182

Query: 192 XXXXXXXXXXXXXXXHFISGMDL---RKXXXXXXXXXXXXTAIQNG-----NASIYIQNL 243
                              G      R+              ++       N++I+IQNL
Sbjct: 183 TNPNSSRSSSRNSSPKPPEGSTSGTKRRIRPNTMYKPSRSPTVKPTLSSELNSAIHIQNL 242

Query: 244 EEFHIKNAREGIQLLQKGLKYRQVASTKMNDVSSRSHTIFTINLYKEHKGEIFKISKMNL 303
           +EFHI +A+EGI+LLQ+GL++RQVASTKMNDVSSRSHTIFTI LY++  GE F++SKMNL
Sbjct: 243 QEFHIMDAKEGIRLLQRGLRHRQVASTKMNDVSSRSHTIFTIMLYRKCNGESFRVSKMNL 302

Query: 304 VDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSIADKNIHIPFRESKLTRLLQDS 363
           VDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINS+ADKN HIPFRESKLTRLLQDS
Sbjct: 303 VDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLADKNAHIPFRESKLTRLLQDS 362

Query: 364 LGGNTKTALIATISPAKLNAEETCSTLEYATKAKSIKNKPQLGSIIMKDVRLKDLNNELA 423
           LGGNTKTALIATISPAK+N+EET STLEYATKAK+IKNKPQ+GS IMKDV +K++  EL 
Sbjct: 363 LGGNTKTALIATISPAKINSEETSSTLEYATKAKNIKNKPQVGSFIMKDVLVKNVTAELV 422

Query: 424 KIKRDLTSTKQKDGVYMTQNHYKDLTNDLESYKTEIQECDRIVKSLELQNALLLKDKKAS 483
           KI+ DL +TK KDG+YM+Q +YK+LTN+LE+YKTE+QEC R ++ L  QN LL K+K+ +
Sbjct: 423 KIRSDLLATKSKDGIYMSQENYKELTNELENYKTEVQECKRAIERLSTQNGLLTKEKRIT 482

Query: 484 NEVNKLQELNLNEMTNTLSNIQTTLEIQHKKEQIL---VEELAHSREKSLK-MKTVIKEY 539
           NEVN+ Q L + +++N +  +   ++ QHK EQ L   V+EL     ++L+ M+  +K Y
Sbjct: 483 NEVNESQRLKIKKLSNNIDFLYDKIDRQHKNEQELSNVVQELM----RALRTMQNSLKVY 538

Query: 540 SEKEERIQSNMKSIFNDXXXXXXXX---XXXXXXGIAKENLIVQTNVKDNIKLIKDDVIS 596
            ++  R Q+ M+ +  +                 G  ++   V  N+    K +      
Sbjct: 539 EDQGHRFQTEMERVLYENIGSFKHSLLNEIEKLKGTEEDGFDVDANIDTLTKELNRIYDF 598

Query: 597 IVTESQELSKKLFLEFSQQIIKETPLILEMFSSDVKKNQELNETYFANLFENLESIKQQY 656
           I T + E+ +K    F  +I ++TP  L+   + V+    +  +Y ++L  +L SI ++Y
Sbjct: 599 INTSTIEICRK----FMNKITEQTPTYLQDIRNQVESITHVVGSYSSDLMMHLSSISEEY 654

Query: 657 SKLNEYFSNDFFKSNHVTIVNDHVNTTKAIIEKSVSDIFKQFQQNMEAFAEQNEKLILEN 716
           + L +Y +  FFK+N    ++ HV+ T   ++ S + IF + ++ M    E N+++++++
Sbjct: 655 NHLKDYLNEHFFKNNFQDALDVHVDRTYHQLKVSANSIFLKLREMMNEELETNKEIMMQS 714

Query: 717 LKTVSSDLIQNEMNSFKEHKSEWDISFKKINHCDYLNNSYHDQMHTYLRNMKGKLQSSDE 776
           LK  +S+++  EM      K  W+ S + IN CD LN+ +   + + +R++  K+    +
Sbjct: 715 LKNAASEVVAKEMGLLDPVKQAWESSLENINECDKLNSGFEKDIGSVVRDVFEKINEGLQ 774

Query: 777 IIKKHMNQIKSNVDSLNSTPKLLNTDRAIGDNYNQIISKRDKLHDHLQISLNSTQNSLLV 836
             +  +     ++       + L TD  I  +  +I  K + L   +Q S +  + +   
Sbjct: 775 FSESAVGDANLDLSRFQDASRALRTDDVIPGSIEEIKKKHNMLKLKVQDSASYMEAATQK 834

Query: 837 FDEICKSIQ 845
           F EI  SIQ
Sbjct: 835 FGEIDDSIQ 843

>Kwal_56.22403 s56 (112080..114911) [2832 bp, 943 aa] {ON} YEL061C
           (CIN8) - 1:1 [contig 185] FULL
          Length = 943

 Score =  727 bits (1877), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 405/863 (46%), Positives = 566/863 (65%), Gaps = 48/863 (5%)

Query: 11  DTDEMNIMVAVRCRGRNKREXXXXXXXXXXXPDVMGSNEISINTSDDIVSGLTAQLNSKT 70
           D +E+NI VAVRCRGRN++E           PDV G+NE+SINT+ D  +G+TAQ+NSKT
Sbjct: 3   DDEELNITVAVRCRGRNEKEVKARSSVVVAVPDVTGTNEVSINTTGD--TGITAQINSKT 60

Query: 71  YTVDKVFGPSANQRLIFEEIAEPLFNDFLRGYNCTVLVYGMTSTGKTYTMTGDEKLYKGD 130
           YTVDKVFGPSA+Q LIF+ IAEPLF DF++GYNCTVLVYGMTSTGKTYTMTGDE+LY G+
Sbjct: 61  YTVDKVFGPSADQLLIFKVIAEPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDERLYDGE 120

Query: 131 LSDSAGIIPRVLFKLFETIEFQSDNYVIKCSFIELYNEELKDLLIDSNNTKL-KKLRIFD 189
           LS+ AGIIPRVLFKLF+ +  Q D+Y+IKCSFIELYNEELKDLL ++ ++ + KKLRIFD
Sbjct: 121 LSEGAGIIPRVLFKLFDALSAQGDDYMIKCSFIELYNEELKDLLDETPDSSMPKKLRIFD 180

Query: 190 XXXXXXXXXXXXXX---XXXHFISGMDLRKXXXXXXXXXXXXTAIQNG------NASIYI 240
                               +  S    R+            + +         +++I+I
Sbjct: 181 SVSNVSSNSRASSRNNSPKPNEGSSFGTRRKTRAPSIHRPTKSPVSKPVSPCEPSSAIHI 240

Query: 241 QNLEEFHIKNAREGIQLLQKGLKYRQVASTKMNDVSSRSHTIFTINLYKEHKGEIFKISK 300
           QNL+EFHI +A+EGI+LLQ+GL++RQVASTKMNDVSSRSHTIFTI LYK+  GE F++SK
Sbjct: 241 QNLQEFHIMDAKEGIRLLQRGLRHRQVASTKMNDVSSRSHTIFTIMLYKKCNGESFRVSK 300

Query: 301 MNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSIADKNIHIPFRESKLTRLL 360
           MNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINS+ADK++HIPFRESKLTRLL
Sbjct: 301 MNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLADKSLHIPFRESKLTRLL 360

Query: 361 QDSLGGNTKTALIATISPAKLNAEETCSTLEYATKAKSIKNKPQLGSIIMKDVRLKDLNN 420
           QDSLGGNTKTALIATISPAK+N+EET STLEYATKAK+IKNKPQ+GS IMKDV LK +  
Sbjct: 361 QDSLGGNTKTALIATISPAKINSEETSSTLEYATKAKNIKNKPQVGSFIMKDVLLKSVTA 420

Query: 421 ELAKIKRDLTSTKQKDGVYMTQNHYKDLTNDLESYKTEIQECDRIVKSLELQNALLLKDK 480
           EL KIK DL STK KDG+YM+Q +YK+LTN+LE+YKTE++EC R ++ +  QN+LL+K+K
Sbjct: 421 ELVKIKSDLLSTKSKDGIYMSQENYKELTNELENYKTEVEECKRAMEKVSAQNSLLIKEK 480

Query: 481 KASNEVNKLQELNLNEMTNTLSNIQTTLEIQHKKEQIL---VEELA---HSREKSLKMKT 534
           + SNEVN+ Q++ L ++ N +  +   ++ QHK EQ L   V+EL    H+ ++SL++  
Sbjct: 481 RVSNEVNESQKVKLRKLGNNIEFLYDKIDRQHKNEQELSNVVQELMRALHTMQQSLRI-- 538

Query: 535 VIKEYSEKEERIQSNMKSIFNDXXXXXXXXXXXXXXGIAKENLI-----VQTNVKDNIKL 589
               Y ++ +R  + M+ +  D              G  K++L+     ++ NV +N   
Sbjct: 539 ----YEDQGQRFHTEMERVLYD------------NIGSFKKSLMDEIEKLKINVDENGDD 582

Query: 590 IKDDVISIVTESQEL-------SKKLFLEFSQQIIKETPLILEMFSSDVKKNQELNETYF 642
           ++ +V ++ TE   +       + ++F  + +++  +TP   +   S V+    +  +Y 
Sbjct: 583 VEVNVDAVTTELTRIFDFMNSSNIEVFRNYIKKVNDQTPAYFKDIYSQVESITSVVSSYS 642

Query: 643 ANLFENLESIKQQYSKLNEYFSNDFFKSNHVTIVNDHVNTTKAIIEKSVSDIFKQFQQNM 702
           +NL  +L SI ++Y+ L +Y +  FFK+N    ++ HV+ T   ++ S + IF + ++ +
Sbjct: 643 SNLMIHLSSISEEYNNLKDYLNEHFFKNNFQEALDVHVDRTYHQLKVSANSIFLKLREML 702

Query: 703 EAFAEQNEKLILENLKTVSSDLIQNEMNSFKEHKSEWDISFKKINHCDYLNNSYHDQMHT 762
               + N++ ++++L+  +S+++  EM      K  W+ S + IN CD LNN + +++  
Sbjct: 703 NEELDTNKEFMMQSLRHAASEVVAKEMCLLDPVKQAWENSLENINECDKLNNVFENKIGV 762

Query: 763 YLRNMKGKLQSSDEIIKKHMNQIKSNVDSLNSTPKLLNTDRAIGDNYNQIISKRDKLHDH 822
            +  +   +    +  +      KS +  + +    L  +  I  N + I  K + L   
Sbjct: 763 TVNEIFKTIDQGQKTSQVTTEDAKSELTRVRAAFSSLQNNGIILQNVDSIKKKHNLLKSQ 822

Query: 823 LQISLNSTQNSLLVFDEICKSIQ 845
           +Q S N  Q +   F EI  SIQ
Sbjct: 823 VQDSANYMQAATQKFGEIDNSIQ 845

>Ecym_3020 Chr3 (37549..40383) [2835 bp, 944 aa] {ON} similar to
           Ashbya gossypii ACR010C
          Length = 944

 Score =  710 bits (1833), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 400/856 (46%), Positives = 552/856 (64%), Gaps = 33/856 (3%)

Query: 8   IEDDTDEMNIMVAVRCRGRNKREXXXXXXXXXXXPDVMGSNEISINTSDDIVSGLTAQLN 67
           ++D  +E+NI VAVRCRGRN+RE           PDV GSNE+SINT+ DI  G+  ++N
Sbjct: 14  LDDGNEELNITVAVRCRGRNEREIKAKSAVVVTVPDVTGSNEVSINTTGDI--GIAGKMN 71

Query: 68  SKTYTVDKVFGPSANQRLIFEEIAEPLFNDFLRGYNCTVLVYGMTSTGKTYTMTGDEKLY 127
           S+TYTVD+VFGPSA+Q+LIF+ IAEPLF+DF++GYNCTVLVYGMTSTGKTYTMTGDEKLY
Sbjct: 72  SRTYTVDQVFGPSADQKLIFKNIAEPLFDDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLY 131

Query: 128 KGDLSDSAGIIPRVLFKLFETIEFQSDNYVIKCSFIELYNEELKDLLIDSNNTKLKKLRI 187
            G+LSDSAGIIPRVLF+LF+T+E    ++++KCS+IELYNEELKDLL D+ +   K+LRI
Sbjct: 132 DGELSDSAGIIPRVLFRLFDTLEATESDHLVKCSYIELYNEELKDLLDDTPDYS-KRLRI 190

Query: 188 FDXXXXXXXXXXXXXXXXXH---FISGMDLRKXXXXXXXXXXXXTAIQ---NGNASIYIQ 241
           FD                       S M  R+               Q     +++IYIQ
Sbjct: 191 FDSNTITNSRAGSQNNSPKEQDGTSSSMAKRRYTHIPTKPKRPSLNKQLLYEQSSAIYIQ 250

Query: 242 NLEEFHIKNAREGIQLLQKGLKYRQVASTKMNDVSSRSHTIFTINLYKEHKGEIFKISKM 301
           NL+EFHI NAREGI +LQKGLK+RQVASTKMND SSRSHTIFTI LYK ++GE+F+ISKM
Sbjct: 251 NLQEFHITNAREGISVLQKGLKHRQVASTKMNDFSSRSHTIFTIMLYKSYEGELFRISKM 310

Query: 302 NLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSIADKNIHIPFRESKLTRLLQ 361
           NLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINS+ADK+IHIPFRESKLTRLLQ
Sbjct: 311 NLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLADKSIHIPFRESKLTRLLQ 370

Query: 362 DSLGGNTKTALIATISPAKLNAEETCSTLEYATKAKSIKNKPQLGSIIMKDVRLKDLNNE 421
           DSLGGNTKTALIATISPAK+NA+ET STLEYATKAK+IKN+PQLGS +MKD+ +K +++E
Sbjct: 371 DSLGGNTKTALIATISPAKINADETSSTLEYATKAKNIKNRPQLGSFMMKDILVKSISSE 430

Query: 422 LAKIKRDLTSTKQKDGVYMTQNHYKDLTNDLESYKTEIQECDRIVKSLELQNALLLKDKK 481
           L+K+K D  STK K+G+YM+  HY+++ NDLE+Y+TEIQE  R V+S   QN+LLLKDKK
Sbjct: 431 LSKLKSDFLSTKAKEGIYMSHEHYQEMVNDLENYQTEIQESKRQVESFSSQNSLLLKDKK 490

Query: 482 ASNEVNKLQELNLNEMTNTLSNIQTTLEIQHKKEQILVEELAHSREKSLKMKTVIKEYSE 541
           AS ++N+LQ++ +  + NT+  +   +E QH+ E  LV  +   +E    MK  ++ Y  
Sbjct: 491 ASQQLNELQDMKITRLQNTIEYLCDKIERQHRNEIDLVSTIHKLKEALHTMKGSLQNYET 550

Query: 542 KEERIQSNMKSIFNDXXXXXXXXXXXXXXGIAK----ENLIVQTNVKDNIKLIKDDVI-S 596
            E R+Q+++K +                  +      +NL +  N+ D I+ I  + + S
Sbjct: 551 HELRLQNDIKEVLYQGITSYRESMDQHLETVKTRMLDKNLSINHNM-DEIRTIFHETLDS 609

Query: 597 IVTESQELSKKLFLEFSQQIIKETPLI-LEMFSSDVKKNQELNETYFANLFENLESIKQQ 655
           + +   ++   +      +I+K+ P    + F   +       +TY   L   L  + ++
Sbjct: 610 VRSAGSDMCTNIV-----KIVKDQPSTSYQQFKEALGDLDTKVQTYSVTLTNKLTEMTEE 664

Query: 656 YSKLNEYFSNDFFKSNHVTIVNDHVNTTKAIIE-KSVSD-IFKQFQQNMEAFAEQNEKLI 713
            + + EY    F K+N+  +++  +   KA  + K+ SD +       ME+  E++  L+
Sbjct: 665 NNNMKEYLDEHFLKNNNQEMLD--LRMEKAYHKSKTASDALISSVVSMMESHMEESRNLM 722

Query: 714 LENLKTVSSDLIQNEMNSFKEHKSEWDISFKKINHCDYLNNSYHDQMHTYLRNMK----G 769
           L ++K   S++I  E+  F+  K  W +SF+ IN CD  +  + ++    L N+K     
Sbjct: 723 LSSMKDAVSEMIDKELEMFQPVKERWVLSFENINECDAAHQQFENKSTKLLTNLKELADN 782

Query: 770 KLQSSDEIIKKHMNQIKSNVDSLNSTPKLLNTDRAIGDNYNQIISKRDKLHDHLQISLNS 829
            + ++D++ K    Q++ NV +     +  +   +I    N I  K   L DH + ++  
Sbjct: 783 SVVAADDVAK----QVQENVTNFEGIVRQASAKESIVKQMNDINDKHKMLEDHFENNIKY 838

Query: 830 TQNSLLVFDEICKSIQ 845
            + S   F+E+  SI+
Sbjct: 839 FKESSKGFEEMDCSIK 854

>ACR010C Chr3 complement(374085..376922) [2838 bp, 945 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YEL061C
           (CIN8)
          Length = 945

 Score =  700 bits (1807), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 388/833 (46%), Positives = 533/833 (63%), Gaps = 30/833 (3%)

Query: 8   IEDDTDEMNIMVAVRCRGRNKREXXXXXXXXXXXPDVMGSNEISINTSDDIVSGLTAQLN 67
           ++D  +E+NI VAVRCRGRN+RE           PDV GSNE+SINT+D++  G+ A++N
Sbjct: 14  LDDAQEELNITVAVRCRGRNEREIKAKSSVVVTVPDVTGSNEVSINTTDEV--GIAAKMN 71

Query: 68  SKTYTVDKVFGPSANQRLIFEEIAEPLFNDFLRGYNCTVLVYGMTSTGKTYTMTGDEKLY 127
           S+TYTVDKVFGPSA+Q LIF+EIAEPLF+DF++GYNCTVLVYGMTSTGKTYTMTGDEKLY
Sbjct: 72  SRTYTVDKVFGPSADQSLIFKEIAEPLFDDFMKGYNCTVLVYGMTSTGKTYTMTGDEKLY 131

Query: 128 KGDLSDSAGIIPRVLFKLFETIEFQSDNYVIKCSFIELYNEELKDLLIDSNNTKLKKLRI 187
            G LSDSAGIIPR++FKLF+ +E    ++++KCS+IELYNEELKDLL +S+++  K+LRI
Sbjct: 132 DGQLSDSAGIIPRIMFKLFDALEATDSDFLVKCSYIELYNEELKDLLDESHDSS-KRLRI 190

Query: 188 FDXXXX-------XXXXXXXXXXXXXHFISGMDLRKXXXXXXXXXXXXTAIQNGNASIYI 240
           FD                        +  S    R               +    + IY+
Sbjct: 191 FDSSSMNHSSRASSQSNSPREPEVAHNGFSRRRQRPPPVKANRMSATKQQLSESGSGIYV 250

Query: 241 QNLEEFHIKNAREGIQLLQKGLKYRQVASTKMNDVSSRSHTIFTINLYKEHKGEIFKISK 300
           QN++EFHI NAREGI +LQKGLK+RQVASTKMND SSRSHTIFTI LYK   GE+F++SK
Sbjct: 251 QNVQEFHIINAREGINVLQKGLKHRQVASTKMNDFSSRSHTIFTIMLYKNCDGELFRVSK 310

Query: 301 MNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSIADKNIHIPFRESKLTRLL 360
           MNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINS+ADK+IHIPFRESKLTRLL
Sbjct: 311 MNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLADKSIHIPFRESKLTRLL 370

Query: 361 QDSLGGNTKTALIATISPAKLNAEETCSTLEYATKAKSIKNKPQLGSIIMKDVRLKDLNN 420
           QDSLGGNTKTALIATISPAK+NA+ET STLEYA KAK+IKN+PQLG+++MKD+ +K++++
Sbjct: 371 QDSLGGNTKTALIATISPAKINADETSSTLEYAAKAKNIKNRPQLGALMMKDILVKNISS 430

Query: 421 ELAKIKRDLTSTKQKDGVYMTQNHYKDLTNDLESYKTEIQECDRIVKSLELQNALLLKDK 480
           ELAKIK D  STK KDG+YM+  HY+++ NDLE+ +TEIQE  R ++SL  QN LLLKDK
Sbjct: 431 ELAKIKSDFLSTKSKDGIYMSHEHYQEIVNDLENCQTEIQESKRQIESLTSQNNLLLKDK 490

Query: 481 KASNEVNKLQELNLNEMTNTLSNIQTTLEIQHKKEQILVEELAHSREKSLKMKTVIKEYS 540
           KAS EV +LQ   + ++ +T+  +   +E QH  E  L   +   +E    M+  +K Y 
Sbjct: 491 KASQEVTELQNSKIKKLQSTIEYLYDKIERQHHNETELATTIHKLKEALHTMQGSLKSYE 550

Query: 541 EKEERIQSNMKSIF----NDXXXXXXXXXXXXXXGIAKENLIVQTNVKDNIKLIKDDVI- 595
             E R+Q+++K +                      +  +NL ++ N+ +NI  I DD + 
Sbjct: 551 THELRLQNDIKEVLYQGITSYRESMNQHLEKVKVSMLDKNLSIKENI-NNITTIFDDTLK 609

Query: 596 SIVTESQELSKKLFLEFSQQIIKETP-LILEMFSSDVKKNQELNETYFANLFENLESIKQ 654
           S+     ++   L      ++IKETP + L+ F+  V   +    +Y   L   L  I +
Sbjct: 610 SVEANGSDMCDTLV-----KLIKETPSMYLKEFNETVSSLKSELSSYSNALTNKLTEISE 664

Query: 655 QYSKLNEYFSNDFFKSNHVTIVNDHVNTTKAIIEKSVSDIFKQFQQNMEAFAEQNEKLIL 714
           + + L EY     FK++   +++  + +    ++     +  +    + A  E++  L++
Sbjct: 665 ENNHLREYLDQHLFKNSTQEVLDLRMESVYQKVKNDSDQLLSKLVSMVGAHVEESRTLMV 724

Query: 715 ENLKTVSSDLIQNEMNSFKEHKSEWDISFKKINHCDYLNNSYHDQMHTYLRNMK----GK 770
            ++K   +++I NE + F+  +  W  S   IN CD  + ++  +  + L  +K      
Sbjct: 725 NSMKDTVNEIIDNERSLFQPIRDRWIASCDNINQCDASHQNFEAKSTSGLDKLKELSDAS 784

Query: 771 LQSSDEIIKKHMNQIKSNVDSLNSTPKLLNTDRAIGDNYNQIISKRDKLHDHL 823
           L+SS++ +    N+ K   DS +   + L  D+++    + I  K   L DH 
Sbjct: 785 LKSSEDAV----NKAKHRTDSFHDFVQKLCCDQSLKKQMHDISDKHRMLEDHF 833

>Kpol_1032.6 s1032 (9109..12123) [3015 bp, 1004 aa] {ON}
           (9109..12123) [3015 nt, 1005 aa]
          Length = 1004

 Score =  637 bits (1642), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 323/619 (52%), Positives = 450/619 (72%)

Query: 237 SIYIQNLEEFHIKNAREGIQLLQKGLKYRQVASTKMNDVSSRSHTIFTINLYKEHKGEIF 296
            IYIQNL+EFHI +A+EGI+LLQ+GL+YRQVASTKMND SSRSHTIFTINLYKEH G+IF
Sbjct: 302 GIYIQNLKEFHITSAKEGIELLQRGLQYRQVASTKMNDFSSRSHTIFTINLYKEHDGKIF 361

Query: 297 KISKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSIADKNIHIPFRESKL 356
           +ISKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINS+ADKNIHIPFRESKL
Sbjct: 362 RISKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLADKNIHIPFRESKL 421

Query: 357 TRLLQDSLGGNTKTALIATISPAKLNAEETCSTLEYATKAKSIKNKPQLGSIIMKDVRLK 416
           TRLLQDSLGGNTKTALIATISPAKLN+EETCSTLEYA KAKSIKNKPQLGSII KD+ +K
Sbjct: 422 TRLLQDSLGGNTKTALIATISPAKLNSEETCSTLEYAAKAKSIKNKPQLGSIITKDILVK 481

Query: 417 DLNNELAKIKRDLTSTKQKDGVYMTQNHYKDLTNDLESYKTEIQECDRIVKSLELQNALL 476
           ++ +ELAK+K DL STK +DGVYM+Q HYK+LTNDLESYKTE+QEC R++  L  QN LL
Sbjct: 482 NIASELAKVKADLLSTKSRDGVYMSQIHYKELTNDLESYKTEVQECKRVIDGLTTQNGLL 541

Query: 477 LKDKKASNEVNKLQELNLNEMTNTLSNIQTTLEIQHKKEQILVEELAHSREKSLKMKTVI 536
           LKDKKASNEV+ LQ++ L  M +++S++  ++E QH+KEQ LV+ +   + KS++M+  I
Sbjct: 542 LKDKKASNEVHNLQKIKLQSMKDSISHLHDSIEKQHRKEQTLVDLILKLKSKSIEMQATI 601

Query: 537 KEYSEKEERIQSNMKSIFNDXXXXXXXXXXXXXXGIAKENLIVQTNVKDNIKLIKDDVIS 596
           K +SE+E+  Q+ MK IFN+               I K+ +I  T++  NI+ IKD+V S
Sbjct: 602 KYHSEREQVTQAKMKQIFNEELLRLKSLLIENLERINKKIVINNTDLGMNIEKIKDEVKS 661

Query: 597 IVTESQELSKKLFLEFSQQIIKETPLILEMFSSDVKKNQELNETYFANLFENLESIKQQY 656
           I+  +Q  +  ++ +  +Q++KE+P++L   + D+ K Q++++ Y   L  ++  +  ++
Sbjct: 662 IIDTTQAEANHVYKDCMEQLMKESPILLGSLNDDIIKMQKISDLYNEQLSISISELNIEH 721

Query: 657 SKLNEYFSNDFFKSNHVTIVNDHVNTTKAIIEKSVSDIFKQFQQNMEAFAEQNEKLILEN 716
           + L +Y +  FFKS+H  I+N+H+  T   I ++ + I +Q +  +E + E++  +I+++
Sbjct: 722 NDLKQYLNGSFFKSDHEEILNEHIEKTYDNIRRASTGIVEQLKTGLELYLEESRNIIIDS 781

Query: 717 LKTVSSDLIQNEMNSFKEHKSEWDISFKKINHCDYLNNSYHDQMHTYLRNMKGKLQSSDE 776
           LK  +SD++++EM  F   K +W+ SF+ IN CD LNN Y   +   L NMK  + S+ +
Sbjct: 782 LKNTTSDIVKSEMELFAPKKKKWEDSFEMINKCDSLNNKYFGDISALLSNMKTSVTSTSD 841

Query: 777 IIKKHMNQIKSNVDSLNSTPKLLNTDRAIGDNYNQIISKRDKLHDHLQISLNSTQNSLLV 836
           ++  H++Q++   D+ + + KL    + IG  + +++ K  KL  HL  S+   ++S+  
Sbjct: 842 LVDDHVSQMRKYTDNTSRSTKLTENSKRIGQQFTEMMEKNSKLESHLNESITMNESSINA 901

Query: 837 FDEICKSIQFAFANYSKTN 855
           FD++ +SI  AF  Y+  N
Sbjct: 902 FDKLSESIHSAFEKYNTAN 920

 Score =  296 bits (758), Expect = 4e-85,   Method: Compositional matrix adjust.
 Identities = 138/191 (72%), Positives = 160/191 (83%), Gaps = 6/191 (3%)

Query: 1   MSADPQKIEDDTDEMNIMVAVRCRGRNKREXXXXXXXXXXXPDVMGSNEISINTSDDIVS 60
           MS DP K   + DE+NI+VAVRCRGRN+RE           PDV GS+EI+INT++D+  
Sbjct: 1   MSLDPDK--GNGDELNIIVAVRCRGRNEREIKAKSSVVVSVPDVAGSSEIAINTTEDV-- 56

Query: 61  GLTAQLNSKTYTVDKVFGPSANQRLIFEEIAEPLFNDFLRGYNCTVLVYGMTSTGKTYTM 120
           G+  Q+NSKTYTVDKVFGPSANQRLIFEE+AEPLFNDF+RGYNCTVLVYGMTSTGKTYTM
Sbjct: 57  GIAGQMNSKTYTVDKVFGPSANQRLIFEEVAEPLFNDFIRGYNCTVLVYGMTSTGKTYTM 116

Query: 121 TGDEKLYKGDLSDSAGIIPRVLFKLFETIEFQSDNYVIKCSFIELYNEELKDLLIDSN-- 178
           TGDE+LY G+LSDSAGIIPRVLFKLF+ +EFQ+D+Y+IKCSFIELYNEELKDLL +    
Sbjct: 117 TGDERLYNGELSDSAGIIPRVLFKLFDAMEFQNDDYIIKCSFIELYNEELKDLLDECQAI 176

Query: 179 NTKLKKLRIFD 189
           N+  KKLRIFD
Sbjct: 177 NSTAKKLRIFD 187

>KNAG0M01130 Chr13 (201705..204557) [2853 bp, 950 aa] {ON} Anc_6.16
           YEL061C
          Length = 950

 Score =  624 bits (1608), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 357/838 (42%), Positives = 518/838 (61%), Gaps = 45/838 (5%)

Query: 13  DEMNIMVAVRCRGRNKREXXXXXXXXXXXPDVMGSNEISINTSDDIVSGLTAQLNSKTYT 72
           D++NI VAVRCRGRNKRE           PDV  + E+SINTS    SG+ AQL +KTYT
Sbjct: 23  DDINITVAVRCRGRNKREIEAKSPIVVTVPDVTTTPEVSINTSGG--SGIEAQLQAKTYT 80

Query: 73  VDKVFGPSANQRLIFEEIAEPLFNDFLRGYNCTVLVYGMTSTGKTYTMTGD-EKLYKGDL 131
           VDKV+GP ++Q+L+FE+ AEPLF+DF+RGYNCT+LVYGMTSTGKTYTMTGD E   +GD+
Sbjct: 81  VDKVYGPDSSQKLVFEDCAEPLFHDFMRGYNCTMLVYGMTSTGKTYTMTGDVEMGAEGDV 140

Query: 132 SDSAGIIPRVLFKLFETIEFQSDNYVIKCSFIELYNEELKDLLID-----SNNTK----- 181
           +  AGI PR+L KLFE ++   D+YV+KCSF+ELYNE+L+DLL +     SN T+     
Sbjct: 141 NGQAGIAPRILVKLFECLQ---DDYVVKCSFVELYNEDLRDLLSEGQDDFSNGTENSSKQ 197

Query: 182 ------LKKLRIFDXXXXXXXXXXXXXXXXXHFISGMDLRKXXXXXXXXXXXXTAIQNGN 235
                  KKLRIFD                 H     D  K                N N
Sbjct: 198 PESLNASKKLRIFDSNNSRSNSPVTNTNNPTHKARS-DYLKKKLKSNRKKSLDDMSLNAN 256

Query: 236 AS-----------IYIQNLEEFHIKNAREGIQLLQKGLKYRQVASTKMNDVSSRSHTIFT 284
           A            IYIQNL++FHI  A+EG+QLLQ+GL+ RQVA+TK+NDVSSRSHTIFT
Sbjct: 257 AGGKTHVPPTQTGIYIQNLKDFHISTAKEGLQLLQRGLQRRQVATTKLNDVSSRSHTIFT 316

Query: 285 INLYKEHKGEIFKISKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSIAD 344
           I LYK+ K +++++SK+NLVDLAGSEN++++GA N RAKE+GSINQSLLTLGRVINS+AD
Sbjct: 317 ITLYKKFKDDLYRLSKINLVDLAGSENVNKAGALNLRAKESGSINQSLLTLGRVINSLAD 376

Query: 345 KNIHIPFRESKLTRLLQDSLGGNTKTALIATISPAKLNAEETCSTLEYATKAKSIKNKPQ 404
           K+ HIPFRESKLTRLLQDSLGGNTKT LIATISPAK+ AEETCSTLEYA+KAK+IKNKPQ
Sbjct: 377 KSAHIPFRESKLTRLLQDSLGGNTKTVLIATISPAKIAAEETCSTLEYASKAKNIKNKPQ 436

Query: 405 LGSIIMKDVRLKDLNNELAKIKRDLTSTKQKDGVYMTQNHYKDLTNDLESYKTEIQECDR 464
           LGS I+KD+ LKD++ EL K++ DL  TK K+G+Y++Q +YK++ +DL+++KTE+ E  R
Sbjct: 437 LGSFIIKDILLKDVSQELIKMRADLWCTKSKEGIYVSQKNYKEMVDDLDNFKTELTELKR 496

Query: 465 IVKSLELQNALLLKDKKASNEVNKLQELNLNEMTNTLSNIQTTLEIQHKKEQILVEELAH 524
              SL  +N LL K+KK+  E     +  L+ + + L ++   L   + +   L E++  
Sbjct: 497 TNDSLVQENELLGKEKKSGAERADSLKSELDNLRSQLKSVTNKLAQTNTQNTKLSEQVTD 556

Query: 525 SREKSLKMKTVIKEYSEKEERIQSNMKSIFNDXXXXXXXXXXXXXXGIAKENLIVQTNVK 584
                 ++K++I+ Y +K E  +   + +  D               +   N      + 
Sbjct: 557 MNRIQTELKSLIEVYQQKHETSKHKFQRLLKDELATLTAKILSQWDTLKNVN-SGNYQIH 615

Query: 585 DNIKLIKDDVISIVTESQELSKKLFLEFSQQIIKETPLILEMFSSDVKKNQELNETYFAN 644
            +I  I+ +V++++  ++E ++ L+      ++KETP I ++ S +V   + + E ++  
Sbjct: 616 THIDSIRGEVMNLLETTKENAETLYKSCIDDLLKETPKIFQLISDNVGDIRGMTEEHYTE 675

Query: 645 LFENLESIKQQYSKLNEYFSNDFFKSNHVTIVNDHVNTTKAIIEKSVSDIFKQFQQNMEA 704
           +  N   + ++++   +Y    FF++NH+ ++  H +   + ++K   D+ +  Q +++ 
Sbjct: 676 MARNFSDLSEEFNTFKQYLDGQFFQNNHIEMIQTHQDIVASNMQKMSDDLLQSVQNSIQN 735

Query: 705 FAEQNEKLILENLKTVSSDLIQNEMNSFKEHKSEWDISFKKINHCDYLNNSYH------- 757
           +   N +++  ++  V+ D+I  EM+ F   KS+W+ S   IN  D L+N +        
Sbjct: 736 YLSTNAQMVTNSINDVAMDVINKEMDLFAPKKSKWEESIDLINQSDSLSNKFRNNMTKSV 795

Query: 758 DQMHTYLRNMKGKLQSSDEIIKKHM--NQIKSNVDSLNSTPKLLNTDRAIGDNYNQII 813
           D + + +RN    +  S   IKKH+  N I S  + +NS   L N+ +AI +  N I+
Sbjct: 796 DDIASVIRNSNESMDRSISTIKKHIIENDINSQ-EQINSNELLTNSFKAIQEKSNNIL 852

>ZYRO0C07898g Chr3 complement(600676..603600) [2925 bp, 974 aa] {ON}
           some similarities with uniprot|P27895 Saccharomyces
           cerevisiae YEL061C CIN8 Kinesin motor protein involved
           in mitotic spindle assembly and chromosome segregation
          Length = 974

 Score =  567 bits (1462), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 293/626 (46%), Positives = 435/626 (69%), Gaps = 7/626 (1%)

Query: 236 ASIYIQNLEEFHIKNAREGIQLLQKGLKYRQVASTKMNDVSSRSHTIFTINLYKEHKGEI 295
           + +YIQNL++FHI +AR+G+QLLQKGL+ RQVA+TKMND SSRSHTIFTI LY+EH+GE+
Sbjct: 275 SGVYIQNLQDFHITSARDGLQLLQKGLRNRQVATTKMNDFSSRSHTIFTITLYREHQGEM 334

Query: 296 FKISKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSIADKNIHIPFRESK 355
           FK+SKMNLVDLAGSENISRSGAQ+QRAKEAGSINQSLLTLGRVINS+ADK+ H+PFRESK
Sbjct: 335 FKVSKMNLVDLAGSENISRSGAQHQRAKEAGSINQSLLTLGRVINSLADKSAHVPFRESK 394

Query: 356 LTRLLQDSLGGNTKTALIATISPAKLNAEETCSTLEYATKAKSIKNKPQLGSIIMKDVRL 415
           LTRLLQDSLGGNTKTALIATISPAK+N+EETCSTL+YA+KAK+IKN+PQL S IMKD+ +
Sbjct: 395 LTRLLQDSLGGNTKTALIATISPAKINSEETCSTLQYASKAKNIKNRPQLRSFIMKDILV 454

Query: 416 KDLNNELAKIKRDLTSTKQKDGVYMTQNHYKDLTNDLESYKTEIQECDRIVKSLELQNAL 475
           K++  ELAK+K DL STK ++GVYM+Q++YK++TNDLESYKTEIQE  RI++ L  QN+L
Sbjct: 455 KNITAELAKVKSDLLSTKLREGVYMSQDNYKEITNDLESYKTEIQESKRIIERLSSQNSL 514

Query: 476 LLKDKKASNEVNKLQELNLNEMTNTLSNIQTTLEIQHKKEQILVEELAHSREKSLKMKTV 535
           LLKDKKASNEVN+LQ + L  M + +S +   LE QHKKEQ LV+   + +      ++V
Sbjct: 515 LLKDKKASNEVNELQRIKLQNMKDVMSGLSEKLESQHKKEQELVDMTCNLKSTLSLTQSV 574

Query: 536 IKEYSEKEERIQSNMKSIFNDXXXXXXXXXXXXXXGIA---KENLIV----QTNVKDNIK 588
           IKEY ++E++I   M+ I                  I      N I+    Q  ++ N+ 
Sbjct: 575 IKEYGQREKQISERMQMILGQEFLQFRQMLVNNIEDIRTNHSGNDILHEGEQNGIQQNLN 634

Query: 589 LIKDDVISIVTESQELSKKLFLEFSQQIIKETPLILEMFSSDVKKNQELNETYFANLFEN 648
           +++ +V+ ++  +Q+ ++K++ ++ ++I++E P + +  S+ V + +    TY   L EN
Sbjct: 635 VLRQEVVELLGLAQKRAEKMYKDWIEKILEEAPTVFQAISNKVDQVEVTVNTYHQRLTEN 694

Query: 649 LESIKQQYSKLNEYFSNDFFKSNHVTIVNDHVNTTKAIIEKSVSDIFKQFQQNMEAFAEQ 708
           L  I + Y+ L +YF++ FFK+NH  ++N H++ T   ++ S   + ++F+Q M+   + 
Sbjct: 695 LSDISEGYNNLKQYFNDHFFKNNHEEVLNSHIDKTYQQLQFSADGLLQKFKQMMDDHLKD 754

Query: 709 NEKLILENLKTVSSDLIQNEMNSFKEHKSEWDISFKKINHCDYLNNSYHDQMHTYLRNMK 768
           N+ L++++L++ +++ I  EM  F+  + +W+ SF  IN+CD ++N ++  M + L ++K
Sbjct: 755 NKTLMMKSLQSATTEAIDKEMQLFEPQRKKWEESFDLINNCDSISNGFNGDMRSALSDIK 814

Query: 769 GKLQSSDEIIKKHMNQIKSNVDSLNSTPKLLNTDRAIGDNYNQIISKRDKLHDHLQISLN 828
               SS ++I + ++++K  V        +L+ +  +      II+K   L + L  S+ 
Sbjct: 815 STFGSSTDVISRSVSKVKDEVKGYEDASTILDGNEVVKRQIADIINKDSSLRNGLYKSIK 874

Query: 829 STQNSLLVFDEICKSIQFAFANYSKT 854
           S+Q  +  FDE+ + I+   A+ + T
Sbjct: 875 SSQGHISAFDELKERIRNTIASENST 900

 Score =  285 bits (729), Expect = 2e-81,   Method: Compositional matrix adjust.
 Identities = 130/190 (68%), Positives = 158/190 (83%), Gaps = 3/190 (1%)

Query: 1   MSADPQKIEDDTDEMNIMVAVRCRGRNKREXXXXXXXXXXXPDVMGSNEISINTSDDIVS 60
           M + P    +D +E+NI VAVR RGRN+RE           PDVMGS+E++INT+DD+  
Sbjct: 1   MGSSPAGGGEDAEELNITVAVRSRGRNEREIRAKSSVVVSVPDVMGSHEVAINTTDDV-- 58

Query: 61  GLTAQLNSKTYTVDKVFGPSANQRLIFEEIAEPLFNDFLRGYNCTVLVYGMTSTGKTYTM 120
           G+TAQ+NSKTY VDKVFGPSANQ+LIF+EIAEPLF DFL+GYNCTVLVYGMTSTGKTYTM
Sbjct: 59  GITAQMNSKTYAVDKVFGPSANQQLIFKEIAEPLFGDFLKGYNCTVLVYGMTSTGKTYTM 118

Query: 121 TGDEKLYKGDLSDSAGIIPRVLFKLFETIEFQSDNYVIKCSFIELYNEELKDLLIDS-NN 179
           TGDEKLY  +LSDSAGIIPR+LFKLFET++ + ++YV+KCSF+ELYNEELKDLL DS  N
Sbjct: 119 TGDEKLYNDELSDSAGIIPRILFKLFETLDLRDEDYVVKCSFVELYNEELKDLLDDSVEN 178

Query: 180 TKLKKLRIFD 189
           + ++KLRI+D
Sbjct: 179 SSMRKLRIYD 188

>NCAS0H00880 Chr8 complement(160883..163897) [3015 bp, 1004 aa] {ON}
           Anc_6.16
          Length = 1004

 Score =  566 bits (1460), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 314/709 (44%), Positives = 467/709 (65%), Gaps = 16/709 (2%)

Query: 237 SIYIQNLEEFHIKNAREGIQLLQKGLKYRQVASTKMNDVSSRSHTIFTINLYKEHKGEIF 296
            IYIQNL+EFHI NA+EG+ LLQKGLK+RQVASTKMND SSRSHTIFTI LYKEHK  +F
Sbjct: 300 GIYIQNLQEFHITNAKEGLSLLQKGLKHRQVASTKMNDFSSRSHTIFTITLYKEHKDNLF 359

Query: 297 KISKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSIADKNIHIPFRESKL 356
           ++SKMNLVDLAGSENI+RSGA NQRAKE GSINQSLLTLGRVINS+ADK+ H+PFRESKL
Sbjct: 360 RLSKMNLVDLAGSENINRSGAMNQRAKETGSINQSLLTLGRVINSLADKSPHVPFRESKL 419

Query: 357 TRLLQDSLGGNTKTALIATISPAKLNAEETCSTLEYATKAKSIKNKPQLGSIIMKDVRLK 416
           TRLLQDSLGGNTKTALIATISPAK+ +EETCSTLEYA+KAK+IKNKPQLGS+I+KD+ LK
Sbjct: 420 TRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIKNKPQLGSVILKDILLK 479

Query: 417 DLNNELAKIKRDLTSTKQKDGVYMTQNHYKDLTNDLESYKTEIQECDRIVKSLELQNALL 476
           ++ +ELAK+K DL STK KDG+YM+  HY++L  +LES KTE+QE  R+++ L  QN++L
Sbjct: 480 NITSELAKVKSDLMSTKSKDGIYMSHEHYQELIMELESSKTEVQESKRMIEKLSSQNSML 539

Query: 477 LKDKKASNEVNKLQELNLNEMTNTLSNIQTTLEIQHKKEQILVEELAHSREKSLKMKTVI 536
           LKDK+++NEVN+LQ + LN + +++SN+   LEIQ+ KE  L+E++    +   K+ +++
Sbjct: 540 LKDKRSANEVNELQRIKLNNLKDSMSNLNEKLEIQNGKETKLMEQIGQLEKSREKLNSLV 599

Query: 537 KEYSEKEERIQSNMKSIFNDXXXXXXXXXXXXXXGIAKENLIVQTNVKDNIKLIKDDVIS 596
           K Y  K+ ++++ + +I N+               I +       +V+ N+K+IKD++ S
Sbjct: 600 KNYQTKQSQLKTQISNILNENLFELKKILNSHKDAIRQSE--GNFDVEMNLKVIKDEITS 657

Query: 597 IVTESQELSKKLFLEFSQQIIKETPLILEMFSSDVKKNQELNETYFANLFENLESIKQQY 656
           ++ ++Q  ++ ++ EF ++ +++TP+ L+     V + + +   Y+  + ENL  I ++Y
Sbjct: 658 MLEKTQHKTEMMYKEFIEEFLEQTPINLQKIFEHVTQVEFMVTGYYNEITENLSDISEEY 717

Query: 657 SKLNEYFSNDFFKSNHVTIVNDHVNTTKAIIEKSVSDIFKQFQQNMEAFAEQNEKLILEN 716
           + L +Y  NDFF++NH  ++N H+N T  I+ +S +++F +F+  M+A   +N+KL+++N
Sbjct: 718 NNLKQYLDNDFFQNNHEDLLNIHINATSDILAQSSAELFNKFKIMMDAHLMENKKLMIDN 777

Query: 717 LKTVSSDLIQNEMNSFKEHKSEWDISFKKINHCDYLNNSYHDQMHTYLRNMKGKLQSSDE 776
            +T ++D+I  EM  FK  +++W+ S + IN CD +NN +H  M   +  +K  L SS  
Sbjct: 778 FRTATNDVITKEMELFKPKRNKWEESIELINRCDSINNGFHHNMTGQVSKIKTNLASSSS 837

Query: 777 IIKKHMNQIKSNV-----DSLNSTPKLLNTDRAIGDNYNQIISKRDKLHDHLQISLNSTQ 831
            I   +  IKS V     +  +     L  D     ++N+II K   L  + + ++N T 
Sbjct: 838 SIHNAIASIKSQVLEQLSNDDSDVKTALENDPMFNKHFNEIIEKNMILQKNRKNAINYTD 897

Query: 832 NSLLVFDEICKSIQFAFANYSKTNLQESALLKGRLFADIDPLNDT--NLNKQESLTFDKG 889
            SLL  DE+ ++++ A  N     + + A+  G    D  P   T   L    S +    
Sbjct: 898 KSLLNIDELSETVKIALNNI----VDDVAITDG---DDNSPGTKTKSKLRPLRSASQLLI 950

Query: 890 DAKLTKENNEDMSSKDENKLNNQNVTLIGLKRSHMDLNDSDSPLKSRRI 938
           ++   KEN        E+KL N N  ++ ++     L+++D  L S++I
Sbjct: 951 NSNQNKENGVRGIDVTESKLGNSNSQILKIRSKRKQLDENDGNLASKKI 999

 Score =  246 bits (629), Expect = 1e-67,   Method: Compositional matrix adjust.
 Identities = 122/199 (61%), Positives = 153/199 (76%), Gaps = 21/199 (10%)

Query: 9   EDDTDEMNIMVAVRCRGRNKREXXXXXXXXXXXPDVMGSNEISINTSDDIVSGLTAQLNS 68
           E+DT E+NI VAVRCRGRN+RE           PD+ G+ EISINT+ +  +G+TAQ+NS
Sbjct: 24  EEDT-ELNITVAVRCRGRNEREINSKSPVVVTVPDITGAQEISINTTGE--TGITAQMNS 80

Query: 69  KTYTVDKVFGPSANQRLIFEEIAEPLFNDFLRGYNCTVLVYGMTSTGKTYTMTGDEKLYK 128
           KTYTVDKVFGP+A+Q LIF+E+AEPLF DF++GYNCTVLVYGMTSTGKTYTMTGDEKLY+
Sbjct: 81  KTYTVDKVFGPAADQDLIFQEVAEPLFRDFVKGYNCTVLVYGMTSTGKTYTMTGDEKLYQ 140

Query: 129 GD--LSDSAGIIPRVLFKLFETIE--------FQSDNYVIKCSFIELYNEELKDLL-IDS 177
               LSD+AGIIPR+LFKLF+T++          + ++V+KCSF+ELYNE+LKDLL  DS
Sbjct: 141 NGTMLSDAAGIIPRILFKLFDTLDNHRHSDVTGSTTDFVVKCSFVELYNEDLKDLLNYDS 200

Query: 178 NNTKL-------KKLRIFD 189
           N+ +        +KLRIFD
Sbjct: 201 NDEQQQQQQLGSRKLRIFD 219

>Smik_5.26 Chr5 complement(38891..41899) [3009 bp, 1002 aa] {ON}
           YEL061C (REAL)
          Length = 1002

 Score =  524 bits (1349), Expect = e-170,   Method: Compositional matrix adjust.
 Identities = 281/619 (45%), Positives = 422/619 (68%), Gaps = 6/619 (0%)

Query: 237 SIYIQNLEEFHIKNAREGIQLLQKGLKYRQVASTKMNDVSSRSHTIFTINLYKEHKGEIF 296
            IYIQNL+EFHI NA EG++LLQKGLK+RQVASTKMND SSRSHTIFTI LYK+H+ E+F
Sbjct: 317 GIYIQNLQEFHITNAMEGLKLLQKGLKHRQVASTKMNDFSSRSHTIFTITLYKKHQDELF 376

Query: 297 KISKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSIADKNIHIPFRESKL 356
           +ISKMNLVDLAGSENI+RSGA NQRAKEAGSINQSLLTLGRVIN++ DK+ HIPFRESKL
Sbjct: 377 RISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINALVDKSGHIPFRESKL 436

Query: 357 TRLLQDSLGGNTKTALIATISPAKLNAEETCSTLEYATKAKSIKNKPQLGSIIMKDVRLK 416
           TRLLQDSLGGNTKTALIATISPAK+ +EETCSTLEYA+KAK+IKNKPQLG+ IMKD+ +K
Sbjct: 437 TRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIKNKPQLGAFIMKDILVK 496

Query: 417 DLNNELAKIKRDLTSTKQKDGVYMTQNHYKDLTNDLESYKTEIQECDRIVKSLELQNALL 476
           ++  ELAKIK DL STK K+G+YM Q+HYK+L +DLESYK E+QEC R ++SL  +N+LL
Sbjct: 497 NITMELAKIKSDLLSTKSKEGIYMNQDHYKNLNSDLESYKNEVQECKREIESLTSKNSLL 556

Query: 477 LKDKKASNEVNKLQELNLNEMTNTLSNIQTTLEIQHKKEQILVEELAHSREKSLKMKTVI 536
           +K+K  S E  + Q   +  +  T+ +++T L+ QHK E  +    +  ++ +  M+  +
Sbjct: 557 VKEKLKSKETIQSQNSQIESLKATIDHLRTQLDKQHKTELEISGFNSKLQKLTEVMQMAL 616

Query: 537 KEYSEKEERIQSNMKSIFNDXXXXXXXXXXXXXXGIAKENLIVQTNVKDNIKLIKDDVIS 596
           ++Y  +E  +    ++                   + + N++ +T+++ N+ +IK++V++
Sbjct: 617 QDYKRRELDLNKKFETHITTEIKNMKTTLFSQLSTLQQRNILQETDIQPNLDIIKNEVLT 676

Query: 597 IVTESQELSKKLFLEFSQQIIKETPLILEMFSSDVKKNQELN---ETYFANLFENLESIK 653
           ++   QE ++ ++ +  ++I+ E+P   + F++ V+K   +    E ++ N+ ENL  I 
Sbjct: 677 LMETMQEKAELMYKDCVKKILNESP---KFFNAIVEKIDIIGVDFERFYKNIAENLSDIS 733

Query: 654 QQYSKLNEYFSNDFFKSNHVTIVNDHVNTTKAIIEKSVSDIFKQFQQNMEAFAEQNEKLI 713
           ++ + L +YF+N FF++NH  +++ HV++T   IEK  +   + F++ +    E+N+KLI
Sbjct: 734 EENNNLKQYFTNHFFRNNHQELLSHHVDSTYEKIEKKTNQFVENFKKALNDHLEENKKLI 793

Query: 714 LENLKTVSSDLIQNEMNSFKEHKSEWDISFKKINHCDYLNNSYHDQMHTYLRNMKGKLQS 773
           ++NL T +S +I  EM+ F+  + +W+ SF  IN CD +NN +++ M T L  +K  + +
Sbjct: 794 MKNLTTTTSAVIDQEMSLFEPKRVKWEHSFDLINECDSMNNEFYNSMATTLSQIKSTVDT 853

Query: 774 SDEIIKKHMNQIKSNVDSLNSTPKLLNTDRAIGDNYNQIISKRDKLHDHLQISLNSTQNS 833
           S   + K ++ +K  V+   +   LL  +    D + Q+I+K   L D+++ S+ ST + 
Sbjct: 854 SSNSMNKSISVMKGQVEESENAISLLKNNIKFNDQFKQLINKHTILKDNIESSITSTNSH 913

Query: 834 LLVFDEICKSIQFAFANYS 852
           +   D+I  +I+    NY 
Sbjct: 914 ITNIDDIYNTIEKIMNNYG 932

 Score =  263 bits (672), Expect = 2e-73,   Method: Compositional matrix adjust.
 Identities = 124/186 (66%), Positives = 149/186 (80%), Gaps = 11/186 (5%)

Query: 13  DEMNIMVAVRCRGRNKREXXXXXXXXXXXPDVMGSNEISINTSDDIVSGLTAQLNSKTYT 72
           +E+NI VAVRCRGRN+RE           PD+ GS EISINT+ D  +G+TAQ+N+K YT
Sbjct: 33  EELNITVAVRCRGRNEREISMKSSVVVNVPDITGSKEISINTTGD--TGITAQMNAKRYT 90

Query: 73  VDKVFGPSANQRLIFEEIAEPLFNDFLRGYNCTVLVYGMTSTGKTYTMTGDEKLYKGDLS 132
           VDKVFGP A+Q LIF+E+A PLF DF++GYNCTVLVYGMTSTGKTYTMTGDEKLY G+LS
Sbjct: 91  VDKVFGPGASQDLIFDEVASPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNGELS 150

Query: 133 DSAGIIPRVLFKLFETIEFQSDNYVIKCSFIELYNEELKDLLIDSNNTK---------LK 183
           DSAGIIPRVL KLF+T+E Q ++YV+KCSFIELYNEELKDLL +++N+          +K
Sbjct: 151 DSAGIIPRVLLKLFDTLELQQNDYVVKCSFIELYNEELKDLLDNNSNSSSNNGFDGQFMK 210

Query: 184 KLRIFD 189
           KLRIFD
Sbjct: 211 KLRIFD 216

>YEL061C Chr5 complement(36535..39537) [3003 bp, 1000 aa] {ON}
           CIN8Kinesin motor protein involved in mitotic spindle
           assembly and chromosome segregation
          Length = 1000

 Score =  522 bits (1345), Expect = e-170,   Method: Compositional matrix adjust.
 Identities = 279/617 (45%), Positives = 417/617 (67%), Gaps = 2/617 (0%)

Query: 237 SIYIQNLEEFHIKNAREGIQLLQKGLKYRQVASTKMNDVSSRSHTIFTINLYKEHKGEIF 296
            IYIQNL+EFHI NA EG+ LLQKGLK+RQVASTKMND SSRSHTIFTI LYK+H+ E+F
Sbjct: 315 GIYIQNLQEFHITNAMEGLNLLQKGLKHRQVASTKMNDFSSRSHTIFTITLYKKHQDELF 374

Query: 297 KISKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSIADKNIHIPFRESKL 356
           +ISKMNLVDLAGSENI+RSGA NQRAKEAGSINQSLLTLGRVIN++ DK+ HIPFRESKL
Sbjct: 375 RISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINALVDKSGHIPFRESKL 434

Query: 357 TRLLQDSLGGNTKTALIATISPAKLNAEETCSTLEYATKAKSIKNKPQLGSIIMKDVRLK 416
           TRLLQDSLGGNTKTALIATISPAK+ +EETCSTLEYA+KAK+IKNKPQLGS IMKD+ +K
Sbjct: 435 TRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIKNKPQLGSFIMKDILVK 494

Query: 417 DLNNELAKIKRDLTSTKQKDGVYMTQNHYKDLTNDLESYKTEIQECDRIVKSLELQNALL 476
           ++  ELAKIK DL STK K+G+YM+Q+HYK+L +DLESYK E+QEC R ++SL  +NALL
Sbjct: 495 NITMELAKIKSDLLSTKSKEGIYMSQDHYKNLNSDLESYKNEVQECKREIESLTSKNALL 554

Query: 477 LKDKKASNEVNKLQELNLNEMTNTLSNIQTTLEIQHKKEQILVEELAHSREKSLK-MKTV 535
           +KDK  S E  + Q   +  +  T+ +++  L+ QHK E I + +  +  +K  + M+  
Sbjct: 555 VKDKLKSKETIQSQNCQIESLKTTIDHLRAQLDKQHKTE-IEISDFNNKLQKLTEVMQMA 613

Query: 536 IKEYSEKEERIQSNMKSIFNDXXXXXXXXXXXXXXGIAKENLIVQTNVKDNIKLIKDDVI 595
           + +Y ++E  +    +                    + +E+++ +TN++ N+ +IK++V+
Sbjct: 614 LHDYKKRELDLNQKFEMHITKEIKKLKSTLFLQLNTMQQESILQETNIQPNLDMIKNEVL 673

Query: 596 SIVTESQELSKKLFLEFSQQIIKETPLILEMFSSDVKKNQELNETYFANLFENLESIKQQ 655
           +++   QE ++ ++ +  ++I+ E+P    +    +   +   + ++ N+ ENL  I ++
Sbjct: 674 TLMRTMQEKAELMYKDCVKKILNESPKFFNVVIEKIDIIRVDFQKFYKNIAENLSDISEE 733

Query: 656 YSKLNEYFSNDFFKSNHVTIVNDHVNTTKAIIEKSVSDIFKQFQQNMEAFAEQNEKLILE 715
            + + +Y  N FFK+NH  ++N HV++T   IEK  ++  + F++ +    ++N+KLI++
Sbjct: 734 NNNMKQYLKNHFFKNNHQELLNRHVDSTYENIEKRTNEFVENFKKVLNDHLDENKKLIMQ 793

Query: 716 NLKTVSSDLIQNEMNSFKEHKSEWDISFKKINHCDYLNNSYHDQMHTYLRNMKGKLQSSD 775
           NL T +S +I  EM+ F+  + +W+ SF  IN CD +NN +++ M   L  +K  + +S 
Sbjct: 794 NLTTATSAVIDQEMDLFEPKRVKWENSFDLINDCDSMNNEFYNSMAATLSQIKSTVDTSS 853

Query: 776 EIIKKHMNQIKSNVDSLNSTPKLLNTDRAIGDNYNQIISKRDKLHDHLQISLNSTQNSLL 835
             + + ++ +K  V+   +   LL  +    D + Q+I+K + L D+++ S+ ST + + 
Sbjct: 854 NSMNESISVMKGQVEESENAISLLKNNTKFNDQFEQLINKHNMLKDNIKNSITSTHSHIT 913

Query: 836 VFDEICKSIQFAFANYS 852
             D+I  +I+    NY 
Sbjct: 914 NVDDIYNTIENIMKNYG 930

 Score =  265 bits (677), Expect = 4e-74,   Method: Compositional matrix adjust.
 Identities = 125/187 (66%), Positives = 148/187 (79%), Gaps = 13/187 (6%)

Query: 13  DEMNIMVAVRCRGRNKREXXXXXXXXXXXPDVMGSNEISINTSDDIVSGLTAQLNSKTYT 72
           +E+NI VAVRCRGRN+RE           PD+ GS EISINT+ D  +G+TAQ+N+K YT
Sbjct: 33  EELNITVAVRCRGRNEREISMKSSVVVNVPDITGSKEISINTTGD--TGITAQMNAKRYT 90

Query: 73  VDKVFGPSANQRLIFEEIAEPLFNDFLRGYNCTVLVYGMTSTGKTYTMTGDEKLYKGDLS 132
           VDKVFGP A+Q LIF+E+A PLF DF++GYNCTVLVYGMTSTGKTYTMTGDEKLY G+LS
Sbjct: 91  VDKVFGPGASQDLIFDEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNGELS 150

Query: 133 DSAGIIPRVLFKLFETIEFQSDNYVIKCSFIELYNEELKDLLIDSNNTK----------L 182
           D+AGIIPRVL KLF+T+E Q ++YV+KCSFIELYNEELKDLL DSN+            +
Sbjct: 151 DAAGIIPRVLLKLFDTLELQQNDYVVKCSFIELYNEELKDLL-DSNSNGSSNTGFDGQFM 209

Query: 183 KKLRIFD 189
           KKLRIFD
Sbjct: 210 KKLRIFD 216

>KAFR0L00370 Chr12 (66535..69426) [2892 bp, 963 aa] {ON} Anc_6.16
           YEL061C
          Length = 963

 Score =  515 bits (1327), Expect = e-167,   Method: Compositional matrix adjust.
 Identities = 284/617 (46%), Positives = 409/617 (66%), Gaps = 8/617 (1%)

Query: 236 ASIYIQNLEEFHIKNAREGIQLLQKGLKYRQVASTKMNDVSSRSHTIFTINLYKEHKGEI 295
           A IYIQNL+EFHI  A+EGI+LLQKGLKYRQVASTKMND SSRSHTIFTI L+KE KGEI
Sbjct: 288 AGIYIQNLQEFHITTAKEGIKLLQKGLKYRQVASTKMNDFSSRSHTIFTITLFKEVKGEI 347

Query: 296 FKISKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSIADKNIHIPFRESK 355
           F++SKMNLVDLAGSENI+RSGA NQRAKEAGSINQSLLTLGRVINS+ADKN+H+PFRESK
Sbjct: 348 FRLSKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINSLADKNVHVPFRESK 407

Query: 356 LTRLLQDSLGGNTKTALIATISPAKLNAEETCSTLEYATKAKSIKNKPQLGSIIMKDVRL 415
           LTRLLQDSLGGNTKTALIATISPAK+  EETCSTLEYA+KAK+IKNKPQLGS IMKD+ L
Sbjct: 408 LTRLLQDSLGGNTKTALIATISPAKVTLEETCSTLEYASKAKNIKNKPQLGSFIMKDILL 467

Query: 416 KDLNNELAKIKRDLTSTKQKDGVYMTQNHYKDLTNDLESYKTEIQECDRIVKSLELQNAL 475
           K++  EL KIK DL STK KDG+YM Q HYK+LT DL++YKTEIQEC R ++SL  QNAL
Sbjct: 468 KNITTELTKIKSDLLSTKSKDGIYMDQQHYKELTTDLQNYKTEIQECKRTIESLTSQNAL 527

Query: 476 LLKDKKASNEVNKLQELNLNEMTNTLSNIQTTLEIQHKKEQILVEELAHSREKSLKMKTV 535
           LLKDK+  NE N+LQ + +  M  ++  +   +E Q   E  L  ++    + + K+  +
Sbjct: 528 LLKDKRTINENNELQRIKIQTMNESMKKLYAKIERQQSIENELDGKIQIFTKTNSKLTKI 587

Query: 536 IKEYSEKEERIQSNMKSIFNDXXXXXXXXXXXXXXGIAKENLIVQTNVKDNIKLIKDDVI 595
           I E   +E  + S  K++ +                   + +     V +N++LIK ++ 
Sbjct: 588 IDEMKNREALVNSKFKTLLDHSLSYVSKKLNYQIENFKDQGINQNFTVDENLQLIKSEMT 647

Query: 596 SIVTESQELSKKLFLEFSQQIIKETPLILEMFSSDVKKNQELNETYFANLFENLESIKQQ 655
           ++++ +++  +K + E   + + +TPL+ +  + +V   + L   Y++ + ENL  + ++
Sbjct: 648 NLLSTARDNFEKFYQECITKFLSDTPLLFDEINDNVLNLKALTSNYYSQIAENLSDLSEE 707

Query: 656 YSKLNEYFSNDFF---KSNHVTIVNDHVNTTKAIIEKSVSDIFKQFQQNMEAFAEQNEKL 712
           Y+   ++ +++F+   K +   ++N ++N T+ +IE S +D+    Q  +      N++L
Sbjct: 708 YNNFKQFITDEFYNQEKGHQHELLNKYINNTQTVIESSSNDVMSTIQNLLNEHLRANKEL 767

Query: 713 ILENLKTVSSDLIQNEMNSFKEHKSEWDISFKKINHCDYLNNSYHDQMHTYLRNMKGKL- 771
           I+ +L  V+++L+ NE++  K   S+W+ S + IN  D LNN ++D + + +  M  K+ 
Sbjct: 768 IINSLSNVTTELMSNELDRLKPKLSKWEESAELINRSDALNNEFNDNVESSMTTMTDKIK 827

Query: 772 QSSDEI---IKKHMNQIKSNVDSLNSTPKLLNTDRAIGDNYNQIISKRDKLHDHLQISLN 828
           Q++D I   IKK     K+N D  +S   +++ +  I +N+  I  K  +LH+ ++    
Sbjct: 828 QTNDSINNNIKKINEHFKTN-DIAHSNNLMIDDNNIIKNNFKSIEEKNSRLHEFVKEGYL 886

Query: 829 STQNSLLVFDEICKSIQ 845
            T  S+   +E+  SI+
Sbjct: 887 VTNESMKKLNELDTSIR 903

 Score =  273 bits (699), Expect = 3e-77,   Method: Compositional matrix adjust.
 Identities = 129/192 (67%), Positives = 157/192 (81%), Gaps = 8/192 (4%)

Query: 1   MSADPQKIEDDTDEMNIMVAVRCRGRNKREXXXXXXXXXXXPDVMGSNEISINTSDDIVS 60
           +S+D Q  E+   E+NI VAVRCRGRN+RE           PD+MGS E++INTS+DI  
Sbjct: 6   VSSDKQPQEE---ELNITVAVRCRGRNQREIDAKSSVVVTVPDIMGSKEVAINTSEDI-- 60

Query: 61  GLTAQLNSKTYTVDKVFGPSANQRLIFEEIAEPLFNDFLRGYNCTVLVYGMTSTGKTYTM 120
           G TAQ+NSKTYTVDKVFGPSA Q LIF+EIAEPLF+DF++GYNCT+LVYGMTSTGKTYTM
Sbjct: 61  GFTAQMNSKTYTVDKVFGPSATQSLIFDEIAEPLFSDFIKGYNCTMLVYGMTSTGKTYTM 120

Query: 121 TGDEKLYKGDLSDSAGIIPRVLFKLFETIEFQSDNYVIKCSFIELYNEELKDLL---IDS 177
           TGDEKLY  +LSDSAGIIPR+LFKLFET+E  ++++++KCSF+ELYNEELKDLL    ++
Sbjct: 121 TGDEKLYNEELSDSAGIIPRILFKLFETLEKLNEDHIVKCSFVELYNEELKDLLHGDCNN 180

Query: 178 NNTKLKKLRIFD 189
           +N   KKLRIFD
Sbjct: 181 DNGNFKKLRIFD 192

>NDAI0D00870 Chr4 complement(195749..198958) [3210 bp, 1069 aa] {ON}
            Anc_6.16
          Length = 1069

 Score =  516 bits (1330), Expect = e-167,   Method: Compositional matrix adjust.
 Identities = 297/705 (42%), Positives = 435/705 (61%), Gaps = 27/705 (3%)

Query: 235  NASIYIQNLEEFHIKNAREGIQLLQKGLKYRQVASTKMNDVSSRSHTIFTINLYKEHKGE 294
            N  IYIQNL+EFHI NA+EG+ LLQKGLKYRQVASTKMND SSRSHTIFTI LYKEH+G 
Sbjct: 344  NNGIYIQNLQEFHISNAKEGLALLQKGLKYRQVASTKMNDFSSRSHTIFTITLYKEHQGT 403

Query: 295  IFKISKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSIADKNIHIPFRES 354
            +F++SKMNLVDLAGSENI+RSGA NQRAKE GSINQSLLTLGRVINS+AD+N HIPFRES
Sbjct: 404  LFRLSKMNLVDLAGSENINRSGAINQRAKETGSINQSLLTLGRVINSLADRNNHIPFRES 463

Query: 355  KLTRLLQDSLGGNTKTALIATISPAKLNAEETCSTLEYATKAKSIKNKPQLGSIIMKDVR 414
            KLTRLLQDSLGGNTKTALIATISPAK+ +EETCSTLEYA+KAK+IKNKPQLGSII KD+ 
Sbjct: 464  KLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIKNKPQLGSIISKDIL 523

Query: 415  LKDLNNELAKIKRDLTSTKQKDGVYMTQNHYKDLTNDLESYKTEIQECDRIVKSLELQNA 474
            LK++  EL+++K DL STK K+G+YM+Q HY+ L N+L+++KTE  E  RI++ L  QNA
Sbjct: 524  LKNITTELSQVKSDLLSTKSKEGIYMSQEHYQKLMNELDNHKTEADESKRIIERLSSQNA 583

Query: 475  LLLKDKKASNEVNKLQELNLNEMTNTLSNIQTTLEIQHKKEQILVEELAHSREKSLKMKT 534
            LLLKDK+ SNEVN+LQ + L++  ++++ +Q  +EIQ+ KEQ+LV  ++  +      K 
Sbjct: 584  LLLKDKRTSNEVNELQRIKLSKFQDSINMLQEKIEIQNGKEQMLVSSVSKLQTSCDTFKK 643

Query: 535  VIKEYSEKEERIQSNMKSIFNDXXXXXXXXXXXXXXGIAKENLIVQTNVKDNIKLIKDDV 594
            +I+ Y  ++  ++S ++ I  D               I   N     ++  N+ +I+++V
Sbjct: 644  MIENYECQQIDVKSKIEQILEDDLLSLRNLLQDHQNKIKTLNSGTDFDIGSNLDMIQNEV 703

Query: 595  ISIVTESQELSKKLFLEFSQQIIKETPLILEMFSSDVKKNQELNETYFANLFENLESIKQ 654
            I ++  +QE ++K + +F +  +K+TP   +    D+       + + A + +NL  I +
Sbjct: 704  IKMLGTTQEKAEKTYKQFIEGFLKQTPENFKKIGEDINDINIKIQNHHAAVAQNLSDISE 763

Query: 655  QYSKLNEYFSNDFFKSNHVTIVNDHVNTTKAIIEKSVSDIFKQFQQNMEAFAEQNEKLIL 714
            +Y+ L +Y + + F++NH  ++N H+N+T   +  S   +F  F+  M    E N  L+L
Sbjct: 764  EYNNLKQYLNENLFQNNHEDLINAHINSTSQTLTNSADVLFNTFKDMMNKHLESNRNLML 823

Query: 715  ENLKTVSSDLIQNEMNSFKEHKSEWDISFKKINHCDYLNNSYHDQMHTYLRNMKGKLQSS 774
             + K  + ++I  EM  F   K +W+ S   IN CD LNN +  ++   L   + K+ +S
Sbjct: 824  NSFKAATDEVINKEMELFIPRKKKWEESIDLINQCDSLNNGFQKEVTDGLSYTRSKITAS 883

Query: 775  DEIIKKHMNQIKSNVDSLNSTPKLLNTDRAIGDN------YNQIISKRDKLHDHLQISLN 828
               +  +  ++K+ + + N     +NT   + DN      +N++  K     D+++ SL 
Sbjct: 884  INQMYDNSTRLKTEMSADNGGYNSINTKNVVEDNQIIRTQFNELARKNSIFQDNVENSLK 943

Query: 829  STQNSLLVFDEICKSIQFAFAN---------------YSKTNLQESALLKGRLFADIDPL 873
                S+   + +  SI+ A  +               + K N +E     G     + P 
Sbjct: 944  CAVASVNNLNHLEDSIKMAVRDTRIKGGPTEGEVGVPFKKENGKEGPTKPG--LQPLQPT 1001

Query: 874  NDTNLNKQESLTF-DKGDAKLTKENNEDMSSKDENKLNNQNVTLI 917
            N+  LN Q+       G      ++N++++ K     N+ NVT+I
Sbjct: 1002 NEIFLNSQQDQQHTTNGHGNYINKDNDNINHKSN---NSGNVTII 1043

 Score =  271 bits (693), Expect = 6e-76,   Method: Compositional matrix adjust.
 Identities = 129/192 (67%), Positives = 159/192 (82%), Gaps = 8/192 (4%)

Query: 4   DPQKIEDDTDEMNIMVAVRCRGRNKREXXXXXXXXXXXPDVMGSNEISINTSDDIVSGLT 63
           DP++ E + +E+NI VAVRCRGRN+RE           PD+ GSNE+SINT+DD+  G+T
Sbjct: 41  DPKEGEQEEEELNITVAVRCRGRNEREIKLKSSVIVTVPDINGSNEVSINTTDDV--GIT 98

Query: 64  AQLNSKTYTVDKVFGPSANQRLIFEEIAEPLFNDFLRGYNCTVLVYGMTSTGKTYTMTGD 123
           AQ+NSKTYTVDKVFGPSANQ+LIF+E+AEPLF DF++GYNCTVLVYGMTSTGKTYTMTGD
Sbjct: 99  AQMNSKTYTVDKVFGPSANQQLIFDEVAEPLFLDFIKGYNCTVLVYGMTSTGKTYTMTGD 158

Query: 124 EKLYKGDLSDSAGIIPRVLFKLFETIEFQSDNYVIKCSFIELYNEELKDLLID------S 177
           EKLY G+LS+SAGIIPR+LFKLF+T+E   ++YV+KCSFIELYNE+LKDLL D      +
Sbjct: 159 EKLYNGELSESAGIIPRILFKLFDTLEMNQEDYVVKCSFIELYNEDLKDLLNDNNNSINN 218

Query: 178 NNTKLKKLRIFD 189
           + + + KLRIFD
Sbjct: 219 SKSNINKLRIFD 230

>Skud_5.28 Chr5 complement(35653..38649) [2997 bp, 998 aa] {ON}
           YEL061C (REAL)
          Length = 998

 Score =  510 bits (1314), Expect = e-165,   Method: Compositional matrix adjust.
 Identities = 269/617 (43%), Positives = 416/617 (67%), Gaps = 2/617 (0%)

Query: 237 SIYIQNLEEFHIKNAREGIQLLQKGLKYRQVASTKMNDVSSRSHTIFTINLYKEHKGEIF 296
            IYIQNL+EFHI NA EG+ LLQ+GLK+RQVASTKMND SSRSHTIFTI LYK+H+ E+F
Sbjct: 313 GIYIQNLQEFHITNALEGLNLLQRGLKHRQVASTKMNDFSSRSHTIFTITLYKKHQDELF 372

Query: 297 KISKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSIADKNIHIPFRESKL 356
           +ISKMNLVDLAGSENI+RSGA NQRAKEAGSINQSLLTLGRVIN++ D++ HIPFRESKL
Sbjct: 373 RISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINALVDRSGHIPFRESKL 432

Query: 357 TRLLQDSLGGNTKTALIATISPAKLNAEETCSTLEYATKAKSIKNKPQLGSIIMKDVRLK 416
           TRLLQDSLGGNTKTALIATISPAK+ +EETCSTLEYA+KAK+IKNKPQLG+ +MKD+ +K
Sbjct: 433 TRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIKNKPQLGAFMMKDILVK 492

Query: 417 DLNNELAKIKRDLTSTKQKDGVYMTQNHYKDLTNDLESYKTEIQECDRIVKSLELQNALL 476
           ++  ELAKIK DL STK K+G+YM+Q+HYK+L +DLES+K E+QEC R ++SL  +N+LL
Sbjct: 493 NITMELAKIKSDLLSTKSKEGIYMSQDHYKNLNSDLESHKNEVQECKREIESLASKNSLL 552

Query: 477 LKDKKASNEVNKLQELNLNEMTNTLSNIQTTLEIQHKKEQILVEELAHSREKSLK-MKTV 535
           +KDK  S E  + Q   +  +  T+++++  L+ QHK E + +    +  +K  + M+  
Sbjct: 553 VKDKLKSRETIQSQNSQMESLKATINHLKAQLDKQHKAE-LEISGFNNKLQKMTEVMQVA 611

Query: 536 IKEYSEKEERIQSNMKSIFNDXXXXXXXXXXXXXXGIAKENLIVQTNVKDNIKLIKDDVI 595
           +++Y ++E  +    ++  +                + ++N+  +T+++ N+ ++K++V+
Sbjct: 612 LQDYKKRELDLNKKFETHISKEIKSLKTALFLQLDNMQQKNIFQETDIQPNLDMVKNEVL 671

Query: 596 SIVTESQELSKKLFLEFSQQIIKETPLILEMFSSDVKKNQELNETYFANLFENLESIKQQ 655
           +++   QE ++ ++ +  ++I+ E+P    +    +   +   + ++ N+ ENL  I ++
Sbjct: 672 TLMETMQEKAELMYKDCVKKILNESPKFFNVIVEKIDIIRIEFQNFYKNIAENLSDISEE 731

Query: 656 YSKLNEYFSNDFFKSNHVTIVNDHVNTTKAIIEKSVSDIFKQFQQNMEAFAEQNEKLILE 715
            + L +Y  N FFK+NH  ++N H+++T   IEK  +   + F+  +    E+N+KLI++
Sbjct: 732 NNNLKQYLKNHFFKNNHQELLNHHIDSTYENIEKKTNQFVENFKMTLNDHLEENKKLIMQ 791

Query: 716 NLKTVSSDLIQNEMNSFKEHKSEWDISFKKINHCDYLNNSYHDQMHTYLRNMKGKLQSSD 775
           N+   +S +I  EM+ F+  +++W+ SF  IN CD +NN +++ M   L  +K  + +S 
Sbjct: 792 NMTNATSAVIDQEMDLFEPRRAKWENSFDLINKCDSMNNEFYNNMAATLSQIKKTVDTSS 851

Query: 776 EIIKKHMNQIKSNVDSLNSTPKLLNTDRAIGDNYNQIISKRDKLHDHLQISLNSTQNSLL 835
             + + ++ +K  V+   +   LL  +    D + Q+ISK   L D+++ S+ ST + + 
Sbjct: 852 NSMNESISVMKGQVEESENAISLLKNNTKFNDQFKQLISKHIILKDNIESSITSTHSHIT 911

Query: 836 VFDEICKSIQFAFANYS 852
             D+I  +I+    N+ 
Sbjct: 912 NVDDIYNTIEDIMTNHG 928

 Score =  260 bits (664), Expect = 2e-72,   Method: Compositional matrix adjust.
 Identities = 122/186 (65%), Positives = 147/186 (79%), Gaps = 11/186 (5%)

Query: 13  DEMNIMVAVRCRGRNKREXXXXXXXXXXXPDVMGSNEISINTSDDIVSGLTAQLNSKTYT 72
           +E+NI VAVRCRGRN+RE           PD+ GS E+SINT+ D  +G+TAQ+N+K YT
Sbjct: 35  EELNITVAVRCRGRNEREIGMKSSVVVNVPDITGSKEVSINTTGD--TGITAQMNAKRYT 92

Query: 73  VDKVFGPSANQRLIFEEIAEPLFNDFLRGYNCTVLVYGMTSTGKTYTMTGDEKLYKGDLS 132
           VDKVFGP A+Q LIFEE+A PLF DF++GYNCTVLVYGMTSTGKTYTMTGDEKLY G+L+
Sbjct: 93  VDKVFGPGASQDLIFEEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNGELN 152

Query: 133 DSAGIIPRVLFKLFETIEFQSDNYVIKCSFIELYNEELKDLLIDSNNTK---------LK 183
           D+AGIIPRVL KLF+T+E Q  +YV+KCSFIELYNEELKDLL +++N           +K
Sbjct: 153 DAAGIIPRVLLKLFDTLELQQSDYVVKCSFIELYNEELKDLLDNNSNGSSNNGFDGQFMK 212

Query: 184 KLRIFD 189
           KLRIFD
Sbjct: 213 KLRIFD 218

>Suva_5.6 Chr5 complement(12298..15297) [3000 bp, 999 aa] {ON}
           YEL061C (REAL)
          Length = 999

 Score =  502 bits (1293), Expect = e-162,   Method: Compositional matrix adjust.
 Identities = 279/617 (45%), Positives = 417/617 (67%), Gaps = 2/617 (0%)

Query: 237 SIYIQNLEEFHIKNAREGIQLLQKGLKYRQVASTKMNDVSSRSHTIFTINLYKEHKGEIF 296
            IYIQNL+EFHI NA EG+ LLQ+GLK+RQVASTKMND SSRSHTIFTI LYK+H+ E+F
Sbjct: 314 GIYIQNLQEFHITNAMEGLNLLQRGLKHRQVASTKMNDFSSRSHTIFTITLYKKHQDELF 373

Query: 297 KISKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSIADKNIHIPFRESKL 356
           +ISKMNLVDLAGSENI+RSGA NQRAKEAGSINQSLLTLGRVIN++ADK+ HIPFRESKL
Sbjct: 374 RISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINALADKSGHIPFRESKL 433

Query: 357 TRLLQDSLGGNTKTALIATISPAKLNAEETCSTLEYATKAKSIKNKPQLGSIIMKDVRLK 416
           TRLLQDSLGGNTKTALIATISPAK+ +EETCSTLEYA+KAK+IKNKPQLG+ IMKD+ +K
Sbjct: 434 TRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIKNKPQLGAFIMKDILVK 493

Query: 417 DLNNELAKIKRDLTSTKQKDGVYMTQNHYKDLTNDLESYKTEIQECDRIVKSLELQNALL 476
           ++  ELAKIK DL STK K+G+YM+Q+HYK+L +DLESYK E+QEC R ++SL  +N+LL
Sbjct: 494 NITMELAKIKSDLLSTKSKEGIYMSQDHYKNLNSDLESYKNEVQECKRDIESLSSKNSLL 553

Query: 477 LKDKKASNEVNKLQELNLNEMTNTLSNIQTTLEIQHKKEQILVEELAHSREKSLK-MKTV 535
           LKDK  S +  + Q   +  +  T++ ++  L+ QHK E + +    +  +K  + M+  
Sbjct: 554 LKDKLKSKDTIQSQNSQMESLKLTINQLKAQLDKQHKTE-LEISGFNNKLQKLTEIMQLA 612

Query: 536 IKEYSEKEERIQSNMKSIFNDXXXXXXXXXXXXXXGIAKENLIVQTNVKDNIKLIKDDVI 595
           +++Y  +E  +    ++  +               G+ + N+  +TN++ N+ +IK++V+
Sbjct: 613 LQDYKRRELDLNKKFETHISKEIKSLKTTLFSQLSGMEQNNISQETNIQPNLDIIKNEVL 672

Query: 596 SIVTESQELSKKLFLEFSQQIIKETPLILEMFSSDVKKNQELNETYFANLFENLESIKQQ 655
           +++   QE ++ ++ +  ++I+ E+P    +    +   +   + ++ N+ ENL  I ++
Sbjct: 673 TLMETMQEKAELMYKDCVKKILNESPKFFNVIVEKIDIIRVDFQRFYNNIAENLSDISEE 732

Query: 656 YSKLNEYFSNDFFKSNHVTIVNDHVNTTKAIIEKSVSDIFKQFQQNMEAFAEQNEKLILE 715
            + L +Y  N FFK+NH  ++N H+++T   IEK  S+  + F+  +    E+N+KLI++
Sbjct: 733 NNNLKQYLKNHFFKNNHQELLNHHIDSTYEDIEKKTSEFVENFKNTLNDHLEENKKLIMQ 792

Query: 716 NLKTVSSDLIQNEMNSFKEHKSEWDISFKKINHCDYLNNSYHDQMHTYLRNMKGKLQSSD 775
           NL   +S +I  EM+ F+  + +W+ SF  IN CD +NN +++ M T L  +K  + +S 
Sbjct: 793 NLTNATSAVINQEMDLFEPKRVKWENSFDLINKCDSMNNEFYNNMATTLSQIKNTVDTSS 852

Query: 776 EIIKKHMNQIKSNVDSLNSTPKLLNTDRAIGDNYNQIISKRDKLHDHLQISLNSTQNSLL 835
             + K ++ +K  V+   +   LL  ++   D + Q+++K   L D+++ S+ ST + + 
Sbjct: 853 NSMNKSISVMKGQVEESENAVSLLKNNKKFNDQFKQLVNKHTILKDNIENSITSTHSHIT 912

Query: 836 VFDEICKSIQFAFANYS 852
             D+I  +I+    NY 
Sbjct: 913 NIDDIYDTIENIMKNYG 929

 Score =  260 bits (665), Expect = 2e-72,   Method: Compositional matrix adjust.
 Identities = 122/186 (65%), Positives = 148/186 (79%), Gaps = 11/186 (5%)

Query: 13  DEMNIMVAVRCRGRNKREXXXXXXXXXXXPDVMGSNEISINTSDDIVSGLTAQLNSKTYT 72
           +E+NI VAVRCRGRN+RE           PD+ GS E+SINT+ D  +G+TAQ+N+K YT
Sbjct: 33  EELNITVAVRCRGRNEREIGMKSSVVVNVPDITGSEEVSINTTGD--TGITAQMNAKRYT 90

Query: 73  VDKVFGPSANQRLIFEEIAEPLFNDFLRGYNCTVLVYGMTSTGKTYTMTGDEKLYKGDLS 132
           VDKVFGP A+Q LIF+E+A PLF DF++GYNCTVLVYGMTSTGKTYTMTGDEKLY G+LS
Sbjct: 91  VDKVFGPGASQDLIFDEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNGELS 150

Query: 133 DSAGIIPRVLFKLFETIEFQSDNYVIKCSFIELYNEELKDLLIDSNNTK---------LK 183
           D+AGIIPRVL KLF+T+E Q ++YV+KCSFIELYNEELKDLL +++N           +K
Sbjct: 151 DAAGIIPRVLLKLFDTLELQQNDYVVKCSFIELYNEELKDLLDNNSNNSSNNGFEGPFMK 210

Query: 184 KLRIFD 189
           KLRIFD
Sbjct: 211 KLRIFD 216

>CAGL0B03641g Chr2 (363897..366863) [2967 bp, 988 aa] {ON} similar
           to uniprot|P27895 Saccharomyces cerevisiae YEL061c CIN8
           Kinesin-like protein
          Length = 988

 Score =  494 bits (1271), Expect = e-159,   Method: Compositional matrix adjust.
 Identities = 263/584 (45%), Positives = 388/584 (66%)

Query: 236 ASIYIQNLEEFHIKNAREGIQLLQKGLKYRQVASTKMNDVSSRSHTIFTINLYKEHKGEI 295
           ASIYIQNLEEFHI +A EG+QLLQKGLK RQVASTKMND SSRSH+IFTI LYKE  GE+
Sbjct: 307 ASIYIQNLEEFHITSAMEGLQLLQKGLKQRQVASTKMNDFSSRSHSIFTITLYKEQNGEL 366

Query: 296 FKISKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSIADKNIHIPFRESK 355
           F++SKMNLVDLAGSENISRSGA NQRAKEAGSINQSLLTLGRVINS+ADK+ HIPFRESK
Sbjct: 367 FRVSKMNLVDLAGSENISRSGAMNQRAKEAGSINQSLLTLGRVINSLADKSEHIPFRESK 426

Query: 356 LTRLLQDSLGGNTKTALIATISPAKLNAEETCSTLEYATKAKSIKNKPQLGSIIMKDVRL 415
           LTRLLQDSLGGNTKTALIATISPAK+ +EETCSTLEYA+KAK+IKNKPQLG+ IMKD+ +
Sbjct: 427 LTRLLQDSLGGNTKTALIATISPAKMTSEETCSTLEYASKAKNIKNKPQLGAFIMKDILV 486

Query: 416 KDLNNELAKIKRDLTSTKQKDGVYMTQNHYKDLTNDLESYKTEIQECDRIVKSLELQNAL 475
           + + +ELAKIK DL STK K+GVYM+  HYKDL  D+E YKTE++E  R ++SL  QNA+
Sbjct: 487 RSITSELAKIKSDLLSTKSKEGVYMSHEHYKDLHYDIECYKTELEESKRAIESLTAQNAM 546

Query: 476 LLKDKKASNEVNKLQELNLNEMTNTLSNIQTTLEIQHKKEQILVEELAHSREKSLKMKTV 535
           L +++ +  + N   + N+  + + +  +Q++L+ Q  KE  +   L   +  + +MK  
Sbjct: 547 LQQERLSLKDDNACYKANIASLKDNVVTLQSSLKEQITKETNIRSLLKDVQGANEEMKKT 606

Query: 536 IKEYSEKEERIQSNMKSIFNDXXXXXXXXXXXXXXGIAKENLIVQTNVKDNIKLIKDDVI 595
           I  +  K++ +Q ++ +  +D               +     +  T +  N+  ++ +V+
Sbjct: 607 IHLFEFKQQELQQSISTFISDEISNIRDTLKKHIEYLQNNGDLKDTEISGNLMRLEKEVV 666

Query: 596 SIVTESQELSKKLFLEFSQQIIKETPLILEMFSSDVKKNQELNETYFANLFENLESIKQQ 655
            ++  ++E + K + E  + ++KETP + E  S  +    +L E   + + E L  + ++
Sbjct: 667 KVIKAAEEEASKSYGECVKMMLKETPRLFESVSGRLDNISKLAEENHSKIAETLSDVSEE 726

Query: 656 YSKLNEYFSNDFFKSNHVTIVNDHVNTTKAIIEKSVSDIFKQFQQNMEAFAEQNEKLILE 715
           Y+ L +Y +N+FFK+NH  +++ HV  T A +E++ + + + F   ++   ++N++ +LE
Sbjct: 727 YNNLKQYLTNNFFKNNHEELLSHHVQNTYAQLEENSAQLMQNFTMMLDKHIQENKRHMLE 786

Query: 716 NLKTVSSDLIQNEMNSFKEHKSEWDISFKKINHCDYLNNSYHDQMHTYLRNMKGKLQSSD 775
           N+  V+ ++I NE+  F E +++W+ S   IN CD +N+S+H  + + L  ++  + SS 
Sbjct: 787 NILGVTDEVINNELQMFGEQRAKWEKSSALINQCDSVNHSFHQALGSNLVEIRDVVSSSR 846

Query: 776 EIIKKHMNQIKSNVDSLNSTPKLLNTDRAIGDNYNQIISKRDKL 819
           + I   ++ I+S   +  S  +++  +  I     +I  K   L
Sbjct: 847 DNIGATISSIQSRTRNRQSIEEMIQGNDVIRQQITRIKQKNKSL 890

 Score =  269 bits (687), Expect = 2e-75,   Method: Compositional matrix adjust.
 Identities = 123/182 (67%), Positives = 151/182 (82%), Gaps = 7/182 (3%)

Query: 12  TDEMNIMVAVRCRGRNKREXXXXXXXXXXXPDVMGSNEISINTSDDIVSGLTAQLNSKTY 71
           T+E+NI+VAVRCRGRN+RE           PD   +NE+SINT+DD+  G+ A++NSKTY
Sbjct: 29  TEELNILVAVRCRGRNEREIKAKSSVVVDVPDNGVTNEVSINTTDDV--GIAAKMNSKTY 86

Query: 72  TVDKVFGPSANQRLIFEEIAEPLFNDFLRGYNCTVLVYGMTSTGKTYTMTGDEKLYKGDL 131
           TVDKVFGPSA+Q+L++EEIAEPLF DF++GYNCT+LVYGMTSTGKTYTMTGDEKL+ G+L
Sbjct: 87  TVDKVFGPSASQKLVYEEIAEPLFQDFIKGYNCTILVYGMTSTGKTYTMTGDEKLHNGEL 146

Query: 132 SDSAGIIPRVLFKLFETIEFQSDNYVIKCSFIELYNEELKDLLIDSNNTKL----KKLRI 187
            D+AGIIPRVLF+LF+T+E   D+Y++KCSF+ELYNEELKDLL DS NT      KKLRI
Sbjct: 147 GDAAGIIPRVLFELFDTLEANKDDYLVKCSFVELYNEELKDLL-DSTNTATNSDNKKLRI 205

Query: 188 FD 189
           FD
Sbjct: 206 FD 207

>Kpol_1045.73 s1045 complement(169347..172235) [2889 bp, 962 aa]
           {ON} complement(169349..172237) [2889 nt, 963 aa]
          Length = 962

 Score =  474 bits (1221), Expect = e-152,   Method: Compositional matrix adjust.
 Identities = 293/895 (32%), Positives = 482/895 (53%), Gaps = 47/895 (5%)

Query: 11  DTDEMNIMVAVRCRGR--NKREXXXXXXXXXXXPDVMGSNEISINTSDDIVSGLTAQLNS 68
           D  E NI V  R +G+  N++            P +     I     DD V         
Sbjct: 9   DKVECNIKVVARFKGQIDNEKGDDVRDQIIIEEPGL-----IKFKGKDDAVK-------- 55

Query: 69  KTYTVDKVFGPSANQRLIFEEIAEPLFNDFLRGYNCTVLVYGMTSTGKTYTMTGDE-KLY 127
           + + +D +F     Q  ++ +  +P+F DF+ GYNC+ LVYG T +GKTYT++G+E  L 
Sbjct: 56  REFGMDHIFSSDVVQEQLYLDSLKPMFQDFINGYNCSTLVYGKTGSGKTYTLSGEEDSLL 115

Query: 128 KGDLSD-SAGIIPRVLFKLFETIEFQSDNYVIKCSFIELYNEELKDLLIDSNNTKL---- 182
             + S  S G+IPRVL +LF+ +   + ++V+KCS++E+YNEELKDLL+D +N+ L    
Sbjct: 116 HSEASRLSVGVIPRVLEELFDHLSCNNIDHVVKCSYVEIYNEELKDLLVDQHNSLLSASI 175

Query: 183 KKLRIFDXXXXXXXXXXXX---XXXXXHFISGMDLRKXXXXXXXXXXXXTAIQNGN---- 235
           KKLRI D                       S   +              TA++  N    
Sbjct: 176 KKLRIVDSGSPNVKNGANSNCNTRDNSPLTSSKSIPTAIIRKKMGRQSLTALKQANTLSI 235

Query: 236 -------------------ASIYIQNLEEFHIKNAREGIQLLQKGLKYRQVASTKMNDVS 276
                               + YIQNLEEFHI NA+EGIQLL +GLK RQ+AS+K    S
Sbjct: 236 SRSNSFNEYSPQRHIQEKTGAPYIQNLEEFHITNAKEGIQLLHRGLKNRQIASSKNQKYS 295

Query: 277 SRSHTIFTINLYKEHKGEIFKISKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLG 336
           SR+ TIFTI LYKE +GEIF++SK N VDLAG+E+  +    NQR K+   INQ +  L 
Sbjct: 296 SRASTIFTIVLYKEEEGEIFRVSKWNFVDLAGAEHSHKIEGTNQRFKDINIINQGIQNLN 355

Query: 337 RVINSIADKNIHIPFRESKLTRLLQDSLGGNTKTALIATISPAKLNAEETCSTLEYATKA 396
           +++NS+ +K   IPF++SKLT L++D+L GN+K+  I T+   K + +E   TLE+  K 
Sbjct: 356 KIVNSLHEKESVIPFKDSKLTYLIKDTLEGNSKSIFILTLRFNKDSLDEMIETLEFGNKV 415

Query: 397 KSIKNKPQLGSIIMKDVRLKDLNNELAKIKRDLTSTKQKDGVYMTQNHYKDLTNDLESYK 456
           +S+K  P LG  I K+  +K ++NELAK+K DL STK K+GVYM+  HY  LT DL+ +K
Sbjct: 416 RSLKCYPLLGPSINKETLIKSISNELAKVKSDLLSTKSKEGVYMSHEHYDVLTKDLDKHK 475

Query: 457 TEIQECDRIVKSLELQNALLLKDKKASNEVNKLQELNLNEMTNTLSNIQTTLEIQHKKEQ 516
            EI +  +++  L  Q+  L KDK+A  EVN++Q + L  M +++S + T +E Q ++E 
Sbjct: 476 VEIMDLKKVIDELNEQSTTLRKDKRAFEEVNEVQRIKLQSMRDSVSMMYTNIEKQQRREH 535

Query: 517 ILVEELAHSREKSLKMKTVIKEYSEKEERIQSNMKSIFNDXXXXXXXXXXXXXXGIAKEN 576
            L+      +E    M   I  Y+++E  +Q+ MK++FN+                 K  
Sbjct: 536 DLINSTDKLKETVNNMNVTIARYTDRESSVQTQMKTLFNEELSKLKSMLLKNLRQFEKNE 595

Query: 577 LIVQTNVKDNIKLIKDDVISIVTESQELSKKLFLEFSQQIIKETPLILEMFSSDVKKNQE 636
           LI    +++N+    +++  I+  S+     LFL+  +++ +E+P +   F  DV + + 
Sbjct: 596 LIDNLEIENNLNKAHEEIKQILQISENEIDSLFLDCIKKMSEESPKLFSSFIQDVSRLEN 655

Query: 637 LNETYFANLFENLESIKQQYSKLNEYFSNDFFKSNHVTIVNDHVNTTKAIIEKSVSDIFK 696
                + NL E L  + ++++ L +Y +  FFK+NH  ++  +VN T   ++KS  D   
Sbjct: 656 STSENYNNLAELLSDVSEEFNNLKQYINEKFFKNNHEELLKTYVNKTYHQVQKSSDDFLL 715

Query: 697 QFQQNMEAFAEQNEKLILENLKTVSSDLIQNEMNSFKEHKSEWDISFKKINHCDYLNNSY 756
           +F   +E++ E N+ ++L+N+K+ +S++I+NEMN F   K +W+ S + I    + +N +
Sbjct: 716 KFNDLLESYLEGNKSVLLQNIKSATSEVIENEMNHFIPQKEKWEKSIELIEKSKHSSNEF 775

Query: 757 HDQMHTYLRNMKGKLQSSDEIIKKHMNQIKSNVDSLNSTPKLLNTDRAIGDNYNQIISKR 816
             +    +  ++  L+ + E +   ++++KS ++ L     ++  +  + + +  I+ K 
Sbjct: 776 KTKNRVIVGKLQDTLKGTSESLFDTLSEMKSKINELQKAANIIENNEVVTEEFISIMKKN 835

Query: 817 DKLHDHLQISLNSTQNSLLVFDEICKSIQFAFANYSKTNLQESALLKGRLFADID 871
             L D L I++ ST+ S++ FD++  SI+  F N   TN+     +   +F  +D
Sbjct: 836 GILKDTLNINMTSTEESIVAFDKLDDSIRNVFKNEIDTNITGYQSILKEIFDQLD 890

>TBLA0A07230 Chr1 (1803117..1806410) [3294 bp, 1097 aa] {ON}
           Anc_6.16 YEL061C
          Length = 1097

 Score =  478 bits (1230), Expect = e-151,   Method: Compositional matrix adjust.
 Identities = 280/633 (44%), Positives = 401/633 (63%), Gaps = 27/633 (4%)

Query: 235 NASIYIQNLEEFHIKNAREGIQLLQKGLKYRQVASTKMNDVSSRSHTIFTINLYKEHKGE 294
           N  IYIQNL+EF+I NA +GI+LLQKGL++R+VASTKMNDVSSRSHTIFTI LYKEH G 
Sbjct: 331 NNQIYIQNLQEFYINNATDGIKLLQKGLRHRKVASTKMNDVSSRSHTIFTITLYKEHNGG 390

Query: 295 IFKISKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSIADKNIHIPFRES 354
           ++++SKMNLVDLAGSENI++SGAQ+QRAKEAGSINQSLLTLGRVINS+ADK+IHIPFRES
Sbjct: 391 LYRVSKMNLVDLAGSENINKSGAQHQRAKEAGSINQSLLTLGRVINSLADKSIHIPFRES 450

Query: 355 KLTRLLQDSLGGNTKTALIATISPAKLNAEETCSTLEYATKAKSIKNKPQLGSIIMKDVR 414
           KLTRLLQDSLGGNTKT LI+TISPAK+N +ET STLEYA+KAK+IKNKP LGS IMKDV 
Sbjct: 451 KLTRLLQDSLGGNTKTVLISTISPAKINVDETSSTLEYASKAKNIKNKPHLGSFIMKDVL 510

Query: 415 LKDLNNELAKIKRDLTSTKQKDGVYMTQNHYKDLTNDLESYKTEIQECDRIVKSLELQNA 474
           LK++  EL KIK DL ST+ KDGVYM+Q HYK+L NDLESYKTE+QE  R  + L  QN 
Sbjct: 511 LKNITTELNKIKSDLMSTRLKDGVYMSQQHYKELNNDLESYKTEVQESKRANERLISQNG 570

Query: 475 LLLKDKKASNEVNKLQELNLNEMTNTLSNIQTTLEIQHKKEQILVEELAHSREKSLKMKT 534
            LLKDKKASNE+N+LQ + + +    +  +   L+  +K+E ILVE +   +     M++
Sbjct: 571 SLLKDKKASNELNELQRIQIEKKNEKIKELYEILDEHYKREDILVELIRQLKNVGTSMQS 630

Query: 535 VIKEYSEKEERIQSNMKSIFNDXXXXXXXXXXXXXXGIAK---ENL-------------I 578
            I+ Y E++  I+ + K I  +               I     +NL             I
Sbjct: 631 TIENYRERDLEIEESTKKILENEFKFLKNELSQILSNINGNIIDNLKSSIISNNSSIEAI 690

Query: 579 VQTNVKDNIKLIKDDVISIVTESQELSKKLFLEFSQQIIKETPLILEMF-----SSDVKK 633
             +N + NI +I++  + I+ + QE S+ ++    ++I+ + P IL  F     S D + 
Sbjct: 691 DSSNFQKNIDIIENTTLKILKQVQEKSQHIYSSCIERILSDIPNILNKFKIEINSIDFQY 750

Query: 634 NQELNETYFANLFENLESIKQQYSKLNEYFSNDFFKSNHVTIVNDHVNTTKAIIEKSVSD 693
           N + N+     + ENL  + ++Y+   EY +N F ++N+  I+ +H+ + ++ IE   ++
Sbjct: 751 NDQFNK-----ITENLSDLSEEYNNFKEYLNNSFLQNNYELILKNHLESGQSQIESFSNN 805

Query: 694 IFKQFQQNMEAFAEQNEKLILENLKTVSSDLIQNEMNSFKEHKSEWDISFKKINHCDYLN 753
           +     + +  F   N KL  E L  + +D+++ E  S K +K +W  S + IN  D +N
Sbjct: 806 LLLNINKQINEFKLHNSKLYEEKLNNIKNDIVKKETESIKPYKEKWVKSIEIINSTDKIN 865

Query: 754 NSYHDQMHTYLRNMKGKLQSSDEIIKKHMNQIKSN-VDSLNSTPKLLNTDRAIGDNYNQI 812
           N++H+ M+  +  +   +  S   I   +N IK N +    +  ++L+++    +N N++
Sbjct: 866 NTFHNDMNNRILQINNLILQSHNDINNSINDIKVNEIRENEAVNEILSSNTEYVNNINEL 925

Query: 813 ISKRDKLHDHLQISLNSTQNSLLVFDEICKSIQ 845
             K     + L+    S++NS+   D   + I+
Sbjct: 926 KIKNMDYQEKLKCIGKSSENSINYLDSTKQVIE 958

 Score =  282 bits (721), Expect = 1e-79,   Method: Compositional matrix adjust.
 Identities = 129/184 (70%), Positives = 152/184 (82%), Gaps = 2/184 (1%)

Query: 6   QKIEDDTDEMNIMVAVRCRGRNKREXXXXXXXXXXXPDVMGSNEISINTSDDIVSGLTAQ 65
           QK     +E+NI VAVRCRGRN+RE           PD+MGSNE+SINTSD++  G+ A 
Sbjct: 2   QKTHTSGEELNITVAVRCRGRNEREVQAKSSVVVSVPDIMGSNEVSINTSDEV--GIAAH 59

Query: 66  LNSKTYTVDKVFGPSANQRLIFEEIAEPLFNDFLRGYNCTVLVYGMTSTGKTYTMTGDEK 125
           +NSKTYTVDKVFGPSA+Q L+F+EIAEPLF DF++GYNCT+LVYGMTSTGKTYTMTGDEK
Sbjct: 60  MNSKTYTVDKVFGPSASQDLMFKEIAEPLFEDFIKGYNCTILVYGMTSTGKTYTMTGDEK 119

Query: 126 LYKGDLSDSAGIIPRVLFKLFETIEFQSDNYVIKCSFIELYNEELKDLLIDSNNTKLKKL 185
           LY G+LSDSAGIIPRVLFKLFE+ E  +D+Y+IKCSF+ELYNE+LKDLL DS +   KKL
Sbjct: 120 LYDGELSDSAGIIPRVLFKLFESPEILNDDYIIKCSFVELYNEDLKDLLDDSVDNTYKKL 179

Query: 186 RIFD 189
           RIFD
Sbjct: 180 RIFD 183

>KLLA0D01045g Chr4 (91110..94007) [2898 bp, 965 aa] {ON} similar to
           uniprot|Q8J1G7 Ashbya gossypii ACR010C CIN8 Kinesin-like
           protein CIN8 and some similarites with YEL061C
           uniprot|P27895 Saccharomyces cerevisiae YEL061C CIN8
           Kinesin motor protein involved in mitotic spindle
           assembly and chromosome segregation
          Length = 965

 Score =  462 bits (1189), Expect = e-147,   Method: Compositional matrix adjust.
 Identities = 256/590 (43%), Positives = 375/590 (63%)

Query: 235 NASIYIQNLEEFHIKNAREGIQLLQKGLKYRQVASTKMNDVSSRSHTIFTINLYKEHKGE 294
           +++IYIQ+L+EFHI +A+EG++LLQKGL +RQVASTKMNDVSSRSHTIFT+ LYK   GE
Sbjct: 266 SSAIYIQHLQEFHITDAKEGLRLLQKGLSHRQVASTKMNDVSSRSHTIFTLTLYKNFNGE 325

Query: 295 IFKISKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSIADKNIHIPFRES 354
            F++SK+NLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINS+ADKN HIPFRES
Sbjct: 326 TFRVSKINLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLADKNAHIPFRES 385

Query: 355 KLTRLLQDSLGGNTKTALIATISPAKLNAEETCSTLEYATKAKSIKNKPQLGSIIMKDVR 414
           KLTRLLQDSLGGNTKTALIATISPAK+N+EET STLEYATKAK+IKNKPQLGS +MKD+ 
Sbjct: 386 KLTRLLQDSLGGNTKTALIATISPAKINSEETSSTLEYATKAKNIKNKPQLGSFMMKDIL 445

Query: 415 LKDLNNELAKIKRDLTSTKQKDGVYMTQNHYKDLTNDLESYKTEIQECDRIVKSLELQNA 474
           +K++++ELAK+K D  STK K+G+YM+  HY ++ ND+E+YKTEIQE  R ++ L  QN 
Sbjct: 446 VKNISHELAKLKSDFLSTKSKEGIYMSHLHYNEVMNDIENYKTEIQESRREIEKLSSQNQ 505

Query: 475 LLLKDKKASNEVNKLQELNLNEMTNTLSNIQTTLEIQHKKEQILVEELAHSREKSLKMKT 534
           LL KDKK+S +  + Q L +  + +++  +   ++++HK E  L   +   ++    M+ 
Sbjct: 506 LLHKDKKSSQDTIESQRLQIRNLQSSMDYLYEKIDLKHKNEIELTNMIMKLKDAVRNMQG 565

Query: 535 VIKEYSEKEERIQSNMKSIFNDXXXXXXXXXXXXXXGIAKENLIVQTNVKDNIKLIKDDV 594
            +K + + E+R+QS+++ +  D               + ++ L     + D+I  +KD +
Sbjct: 566 ALKTHEDHEQRLQSDIQKMLYDNILEYRRKIETKLDNLKQQALEQSFTIDDDINNVKDSL 625

Query: 595 ISIVTESQELSKKLFLEFSQQIIKETPLILEMFSSDVKKNQELNETYFANLFENLESIKQ 654
            +++   ++ +  +    +Q+++ + P       S++       + +   L E L  I  
Sbjct: 626 ETLLETVKKDAIIMCENLAQKVVGDQPKFFNSMLSELNDMFSKVDEHTDRLKEGLSQITA 685

Query: 655 QYSKLNEYFSNDFFKSNHVTIVNDHVNTTKAIIEKSVSDIFKQFQQNMEAFAEQNEKLIL 714
           + + L  Y    FF++NH  I+N H + T   +  S   +  +    +    EQN  L++
Sbjct: 686 ENNNLKAYLDTHFFRNNHQEILNVHADKTYHQLNLSSKHLMSKITNIISDHVEQNRTLLM 745

Query: 715 ENLKTVSSDLIQNEMNSFKEHKSEWDISFKKINHCDYLNNSYHDQMHTYLRNMKGKLQSS 774
           + LKT ++++I  EM+ F+  +  W+ SF  IN CD L+N + D     L ++K  ++S+
Sbjct: 746 DTLKTATTEVITQEMSHFEPVRKTWEQSFNHINVCDSLSNKFKDDTTESLNSLKSHMEST 805

Query: 775 DEIIKKHMNQIKSNVDSLNSTPKLLNTDRAIGDNYNQIISKRDKLHDHLQ 824
                   ++IK N+        + N    I    + I +K   L D L+
Sbjct: 806 VRESSLIADKIKDNLCHFQDRNDIANMTTNINGTVDDIKNKHSVLRDELE 855

 Score =  270 bits (691), Expect = 3e-76,   Method: Compositional matrix adjust.
 Identities = 123/180 (68%), Positives = 151/180 (83%), Gaps = 5/180 (2%)

Query: 13  DEMNIMVAVRCRGRNKREXXXXXXXXXXXPDVMGSNEISINTSDDIVSGLTAQLNSKTYT 72
           DE+NI VAVRCRGRN++E           PDV+G+NE+SINTS DI  G+TA++NSKTYT
Sbjct: 11  DELNITVAVRCRGRNEKEIKAKSSVVVNCPDVIGANEVSINTSGDI--GITARMNSKTYT 68

Query: 73  VDKVFGPSANQRLIFEEIAEPLFNDFLRGYNCTVLVYGMTSTGKTYTMTGDEKLYKGDLS 132
           VDKVFGPSA+Q L+F+EIA+P+F+DF++GYNCT+LVYGMTSTGKTYTMTGDEKLY G+LS
Sbjct: 69  VDKVFGPSADQSLVFKEIADPMFHDFIKGYNCTMLVYGMTSTGKTYTMTGDEKLYDGELS 128

Query: 133 DSAGIIPRVLFKLFETIEFQSDNYVIKCSFIELYNEELKDLL---IDSNNTKLKKLRIFD 189
           ++AGIIPRVLFKLF+T+E Q  +Y++KCSFIELYNEELKDLL    DS     +KLRI+D
Sbjct: 129 EAAGIIPRVLFKLFDTLEVQESDYMVKCSFIELYNEELKDLLDDGQDSGGNNSRKLRIYD 188

>SAKL0F12298g Chr6 complement(958588..961926) [3339 bp, 1112 aa]
           {ON} similar to uniprot|P28742 Saccharomyces cerevisiae
           YBL063W KIP1 Kinesin-related motor protein required for
           mitotic spindle assembly and chromosome segregation
           functionally redundant with Cin8p
          Length = 1112

 Score =  374 bits (960), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 212/453 (46%), Positives = 281/453 (62%), Gaps = 55/453 (12%)

Query: 11  DTDEMNIMVAVRCRGRNKREXXXXXXXXXXXPDVMGSNEISINTSDDIVSGLTAQLNSKT 70
           D+   NI V VRCR RNKRE               G + I  N S      LT     KT
Sbjct: 49  DSPGYNIKVYVRCRSRNKREIGEKSSVVISTMGAQGRDVILSNPSSSSSGSLTNV--KKT 106

Query: 71  YTVDKVFGPSANQRLIFEEIAEPLFNDFLRGYNCTVLVYGMTSTGKTYTMTGDEKLYKGD 130
           YT D+VFG  ++Q ++F  +A+   ++ L+GYNCTV  YG T TGKTYTM+GD  +    
Sbjct: 107 YTFDRVFGAESDQEVVFNSVAKNYISEMLQGYNCTVFAYGQTGTGKTYTMSGDINILGST 166

Query: 131 ----------LSDSAGIIPRVLFKLFETIEFQSDNYVIKCSFIELYNEELKDLLIDSN-- 178
                     LS+ AGIIPRVL  LF+ ++ +S +Y +K SF+ELYNE LKDLL DSN  
Sbjct: 167 THNHDQSSILLSEHAGIIPRVLVDLFKDLKNESTDYSVKVSFLELYNERLKDLLADSNKE 226

Query: 179 -NTKLKKLRIFDXXXXXXXXXXXXXXXXXHFISGMDLRKXXXXXXXXXXXXTAIQNGNAS 237
            +   + +RIFD                                            G+ S
Sbjct: 227 DDNNAESIRIFDNIKPEKNT-----------------------------------QGSHS 251

Query: 238 IYIQNLEEFHIKNAREGIQLLQKGLKYRQVASTKMNDVSSRSHTIFTI--NLYK--EHKG 293
           I ++ +EE +IK+A+EG++LL +G   RQVASTK ND+SSRSHT+FTI  N+ K     G
Sbjct: 252 IMVKGMEEIYIKSAQEGLKLLTEGSIKRQVASTKCNDLSSRSHTVFTITTNVTKVDPLSG 311

Query: 294 EIF-KISKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSIADKNIHIPFR 352
           E + K  K+NLVDLAGSENI+RSGA+N+RA+EAG IN+SLLTLGRVIN++ D + HIP+R
Sbjct: 312 EEYVKNGKLNLVDLAGSENINRSGAENKRAQEAGLINKSLLTLGRVINALVDHSQHIPYR 371

Query: 353 ESKLTRLLQDSLGGNTKTALIATISPAKLNAEETCSTLEYATKAKSIKNKPQLGSIIMKD 412
           ESKLTRLLQDSLGG TKT +IAT+SPAK++ EET STLEYAT+AKSIKN PQ+   + KD
Sbjct: 372 ESKLTRLLQDSLGGKTKTCIIATVSPAKISMEETVSTLEYATRAKSIKNTPQINQSMTKD 431

Query: 413 VRLKDLNNELAKIKRDLTSTKQKDGVYMTQNHY 445
             + +  +E+ +++++L +T+ KDG+Y+TQ  Y
Sbjct: 432 SCITEYIHEIDRLRKELRATRTKDGIYITQEKY 464

>ACR228C Chr3 complement(758111..761500) [3390 bp, 1129 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YBL063W
           (KIP1)
          Length = 1129

 Score =  366 bits (939), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 202/446 (45%), Positives = 284/446 (63%), Gaps = 46/446 (10%)

Query: 14  EMNIMVAVRCRGRNKREXXXXXXXXXXXPDVMGSNEISINTSDDIVSGLTAQLNSKTYTV 73
           E NI V VRCR RN+RE              +G+N        +++       ++KTYT 
Sbjct: 52  EYNIKVYVRCRSRNEREIREKSSVVI---STLGNN------GREVILTNPGTGSNKTYTF 102

Query: 74  DKVFGPSANQRLIFEEIAEPLFNDFLRGYNCTVLVYGMTSTGKTYTMTGDEKLYKGD--- 130
           D+VFG  ++Q  +F ++A    N+ + GYNCTV  YG T TGKTYTM+GD  +       
Sbjct: 103 DRVFGVESDQESMFNQVARAYINEMIEGYNCTVFAYGQTGTGKTYTMSGDITMMGSSEDD 162

Query: 131 -----LSDSAGIIPRVLFKLFETIEFQSDNYVIKCSFIELYNEELKDLLIDSNNTKLKKL 185
                LS+ AGIIPRVL +LF  +   S++Y +K SF+ELYNE+L+DLL+D  +  L+  
Sbjct: 163 PNFVLLSEHAGIIPRVLVELFRELREVSEDYSVKVSFLELYNEKLRDLLVDDKDVSLED- 221

Query: 186 RIFDXXXXXXXXXXXXXXXXXHFISGMDLRKXXXXXXXXXXXXTAIQNGNASIYIQNLEE 245
                                H  +GM   +            T+  NG  SI+++ +EE
Sbjct: 222 ---------------------HNFNGMAPPESIRIYDSLKTDRTS-PNG-YSIFVKGMEE 258

Query: 246 FHIKNAREGIQLLQKGLKYRQVASTKMNDVSSRSHTIFTI--NLYKEHK--GEIF-KISK 300
            +I++A+EG++LL  G   R+VA+TK ND+SSRSHTIFTI  N+ K H   GE + K+ K
Sbjct: 259 MYIRSAQEGLKLLMDGSLKRKVAATKCNDLSSRSHTIFTITTNVTKIHPISGEQYVKVGK 318

Query: 301 MNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSIADKNIHIPFRESKLTRLL 360
           +NLVDLAGSENI+RSGA+N+RA+EAG IN+SLLTLGRVIN++ D + HIP+RESKLTRLL
Sbjct: 319 LNLVDLAGSENINRSGAENKRAQEAGLINKSLLTLGRVINALVDHSQHIPYRESKLTRLL 378

Query: 361 QDSLGGNTKTALIATISPAKLNAEETCSTLEYATKAKSIKNKPQLGSIIMKDVRLKDLNN 420
           QDSLGG TKT +IATISPAK++ EET STLEYAT+AKSIKN PQ+  ++ K+  + +   
Sbjct: 379 QDSLGGKTKTCIIATISPAKISMEETVSTLEYATRAKSIKNTPQVNQLMAKESCIIEYIQ 438

Query: 421 ELAKIKRDLTSTKQKDGVYMTQNHYK 446
           E+ +++++L ++  K+G+Y+TQ  ++
Sbjct: 439 EIERLRKELRASHSKEGIYITQEKFE 464

>KAFR0L01710 Chr12 complement(308820..312275) [3456 bp, 1151 aa]
           {ON} Anc_7.387 YBL063W
          Length = 1151

 Score =  365 bits (938), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 210/443 (47%), Positives = 278/443 (62%), Gaps = 48/443 (10%)

Query: 16  NIMVAVRCRGRNKREXXXXXXXXXXXPDVMGSNEISINTSDDIVSGLTAQLNSKTYTVDK 75
           NI V VRCR RN+RE               G  E+ ++    ++S        KTY  D+
Sbjct: 59  NIQVYVRCRSRNQREIEEKSSVVISTMGAQG-KEVVLSDPSSVLSH-----TKKTYIFDQ 112

Query: 76  VFGPSANQRLIFEEIAEPLFNDFLRGYNCTVLVYGMTSTGKTYTMTGDEKLYKGDL---- 131
           VFG  ++Q ++F   A+   ++ L+GYNCT+  YG T TGKTYTM+GD  +  GDL    
Sbjct: 113 VFGVESDQEVVFNATAQNYIHEMLQGYNCTIFAYGQTGTGKTYTMSGDINIL-GDLESQD 171

Query: 132 ----SDSAGIIPRVLFKLFETIEFQSDNYVIKCSFIELYNEELKDLLIDSNNTKLKKLRI 187
                + AGIIPRVL  LF+ +  +S  Y +K SF+ELYNE LKDLL  S  T+ + +RI
Sbjct: 172 KILLGEHAGIIPRVLVNLFQYLTRESTEYSVKISFLELYNERLKDLLSQSKETE-ESIRI 230

Query: 188 FDXXXXXXXXXXXXXXXXXHFISGMDLRKXXXXXXXXXXXXTAIQNGNASIYIQNLEEFH 247
           FD                 H  SG                 ++  N  +SI ++ +EE +
Sbjct: 231 FDN----------------HIPSG-----------NSKIQKSSRNNTYSSIMVKGMEEIY 263

Query: 248 IKNAREGIQLLQKGLKYRQVASTKMNDVSSRSHTIFTINLYKEH----KGEIF-KISKMN 302
           IK+A EG+QLL +G   R+VASTK ND+SSRSHTIFTI           GE + KI K+N
Sbjct: 264 IKSAHEGLQLLTEGSLKRKVASTKCNDLSSRSHTIFTITTNITKIDPVSGEQYVKIGKLN 323

Query: 303 LVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSIADKNIHIPFRESKLTRLLQD 362
           LVDLAGSENISRSGA+N RA+EAG IN+SLLTLGRVIN++ D + HIP+RESKLTRLLQD
Sbjct: 324 LVDLAGSENISRSGAENMRAQEAGLINKSLLTLGRVINALVDHSQHIPYRESKLTRLLQD 383

Query: 363 SLGGNTKTALIATISPAKLNAEETCSTLEYATKAKSIKNKPQLGSIIMKDVRLKDLNNEL 422
           SLGG TKT +IAT+SPAK++ EET STLEYAT+AKSIKN PQ+   + KDV + +   E+
Sbjct: 384 SLGGKTKTCIIATVSPAKISMEETISTLEYATRAKSIKNTPQINQSMSKDVCINEYVQEI 443

Query: 423 AKIKRDLTSTKQKDGVYMTQNHY 445
            +++++L +++QKDGVY+TQ  +
Sbjct: 444 ERLRQELKASRQKDGVYITQEQF 466

>Suva_2.54 Chr2 (99000..102332) [3333 bp, 1110 aa] {ON} YBL063W
           (REAL)
          Length = 1110

 Score =  361 bits (926), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 208/455 (45%), Positives = 270/455 (59%), Gaps = 71/455 (15%)

Query: 12  TDEMNIMVAVRCRGRNKREXXXXXXXXXXXPDVMGSNEISINTSDDIVSGLTAQLNSKTY 71
           T E NI V VRCR RN+RE               G   I  N S    S      + KTY
Sbjct: 48  TSESNIHVYVRCRSRNRREIDEKSSVVISTLGPQGKEIILSNGSHQSYSS-----SKKTY 102

Query: 72  TVDKVFGPSANQRLIFEEIAEPLFNDFLRGYNCTVLVYGMTSTGKTYTMTGDEKLYKGD- 130
             D+VFG  ++Q ++F   A+    + L GYNCT+  YG T TGKTYTM+GD  +  GD 
Sbjct: 103 QFDQVFGAESDQEMVFHATAKNYIREMLHGYNCTIFAYGQTGTGKTYTMSGDINIL-GDV 161

Query: 131 -------LSDSAGIIPRVLFKLFETIEFQSDNYVIKCSFIELYNEELKDLLID------- 176
                  L + AGIIPRVL  LF+ +   +  Y +K SF+ELYNE LKDLL D       
Sbjct: 162 QSTDNLLLGEHAGIIPRVLVDLFKELSSLNKEYSVKVSFLELYNENLKDLLSDNEDDDPT 221

Query: 177 SNNTKLKKLRIFDXXXXXXXXXXXXXXXXXHFISGMDLRKXXXXXXXXXXXXTAIQNGNA 236
           +N++K K++RIFD                                           N N+
Sbjct: 222 ANDSK-KQIRIFDN-----------------------------------------NNNNS 239

Query: 237 SIYIQNLEEFHIKNAREGIQLLQKGLKYRQVASTKMNDVSSRSHTIFTINL------YKE 290
           SI ++ ++E  I +A EG+ LL +G   R+VA+TK ND+SSRSHT+FTI         KE
Sbjct: 240 SIMVKGMQEIFINSAHEGLNLLMQGSLKRKVAATKCNDLSSRSHTVFTITTNIIEQDSKE 299

Query: 291 H--KGEIFKISKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSIADKNIH 348
           H       KI K+NLVDLAGSENI+RSGA+N+RA+EAG IN+SLLTLGRVIN++ D + H
Sbjct: 300 HGQNKNFVKIGKLNLVDLAGSENINRSGAENKRAQEAGLINKSLLTLGRVINALVDHSNH 359

Query: 349 IPFRESKLTRLLQDSLGGNTKTALIATISPAKLNAEETCSTLEYATKAKSIKNKPQLGSI 408
           IP+RESKLTRLLQDSLGG TKT +IAT+SPAK++ EET STLEYAT+AKSIKN PQ+   
Sbjct: 360 IPYRESKLTRLLQDSLGGMTKTCIIATVSPAKISMEETASTLEYATRAKSIKNSPQVNQS 419

Query: 409 IMKDVRLKDLNNELAKIKRDLTSTKQKDGVYMTQN 443
           + KD  LKD   E+ K++ DL +++ K G+++TQ+
Sbjct: 420 LSKDTCLKDYIQEIEKLRNDLKNSRNKQGIFITQD 454

>TDEL0C01600 Chr3 (276912..280229) [3318 bp, 1105 aa] {ON} Anc_7.387
           YBL063W
          Length = 1105

 Score =  356 bits (914), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 197/447 (44%), Positives = 283/447 (63%), Gaps = 42/447 (9%)

Query: 16  NIMVAVRCRGRNKREXXXXXXXXXXXPDVMGSNEISINTSDDIVSGLTAQLNSKTYTVDK 75
           N+ V VRCR RN++E               G   I  N +  +        + +TYT D+
Sbjct: 41  NMRVYVRCRSRNEQEIEEKSSVVISTLGAKGREVILSNGAGSLSH------SKRTYTFDQ 94

Query: 76  VFGPSANQRLIFEEIAEPLFNDFLRGYNCTVLVYGMTSTGKTYTMTGDEKLYKGDL---- 131
           VFG  ++Q  +F+E+A+   ++ L GYNCTV  YG T TGKTYTM+GD  +  GDL    
Sbjct: 95  VFGAESDQETVFDEVAKDYISEMLEGYNCTVFTYGQTGTGKTYTMSGDISIL-GDLDSQD 153

Query: 132 ----SDSAGIIPRVLFKLFETIEFQSDNYVIKCSFIELYNEELKDLLIDSNNTKLKKLRI 187
                + +GIIPRVL  LF+ +  +++ Y +K SF+ELYNE+LKDLL +S   + + +RI
Sbjct: 154 KILLGEHSGIIPRVLVDLFKQLSQETNEYTVKVSFLELYNEKLKDLLAESEQEE-ENIRI 212

Query: 188 FDXXXXXXXXXXXXXXXXXHFISGMDLRKXXXXXXX---XXXXXTAIQNGNASIYIQNLE 244
           FD                    SG +  K               ++  + ++SI ++ +E
Sbjct: 213 FDNN------------------SGFNCNKNVKQLVKLDGSSHRTSSASSSSSSIMVKGME 254

Query: 245 EFHIKNAREGIQLLQKGLKYRQVASTKMNDVSSRSHTIFTINLYKEHKGEI-----FKIS 299
           EF+IK+A EG++LL  G   R+VA+TK ND+SSRSHT+FTI         +      KI 
Sbjct: 255 EFYIKSAHEGLELLMTGSLKRKVAATKCNDLSSRSHTVFTITTNVARTDPVSNEQYIKIG 314

Query: 300 KMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSIADKNIHIPFRESKLTRL 359
           K+NLVDLAGSENI+RSGA+N+RA+EAG IN+SLLTLGRVIN++ D + HIP+RESKLTRL
Sbjct: 315 KLNLVDLAGSENINRSGAENKRAQEAGLINKSLLTLGRVINALVDNSQHIPYRESKLTRL 374

Query: 360 LQDSLGGNTKTALIATISPAKLNAEETCSTLEYATKAKSIKNKPQLGSIIMKDVRLKDLN 419
           LQDSLGG TKT +IATISPAK++ +ET STLEYAT+AKSIKN PQ+   + K+  L +  
Sbjct: 375 LQDSLGGKTKTCIIATISPAKISMDETVSTLEYATRAKSIKNTPQVNQSMSKNSCLGEYI 434

Query: 420 NELAKIKRDLTSTKQKDGVYMTQNHYK 446
           +E+ +++++L +++QK+G+Y+T++ ++
Sbjct: 435 HEIERLRQELKASRQKEGMYITEDQFQ 461

>Ecym_4688 Chr4 (1342239..1345643) [3405 bp, 1134 aa] {ON} similar
           to Ashbya gossypii ACR228C
          Length = 1134

 Score =  355 bits (912), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 200/444 (45%), Positives = 272/444 (61%), Gaps = 44/444 (9%)

Query: 16  NIMVAVRCRGRNKREXXXXXXXXXXXPDVMGSNEISINTSDDIVSGLTAQLNSKTYTVDK 75
           NI V VRCR RN RE               G   I  N S           N+KTYT D+
Sbjct: 56  NIKVYVRCRSRNVREIKEKSSVVVSTLGSQGREIILSNQSTG---------NNKTYTFDQ 106

Query: 76  VFGPSANQRLIFEEIAEPLFNDFLRGYNCTVLVYGMTSTGKTYTMTGDEKLYKGDLSDS- 134
           VFG  ++Q  +F+++A     + L GYNCTV  YG T TGKTYTM+GD  +    L D  
Sbjct: 107 VFGVESDQESLFDKVARAYITEMLEGYNCTVFAYGQTGTGKTYTMSGDISVVGASLEDPN 166

Query: 135 -------AGIIPRVLFKLFETIEFQSDNYVIKCSFIELYNEELKDLLIDSNNTKLKKLRI 187
                  AGIIPRVL +LF+ ++ +S++Y +K SF+ELYNE+L+DLL++       K  +
Sbjct: 167 YVLLSEHAGIIPRVLVELFQQLQRESEDYSVKVSFLELYNEKLRDLLVED------KEPL 220

Query: 188 FDXXXXXXXXXXXXXXXXXHFISGMDLRKXXXXXXXXXXXXTAIQNGNASIYIQNLEEFH 247
            D                   I G                     +   SI ++ +EE +
Sbjct: 221 IDEGG----------------IGGGVANSPETIRIYDNLKLDRSNSSGHSIMVKGMEEMY 264

Query: 248 IKNAREGIQLLQKGLKYRQVASTKMNDVSSRSHTIFTI--NLYKEHK--GEIF-KISKMN 302
           I++A+EG++LL +G   R+VA+T+ ND+SSRSHTIFTI  N+ K H   GE + KI K+N
Sbjct: 265 IRSAQEGLKLLMEGSLKRKVAATRCNDLSSRSHTIFTITTNVTKIHPISGEQYVKIGKLN 324

Query: 303 LVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSIADKNIHIPFRESKLTRLLQD 362
           LVDLAGSENI+RSGA+N+RA+EAG IN+SLLTLGRVIN++ D + HIP+RESKLTRLLQD
Sbjct: 325 LVDLAGSENINRSGAENKRAQEAGLINKSLLTLGRVINALVDHSQHIPYRESKLTRLLQD 384

Query: 363 SLGGNTKTALIATISPAKLNAEETCSTLEYATKAKSIKNKPQLGSIIMKDVRLKDLNNEL 422
           SLGG TKT +IAT+SPAK + EET STLEYAT+AKSIKN PQ+  ++ K+  +     E+
Sbjct: 385 SLGGKTKTCIIATVSPAKTSMEETASTLEYATRAKSIKNTPQINQLMAKESCILGYIKEI 444

Query: 423 AKIKRDLTSTKQKDGVYMTQNHYK 446
            K++++L +   K+G+Y+T+  Y+
Sbjct: 445 EKLRKNLKANHAKEGIYITEEKYE 468

>Skud_2.41 Chr2 (85542..88874) [3333 bp, 1110 aa] {ON} YBL063W
           (REAL)
          Length = 1110

 Score =  353 bits (907), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 206/455 (45%), Positives = 268/455 (58%), Gaps = 71/455 (15%)

Query: 12  TDEMNIMVAVRCRGRNKREXXXXXXXXXXXPDVMGSNEISINTSDDIVSGLTAQLNSKTY 71
           T + NI V VRCR RNKRE               G   I  N S    S      + KTY
Sbjct: 47  TSDSNIHVYVRCRSRNKREIDEKSSVVISTLGPQGKEIILSNGSHQSYSS-----SKKTY 101

Query: 72  TVDKVFGPSANQRLIFEEIAEPLFNDFLRGYNCTVLVYGMTSTGKTYTMTGDEKLYKGD- 130
             D+VFG  ++Q  +F   A+    + L GYNCT+  YG T TGKTYTM+GD  +  GD 
Sbjct: 102 QFDQVFGAESDQETVFNATAKNYIREMLHGYNCTIFAYGQTGTGKTYTMSGDINIL-GDV 160

Query: 131 -------LSDSAGIIPRVLFKLFETIEFQSDNYVIKCSFIELYNEELKDLLIDSN----- 178
                  L + AGIIPRVL  LF+ +   +  Y +K +F+ELYNE LKDLL D+      
Sbjct: 161 QSTDNLLLGEHAGIIPRVLVDLFKELSSLNKEYSVKVTFLELYNENLKDLLSDNEDDDPA 220

Query: 179 -NTKLKKLRIFDXXXXXXXXXXXXXXXXXHFISGMDLRKXXXXXXXXXXXXTAIQNGNAS 237
            N   +++RIFD                                           N N+S
Sbjct: 221 VNDSKRQIRIFDN-----------------------------------------NNNNSS 239

Query: 238 IYIQNLEEFHIKNAREGIQLLQKGLKYRQVASTKMNDVSSRSHTIFTINL------YKEH 291
           I ++ ++E  I +A EG+ LL +G   R+VA+TK ND+SSRSHT+FTI         K+H
Sbjct: 240 IMVKGMQEIFINSAHEGLNLLMQGSLKRKVAATKCNDLSSRSHTVFTITTNIVEQDSKDH 299

Query: 292 KGE---IFKISKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSIADKNIH 348
            G+     KI K+NLVDLAGSENI+RSGA+N+RA+EAG IN+SLLTLGRVIN++ D + H
Sbjct: 300 -GQNKNFVKIGKLNLVDLAGSENINRSGAENKRAQEAGLINKSLLTLGRVINALVDHSNH 358

Query: 349 IPFRESKLTRLLQDSLGGNTKTALIATISPAKLNAEETCSTLEYATKAKSIKNKPQLGSI 408
           IP+RESKLTRLLQDSLGG TKT +IATISPAK++ EET STLEYAT+AKSIKN PQ+   
Sbjct: 359 IPYRESKLTRLLQDSLGGMTKTCIIATISPAKISMEETASTLEYATRAKSIKNTPQVNQS 418

Query: 409 IMKDVRLKDLNNELAKIKRDLTSTKQKDGVYMTQN 443
           + KD  LKD   E+ K++ DL +++ K G+++TQ+
Sbjct: 419 LSKDTCLKDYIQEIEKLRNDLKNSRNKQGIFITQD 453

>ZYRO0B03234g Chr2 complement(263393..266809) [3417 bp, 1138 aa]
           {ON} similar to uniprot|P28742 Saccharomyces cerevisiae
           YBL063W KIP1 Kinesin-related motor protein required for
           mitotic spindle assembly and chromosome segregation
           functionally redundant with Cin8p
          Length = 1138

 Score =  353 bits (907), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 209/458 (45%), Positives = 282/458 (61%), Gaps = 49/458 (10%)

Query: 16  NIMVAVRCRGRNKREXXXXXXXXXXXPDVMGSNEISINTSDDIVSGLTAQLN--SKTYTV 73
           NI V VRCR RN+RE              MG    S+     I+S  ++ L+   KTY  
Sbjct: 44  NIKVYVRCRSRNQREIDEKSSVVV---STMGRKGKSV-----ILSNPSSPLSHPKKTYMF 95

Query: 74  DKVFGPSANQRLIFEEIAEPLFNDFLRGYNCTVLVYGMTSTGKTYTMTGDEKLYKGDL-- 131
           D+VFG  ++Q  IF E+A+    + L GYNCTV  YG T TGKTYTM+GD  ++ GDL  
Sbjct: 96  DEVFGADSDQESIFTEVAKNYIQEMLEGYNCTVFAYGQTGTGKTYTMSGDMSIW-GDLDS 154

Query: 132 ------SDSAGIIPRVLFKLFETIEFQSDNYVIKCSFIELYNEELKDLLIDSNNTKLKKL 185
                  + AGIIPRVL  LF+ +  ++  + +K SF+ELYNE LKDLL D N++    +
Sbjct: 155 QDKILLGEHAGIIPRVLVNLFKQLSKETTEHSVKISFLELYNERLKDLLAD-NDSDEDNI 213

Query: 186 RIFDXXXXXXXXXXXXXXXXXHFIS-GMDLRKXXXXXXXXXXXXTAI------------Q 232
           RIFD                 H  S GM   K             A              
Sbjct: 214 RIFDNNNSNA-----------HGASNGMSQVKMNKSKVRAPTLSGATVSSSASNSSTSSS 262

Query: 233 NGNASIYIQNLEEFHIKNAREGIQLLQKGLKYRQVASTKMNDVSSRSHTIFTINLYKEH- 291
           + ++SI ++ +EE +IK+A EG+QLL KG   R+VA+TK ND+SSRSHTIFTI  +    
Sbjct: 263 SSSSSITVKGMEERYIKSAYEGLQLLTKGSLKRKVAATKCNDLSSRSHTIFTIVTHVART 322

Query: 292 ---KGEIF-KISKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSIADKNI 347
               GE + KI K+NLVDLAGSENI+RSGA+N RA+EAG IN+SLLTLGRVIN++ + + 
Sbjct: 323 DPVSGEQYVKIGKLNLVDLAGSENINRSGAENMRAQEAGLINKSLLTLGRVINALVEHSS 382

Query: 348 HIPFRESKLTRLLQDSLGGNTKTALIATISPAKLNAEETCSTLEYATKAKSIKNKPQLGS 407
           HIP+R SKLTRLLQDSLGG TKT +IATISPA+++ +ET STLEYAT+AKSIKN PQ+  
Sbjct: 383 HIPYRGSKLTRLLQDSLGGKTKTCIIATISPARISMDETVSTLEYATRAKSIKNTPQVNQ 442

Query: 408 IIMKDVRLKDLNNELAKIKRDLTSTKQKDGVYMTQNHY 445
            + KD  + +   E+ +++++L +++Q++G+Y+TQ  Y
Sbjct: 443 SLSKDSCIMEYIYEIERLRQELKASRQREGMYITQEQY 480

>NDAI0E04300 Chr5 complement(965403..968963) [3561 bp, 1186 aa] {ON}
           Anc_7.387
          Length = 1186

 Score =  351 bits (900), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 200/442 (45%), Positives = 271/442 (61%), Gaps = 62/442 (14%)

Query: 16  NIMVAVRCRGRNKREXXXXXXXXXXXPDVMGSNEISINTSDDIVSGLTAQLNSKTYTVDK 75
           NI V VRCR R++RE               G+  I  N S  +          K+Y+ D+
Sbjct: 108 NIKVYVRCRSRSEREIKEKSSVVISTLGPQGNQVILSNPSSPL------SYPKKSYSFDR 161

Query: 76  VFGPSANQRLIFEEIAEPLFNDFLRGYNCTVLVYGMTSTGKTYTMTGDEKLYKGDL---- 131
           VFG  ++Q  +F + A+   ++ L GYNCTV  YG T TGKTYTM+GD  +  G+L    
Sbjct: 162 VFGAESDQETVFNDAAKNYISEMLSGYNCTVFAYGQTGTGKTYTMSGDLNIL-GNLESKD 220

Query: 132 ----SDSAGIIPRVLFKLFETIEFQSDNYVIKCSFIELYNEELKDLLIDSNNTKLKKLRI 187
                + AGIIPRVL  LF+ +  ++D Y +K SF+ELYNE LKDL    N ++ + +RI
Sbjct: 221 MILLGEHAGIIPRVLVNLFKMLALEND-YSVKISFLELYNERLKDLFAQ-NESEEETIRI 278

Query: 188 FDXXXXXXXXXXXXXXXXXHFISGMDLRKXXXXXXXXXXXXTAIQNGNASIYIQNLEEFH 247
           FD                                           N ++SI ++ +EE +
Sbjct: 279 FDNN----------------------------------------NNASSSIMVKGMEEIY 298

Query: 248 IKNAREGIQLLQKGLKYRQVASTKMNDVSSRSHTIFTI--NLYK--EHKGEIF-KISKMN 302
           IK+A EG+QLL  G   R+VASTK ND+SSRSHT+FTI  N+ K     GE + K  K+N
Sbjct: 299 IKSAHEGLQLLMDGSLKRKVASTKCNDLSSRSHTVFTIATNITKIDPISGEQYIKTGKLN 358

Query: 303 LVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSIADKNIHIPFRESKLTRLLQD 362
           LVDLAGSENI+RSGA+N+RA+EAG IN+SLLTLGRVIN++ D + HIP+RESKLTRLLQD
Sbjct: 359 LVDLAGSENINRSGAENKRAQEAGLINKSLLTLGRVINALVDHSQHIPYRESKLTRLLQD 418

Query: 363 SLGGNTKTALIATISPAKLNAEETCSTLEYATKAKSIKNKPQLGSIIMKDVRLKDLNNEL 422
           SLGG TKT +IATISPAK++ EET STLEYA +AKSIKN PQ+   + KD  + +  +E+
Sbjct: 419 SLGGKTKTCIIATISPAKISMEETVSTLEYAIRAKSIKNTPQINQSMSKDTCINEYVSEI 478

Query: 423 AKIKRDLTSTKQKDGVYMTQNH 444
            +++ +L +++QKDG+ +TQ+ 
Sbjct: 479 ERLRLELKTSRQKDGICITQDQ 500

>NCAS0E02640 Chr5 (527838..531146) [3309 bp, 1102 aa] {ON} Anc_7.387
          Length = 1102

 Score =  348 bits (892), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 195/442 (44%), Positives = 273/442 (61%), Gaps = 61/442 (13%)

Query: 17  IMVAVRCRGRNKREXXXXXXXXXXXPDVMGSNEISINTSDDIVSGLTAQLNSKTYTVDKV 76
           I V VRCR RN+RE                S ++ ++     ++        +TYT D+V
Sbjct: 61  IKVYVRCRSRNEREIQEKSSVVISTLGAPQSTQLLLSNPLLPLA-----YAKRTYTFDRV 115

Query: 77  FGPSANQRLIFEEIAEPLFNDFLRGYNCTVLVYGMTSTGKTYTMTGDEKLYKGDL----- 131
           FG  ++Q  +F + A+   ++ L GYNCTV  YG T TGKTYTM+GD  +  GDL     
Sbjct: 116 FGAESDQESVFNDAAKNYIHEMLEGYNCTVFAYGQTGTGKTYTMSGDLNILGGDLDSNTM 175

Query: 132 ---SDSAGIIPRVLFKLFETIEFQSDNYVIKCSFIELYNEELKDLLIDSNNTKLKKLRIF 188
               + AGIIPRVL +LF  ++  ++ Y +K SF+ELYNE LKDLL  S  ++ + +RIF
Sbjct: 176 VLLGEHAGIIPRVLVELFRWLD-GNEGYSVKVSFLELYNERLKDLLA-SEQSEEENIRIF 233

Query: 189 DXXXXXXXXXXXXXXXXXHFISGMDLRKXXXXXXXXXXXXTAIQNGNASIYIQNLEEFHI 248
           D                                           + ++SI ++ +EE +I
Sbjct: 234 DNV-----------------------------------------SASSSIMVKGMEEIYI 252

Query: 249 KNAREGIQLLQKGLKYRQVASTKMNDVSSRSHTIFTI--NLYK--EHKGEIF-KISKMNL 303
            +A +G+QLL  G   R+VA+TK ND+SSRSHT+FTI  N+ K     GE + K  K+NL
Sbjct: 253 NSAHQGLQLLMDGSIKRKVAATKCNDLSSRSHTVFTITTNITKLDPVSGEQYVKTGKLNL 312

Query: 304 VDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSIADKNIHIPFRESKLTRLLQDS 363
           VDLAGSENI+RSGA+N+RA+EAG IN+SLLTLGRVIN++ D   HIP+RESKLTRLLQDS
Sbjct: 313 VDLAGSENINRSGAENKRAQEAGLINKSLLTLGRVINALVDHTQHIPYRESKLTRLLQDS 372

Query: 364 LGGNTKTALIATISPAKLNAEETCSTLEYATKAKSIKNKPQLGSIIMKDVRLKDLNNELA 423
           LGG TKT +IATISPAK++ +ET STLEYAT+AKSIKN PQ+   + KD  + +  +E+ 
Sbjct: 373 LGGKTKTCIIATISPAKISMDETISTLEYATRAKSIKNTPQVNQSMSKDSCINEYVHEIE 432

Query: 424 KIKRDLTSTKQKDGVYMTQNHY 445
           +++++L +++QKDG+ +TQ+ +
Sbjct: 433 RLRQELKTSRQKDGISITQDQF 454

>Smik_2.53 Chr2 (95765..99106) [3342 bp, 1113 aa] {ON} YBL063W
           (REAL)
          Length = 1113

 Score =  347 bits (890), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 209/455 (45%), Positives = 269/455 (59%), Gaps = 71/455 (15%)

Query: 12  TDEMNIMVAVRCRGRNKREXXXXXXXXXXXPDVMGSNEISINTSDDIVSGLTAQLNSKTY 71
           T + NI V VRCR RNKRE               G   I  N S    S      + KTY
Sbjct: 48  TSDSNIHVYVRCRSRNKREIDEKSSVVISTLGPQGKEIILSNGSHQSYSS-----SKKTY 102

Query: 72  TVDKVFGPSANQRLIFEEIAEPLFNDFLRGYNCTVLVYGMTSTGKTYTMTGDEKLYKGD- 130
             D+VFG  ++Q  +F   A+    + L GYNCT+  YG T TGKTYTM+GD  +  GD 
Sbjct: 103 QFDQVFGAESDQETVFNATAKNYIREMLHGYNCTIFAYGQTGTGKTYTMSGDINIL-GDV 161

Query: 131 -------LSDSAGIIPRVLFKLFETIEFQSDNYVIKCSFIELYNEELKDLLIDS------ 177
                  L + AGIIPRVL  LF+ +   +  Y +K SF+ELYNE LKDLL DS      
Sbjct: 162 QSTDKLLLGEHAGIIPRVLVDLFKELSTLNREYSVKISFLELYNENLKDLLSDSDDDDPV 221

Query: 178 -NNTKLKKLRIFDXXXXXXXXXXXXXXXXXHFISGMDLRKXXXXXXXXXXXXTAIQNGNA 236
            N+TK +++RIFD                                           N N+
Sbjct: 222 VNDTK-RQIRIFDN-----------------------------------------NNNNS 239

Query: 237 SIYIQNLEEFHIKNAREGIQLLQKGLKYRQVASTKMNDVSSRSHTIFTINL------YKE 290
           SI ++ ++E  I +A EG+ LL +G   R+VA+TK ND+SSRSHT+FTI         K+
Sbjct: 240 SIMVKGMQEIFINSAHEGLNLLMQGSLKRKVAATKCNDLSSRSHTVFTITTNIVEQDSKD 299

Query: 291 H--KGEIFKISKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSIADKNIH 348
           H       KI K+NLVDLAGSENI+RSGA+N+RA+EAG IN+SLLTLGRVIN++ D + H
Sbjct: 300 HGQNKNFVKIGKLNLVDLAGSENINRSGAENKRAQEAGLINKSLLTLGRVINALVDHSNH 359

Query: 349 IPFRESKLTRLLQDSLGGNTKTALIATISPAKLNAEETCSTLEYATKAKSIKNKPQLGSI 408
           IP+RESKLTRLLQDSLGG TKT +IAT+SPAK++ EET STLEYAT+AKSIKN PQ+   
Sbjct: 360 IPYRESKLTRLLQDSLGGMTKTCIIATVSPAKISMEETASTLEYATRAKSIKNTPQVNQS 419

Query: 409 IMKDVRLKDLNNELAKIKRDLTSTKQKDGVYMTQN 443
           + KD  LKD   E+ K+K DL +++ K G+++TQ+
Sbjct: 420 LSKDTCLKDYIQEIEKLKNDLKNSRNKQGIFITQD 454

>YBL063W Chr2 (101886..105221) [3336 bp, 1111 aa] {ON}
           KIP1Kinesin-related motor protein required for mitotic
           spindle assembly, chromosome segregation, and 2 micron
           plasmid partitioning; functionally redundant with Cin8p
           for chromosomal but not plasmid functions
          Length = 1111

 Score =  346 bits (887), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 205/455 (45%), Positives = 265/455 (58%), Gaps = 69/455 (15%)

Query: 12  TDEMNIMVAVRCRGRNKREXXXXXXXXXXXPDVMGSNEISINTSDDIVSGLTAQLNSKTY 71
           T + NI V VRCR RNKRE               G   I  N S    S      + KTY
Sbjct: 48  TSDSNIHVYVRCRSRNKREIEEKSSVVISTLGPQGKEIILSNGSHQSYSS-----SKKTY 102

Query: 72  TVDKVFGPSANQRLIFEEIAEPLFNDFLRGYNCTVLVYGMTSTGKTYTMTGDEKLYKGD- 130
             D+VFG  ++Q  +F   A+    + L GYNCT+  YG T TGKTYTM+GD  +  GD 
Sbjct: 103 QFDQVFGAESDQETVFNATAKNYIKEMLHGYNCTIFAYGQTGTGKTYTMSGDINIL-GDV 161

Query: 131 -------LSDSAGIIPRVLFKLFETIEFQSDNYVIKCSFIELYNEELKDLLI------DS 177
                  L + AGIIPRVL  LF+ +   +  Y +K SF+ELYNE LKDLL        +
Sbjct: 162 QSTDNLLLGEHAGIIPRVLVDLFKELSSLNKEYSVKISFLELYNENLKDLLSDSEDDDPA 221

Query: 178 NNTKLKKLRIFDXXXXXXXXXXXXXXXXXHFISGMDLRKXXXXXXXXXXXXTAIQNGNAS 237
            N   +++RIFD                                           N N+S
Sbjct: 222 VNDPKRQIRIFDN-----------------------------------------NNNNSS 240

Query: 238 IYIQNLEEFHIKNAREGIQLLQKGLKYRQVASTKMNDVSSRSHTIFTINL------YKEH 291
           I ++ ++E  I +A EG+ LL +G   R+VA+TK ND+SSRSHT+FTI         K+H
Sbjct: 241 IMVKGMQEIFINSAHEGLNLLMQGSLKRKVAATKCNDLSSRSHTVFTITTNIVEQDSKDH 300

Query: 292 --KGEIFKISKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSIADKNIHI 349
                  KI K+NLVDLAGSENI+RSGA+N+RA+EAG IN+SLLTLGRVIN++ D + HI
Sbjct: 301 GQNKNFVKIGKLNLVDLAGSENINRSGAENKRAQEAGLINKSLLTLGRVINALVDHSNHI 360

Query: 350 PFRESKLTRLLQDSLGGNTKTALIATISPAKLNAEETCSTLEYATKAKSIKNKPQLGSII 409
           P+RESKLTRLLQDSLGG TKT +IATISPAK++ EET STLEYAT+AKSIKN PQ+   +
Sbjct: 361 PYRESKLTRLLQDSLGGMTKTCIIATISPAKISMEETASTLEYATRAKSIKNTPQVNQSL 420

Query: 410 MKDVRLKDLNNELAKIKRDLTSTKQKDGVYMTQNH 444
            KD  LKD   E+ K++ DL +++ K G+++TQ+ 
Sbjct: 421 SKDTCLKDYIQEIEKLRNDLKNSRNKQGIFITQDQ 455

>TPHA0E00890 Chr5 (181328..185026) [3699 bp, 1232 aa] {ON} Anc_7.387
           YBL063W
          Length = 1232

 Score =  330 bits (845), Expect = 8e-96,   Method: Compositional matrix adjust.
 Identities = 214/522 (40%), Positives = 282/522 (54%), Gaps = 90/522 (17%)

Query: 4   DPQKIEDDTDEMNIMVAVRCRGRNKREXXXXXXXXXXXPDVMGSNEI-SINTSDDI---- 58
           D  K    T + NI V VRCR R +RE               G+  I S N S  +    
Sbjct: 39  DSSKSLSHTKDDNIKVYVRCRSRTQREIDEKSSVVISTLGANGNKVILSPNQSRKLYNTN 98

Query: 59  VSGLT--------------------AQLNSKTYTVDKVFGPSANQRLIFEEIAEPLFNDF 98
            +G T                       N +TYT DKVFG  ++Q  +FE +A+    + 
Sbjct: 99  ANGSTRTKNNTNLNNNIKNATTNSNTGTNGRTYTFDKVFGVESDQETLFESVAKNYIYEM 158

Query: 99  LRGYNCTVLVYGMTSTGKTYTMTGDEKLY-------KGDLSDSAGIIPRVLFKLF----- 146
           L+GYNCTV  YG T TGKTYTM+GD  +        K  L + AGIIPRVL  LF     
Sbjct: 159 LQGYNCTVFAYGQTGTGKTYTMSGDLNILGNLDSKDKILLGEHAGIIPRVLVYLFKELSK 218

Query: 147 ------------------------ETIEFQSDNYVIKCSFIELYNEELKDLLIDSNNTKL 182
                                   E I  ++  Y +K SF+ELYNE+L DLL   +N K 
Sbjct: 219 NDTITNTKVNNNKNNNNNSNNKNEEQINLKNTEYSVKVSFLELYNEKLTDLL---SNYKT 275

Query: 183 KKLRIFDXXXXXXXXXXXXXXXXX---------------HFISGMDLRKXXXXXXXXXXX 227
             L   D                                H   G ++R            
Sbjct: 276 DALNSNDKLINQTSGNSTPYSITNGLNVNDKFKIKNNNLHDFDGKNVR------IMSNQN 329

Query: 228 XTAIQNGNASIYIQNLEEFHIKNAREGIQLLQKGLKYRQVASTKMNDVSSRSHTIFTI-- 285
            +A     +SI ++ +EE +IK+A EG+QLL +G   R+VASTK+ND+SSRSHTIFTI  
Sbjct: 330 KSASNCNGSSITVKGMEEIYIKSAHEGLQLLTEGSLKRKVASTKLNDLSSRSHTIFTIIT 389

Query: 286 NLYKEHK--GEIF-KISKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSI 342
           N+ K     G+ F K  K+NLVDLAGSENI+RSGA+N+RA+EAG IN+SLLTLGRVIN++
Sbjct: 390 NVTKVDPVTGKHFVKTGKLNLVDLAGSENINRSGAENKRAQEAGLINKSLLTLGRVINAL 449

Query: 343 ADKNIHIPFRESKLTRLLQDSLGGNTKTALIATISPAKLNAEETCSTLEYATKAKSIKNK 402
            D++ HIP+RESKLTRLLQDSLGG TKT +IAT+SPAK++ EET STLEYAT+AKSIKN 
Sbjct: 450 VDRSHHIPYRESKLTRLLQDSLGGKTKTCIIATVSPAKISLEETVSTLEYATRAKSIKNT 509

Query: 403 PQLGSIIMKDVRLKDLNNELAKIKRDLTSTKQKDGVYMTQNH 444
           PQ+   + KD  + +  NE+ +++ +L   + K+G+Y+TQ+ 
Sbjct: 510 PQINQSLSKDTFIHEYINEIDRLRNELKLARTKEGIYITQDQ 551

>TPHA0J00300 Chr10 (65794..68742) [2949 bp, 982 aa] {ON} Anc_6.16
           YEL061C
          Length = 982

 Score =  270 bits (690), Expect = 5e-76,   Method: Compositional matrix adjust.
 Identities = 195/625 (31%), Positives = 347/625 (55%), Gaps = 21/625 (3%)

Query: 237 SIYIQNLEEFHIKNAREGIQLLQKGLKYRQVASTKM----NDVSSRSHTIFTINLYKEHK 292
           SIYIQNL+E  I    EG+ +++KGLK R++AST      N+ S RSH+IF I LYKE +
Sbjct: 271 SIYIQNLQEITITEIEEGMAIIKKGLKNRRIASTGSASDKNEFSKRSHSIFNITLYKEEE 330

Query: 293 -GEIFKISKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSIADKNIHIPF 351
             E+F++SK++ V+ AGSE    + ++N      G+ N +L +  ++IN + + + +  F
Sbjct: 331 VNEVFRMSKLSFVNFAGSEYGDNNTSKN------GAFNSNLQSFNKMINGMVNNSTYASF 384

Query: 352 RESKLTRLLQDSLGGNTKTALIATISPAKLNAEETCSTLEYATKAKSIKNKPQLGSIIMK 411
            +SKLT+LLQ++  G T+T  IA I+P K   + TCS L  ATK K IKN+P+ GS+I K
Sbjct: 385 LDSKLTQLLQNNFDGITRTLFIANIAPLKKQLDATCSVLTMATKIKEIKNEPKKGSVITK 444

Query: 412 DVRLKDLNNELAKIKRDLTSTKQKD-GVYMTQNHYKDLTNDLESYKTEIQECDRIVKSLE 470
           +  +K L+NEL K K DL S K  D G+YM + HY +LT  LESYK +IQ     +  L 
Sbjct: 445 ESLIKILSNELVKTKSDLLSYKSNDNGIYMDEKHYSELTKTLESYKEKIQNSKNSINELT 504

Query: 471 LQNALLLKDKKASNEVNKLQELNLNEMTNTLSNIQTTLEIQHKKEQIL--VEELAHSREK 528
            +   +  +K+   E+N+ Q + L  +  T+SN+   LE Q K+E  L  ++   HS   
Sbjct: 505 KKGNEIRIEKRTFEEINERQRIKLQNLRETISNLNCALEKQSKRESELENIKIKLHSILG 564

Query: 529 SLKMKTVIKEYSEKEERIQSNMKSIFNDXXXXXXXXXXXXXXGIAKENLIVQTNVKDNIK 588
           +  M+  +++YS+KE  +Q+ +K +++                I         N+  NI 
Sbjct: 565 N--MQKSVEKYSDKEIHLQNKLKLLYDKELVKLKNSLESNFADIKNRMPDDNDNMNTNID 622

Query: 589 LIKDDVISIVTESQELSKKLFLEFSQQIIKETPLILEMFSSDVKKNQELNETYFANLFEN 648
            IK +++ I  +SQ   K+L    + Q++  +P   E   +++K  +E  E       E 
Sbjct: 623 NIKAEILKIANQSQSKVKELLTNSANQVLDTSPKYFEQLDTNLKNLEESVEINHNKYSEL 682

Query: 649 LESIKQQYSKLNEYFSNDFFKSNHVTIVNDHVNTTKAIIEKSVSDIFKQFQQNMEAFAEQ 708
           L  I ++++ LN Y +++F KS+H  +++ ++N T   ++    +  + F++ ++ + E+
Sbjct: 683 LSDISEEFNNLNNYINDNFLKSSHEELIDTYINRTYHEVQGISVEFTENFKKLLDIYVEK 742

Query: 709 NEKLILENLKTVSSDLIQNEMNSFKEHKSEWDISFKKINHCDYLNNSY---HDQMHTYLR 765
           N K + +++ +++S++++NE+  F   K +W+++  +I   +  N S     ++    L 
Sbjct: 743 NTKSLSKSITSLTSEIVENELTQFNPEKKKWELASNEI--IENFNESITKNKNKNSEILA 800

Query: 766 NMKGKLQSSDEIIKKHMNQIKSNVDSLNSTPKLLNTDRAIGDNYNQIISKRDKLHDHLQI 825
            +  +  S+ E+   +M+ IK NV+ +    ++ N++  I   + +II+K  KL D +  
Sbjct: 801 KLLSESTSTSELFINNMSSIKKNVEIVEEFSEIFNSNDLIKSEFLEIINKNKKLKDLITD 860

Query: 826 SLNSTQNSLLVFDEICKSIQFAFAN 850
           + NS++NS+  FD + +++Q  F N
Sbjct: 861 NFNSSENSIDSFDNLKEAMQNVFKN 885

 Score =  115 bits (289), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 64/189 (33%), Positives = 104/189 (55%), Gaps = 21/189 (11%)

Query: 16  NIMVAVRCRGRNKREXXXXXXXXXXXPDVMGSNEISINTSDDIVSGLTAQLNSKTYTVDK 75
           NI VAVRCR     E           P ++   +    TS++++    +    K YT+D 
Sbjct: 9   NITVAVRCREPIDEEKHSGS------PTIISIGDNEDGTSNEVIVLDESTGRKKIYTLDA 62

Query: 76  VFGPSANQRLIFEEIAEPLFNDFLRGYNCTVLVYGMTSTGKTYTMTGD-EKLYKGDLSDS 134
           V+G   +Q+ +F+E   P +  F  GYN +++ YG   +GK YT+ G+  +L   + ++S
Sbjct: 63  VYGEQDDQKKLFDETVIPFYKSFFDGYNVSIMSYGSRFSGKNYTLYGEYSELQNANNAES 122

Query: 135 A--GIIPRVLFKLFETIEFQSDNYVIKCSFIELYNEELKDLLIDS------------NNT 180
              G++PRVL +LF+ +E   ++++IKCSF+E+YN+EL+DLLID+              +
Sbjct: 123 ENLGVVPRVLSRLFKDLESNGNDHIIKCSFVEIYNDELRDLLIDTGNNANGNNSNGATGS 182

Query: 181 KLKKLRIFD 189
             KKLRI D
Sbjct: 183 TGKKLRIVD 191

>TBLA0D00640 Chr4 (168893..172321) [3429 bp, 1142 aa] {ON} Anc_7.387
           YBL063W
          Length = 1142

 Score =  272 bits (695), Expect = 6e-76,   Method: Compositional matrix adjust.
 Identities = 197/497 (39%), Positives = 260/497 (52%), Gaps = 116/497 (23%)

Query: 12  TDEMNIMVAVRCRGRNKREXXXXXXXXXXXPDVMGSNEISINTSDDIVSGLTAQLNSKTY 71
           T   NI V VRCR RN++E              +G N   I     I+S  T   N   Y
Sbjct: 5   THNSNIKVYVRCRSRNQKEIDEKSSVVVS---TLGQNGNQI-----IISNST---NKNKY 53

Query: 72  TVDKVFGPSANQRLIFEEIAEPLFNDFLRGYNCTVLVYGMTSTGKTYTMTGDEKLYKGDL 131
             D VFG  ++Q  IF  +A     + + GYNCT+  YG T TGKTYTM+GD  +  GDL
Sbjct: 54  IFDNVFGVESDQESIFNSVAYNYIQEMIDGYNCTLFAYGQTGTGKTYTMSGDLNII-GDL 112

Query: 132 SDS--------AGIIPRVLFKLFETIEFQSDN--------YVIKCSFIELYNEELK---- 171
           + +        AGIIPRVL +LF ++E    N        Y +K SF+ELYNE LK    
Sbjct: 113 NSTKNILLGEHAGIIPRVLVQLFTSLEDSISNQKNTSVKGYTVKISFLELYNERLKDLLS 172

Query: 172 ---DLLIDSNNTKL------KKLRIFDXXXXXXXXXXXXXXXXXHFISGMDLRKXXXXXX 222
              DL  +S ++          ++IFD                                 
Sbjct: 173 ADADLPPNSGSSSANDPSVSSNIKIFDNK------------------------------- 201

Query: 223 XXXXXXTAIQNGNASIYIQNLEEFHIKNAREGIQLLQKGLKYRQVASTKMNDVSSRSHTI 282
                     + ++SI ++ ++E  IKNA EG+ LL KG   R+V STK+ND+SSRSHTI
Sbjct: 202 ---------DSSDSSIIVKGMQEIFIKNAMEGLNLLMKGSLQRKVKSTKLNDLSSRSHTI 252

Query: 283 FTIN-----LYKEHKGEIFKISKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGR 337
           FTI      L  +   E  KI K+NLVDLAGSENI++SG +  R++E G IN+SLLTLGR
Sbjct: 253 FTITTNIIKLDNQTNKEYIKIGKLNLVDLAGSENITKSGLK--RSQETGLINKSLLTLGR 310

Query: 338 VINSIADK--NIH----------------------IPFRESKLTRLLQDSLGGNTKTALI 373
           VIN+++DK  N H                      IP+RESKLTRLLQDSLGG TKT +I
Sbjct: 311 VINALSDKTNNTHGSNNDNNNSSSSSSISNSHHSHIPYRESKLTRLLQDSLGGMTKTCII 370

Query: 374 ATISPAKLNAEETCSTLEYATKAKSIKNKPQLGSIIMKDVRLKDLNNELAKIKRDL-TST 432
           ATISPAK   +ET STLEYAT+A SIKN P++         + D  N++ ++K +L TST
Sbjct: 371 ATISPAKTCLDETISTLEYATRAMSIKNNPKINKSQNPSNFINDYINQIDRLKLELQTST 430

Query: 433 KQKDGVYMT---QNHYK 446
            +  G+++     N+YK
Sbjct: 431 DKIGGIFIPLEKLNYYK 447

>SAKL0G05016g Chr7 (415990..417504) [1515 bp, 504 aa] {ON} weakly
           similar to uniprot|P53086 Saccharomyces cerevisiae
           YGL216W KIP3 Kinesin-related motor protein involved in
           mitotic spindle positioning
          Length = 504

 Score =  191 bits (484), Expect = 2e-51,   Method: Compositional matrix adjust.
 Identities = 143/444 (32%), Positives = 222/444 (50%), Gaps = 81/444 (18%)

Query: 16  NIMVAVRCRGRNKREXXXXXXXXXXXPDVMGSNEISINTSDDIVSGLTAQLNSKTYTVDK 75
           NI VAVR R    RE           P      +  I+TS  + +    Q   K +T D 
Sbjct: 4   NIKVAVRLRSPLPREHGQPIITQVTSPTSFVIQQ-HISTSSLLATEEFTQ--GKIFTFDH 60

Query: 76  VFGPSAN----QRLIFEEIAEPLFNDFLRGYNCTVLVYGMTSTGKTYTMTGDE--KLYKG 129
            F  S N    Q +I++ I        L GYN  +L YG T +GK++TM G E  K +  
Sbjct: 61  CFKYSENASHDQEVIYDTIGREYLLHTLDGYNTCILAYGQTGSGKSFTMMGPEVSKHFHN 120

Query: 130 D-------LSDSA-GIIPRVLFKLFETIEFQSD-------NYVIKCSFIELYNEELKDLL 174
           +       + DSA GIIPRV   LF+     +         + I CS++E+YNE+++DLL
Sbjct: 121 NQTALDRAIEDSAIGIIPRVCCDLFDICNMCNSEEDGIKTQFEIYCSYLEIYNEQVRDLL 180

Query: 175 IDSNNTKLKKLRIFDXXXXXXXXXXXXXXXXXHFISGMDLRKXXXXXXXXXXXXTAIQNG 234
            +  +    K R+ +                                             
Sbjct: 181 SEDGS----KCRVRE-------------------------------------------RA 193

Query: 235 NASIYIQNLEEFHIKNAREGIQLLQKGLKYRQVASTKMNDVSSRSHTIFTINLYKEH--- 291
           + + +++ L EF +    E ++ +++G + R V  T MN+ SSRSH IFTI++ +     
Sbjct: 194 DKTTFVEGLNEFKVCKVEEILEYMKQGDRLRTVGVTNMNNSSSRSHAIFTISIKQSETTL 253

Query: 292 KGEIF-KISKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSIADKNIH-- 348
            G++  + S + LVDLAGSE +S +GA+  R KE  +IN+SL TLGRV++ +A KN    
Sbjct: 254 AGDLTERRSSIKLVDLAGSERVSTTGARGDRLKEGSNINKSLTTLGRVVSVLAKKNRPKL 313

Query: 349 IPFRESKLTRLLQDSLGGNTKTALIATISPAKLNAEETCSTLEYATKAKSIKNKPQLGS- 407
           IP+R+S LT +L+++LGGN+KT +IA +SP   + EET STL YAT AK +KN  ++ S 
Sbjct: 314 IPYRDSALTWVLKENLGGNSKTVMIACVSPC--DYEETISTLRYATTAKEVKNTARVNSS 371

Query: 408 -IIMKDVRLKDLNNELAKIKRDLT 430
             +    +L  + N+L +++++L+
Sbjct: 372 ESLKNKEQLVTMRNQLEELQKELS 395

>KLTH0G03850g Chr7 (308053..309474) [1422 bp, 473 aa] {ON} some
           similarities with uniprot|P28742 Saccharomyces
           cerevisiae YBL063W
          Length = 473

 Score =  187 bits (474), Expect = 2e-50,   Method: Compositional matrix adjust.
 Identities = 120/366 (32%), Positives = 190/366 (51%), Gaps = 81/366 (22%)

Query: 82  NQRLIFEEIAEPLFNDFLRGYNCTVLVYGMTSTGKTYTMTGDEKLYKGDLSDSAGIIPRV 141
           +Q  ++E++A       L GYN  +  YG T +GK++TMTG  +L         GI+PR+
Sbjct: 62  DQAQLYEQLARDYLLHALDGYNTCIFAYGQTGSGKSHTMTGSAEL--------PGIVPRM 113

Query: 142 LFKLFETIEF-------QSDNYVIKCSFIELYNEELKDLLIDSNNTKLKKLRIFDXXXXX 194
             +LFE  E         S  + I+CS++E+YNE ++DLL  +N  +++           
Sbjct: 114 CQELFEVREMYESSDDQASTQFKIRCSYLEIYNETVRDLL-GANKCRIR----------- 161

Query: 195 XXXXXXXXXXXXHFISGMDLRKXXXXXXXXXXXXTAIQNGNASIYIQNLEEFHIKNAREG 254
                                                +  + + +++ L+EF + +  E 
Sbjct: 162 -------------------------------------ERADKTTFVEGLQEFEVNSVDEI 184

Query: 255 IQLLQKGLKYRQVASTKMNDVSSRSHTIFTINLYKEHKGEIFKI----SKMNLVDLAGSE 310
           +  L++G + + V +T +N+ SSRSHTIFTIN+ ++    +  +    S + L+DLAGSE
Sbjct: 185 LDYLRQGSERKTVGATLVNEQSSRSHTIFTINVEQKENSPLGHVLERRSSIRLIDLAGSE 244

Query: 311 NISRSGAQNQRAKEAGSINQSLLTLGRVINSIADKNIH--IPFRESKLTRLLQDSLGGNT 368
             + SGA  +R KE  +IN+SL TLGRVI  +A K     IP+R++ LT +L++SLGGN+
Sbjct: 245 RANASGATGERLKEGSNINKSLSTLGRVIAMLAKKKQPRLIPYRDAALTWVLKESLGGNS 304

Query: 369 KTALIATISPAKLNAEETCSTLEYATKAKSIKNKPQL-------GSIIMKDVR--LKDLN 419
           KT +IA +SP     EET STL YAT A+S+K   QL       G + M  +R  L +L 
Sbjct: 305 KTCMIACVSPCDF--EETMSTLRYATLARSVKTFAQLNTQETVDGKVQMLAMRQQLDELQ 362

Query: 420 NELAKI 425
             L+++
Sbjct: 363 GALSRV 368

>SAKL0G18920g Chr7 complement(1634668..1636617) [1950 bp, 649 aa]
           {ON} weakly similar to uniprot|P32364 Saccharomyces
           cerevisiae YKL079W SMY1 not believed to act as a
           kinesin, colocalizes with Myo2p; kinesin heavy chain
           homolog
          Length = 649

 Score =  186 bits (472), Expect = 8e-49,   Method: Compositional matrix adjust.
 Identities = 122/350 (34%), Positives = 186/350 (53%), Gaps = 59/350 (16%)

Query: 63  TAQLNSKTYTVDKVFGPSANQRLIFEEIAEPLFNDFLRGYNCTVLVYGMTSTGKTYTMTG 122
           + Q N + +T D+VF   + Q  ++E +A  +   F +GYN T+L YG T +GK++TM G
Sbjct: 67  STQNNDRLFTFDRVFDTGSTQESVYEFVAGDMLKSFFQGYNGTILAYGQTGSGKSHTMFG 126

Query: 123 DEKLYKGDLSDSAGIIPRV---LFKLFETIEFQSDNYVIKCSFIELYNEELKDLLIDSNN 179
            +        ++ G+IPR+   +FK  ET +++   + +  SF+E+Y E++ DLL  S  
Sbjct: 127 PK--------ENRGVIPRICHDIFKQIETPDYEDCIFTVSVSFMEVYLEKIYDLLAQSLE 178

Query: 180 TKLKKLRIFDXXXXXXXXXXXXXXXXXHFISGMDLRKXXXXXXXXXXXXTAIQNGNASIY 239
               K RI                     +S  D +                   ++ IY
Sbjct: 179 KPADK-RIS--------------------LSLHDTK-------------------DSGIY 198

Query: 240 IQNLEEFHIKNAREGIQLLQKGLKYRQVASTKMNDVSSRSHTIFTINLYKEHK-GEIFKI 298
           ++ L   ++ + +E +  +++G   R V+ST MN  SSRSH+I  INL K +   E  + 
Sbjct: 199 VKGLNTNYVTSEQELLDYIKQGESQRNVSSTSMNLESSRSHSIVRINLEKRNALEENIQH 258

Query: 299 SKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSIAD-------KNIHIPF 351
           S + LVDLAGSE + ++ A     +EA  IN SL  LG VIN++          + HIP+
Sbjct: 259 SFLYLVDLAGSEKVGKTNAAGVTLEEAKKINSSLSALGNVINALTQVESKSKRTSAHIPY 318

Query: 352 RESKLTRLLQDSLGGNTKTALIATISPAKLNAEETCSTLEYATKAKSIKN 401
           R+SKLTRLLQDSLGGN+KT LI   S ++ N +ET STL + ++AK IKN
Sbjct: 319 RDSKLTRLLQDSLGGNSKTTLILNCSTSRFNEQETLSTLRFGSRAKKIKN 368

>Ecym_3415 Chr3 (782976..784964) [1989 bp, 662 aa] {ON} similar to
           Ashbya gossypii ADR145C
          Length = 662

 Score =  186 bits (472), Expect = 9e-49,   Method: Compositional matrix adjust.
 Identities = 123/359 (34%), Positives = 186/359 (51%), Gaps = 52/359 (14%)

Query: 53  NTSDDIVSGLTAQLNSKTYTVDKVFGPSANQRLIFEEIAEPLFNDFLRGYNCTVLVYGMT 112
           +TS    +G+  +  S+++  D VFG ++ Q  +++ +AE + + F  GYN T+L YG T
Sbjct: 69  DTSPGSTNGVQGESPSRSFHFDYVFGTNSTQDDVYDFVAEEMLDQFFTGYNSTILAYGQT 128

Query: 113 STGKTYTMTGDEKLYKGDLSDSAGIIPRVLFKLFETIEFQSDN----YVIKCSFIELYNE 168
            +GK+YTM G          D+ G+IPR+  ++FE I     +    YV+  SF+E+Y E
Sbjct: 129 GSGKSYTMFGP--------IDNRGLIPRICHEIFERIGLLKSSADIEYVVSVSFLEIYLE 180

Query: 169 ELKDLLIDSNNTKLKKLRIFDXXXXXXXXXXXXXXXXXHFISGMDLRKXXXXXXXXXXXX 228
           ++ DLL +S N      +  +                                       
Sbjct: 181 KVYDLLGESINKSASPKKTSEKRTSL---------------------------------- 206

Query: 229 TAIQNGNASIYIQNLEEFHIKNAREGIQLLQKGLKYRQVASTKMNDVSSRSHTIFTINLY 288
           T  ++    +Y+Q+     + +  E +  +  G   R  +ST MN  SSRSH I  INL 
Sbjct: 207 TIHESSTFGVYVQSATVISVSDGDELLHCIHLGESQRCKSSTDMNFESSRSHAIVKINLL 266

Query: 289 KEH--KGEIFKISKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSIADKN 346
           K    +G I K S + LVDLAGSE +S++ A     +EA  IN SL +LG VIN++  K+
Sbjct: 267 KRDNLEGSIQK-SDLFLVDLAGSEKVSKTNAVGATLEEAKKINLSLSSLGNVINALTQKD 325

Query: 347 ---IHIPFRESKLTRLLQDSLGGNTKTALIATISPAKLNAEETCSTLEYATKAKSIKNK 402
               HIP+R+S+LTRLL+DSLGGN+KT LI   +  K N  ET +TL + ++AK I+NK
Sbjct: 326 KKRTHIPYRDSQLTRLLRDSLGGNSKTTLILNCACDKSNEAETLTTLRFGSRAKQIENK 384

>ADR145C Chr4 complement(959805..961712) [1908 bp, 635 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YKL079W
           (SMY1)
          Length = 635

 Score =  182 bits (462), Expect = 1e-47,   Method: Compositional matrix adjust.
 Identities = 149/475 (31%), Positives = 228/475 (48%), Gaps = 74/475 (15%)

Query: 42  PDVMGSNEISINTSDDIVSGLTAQLNSKTYTVDKVFGPSANQRLIFEEIAEPLFNDFLRG 101
           P   G +   +   +  V    A   ++ +  D VFG  A Q  +F+ +AE + + F  G
Sbjct: 31  PLPEGGSAAVVAADEGTVEFAGAADEARAFRFDYVFGTDARQEEVFDYVAEEMLDQFFTG 90

Query: 102 YNCTVLVYGMTSTGKTYTMTGDEKLYKGDLSDSAGIIPRVLFKLFETIEFQSD----NYV 157
           YN T+L YG T +GK+YTM G             G+IPR+  ++FE I    +     YV
Sbjct: 91  YNSTILAYGQTGSGKSYTMFGP--------PGHRGLIPRICQQIFERIGLLKNCADIEYV 142

Query: 158 IKCSFIELYNEELKDLLIDSNNTKLKKLRIFDXXXXXXXXXXXXXXXXXHFISGMDLRKX 217
           +  SF+E+Y E++ DLL +S N      +  D                            
Sbjct: 143 VSVSFLEIYLEKVYDLLGESINKASSPKKNSDKRASL----------------------- 179

Query: 218 XXXXXXXXXXXTAIQNGNASIYIQNLEEFHIKNAREGIQLLQKGLKYRQVASTKMNDVSS 277
                      T  ++    +Y++      + +  E +  +  G   R   ST MN  SS
Sbjct: 180 -----------TVHESNTFGVYVEGATIVSVSDGDELLNCIHLGEAQRYKGSTDMNLESS 228

Query: 278 RSHTIFTINLYKEH--KGEIFKISKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTL 335
           RSH I  INL K    +G I K S + LVDLAGSE ++++ A     +EA  IN SL +L
Sbjct: 229 RSHAIVKINLLKRDNLEGNIQK-SDLFLVDLAGSEKVAKTNAVGATLEEAKKINLSLSSL 287

Query: 336 GRVINSIA--DKNIHIPFRESKLTRLLQDSLGGNTKTALIATISPAKLNAEETCSTLEYA 393
           G VIN++   +K  HIP+R+S+LTRLL+DSLGGN+KT LI   +  K N  ET +TL + 
Sbjct: 288 GNVINALTQKEKRTHIPYRDSQLTRLLRDSLGGNSKTTLILNCACDKSNESETLTTLRFG 347

Query: 394 TKAKSIKNKPQLGSIIMK-DVRLKDLNNELAKIKRDLTSTKQKDGVYMTQNHYKDLTNDL 452
           ++AK IKNK    +I+ K D+ LK       K++R +   ++K+  Y T+         +
Sbjct: 348 SRAKHIKNK----AIVNKSDLFLKK------KLERKIAQLEKKEQDYKTR---------I 388

Query: 453 ESYKTEIQECDRIV--KSLELQNALLLKDKKASNEVNKLQELNLNEMTNTLSNIQ 505
           E  + E++E       + L  +  LL ++ K   +V+ L+ L LN  T++L   Q
Sbjct: 389 ELLEHEVKELQATASHRPLPEEVDLLAENTKLRAQVDSLKVL-LNPRTDSLDTEQ 442

>Ecym_4066 Chr4 (146761..148197) [1437 bp, 478 aa] {ON} similar to
           Ashbya gossypii ACR228C - AER441C - ADR145C
          Length = 478

 Score =  177 bits (450), Expect = 3e-47,   Method: Compositional matrix adjust.
 Identities = 137/437 (31%), Positives = 216/437 (49%), Gaps = 93/437 (21%)

Query: 16  NIMVAVRCRGRNKREXXXXXXXXXXXPDVM---GSNEISI---NTSDDIVSGLTAQLNSK 69
           NI VA+R R +  RE           P V+    SNEI++   NT++ I +         
Sbjct: 4   NIKVAIRIRDKISRETSR--------PSVIKRKTSNEITLQKDNTANVITT------VEH 49

Query: 70  TYTVDKVFGPSANQRLIFEEIAEPLFNDFLRGYNCTVLVYGMTSTGKTYTMTGDEKLYKG 129
           T+  D+VF  S+NQ+ I+ E+A       L GY+  V+ YG T  GKTYTM G E+    
Sbjct: 50  TFYFDQVFDESSNQKQIYHELAREYILKALEGYHTCVIAYGQTGAGKTYTMMGTEQ---- 105

Query: 130 DLSDSAGIIPRVLFKLFETIEFQSD---------NYVIKCSFIELYNEELKDLLIDSNNT 180
                 GIIP V  +LF+ I+   D         ++ +  S+ ++YNE++ D+L    N 
Sbjct: 106 ----EPGIIPLVSHELFKIIDMCQDEGPDEDALVHFKVTVSYFQIYNEQIYDMLSGGCNV 161

Query: 181 KLKKLRIFDXXXXXXXXXXXXXXXXXHFISGMDLRKXXXXXXXXXXXXTAIQNGNASIYI 240
               LR+ D                         RK                      YI
Sbjct: 162 ----LRVRDGP-----------------------RKVT--------------------YI 174

Query: 241 QNLEEFHIKNAREGIQLLQKGLKYRQVASTKMNDVSSRSHTIFTINLYKEH----KGEIF 296
           + L +  + +  E ++ +++G   R VA T +N+ SSRSH I TIN+ +         + 
Sbjct: 175 EGLSDRIVNSCEELLKCIEEGSARRSVAGTAVNENSSRSHAICTINIQQTEIDSFGDTVE 234

Query: 297 KISKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSIADKNI-HIPFRESK 355
           ++S + LVDLAGSE    S  +++R KE  +IN+SL+TL RV+  +++  +  +P+RES 
Sbjct: 235 RVSSIKLVDLAGSERTKVSKTKDERFKEGTNINKSLMTLRRVVTMLSNNKVTGVPYRESL 294

Query: 356 LTRLLQDSLGGNTKTALIATISPAKLNAEETCSTLEYATKAKSIKNKPQLGS--IIMKDV 413
           LTR+L+D+L GN+ T ++A ISP   + EE+ STL YA+ AK ++ +  L +  I   + 
Sbjct: 295 LTRVLRDNLDGNSITCILACISPC--DYEESISTLRYASTAKHVRTEAHLNTTQISKGEE 352

Query: 414 RLKDLNNELAKIKRDLT 430
           +L  L N+L +++  LT
Sbjct: 353 QLFSLQNQLKELQATLT 369

>Kwal_47.18608 s47 complement(896394..897833) [1440 bp, 479 aa] {ON}
           YGL216W (KIP3) - kinesin-related protein involved in
           mitosis [contig 192] FULL
          Length = 479

 Score =  172 bits (436), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 113/355 (31%), Positives = 185/355 (52%), Gaps = 76/355 (21%)

Query: 68  SKTYTVDKVFGPS----ANQRLIFEEIAEPLFNDFLRGYNCTVLVYGMTSTGKTYTMTGD 123
           ++++  D+ F  S    A+Q  ++E+++       L GY+  V  YG T +GK++TMTG 
Sbjct: 44  TRSFHFDQCFAYSENIEADQLELYEQLSREYLLHALDGYHTCVFAYGQTGSGKSHTMTGS 103

Query: 124 EKLYKGDLSDSAGIIPRVLFKLFETIEF--QSDNYV-----IKCSFIELYNEELKDLLID 176
                    +S GI+ R+  +LFE  E    SD+ V     I+CS++E+YNE ++DLL  
Sbjct: 104 --------PESPGIVSRMCQELFEVREIYESSDDQVNTQFKIRCSYLEIYNETVRDLL-- 153

Query: 177 SNNTKLKKLRIFDXXXXXXXXXXXXXXXXXHFISGMDLRKXXXXXXXXXXXXTAIQNGNA 236
              T   ++R                                             +  + 
Sbjct: 154 --GTGRCRIR---------------------------------------------ERADK 166

Query: 237 SIYIQNLEEFHIKNAREGIQLLQKGLKYRQVASTKMNDVSSRSHTIFTINLYKEHKGEIF 296
           + +++ L EF + +  + +  +++G + R + ST +N+ SSRSHTIFTI++ ++ K  + 
Sbjct: 167 TTFVEGLREFDVSSVEDILNYVKQGNEKRMMGSTLVNEYSSRSHTIFTISIKQKEKSALG 226

Query: 297 KI----SKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSIADKNIH--IP 350
            +    S + L+DLAGSE    +     R KE  +IN+SL TLGRVI+ +A +     IP
Sbjct: 227 HVIERHSSIKLIDLAGSERAKAAKTSGDRLKEGSNINKSLSTLGRVISMLAKRKQPKLIP 286

Query: 351 FRESKLTRLLQDSLGGNTKTALIATISPAKLNAEETCSTLEYATKAKSIKNKPQL 405
           +R++ LT +L++SLGGN+KT +IA +SP   + EET STL YAT A+++K   QL
Sbjct: 287 YRDAALTWVLKESLGGNSKTCMIACVSPC--DYEETLSTLRYATLARNVKTCAQL 339

>ZYRO0D12650g Chr4 (1071620..1073056) [1437 bp, 478 aa] {ON} some
           similarities with uniprot|P28742 Saccharomyces
           cerevisiae YBL063W KIP1
          Length = 478

 Score =  169 bits (429), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 121/363 (33%), Positives = 180/363 (49%), Gaps = 78/363 (21%)

Query: 68  SKTYTVDKVFGPS----ANQRLIFEEIAEPLFNDFLRGYNCTVLVYGMTSTGKTYTMTGD 123
           +K +  D  FG +     +Q +I+E +        L GYN  +L YG T +GKT+TM G+
Sbjct: 49  AKEFRYDHCFGSTDSVDRDQSIIYESLVRGYVLHTLEGYNSCILAYGQTGSGKTFTMMGE 108

Query: 124 EKLYKGDLSDSAGIIPRVLFKLFETIEF------QSD---NYVIKCSFIELYNEELKDLL 174
               KG+     GI+PR   +LFE          +SD   ++ +KCSF E+YNE++ DLL
Sbjct: 109 ----KGN----EGIVPRFCRELFEVFHMCHQDDQESDIITDFQVKCSFFEIYNEQVIDLL 160

Query: 175 IDSNNTKLKKLRIFDXXXXXXXXXXXXXXXXXHFISGMDLRKXXXXXXXXXXXXTAIQNG 234
              +  K K                              +R                +  
Sbjct: 161 SSLSQRKCK------------------------------IR----------------ERH 174

Query: 235 NASIYIQNLEEFHIKNAREGIQLLQKGLKYRQVASTKMNDVSSRSHTIF--TINLYKEHK 292
           + S +++ LEE  + N  E I  + KG + R V ST MN  SSRSH IF  ++N  + HK
Sbjct: 175 DHSTFVEGLEEIAVHNVEELISCIHKGNENRTVRSTNMNQESSRSHAIFHISVNQKETHK 234

Query: 293 --GEIFKI-SKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSIAD----K 345
             G + +  S   LVDLAGSE +  + A  +  +E  SIN+SL  LGRVI+ +A+    +
Sbjct: 235 KTGTVVECHSTCKLVDLAGSERLGSAAADGKIRQEGTSINKSLSILGRVISLLAEGDRQR 294

Query: 346 NIHIPFRESKLTRLLQDSLGGNTKTALIATISPAKLNAEETCSTLEYATKAKSIKNKPQL 405
           +  IP+RES LT +L+++LGGN+ T L+A +SP   N  E+ STL YA+  K +K    +
Sbjct: 295 SQMIPYRESALTWILKENLGGNSNTCLVACVSPE--NYYESLSTLRYASLTKKVKTNATI 352

Query: 406 GSI 408
            S+
Sbjct: 353 NSM 355

>Kpol_1004.25 s1004 (54983..56503) [1521 bp, 506 aa] {ON}
           (54983..56503) [1521 nt, 507 aa]
          Length = 506

 Score =  170 bits (430), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 121/357 (33%), Positives = 166/357 (46%), Gaps = 81/357 (22%)

Query: 74  DKVFGPSANQRLIFEEIAEPLFNDFLRGYNCTVLVYGMTSTGKTYTMTGDEKLYKGDLSD 133
           D+ FG   +Q   ++        D L GYNC +L YG T +GKTYTM G+ K      +D
Sbjct: 64  DEGFGKINSQSEFYKGSINHFVKDALNGYNCCILAYGQTGSGKTYTMMGESK------ND 117

Query: 134 SAGIIPRVLFKLFETIEF----------QSDNYVIKCSFIELYNEELKDLLIDSNNTKLK 183
           + G+IPR    LF  IE           Q   Y + CS  E+YNE++ DLL  +      
Sbjct: 118 TRGVIPRFCEDLFHEIESIKIKDSSDLSQRSEYKVVCSIFEIYNEQIIDLLEMNEVQSCS 177

Query: 184 KLRIFDXXXXXXXXXXXXXXXXXHFISGMDLRKXXXXXXXXXXXXTAIQNGNASIYIQNL 243
           K R+                                            +N + S+YI+N+
Sbjct: 178 KYRVR-------------------------------------------ENRDRSMYIENI 194

Query: 244 EEFHIKNAREGIQLLQKGLKYRQVASTKMNDVSSRSHTIFTINLYKEH-----KGEIFKI 298
            E  + N  + I+ ++ G + R   ST MN  SSRSH I +I + +          I   
Sbjct: 195 TEIEVSNIDQMIKCVKMGFRNRTTRSTNMNVNSSRSHAIVSITIKRTDIDLNTNSSIISD 254

Query: 299 SKMNLVDLAGSE-NISRSGAQNQRAKEAGSINQSLLTLGRVINSIADK------------ 345
           S    VDLAGSE + +     N R KE  SIN+SL TL RV+ S+  +            
Sbjct: 255 SICRFVDLAGSERSTATQNCHNDRLKEGNSINKSLSTLRRVLTSLKKREELKYNSNSNSS 314

Query: 346 --NIHIPFRESKLTRLLQDSLGGNTKTALIATISPAKLNAEETCSTLEYATKAKSIK 400
             NI +PFRES LT +L+D+LGGN+KT +IA ISP   N EE+ STL YA  A++IK
Sbjct: 315 AHNIVVPFRESLLTWILKDNLGGNSKTCIIACISPT--NFEESASTLRYADIAQTIK 369

>KAFR0F04210 Chr6 complement(826173..828191) [2019 bp, 672 aa] {ON}
           Anc_3.528 YGL216W
          Length = 672

 Score =  172 bits (437), Expect = 3e-44,   Method: Compositional matrix adjust.
 Identities = 121/345 (35%), Positives = 176/345 (51%), Gaps = 66/345 (19%)

Query: 71  YTVDKVFGPSANQRLIFEEIAEPLFNDFLRGYNCTVLVYGMTSTGKTYTMTGDEKLYKGD 130
           +  DK+F   + Q  IFE+   PL +  L G+N TV  YG T  GKTYT+ G        
Sbjct: 92  FIFDKLFDDDSTQEQIFEDTTRPLLDSVLDGFNGTVFAYGATGCGKTYTING-------- 143

Query: 131 LSDSAGIIPRVLFKLFETIE--FQSDNYV---IKCSFIELYNEELKDLLIDSNNTKLKKL 185
            S+  GII R + +LF  IE   Q  N     I  S++E+YNE ++DLL     T  KKL
Sbjct: 144 TSEDPGIIFRTMNELFGKIEILLQDSNRSKIEISLSYLEIYNETIRDLL--KPETPSKKL 201

Query: 186 RIFDXXXXXXXXXXXXXXXXXHFISGMDLRKXXXXXXXXXXXXTAIQNGNASIYIQNLEE 245
            I                                            ++ N+ I + NL  
Sbjct: 202 IIR-------------------------------------------EDQNSKISVTNLSY 218

Query: 246 FHIKNAREGIQLLQKGLKYRQVASTKMNDVSSRSHTIFTINLYKEHK-----GEIFKI-S 299
              +N ++ I L+ +G   R  + T+ N+VSSRSH++  I++ +  K     G   +I S
Sbjct: 219 HRPENVQDVIDLVIRGNLNRSSSPTEANEVSSRSHSVLQIHVKQVLKNFDDIGSTNQIDS 278

Query: 300 KMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSIA--DKNIHIPFRESKLT 357
            ++++DLAGSE    +  +  R  E  +IN+SLL LG  IN++    K+ HIP+R+SKLT
Sbjct: 279 TLSIIDLAGSERAITTKNRGIRLYEGANINKSLLALGNCINALCINKKSCHIPYRDSKLT 338

Query: 358 RLLQDSLGGNTKTALIATISPAKLNAEETCSTLEYATKAKSIKNK 402
           RLL+ SLGGN KT +I  +SP+ L+ +ET +TL+YA +AK IK K
Sbjct: 339 RLLKFSLGGNCKTVMIVCVSPSSLHYDETLNTLKYANRAKEIKTK 383

>KLLA0B00759g Chr2 (59965..61335) [1371 bp, 456 aa] {ON} some
           similarities with uniprot|P28742 Saccharomyces
           cerevisiae YBL063W KIP1 Kinesin-related motor protein
           required for mitotic spindle assembly and chromosome
           segregation; functionally redundant with Cin8p
          Length = 456

 Score =  167 bits (423), Expect = 7e-44,   Method: Compositional matrix adjust.
 Identities = 114/345 (33%), Positives = 176/345 (51%), Gaps = 63/345 (18%)

Query: 69  KTYTVDKVFGPSANQRLIFEEIAEPLFNDFLRGYNCTVLVYGMTSTGKTYTMTGDEKLYK 128
           +++  D +F  S++Q  I  E+        L GYN  +  YG T +GKTYTM G      
Sbjct: 35  RSFNFDHIFDTSSSQTDIPGELCSKYVLHALEGYNACIFAYGQTGSGKTYTMRGT----- 89

Query: 129 GDLSDSAGIIPRVLFKLFETIEF-QSDNYVIKCSFIELYNEELKDLLIDSNNTKLKKLRI 187
              + + GIIP +   LF+ +E  ++    +  ++ E+YNE+L DLL D++     ++R 
Sbjct: 90  ---NSNPGIIPLLCRDLFDALELDKTTVSSVSITYFEIYNEKLIDLLGDTS----PRVR- 141

Query: 188 FDXXXXXXXXXXXXXXXXXHFISGMDLRKXXXXXXXXXXXXTAIQNGNASIYIQNLEEFH 247
                                                       +  +   ++Q++  F 
Sbjct: 142 --------------------------------------------ETNDKKTFVQDITTFK 157

Query: 248 IKNAREGIQLLQKGLKYRQVASTKMNDVSSRSHTIFTINLYKEHKGEIFKISKMNLVDLA 307
           +    E ++ L  G   R VAST+MN  SSRSH IFT+++ ++      + S + LVDLA
Sbjct: 158 VNRVEEVLEYLSIGDSKRSVASTRMNMESSRSHAIFTLSIKQQEPDGSIRESDLKLVDLA 217

Query: 308 GSENISRS-GAQN-QRAKEAGSINQSLLTLGRVINSIADKNIH-IPFRESKLTRLLQDSL 364
           GSE  + + G  N +R KE  +IN+SL TLGR I+ +A  + H IP+R+S LT +L+++L
Sbjct: 218 GSERANATMGIDNGKRMKEGANINKSLSTLGRCISQLAKNSKHLIPYRDSLLTWVLKENL 277

Query: 365 GGNTKTALIATISPAKLNAEETCSTLEYATKAKSIKNKPQLGSII 409
           GGN+KT +IA ISP  L  EE+ STL YAT AK IK +  +  I+
Sbjct: 278 GGNSKTCMIACISPIDL--EESLSTLRYATTAKEIKLRATMNEIV 320

>ZYRO0E08668g Chr5 complement(694586..696922) [2337 bp, 778 aa] {ON}
           similar to uniprot|P53086 Saccharomyces cerevisiae
           YGL216W KIP3 Kinesin-related motor protein involved in
           mitotic spindle positioning
          Length = 778

 Score =  172 bits (435), Expect = 1e-43,   Method: Compositional matrix adjust.
 Identities = 109/343 (31%), Positives = 176/343 (51%), Gaps = 64/343 (18%)

Query: 71  YTVDKVFGPSANQRLIFEEIAEPLFNDFLRGYNCTVLVYGMTSTGKTYTMTGDEKLYKGD 130
           +  D++F   + Q+ ++E    PL +  L G+N TV  YG T  GKTYT++G        
Sbjct: 128 FVFDRLFDVDSTQKDVYESTMIPLLDSVLDGFNGTVFAYGATGCGKTYTISGS------- 180

Query: 131 LSDSAGIIPRVLFKLFETIEFQSD--NYVIKCSFIELYNEELKDLLIDSNNTKLKKLRIF 188
             ++ GII + + +LF  IE   D  ++ +  SF+E+YNE ++DLL     T  KKL I 
Sbjct: 181 -PENPGIIFQAMQELFNRIENLKDTKHFELSLSFLEIYNESIRDLLCPE--TSSKKLVI- 236

Query: 189 DXXXXXXXXXXXXXXXXXHFISGMDLRKXXXXXXXXXXXXTAIQNGNASIYIQNLEEFHI 248
                                                     +++ N SI + NL  ++ 
Sbjct: 237 ------------------------------------------LEDSNESIRVSNLSHYNP 254

Query: 249 KNAREGIQLLQKGLKYRQVASTKMNDVSSRSHTIFTINLYKEHKGEIFK----ISKMNLV 304
           +   + + L+ KG   R  ++T  N+ SSRSH +  I++ + ++    K     + ++++
Sbjct: 255 QKVEDVMDLVIKGNMNRTTSATDANEASSRSHAVLQIHIMQHNRTADLKSDHTFATLSII 314

Query: 305 DLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSIA-----DKNIHIPFRESKLTRL 359
           DLAGSE  + +  +  R  E  +IN+SLL LG  IN++       ++ H+P+R+SKLTRL
Sbjct: 315 DLAGSERAATTKNRGNRLYEGANINRSLLALGNCINALCLNDGTRRSCHVPYRDSKLTRL 374

Query: 360 LQDSLGGNTKTALIATISPAKLNAEETCSTLEYATKAKSIKNK 402
           L+ SLGGN KT +I  ISP+  + +ET +TL+YA +AK IK K
Sbjct: 375 LKFSLGGNCKTVMIVCISPSSTHYDETLNTLKYANRAKEIKTK 417

>TBLA0C04960 Chr3 complement(1210067..1212472) [2406 bp, 801 aa]
           {ON} Anc_3.528 YGL216W
          Length = 801

 Score =  170 bits (430), Expect = 6e-43,   Method: Compositional matrix adjust.
 Identities = 130/423 (30%), Positives = 206/423 (48%), Gaps = 89/423 (21%)

Query: 71  YTVDKVFGPSANQRLIFEEIAEPLFNDFLRGYNCTVLVYGMTSTGKTYTMTGDEKLYKGD 130
           +  DK+   ++ Q+ +F+   EPL +  L GYN TV  YG T  GKTYT++G        
Sbjct: 110 FIFDKLLDQNSTQQHVFQSTTEPLLDSILDGYNGTVFAYGATGCGKTYTISGT------- 162

Query: 131 LSDSAGIIPRVLFKLFETIEFQSDN--YVIKCSFIELYNEELKDLLIDSNNTKLKKLRIF 188
             ++ GII   L  LF  IE   D     I  S++E+YNE +KDLL  + ++K   +R  
Sbjct: 163 -PENPGIIFLTLQSLFNKIENLKDTKEISISLSYLEIYNESIKDLLDPTISSKKLVIR-- 219

Query: 189 DXXXXXXXXXXXXXXXXXHFISGMDLRKXXXXXXXXXXXXTAIQNGNASIYIQNLEEFHI 248
                                                      ++ N  I + NL  +  
Sbjct: 220 -------------------------------------------EDANNKISVSNLSTYSP 236

Query: 249 KNAREGIQLLQKGLKYRQVASTKMNDVSSRSHTIFTINLYKEHK--------GEIFKISK 300
               E + L+ +G   R  +ST  N+ SSRSH +  I+L +++K         ++F  S 
Sbjct: 237 ATIEEVMDLIIQGNLNRTTSSTHANETSSRSHAVLQIHLTQQNKLNNDINSTEQLF--ST 294

Query: 301 MNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSI-------ADKNIHIPFRE 353
           ++++DLAGSE  + +  + +   E  +IN+SLL LG  IN++       + + IHIP+R+
Sbjct: 295 LSIIDLAGSERAASTKNRGETLLEGANINKSLLALGNCINALCINTSSHSQQQIHIPYRD 354

Query: 354 SKLTRLLQDSLGGNTKTALIATISPAKLNAEETCSTLEYATKAKSIKNKPQLGSIIMKDV 413
           SKLTRLL+ SLGGN KT +I  +SP+  + +ET +TL+YA +AK IK K     II   +
Sbjct: 355 SKLTRLLKFSLGGNCKTVMIVCVSPSSKHYDETLNTLKYANRAKEIKTK-----IIRNQL 409

Query: 414 RLKDLNNELAKIKRDLTSTKQ------KDGVYMTQNHYKDLTNDLESYKTEIQECDRIVK 467
               LN  ++   + +T  KQ      K+ + +  NH   +  DL+  + EI   D+I+ 
Sbjct: 410 ---SLNRHISSYLKMITQQKQEIENLRKNQLTIINNHLSKIEIDLKKIEFEI---DQIIS 463

Query: 468 SLE 470
           +L+
Sbjct: 464 NLK 466

>NCAS0E00550 Chr5 complement(93778..96132) [2355 bp, 784 aa] {ON}
           Anc_3.528
          Length = 784

 Score =  169 bits (429), Expect = 7e-43,   Method: Compositional matrix adjust.
 Identities = 111/344 (32%), Positives = 175/344 (50%), Gaps = 65/344 (18%)

Query: 71  YTVDKVFGPSANQRLIFEEIAEPLFNDFLRGYNCTVLVYGMTSTGKTYTMTGDEKLYKGD 130
           +  DK+F   A+Q  +++     L +  L G+N TV  YG T  GKTYT++G        
Sbjct: 151 FVFDKLFDQDASQETVYQSTTSGLLDSVLDGFNGTVFAYGATGCGKTYTVSGT------- 203

Query: 131 LSDSAGIIPRVLFKLFETIEFQSDN--YVIKCSFIELYNEELKDLLIDSNNTKLKKLRIF 188
             +  GII RV+ +LFE +E   D   + +  S++E+YNE ++DLL     T  K+L I 
Sbjct: 204 -PEQPGIIFRVMQELFERMEDLKDTKRFELSLSYLEIYNETIRDLL--KPETVPKRLIIR 260

Query: 189 DXXXXXXXXXXXXXXXXXHFISGMDLRKXXXXXXXXXXXXTAIQNGNASIYIQNLEEFHI 248
                                                      ++G   I + NL   + 
Sbjct: 261 -------------------------------------------EDGANKISVSNLSYHNP 277

Query: 249 KNAREGIQLLQKGLKYRQVASTKMNDVSSRSHTIFTINLYKEHKGEIFK----ISKMNLV 304
           +  +E I L+ KG   R  + T+ N+VSSRSH +  I++ + ++          + ++++
Sbjct: 278 QTVQEVIDLVIKGNINRTTSPTEANEVSSRSHAVLQIHIMQTNRTADLTSEHTFATLSII 337

Query: 305 DLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSIA------DKNIHIPFRESKLTR 358
           DLAGSE  + +  + +R  E  +IN+SLL LG  IN++       +++ HIP+R+SKLTR
Sbjct: 338 DLAGSERAAATKNRGERLYEGANINRSLLALGNCINALCLTDGGTNRSCHIPYRDSKLTR 397

Query: 359 LLQDSLGGNTKTALIATISPAKLNAEETCSTLEYATKAKSIKNK 402
           LL+ SLGGN KT +I  ISP+  + +ET +TL+YA +AK IK K
Sbjct: 398 LLKFSLGGNCKTVMIVCISPSSSHYDETLNTLKYANRAKEIKTK 441

>Kwal_47.19093 s47 complement(1092732..1095191) [2460 bp, 819 aa]
           {ON} YGL216W (KIP3) - 1:1 [contig 188] FULL
          Length = 819

 Score =  169 bits (427), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 108/343 (31%), Positives = 170/343 (49%), Gaps = 64/343 (18%)

Query: 71  YTVDKVFGPSANQRLIFEEIAEPLFNDFLRGYNCTVLVYGMTSTGKTYTMTGDEKLYKGD 130
           +  D+VF   ++Q  ++E    PL +  L G+N TV  YG T  GKTYT++G        
Sbjct: 125 FVFDRVFDMDSSQIEVYEATTRPLLDSVLDGFNGTVFAYGATGCGKTYTVSG-------- 176

Query: 131 LSDSAGIIPRVLFKLFETIEFQSDN--YVIKCSFIELYNEELKDLLIDSNNTKLKKLRIF 188
             ++ GII   + +LF  +E   D   + +  S++E+YNE ++DLL     TK   LR  
Sbjct: 177 TPENPGIIFLTMQELFAKMEELQDTKRFELSASYLEIYNETIRDLLEPETPTKKLVLR-- 234

Query: 189 DXXXXXXXXXXXXXXXXXHFISGMDLRKXXXXXXXXXXXXTAIQNGNASIYIQNLEEFHI 248
                                                      ++ +  I + NL    +
Sbjct: 235 -------------------------------------------EDSHRHITVANLSHHPL 251

Query: 249 KNAREGIQLLQKGLKYRQVASTKMNDVSSRSHTIFTINLYKEHKG----EIFKISKMNLV 304
               + + L+ KG   R  ++T  N+ SSRSH +  +++ + ++     E  K + ++L+
Sbjct: 252 STVEDVMDLVIKGNTNRTTSATDANETSSRSHAVLQVHITQRNRTAELTEDHKFATLSLI 311

Query: 305 DLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSIA-----DKNIHIPFRESKLTRL 359
           DLAGSE  S +  + +R  E  +IN+SLL LG  IN++          H+P+R+SKLTRL
Sbjct: 312 DLAGSERASATKNRGERLHEGANINRSLLALGNCINALCVSGRKRGGYHVPYRDSKLTRL 371

Query: 360 LQDSLGGNTKTALIATISPAKLNAEETCSTLEYATKAKSIKNK 402
           L+ SLGGN KT +I  ISP+  + +ET +TL+YAT+AK IK K
Sbjct: 372 LKFSLGGNCKTVMIVCISPSSNHYDETLNTLKYATRAKEIKTK 414

>KLTH0G01606g Chr7 (116364..118823) [2460 bp, 819 aa] {ON} similar
           to uniprot|P53086 Saccharomyces cerevisiae YGL216W KIP3
           Kinesin-related motor protein involved in mitotic
           spindle positioning
          Length = 819

 Score =  167 bits (424), Expect = 4e-42,   Method: Compositional matrix adjust.
 Identities = 108/343 (31%), Positives = 171/343 (49%), Gaps = 64/343 (18%)

Query: 71  YTVDKVFGPSANQRLIFEEIAEPLFNDFLRGYNCTVLVYGMTSTGKTYTMTGDEKLYKGD 130
           +  D+VF   A+Q  ++E    PL +  L G+N TV  YG T  GKTYT++G        
Sbjct: 125 FVFDRVFDMHASQEEVYEATTRPLLDSVLDGFNSTVFAYGATGCGKTYTVSGT------- 177

Query: 131 LSDSAGIIPRVLFKLFETIEFQSDN--YVIKCSFIELYNEELKDLLIDSNNTKLKKLRIF 188
            +++ GII   + +LF  +E   D   + +  S++E+YNE ++DLL     +K   LR  
Sbjct: 178 -AENPGIIFLTMQELFAKMEQLKDTKKFELTASYLEIYNESIRDLLEPETPSKKLVLR-- 234

Query: 189 DXXXXXXXXXXXXXXXXXHFISGMDLRKXXXXXXXXXXXXTAIQNGNASIYIQNLEEFHI 248
                                                      ++ +  I + NL    +
Sbjct: 235 -------------------------------------------EDVHRHITVANLSHHPL 251

Query: 249 KNAREGIQLLQKGLKYRQVASTKMNDVSSRSHTIFTINLYKEHKG----EIFKISKMNLV 304
               + + L+ KG   R  ++T  N+ SSRSH +  +++ ++++     E  K + ++L+
Sbjct: 252 FTVEDVMDLVVKGNINRTTSATDANETSSRSHAVLQVHITQKNRTAELTEDHKFATLSLI 311

Query: 305 DLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSIA-----DKNIHIPFRESKLTRL 359
           DLAGSE  S +  + +R  E  +IN+SLL LG  IN++          H+P+R+SKLTRL
Sbjct: 312 DLAGSERASATKNRGERLHEGANINRSLLALGNCINALCAGGKRGGGFHVPYRDSKLTRL 371

Query: 360 LQDSLGGNTKTALIATISPAKLNAEETCSTLEYATKAKSIKNK 402
           L+ SLGGN KT +I  ISP   + +ET +TL+YAT+AK IK K
Sbjct: 372 LKFSLGGNCKTVMIVCISPTSNHYDETLNTLKYATRAKEIKTK 414

>SAKL0F01760g Chr6 (146659..149088) [2430 bp, 809 aa] {ON} similar
           to uniprot|P53086 Saccharomyces cerevisiae YGL216W KIP3
           Kinesin-related motor protein involved in mitotic
           spindle positioning
          Length = 809

 Score =  166 bits (420), Expect = 1e-41,   Method: Compositional matrix adjust.
 Identities = 108/342 (31%), Positives = 171/342 (50%), Gaps = 63/342 (18%)

Query: 71  YTVDKVFGPSANQRLIFEEIAEPLFNDFLRGYNCTVLVYGMTSTGKTYTMTGDEKLYKGD 130
           +  DK+F   A Q  ++E    PL +  L G+N TV  YG T  GKT+T++G        
Sbjct: 136 FVFDKLFDEDATQTEVYESTTRPLLDSVLDGFNGTVFAYGATGCGKTFTISG-------- 187

Query: 131 LSDSAGIIPRVLFKLFETIEFQSD--NYVIKCSFIELYNEELKDLLIDSNNTKLKKLRIF 188
             +  G+I   + +LF+ IE   D  ++ +  S++E+YNE ++DLL  S +   KKL I 
Sbjct: 188 TPEQPGVIFLTMQELFQRIEDLKDSKHFDLTLSYLEIYNESIRDLL--SPDISSKKLVIR 245

Query: 189 DXXXXXXXXXXXXXXXXXHFISGMDLRKXXXXXXXXXXXXTAIQNGNASIYIQNLEEFHI 248
           +                   I G                          I + NL     
Sbjct: 246 EDS-----------------IKG--------------------------ISVANLSHHTP 262

Query: 249 KNAREGIQLLQKGLKYRQVASTKMNDVSSRSHTIFTINLYKEHK----GEIFKISKMNLV 304
           +  ++ + L+ +G   R  + T  N+ SSRSH +  IN+ ++++     E    + ++++
Sbjct: 263 QTVQDVMDLVVRGNMNRTTSPTDANETSSRSHAVLQINVVQKNRTAELSEAHTFATLSII 322

Query: 305 DLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSIA----DKNIHIPFRESKLTRLL 360
           DLAGSE  S +  + +R  E  +IN+SLL LG  IN++         H+P+R+SKLTRLL
Sbjct: 323 DLAGSERASATKNRGERLHEGANINRSLLALGNCINALCVSGRRSTCHVPYRDSKLTRLL 382

Query: 361 QDSLGGNTKTALIATISPAKLNAEETCSTLEYATKAKSIKNK 402
           + SLGGN KT +I  I+P+  + +ET +TL+YA +AK IK K
Sbjct: 383 KFSLGGNCKTVMIVCIAPSSAHYDETLNTLKYANRAKEIKTK 424

>Smik_7.48 Chr7 (79575..81992) [2418 bp, 805 aa] {ON} YGL216W (REAL)
          Length = 805

 Score =  166 bits (419), Expect = 2e-41,   Method: Compositional matrix adjust.
 Identities = 107/342 (31%), Positives = 169/342 (49%), Gaps = 63/342 (18%)

Query: 71  YTVDKVFGPSANQRLIFEEIAEPLFNDFLRGYNCTVLVYGMTSTGKTYTMTGDEKLYKGD 130
           +  DK+F  +++Q  +++E   PL +  L G+N TV  YG T  GKTYT++G        
Sbjct: 153 FVFDKLFDENSSQSRVYKETTSPLLDSVLDGFNSTVFAYGATGCGKTYTVSGT------- 205

Query: 131 LSDSAGIIPRVLFKLFETIEFQSD--NYVIKCSFIELYNEELKDLLIDSNNTKLKKLRIF 188
                GII   + +LF  I    D  N+ I  S++E+YNE ++DLL     +K   +R  
Sbjct: 206 -PSQPGIIFLAMEELFNKIADLRDEKNFEISLSYLEIYNERIRDLLKPETPSKRLVIR-- 262

Query: 189 DXXXXXXXXXXXXXXXXXHFISGMDLRKXXXXXXXXXXXXTAIQNGNASIYIQNLEEFHI 248
                                                      ++  + I + NL   H 
Sbjct: 263 -------------------------------------------EDTQSHIKVANLSYHHP 279

Query: 249 KNAREGIQLLQKGLKYRQVASTKMNDVSSRSHTIFTINLYKEHK----GEIFKISKMNLV 304
               + + L+ +G   R  + T+ N+VSSRSH +  I++ + +K          + ++++
Sbjct: 280 TTVEDVMDLVVQGNINRTTSPTEANEVSSRSHAVLQIHIMQTNKLVDLTSQHTFATLSII 339

Query: 305 DLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSIA----DKNIHIPFRESKLTRLL 360
           DLAGSE  + +  +  R  E  +IN+SLL LG  IN++      ++ HIP+R+SKLTRLL
Sbjct: 340 DLAGSERAAATRNRGIRLHEGANINRSLLALGNCINALCLNDGSRSCHIPYRDSKLTRLL 399

Query: 361 QDSLGGNTKTALIATISPAKLNAEETCSTLEYATKAKSIKNK 402
           + SLGGN KT +I  ISP+  + +ET +TL+YA +AK IK K
Sbjct: 400 KFSLGGNCKTVMIVCISPSSSHYDETLNTLKYANRAKEIKTK 441

>NDAI0I02960 Chr9 complement(699469..702075) [2607 bp, 868 aa] {ON}
           Anc_3.528
          Length = 868

 Score =  165 bits (418), Expect = 3e-41,   Method: Compositional matrix adjust.
 Identities = 117/359 (32%), Positives = 182/359 (50%), Gaps = 78/359 (21%)

Query: 64  AQLNSKTYTVDKVFGPSANQRLIFEEIAEPLFNDFLRGYNCTVLVYGMTSTGKTYTMTGD 123
           A+ N   +  DK+F  +++Q  ++      L +  L G+N TV  YG T  GKTYT++G 
Sbjct: 184 AKKNEMKFVFDKIFDENSSQDEVYLGTTSSLLDSVLDGFNGTVFAYGATGCGKTYTVSGT 243

Query: 124 EKLYKGDLSDSAGIIPRVLFKLFETIEFQSD--NYVIKCSFIELYNEELKDLLIDSNNTK 181
           +        ++ GII RV+ +LFE +E   D   + +  S++E+YNE + DLL    +T 
Sbjct: 244 Q--------ENPGIIFRVMQELFERMEDLKDEKTFQLSISYLEIYNEMIYDLL--KPDTP 293

Query: 182 LKKLRIFDXXXXXXXXXXXXXXXXXHFISGMDLRKXXXXXXXXXXXXTAIQNGNASIYIQ 241
            KKL I                                            ++ ++ I + 
Sbjct: 294 SKKLIIR-------------------------------------------EDKDSKISVS 310

Query: 242 NLEEFHIKNAREGIQLLQKGLKYRQVASTKMNDVSSRSHTIFTI---------NLYKEHK 292
           NL   + K+ ++ I L+ +G   R  +ST+ N+VSSRSH +  I         +L  EH 
Sbjct: 311 NLSYHYPKSVQDVIDLVIRGNINRSTSSTEANEVSSRSHAVLQIHIMQTNTKIDLTSEHT 370

Query: 293 GEIFKISKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSIA-------DK 345
                 + ++++DLAGSE  + +  + +R  E  +IN+SLL LG  IN++         +
Sbjct: 371 -----FATLSIIDLAGSERAAATKNRGERLYEGANINKSLLALGNCINALCIPTNNTRRR 425

Query: 346 NI--HIPFRESKLTRLLQDSLGGNTKTALIATISPAKLNAEETCSTLEYATKAKSIKNK 402
           NI  HIP+R+SKLTRLL+ SLGGN KT +I  ISP+  + +ET +TL+YA +AK IK K
Sbjct: 426 NIRYHIPYRDSKLTRLLKFSLGGNCKTVMIVCISPSSSHYDETLNTLKYANRAKEIKTK 484

>Suva_7.44 Chr7 (79883..82300) [2418 bp, 805 aa] {ON} YGL216W (REAL)
          Length = 805

 Score =  164 bits (416), Expect = 3e-41,   Method: Compositional matrix adjust.
 Identities = 107/342 (31%), Positives = 168/342 (49%), Gaps = 63/342 (18%)

Query: 71  YTVDKVFGPSANQRLIFEEIAEPLFNDFLRGYNCTVLVYGMTSTGKTYTMTGDEKLYKGD 130
           +  DK+F  +++Q  +++E   PL +  L GYN TV  YG T  GKTYT++G        
Sbjct: 153 FVFDKLFDENSSQTQVYKETTSPLLDSVLDGYNSTVFAYGATGCGKTYTVSGT------- 205

Query: 131 LSDSAGIIPRVLFKLFETIEFQSD--NYVIKCSFIELYNEELKDLLIDSNNTKLKKLRIF 188
                G+I   + +LF  I+   D  N+ I  S++E+YNE ++DLL     +K   +R  
Sbjct: 206 -PSQPGVIFLAMEELFNKIDDLKDEKNFEISLSYLEIYNERIRDLLKPETPSKRLIIR-- 262

Query: 189 DXXXXXXXXXXXXXXXXXHFISGMDLRKXXXXXXXXXXXXTAIQNGNASIYIQNLEEFHI 248
                                                      ++    I + NL   H 
Sbjct: 263 -------------------------------------------EDTQNHIKVANLSYHHP 279

Query: 249 KNAREGIQLLQKGLKYRQVASTKMNDVSSRSHTIFTINLYKEHK----GEIFKISKMNLV 304
               + + L+ +G   R  + T+ N+VSSRSH +  I++ + +K          + ++++
Sbjct: 280 TTVEDVMNLVVQGNINRTTSPTEANEVSSRSHAVLQIHIMQTNKLVDLTSQHTFATLSVI 339

Query: 305 DLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSIA----DKNIHIPFRESKLTRLL 360
           DLAGSE  + +  +  R  E  +IN+SLL LG  IN++      +  HIP+R+SKLTRLL
Sbjct: 340 DLAGSERAAATRNRGLRLHEGANINRSLLALGNCINALCLNDGSRTCHIPYRDSKLTRLL 399

Query: 361 QDSLGGNTKTALIATISPAKLNAEETCSTLEYATKAKSIKNK 402
           + SLGGN KT +I  ISP+  + +ET +TL+YA +AK IK K
Sbjct: 400 KFSLGGNCKTVMIVCISPSSSHYDETLNTLKYANRAKEIKTK 441

>CAGL0I07029g Chr9 (675486..677603) [2118 bp, 705 aa] {ON} similar
           to uniprot|P53086 Saccharomyces cerevisiae YGL216w KIP3
           kinesin-related protein required for nuclear migration
          Length = 705

 Score =  163 bits (413), Expect = 5e-41,   Method: Compositional matrix adjust.
 Identities = 107/344 (31%), Positives = 172/344 (50%), Gaps = 65/344 (18%)

Query: 71  YTVDKVFGPSANQRLIFEEIAEPLFNDFLRGYNCTVLVYGMTSTGKTYTMTGDEKLYKGD 130
           +  DK+F   A QR +++     L +  L G+N TV  YG T  GKTYT++G        
Sbjct: 156 FVFDKLFDTDATQREVYQSTTSSLLDSVLDGFNGTVFAYGATGCGKTYTVSG-------- 207

Query: 131 LSDSAGIIPRVLFKLFETIEFQSD--NYVIKCSFIELYNEELKDLLIDSNNTKLKKLRIF 188
             ++ GI+ + + +LF+ +E   D  ++ I  SF+E+YNE ++DLL     T  +KL I 
Sbjct: 208 TPENPGIVFQAMEELFQKMEDLKDTKSFQISLSFLEIYNERIRDLL--KPETPSQKLIIR 265

Query: 189 DXXXXXXXXXXXXXXXXXHFISGMDLRKXXXXXXXXXXXXTAIQNGNASIYIQNLEEFHI 248
                                                      ++ +  I + NL +   
Sbjct: 266 -------------------------------------------EDTDNKITVANLSQHFP 282

Query: 249 KNAREGIQLLQKGLKYRQVASTKMNDVSSRSHTIFTINLYKEHKGEIFK----ISKMNLV 304
              +E + L+ +G   R  + T+ N+VSSRSH +  I++ ++++    K       ++++
Sbjct: 283 TTVQEVMDLVIRGNFNRTTSPTEANEVSSRSHAVLQIHIVQKNRTPDIKEEHTFGTLSII 342

Query: 305 DLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSIA------DKNIHIPFRESKLTR 358
           DLAGSE  + +  +  R  E  +IN+SLL LG  IN++           H+P+R+SKLTR
Sbjct: 343 DLAGSERAAATKNRGARLHEGANINRSLLALGNCINALCINGNDERPRCHVPYRDSKLTR 402

Query: 359 LLQDSLGGNTKTALIATISPAKLNAEETCSTLEYATKAKSIKNK 402
           LL+ SLGGN KT +I  ISP+  + +ET +TL+YA +AK IK K
Sbjct: 403 LLKFSLGGNCKTVMIVCISPSSSHYDETLNTLKYANRAKEIKTK 446

>Skud_7.53 Chr7 (90098..92515) [2418 bp, 805 aa] {ON} YGL216W (REAL)
          Length = 805

 Score =  163 bits (413), Expect = 8e-41,   Method: Compositional matrix adjust.
 Identities = 108/342 (31%), Positives = 167/342 (48%), Gaps = 63/342 (18%)

Query: 71  YTVDKVFGPSANQRLIFEEIAEPLFNDFLRGYNCTVLVYGMTSTGKTYTMTGDEKLYKGD 130
           +  DK+F  +++Q  +++E   PL +  L G+N TV  YG T  GKTYT++G        
Sbjct: 153 FVFDKLFDENSSQVRVYKETTSPLLDSVLDGFNSTVFAYGATGCGKTYTVSGT------- 205

Query: 131 LSDSAGIIPRVLFKLFETIEFQSD--NYVIKCSFIELYNEELKDLLIDSNNTKLKKLRIF 188
                GII   + +LF  I    D  N+ I  S++E+YNE + DLL     +K   +R  
Sbjct: 206 -PSQPGIIFLAMEELFNKISDLKDEKNFEISLSYLEIYNERISDLLRPETPSKRLVIR-- 262

Query: 189 DXXXXXXXXXXXXXXXXXHFISGMDLRKXXXXXXXXXXXXTAIQNGNASIYIQNLEEFHI 248
                                                      ++    I + NL   H 
Sbjct: 263 -------------------------------------------EDTQNHIKVANLSYHHP 279

Query: 249 KNAREGIQLLQKGLKYRQVASTKMNDVSSRSHTIFTINLYKEHK----GEIFKISKMNLV 304
               + + L+ +G   R  + T+ N+VSSRSH++  I++ + +K          + ++++
Sbjct: 280 TTVEDVMDLVVQGNINRTTSPTEANEVSSRSHSVLQIHIMQTNKLVDLTSQHTFATLSII 339

Query: 305 DLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSI----ADKNIHIPFRESKLTRLL 360
           DLAGSE  S +  +  R  E  +IN+SLL LG  IN++      +  HIP+R+SKLTRLL
Sbjct: 340 DLAGSERASATRNRGIRLHEGANINRSLLALGNCINALCLNDGSRTCHIPYRDSKLTRLL 399

Query: 361 QDSLGGNTKTALIATISPAKLNAEETCSTLEYATKAKSIKNK 402
           + SLGGN KT +I  ISP+  + +ET +TL+YA +AK IK K
Sbjct: 400 KFSLGGNCKTVMIVCISPSSSHYDETLNTLKYANRAKEIKTK 441

>YGL216W Chr7 (84885..87302) [2418 bp, 805 aa] {ON}
           KIP3Kinesin-related motor protein involved in mitotic
           spindle positioning
          Length = 805

 Score =  162 bits (411), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 106/342 (30%), Positives = 168/342 (49%), Gaps = 63/342 (18%)

Query: 71  YTVDKVFGPSANQRLIFEEIAEPLFNDFLRGYNCTVLVYGMTSTGKTYTMTGDEKLYKGD 130
           +  DK+F  +++Q  +++E   PL +  L G+N TV  YG T  GKTYT++G        
Sbjct: 153 FVFDKLFDETSSQARVYKETTSPLLDSVLDGFNSTVFAYGATGCGKTYTVSGT------- 205

Query: 131 LSDSAGIIPRVLFKLFETIEFQSD--NYVIKCSFIELYNEELKDLLIDSNNTKLKKLRIF 188
                GII   + +LF  I    D  ++ I  S++E+YNE ++DLL     +K   +R  
Sbjct: 206 -PSQPGIIFLAMEELFNKITDLKDEKDFEISLSYLEIYNERIRDLLKPETPSKRLVIR-- 262

Query: 189 DXXXXXXXXXXXXXXXXXHFISGMDLRKXXXXXXXXXXXXTAIQNGNASIYIQNLEEFHI 248
                                                      ++    I + NL   H 
Sbjct: 263 -------------------------------------------EDTQNHIKVANLSYHHP 279

Query: 249 KNAREGIQLLQKGLKYRQVASTKMNDVSSRSHTIFTINLYKEHK----GEIFKISKMNLV 304
               + + L+ +G   R  + T+ N+VSSRSH +  I++ + +K          + ++++
Sbjct: 280 NTVEDVMDLVVQGNINRTTSPTEANEVSSRSHAVLQIHIMQTNKLVDLTSQHTFATLSII 339

Query: 305 DLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSI----ADKNIHIPFRESKLTRLL 360
           DLAGSE  + +  +  R  E  +IN+SLL LG  IN++      ++ HIP+R+SKLTRLL
Sbjct: 340 DLAGSERAAATRNRGIRLHEGANINRSLLALGNCINALCLNDGSRSCHIPYRDSKLTRLL 399

Query: 361 QDSLGGNTKTALIATISPAKLNAEETCSTLEYATKAKSIKNK 402
           + SLGGN KT +I  ISP+  + +ET +TL+YA +AK IK K
Sbjct: 400 KFSLGGNCKTVMIVCISPSSSHYDETLNTLKYANRAKEIKTK 441

>Kpol_423.8 s423 (11134..13554) [2421 bp, 806 aa] {ON}
           (11134..13554) [2421 nt, 807 aa]
          Length = 806

 Score =  161 bits (408), Expect = 4e-40,   Method: Compositional matrix adjust.
 Identities = 106/345 (30%), Positives = 174/345 (50%), Gaps = 68/345 (19%)

Query: 71  YTVDKVFGPSANQRLIFEEIAEPLFNDFLRGYNCTVLVYGMTSTGKTYTMTGDEKLYKGD 130
           +  DK+F   ++Q  ++      L +  L G+N TV  YG T  GKTYT++G        
Sbjct: 146 FIFDKLFNEGSSQLAVYRSTTSLLLDSVLDGFNGTVFAYGATGCGKTYTISGT------- 198

Query: 131 LSDSAGIIPRVLFKLFETIEFQSD--NYVIKCSFIELYNEELKDLLIDSNNTKLKKLRIF 188
             +  GII   + +LF+ IE   D  N+ +  S++E+YNE ++DLL  + +T  KKL I 
Sbjct: 199 -PEQPGIIFLAMEELFQKIENIKDTKNFELTLSYLEIYNESIRDLL--NPDTPSKKLVIR 255

Query: 189 DXXXXXXXXXXXXXXXXXHFISGMDLRKXXXXXXXXXXXXTAIQNGNASIYIQNLEEFHI 248
                                                      ++  + I + NL     
Sbjct: 256 -------------------------------------------EDNESKISVANLSHHRP 272

Query: 249 KNAREGIQLLQKGLKYRQVASTKMNDVSSRSHTIFTINLYKEHK------GEIFKISKMN 302
           K  ++ + L+ KG   R  ++T  N+ SSRSH +  I++ + ++        +F  + ++
Sbjct: 273 KTVQDVMDLIIKGNINRTTSATDANETSSRSHAVLQIHISQTNRTVDLTSSHVF--ATLS 330

Query: 303 LVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSIA-----DKNIHIPFRESKLT 357
           ++DLAGSE  + +  + +R  E  +IN+SLL LG  IN++       ++ H+P+R+SKLT
Sbjct: 331 IIDLAGSERAASTKNRGERLYEGANINKSLLALGNCINALCLNDGTRRSCHVPYRDSKLT 390

Query: 358 RLLQDSLGGNTKTALIATISPAKLNAEETCSTLEYATKAKSIKNK 402
           RLL+ SLGGN KT +I  +SP+  + +ET +TL+YA +AK IK K
Sbjct: 391 RLLKFSLGGNCKTVMIVCVSPSSTHYDETLNTLKYANRAKEIKTK 435

>TDEL0D05960 Chr4 complement(1079683..1081884) [2202 bp, 733 aa]
           {ON} Anc_3.528 YGL216W
          Length = 733

 Score =  160 bits (405), Expect = 5e-40,   Method: Compositional matrix adjust.
 Identities = 107/343 (31%), Positives = 167/343 (48%), Gaps = 64/343 (18%)

Query: 71  YTVDKVFGPSANQRLIFEEIAEPLFNDFLRGYNCTVLVYGMTSTGKTYTMTGDEKLYKGD 130
           +  DK+F  +A Q  ++      L +  L G+N TV  YG T  GKTYT++G        
Sbjct: 129 FVFDKLFDENATQEEVYSGTTSELLDAVLDGFNGTVFAYGATGCGKTYTVSGT------- 181

Query: 131 LSDSAGIIPRVLFKLFETIEFQSDN--YVIKCSFIELYNEELKDLLIDSNNTKLKKLRIF 188
             +  G+I   + +LF  +E   D   + I  S++E+YNE ++DLL  S     KKL I 
Sbjct: 182 -PERPGVIFLAMQELFARMEELEDTRKFEISVSYLEIYNETIRDLL--SPEMSPKKLVIR 238

Query: 189 DXXXXXXXXXXXXXXXXXHFISGMDLRKXXXXXXXXXXXXTAIQNGNASIYIQNLEEFHI 248
                                                      ++    I + NL     
Sbjct: 239 -------------------------------------------EDSENRISVANLSHHRP 255

Query: 249 KNAREGIQLLQKGLKYRQVASTKMNDVSSRSHTIFTINLYKEHK-GEI---FKISKMNLV 304
           K   + + L+  G   R  ++T  N+ SSRSH +  IN+ +  +  EI      +K++++
Sbjct: 256 KTVEDVMDLVVLGNTNRTTSATDANETSSRSHAVLQINIVQSSRTAEITSDHTFAKLSII 315

Query: 305 DLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSIA-----DKNIHIPFRESKLTRL 359
           DLAGSE  + +  + +R +E  +IN+SLL LG  IN++       +  H+P+R+SKLTRL
Sbjct: 316 DLAGSERAASTKNRGERLQEGANINRSLLALGNCINALCISDGTRRTCHVPYRDSKLTRL 375

Query: 360 LQDSLGGNTKTALIATISPAKLNAEETCSTLEYATKAKSIKNK 402
           L+ SLGGN KT +I  +SP+  + +ET +TL+YA +AK IK K
Sbjct: 376 LKFSLGGNCKTVMIVCVSPSSTHYDETLNTLKYANRAKEIKTK 418

>KNAG0B00520 Chr2 (85045..87216) [2172 bp, 723 aa] {ON} Anc_3.528
           YGL216W
          Length = 723

 Score =  160 bits (405), Expect = 6e-40,   Method: Compositional matrix adjust.
 Identities = 108/351 (30%), Positives = 174/351 (49%), Gaps = 64/351 (18%)

Query: 63  TAQLNSKTYTVDKVFGPSANQRLIFEEIAEPLFNDFLRGYNCTVLVYGMTSTGKTYTMTG 122
           T   +   +  DK+F    +Q  ++      L +  L G+N TV  YG T  GKTYT++G
Sbjct: 135 TGSADETKFVFDKLFDTDVSQEDVYRGTTSTLLDSVLDGFNGTVFAYGATGCGKTYTVSG 194

Query: 123 DEKLYKGDLSDSAGIIPRVLFKLFETIEF--QSDNYVIKCSFIELYNEELKDLLIDSNNT 180
                     ++ GII R + +LF  ++    + ++ +  SF+E+YNE + DLL  S +T
Sbjct: 195 TR--------ENPGIIFRTMEELFVKMDALAGTKDFELTVSFLEIYNETIHDLL--SPDT 244

Query: 181 KLKKLRIFDXXXXXXXXXXXXXXXXXHFISGMDLRKXXXXXXXXXXXXTAIQNGNASIYI 240
             +KL I                                            ++ N  I +
Sbjct: 245 PPQKLVIR-------------------------------------------EDSNEKISV 261

Query: 241 QNLEEFHIKNAREGIQLLQKGLKYRQVASTKMNDVSSRSHTIFTINLYKEHKGEIFK--- 297
            NL     ++ ++ + L+ +G   R  + T+ N VSSRSH +  I++ + +K    K   
Sbjct: 262 SNLSYHSPRSVQDVLDLVIRGNDNRTTSPTEANSVSSRSHAVLQIHIMQRNKLVDLKEHQ 321

Query: 298 -ISKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSIAD-----KNIHIPF 351
               ++++DLAGSE  + +  + +R  E  +IN+SLL LG  IN++       +N H+P+
Sbjct: 322 TFGTLSIIDLAGSERAAATKNRGRRLHEGANINRSLLALGNCINALCSNDGSHRNQHVPY 381

Query: 352 RESKLTRLLQDSLGGNTKTALIATISPAKLNAEETCSTLEYATKAKSIKNK 402
           R+SKLTRLL+ SLGGN KT +I  ISP+  + +ET +TL+YA +AK IK K
Sbjct: 382 RDSKLTRLLKFSLGGNCKTVMIVCISPSSAHYDETLNTLKYANRAKEIKTK 432

>KLLA0A01606g Chr1 (139355..141664) [2310 bp, 769 aa] {ON} similar
           to uniprot|P53086 Saccharomyces cerevisiae YGL216W KIP3
           Kinesin-related motor protein involved in mitotic
           spindle positioning
          Length = 769

 Score =  159 bits (403), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 106/344 (30%), Positives = 170/344 (49%), Gaps = 65/344 (18%)

Query: 71  YTVDKVFGPSANQRLIFEEIAEPLFNDFLRGYNCTVLVYGMTSTGKTYTMTGDEKLYKGD 130
           +  D++F     Q+ ++E    PL +  L G+N TV  YG T  GKT+T++G        
Sbjct: 124 FIFDRIFDMDVTQQEVYENTTRPLLDSVLDGFNGTVFAYGATGCGKTFTISGT------- 176

Query: 131 LSDSAGIIPRVLFKLFETIEFQSDN--YVIKCSFIELYNEELKDLLIDSNNTKLKKLRIF 188
            S+  GII   + +LF  +E   D   + ++ SF+E+YNE++ DLL    N   KKL I 
Sbjct: 177 -SEQPGIIFLTMQELFIRMEQLKDTKKFQLQLSFLEIYNEQIHDLL--DPNISSKKLVIR 233

Query: 189 DXXXXXXXXXXXXXXXXXHFISGMDLRKXXXXXXXXXXXXTAIQNGNASIYIQNLEEFHI 248
                                                      ++     ++ NL +   
Sbjct: 234 -------------------------------------------EDSYNRTFVSNLSKHSP 250

Query: 249 KNAREGIQLLQKGLKYRQVASTKMNDVSSRSHTIFTINLYKEHKGEIFK----ISKMNLV 304
           +N  E + L+ KG   R  + T  N+ SSRSH +  I++ + ++    K     + ++++
Sbjct: 251 ENVEEVMDLVIKGNMNRTTSPTDANETSSRSHAVLQIHVAQMNRTADIKQDQTFATLSII 310

Query: 305 DLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSIADKN------IHIPFRESKLTR 358
           DLAGSE  + +  + +R  E  +IN+SLL LG  IN++   +       H+P+R+SKLTR
Sbjct: 311 DLAGSERAAVTKNRGERLLEGANINRSLLALGNCINALCVSSTRTGFSCHVPYRDSKLTR 370

Query: 359 LLQDSLGGNTKTALIATISPAKLNAEETCSTLEYATKAKSIKNK 402
           LL+ SLGGN KT +I  +SP+  + +ET +TL+YA +AK IK K
Sbjct: 371 LLKFSLGGNCKTVMIVCVSPSSGHYDETLNTLKYANRAKEIKTK 414

>AER441C Chr5 complement(1480055..1482511) [2457 bp, 818 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YGL216W
           (KIP3)
          Length = 818

 Score =  159 bits (402), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 106/342 (30%), Positives = 170/342 (49%), Gaps = 63/342 (18%)

Query: 71  YTVDKVFGPSANQRLIFEEIAEPLFNDFLRGYNCTVLVYGMTSTGKTYTMTGDEKLYKGD 130
           +  DK+F   A+Q+ +F+    PL +  L G+N TV  YG T  GKT+T++G        
Sbjct: 128 FMFDKLFDVDASQQDVFQCTTMPLLDSILDGFNGTVFAYGATGCGKTFTISG-------- 179

Query: 131 LSDSAGIIPRVLFKLFETIEFQSDN--YVIKCSFIELYNEELKDLLIDSNNTKLKKLRIF 188
             DS GII   + +LF+ I    D   + +  S++E+YNE ++DLL    +T  +KL I 
Sbjct: 180 TPDSPGIIFLTMQELFQRINNLKDTKTFELTVSYLEIYNETIRDLL--EPDTPSQKLIIR 237

Query: 189 DXXXXXXXXXXXXXXXXXHFISGMDLRKXXXXXXXXXXXXTAIQNGNASIYIQNLEEFHI 248
                                                      ++ +++  + NL     
Sbjct: 238 -------------------------------------------EDSDSTTTVANLSYHTP 254

Query: 249 KNAREGIQLLQKGLKYRQVASTKMNDVSSRSHTIFTINLYKEHKGEIFKISKM----NLV 304
           +   + + L+ +G   R  + T  N+ SSRSH +  +++ +  +    K  KM    +++
Sbjct: 255 ETVEDVMDLVIRGNVNRTTSPTDANETSSRSHAVLQVHVVQSSRTVDLKEDKMYATLSII 314

Query: 305 DLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSIADKN----IHIPFRESKLTRLL 360
           DLAGSE  S +  + +R  E  +IN+SLL LG  IN++         H+P+R+SKLTRLL
Sbjct: 315 DLAGSERASATKNRGERLHEGSNINKSLLALGNCINALCMTGRRAVCHVPYRDSKLTRLL 374

Query: 361 QDSLGGNTKTALIATISPAKLNAEETCSTLEYATKAKSIKNK 402
           + SLGGN KT +I  +SP+  + +ET +TL+YA +AK IK K
Sbjct: 375 KFSLGGNCKTVMIVCVSPSSAHYDETLNTLKYANRAKDIKTK 416

>TBLA0C05310 Chr3 (1286959..1288989) [2031 bp, 676 aa] {ON}
           Anc_3.479 YPR141C
          Length = 676

 Score =  157 bits (398), Expect = 3e-39,   Method: Compositional matrix adjust.
 Identities = 119/370 (32%), Positives = 178/370 (48%), Gaps = 71/370 (19%)

Query: 52  INTSDDIVSGLTAQLNSKT-------------YTVDKVFGPSANQRLIFEEIAEPLFNDF 98
           ++TS  +++   A+L S++             Y+ DKVF  +   + IF+E++E L    
Sbjct: 351 LDTSHILINAFNAELGSQSIEVEKNCNLTPIKYSFDKVFSQTDTNQEIFKEVSE-LIQSS 409

Query: 99  LRGYNCTVLVYGMTSTGKTYTMTGDEKLYKGDLSDSAGIIPRVLFKLFETIEFQSDN--- 155
           L G+N  +  YG T +GKT+TM          L+   GIIP     +F+ I+  + N   
Sbjct: 410 LDGFNVCIFAYGQTGSGKTFTM----------LNPKDGIIPSTAKHIFDWIDNSAKNGWK 459

Query: 156 YVIKCSFIELYNEELKDLLIDSNNTKLKKLRIFDXXXXXXXXXXXXXXXXXHFISGMDLR 215
           Y + C F+E+YN+E+ DLL   +N                           H I   D  
Sbjct: 460 YNVTCEFLEIYNDEIYDLLRSDDN------------------KSNSSNGPRHKIHHDDAS 501

Query: 216 KXXXXXXXXXXXXTAIQNGNASIYIQNLEEFHIKNAREGIQLLQKGLKYRQVASTKMNDV 275
           K                    +  ++NLE   + +      +L+  +K R  AST  N+ 
Sbjct: 502 K--------------------TTVVENLETITLTSKESVDAVLKNAMKLRATASTSSNER 541

Query: 276 SSRSHTIFTINLY--KEHKGEIFKISKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLL 333
           SSRSH+IF I ++   E  GE  +   +NL+DLAGSE +S S  Q++R KE   IN+SL 
Sbjct: 542 SSRSHSIFIIKIHGINEGLGE-ERNGLLNLIDLAGSERLSVSKVQSERIKETQHINKSLS 600

Query: 334 TLGRVINSIADKNI---HIPFRESKLTRLLQDSLGGNTKTALIATISPAKLNAEETCSTL 390
            LG V+NS+   +    HI FR+SKLT LLQ SL GN+KT ++  IS +  +  ET  +L
Sbjct: 601 FLGNVMNSLGSPDATTRHISFRDSKLTYLLQYSLTGNSKTLMVVNISSSSDHINETIKSL 660

Query: 391 EYATKAKSIK 400
            +A K  S K
Sbjct: 661 NFAKKVNSTK 670

>TBLA0C03940 Chr3 complement(946819..949038) [2220 bp, 739 aa] {ON}
           Anc_3.479 YPR141C
          Length = 739

 Score =  157 bits (398), Expect = 4e-39,   Method: Compositional matrix adjust.
 Identities = 123/352 (34%), Positives = 164/352 (46%), Gaps = 70/352 (19%)

Query: 67  NSKTYTV--DKVFGPSANQRLIFEEIAEPLFNDFLRGYNCTVLVYGMTSTGKTYTMTGDE 124
           N+ TY+   D VF        +F EI E L    L GYN  +  YG T +GKTYTM    
Sbjct: 438 NNATYSFEFDHVFKQDEGNSEVFNEI-EQLIQSALDGYNVCIFAYGQTGSGKTYTM---- 492

Query: 125 KLYKGDLSDSAGIIPRVLFKLFETIEFQSDN---YVIKCSFIELYNEELKDLLIDSNNTK 181
                 L+ + G+IP  +  +F +++    N   Y + C FIELYNE + DL  D+  TK
Sbjct: 493 ------LNPNDGVIPMTIKYIFNSMDSLKKNGWEYNVSCEFIELYNENIIDLFRDNGPTK 546

Query: 182 LKKLRIFDXXXXXXXXXXXXXXXXXHFISGMDLRKXXXXXXXXXXXXTAIQNGNASIYIQ 241
                                    H I   D  K                      Y+ 
Sbjct: 547 ---------------------DSISHEIRHDDQSKIT--------------------YVT 565

Query: 242 NLEEFHIKNAREGIQLLQKGLKYRQVASTKMNDVSSRSHTIFTINLYK-EHKGEIFKISK 300
           N++ F I+N  + I L+ K    R  +ST +N  SSRSH IF I L    HK     ISK
Sbjct: 566 NIKRFKIENISDTIGLINKSKIKRMTSSTGLNSHSSRSHGIFIIYLEGYNHKTNEKCISK 625

Query: 301 MNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSI------------ADKNIH 348
           +NLVDLAGSE I+ S  Q  R KE  SIN+SL  LG VI+++              K  H
Sbjct: 626 LNLVDLAGSERINFSKVQGDRLKETQSINKSLSCLGDVIHALNRGNKNHLNSNDLQKTRH 685

Query: 349 IPFRESKLTRLLQDSLGGNTKTALIATISPAKLNAEETCSTLEYATKAKSIK 400
           IPFR SKLT LL+ SL G++KT +   +S  + +  ET ++L +ATK  + K
Sbjct: 686 IPFRNSKLTYLLKYSLIGDSKTLMFVNVSSNEAHLNETINSLRFATKVNNTK 737

>TPHA0D03480 Chr4 complement(731687..734230) [2544 bp, 847 aa] {ON}
           Anc_3.528 YGL216W
          Length = 847

 Score =  158 bits (399), Expect = 5e-39,   Method: Compositional matrix adjust.
 Identities = 105/343 (30%), Positives = 166/343 (48%), Gaps = 64/343 (18%)

Query: 71  YTVDKVFGPSANQRLIFEEIAEPLFNDFLRGYNCTVLVYGMTSTGKTYTMTGDEKLYKGD 130
           +  DK+F  +ANQ  ++      L +  L G+N TV  YG T  GKT+T++G        
Sbjct: 128 FVFDKLFDETANQTNVYNSTTSSLLDSVLDGFNGTVFAYGATGCGKTFTISG-------- 179

Query: 131 LSDSAGIIPRVLFKLFETIEFQSD--NYVIKCSFIELYNEELKDLLIDSNNTKLKKLRIF 188
             +  GII   + +LF+ IE   D  N  +  S++E+YNE ++DLL  + N   KKL I 
Sbjct: 180 TPEQPGIIFLTMDELFKRIESLKDTKNIELTLSYLEIYNETIRDLL--NPNVSSKKLVIR 237

Query: 189 DXXXXXXXXXXXXXXXXXHFISGMDLRKXXXXXXXXXXXXTAIQNGNASIYIQNLEEFHI 248
                                                      ++ +  I + NL     
Sbjct: 238 -------------------------------------------EDSDQKITVSNLSHHKP 254

Query: 249 KNAREGIQLLQKGLKYRQVASTKMNDVSSRSHTIFTINLYKEHKGEIF----KISKMNLV 304
           +  +E +  + +G   R  + T  N+ SSRSH +  I++ +  +          + ++++
Sbjct: 255 QTVQEVMDFVIRGNMNRTTSPTDANETSSRSHAVLQIHIAQTDRTPDLISNSTFATLSII 314

Query: 305 DLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSIA-----DKNIHIPFRESKLTRL 359
           DLAGSE  + +  + +R  E  +IN+SLL LG  IN++       +  H+P+R+SKLTRL
Sbjct: 315 DLAGSERAASTKNRGERLIEGANINKSLLALGNCINALCISDGTRRTCHVPYRDSKLTRL 374

Query: 360 LQDSLGGNTKTALIATISPAKLNAEETCSTLEYATKAKSIKNK 402
           L+ SLGGN KT +I  ISP+  + +ET +TL YA +AK IK K
Sbjct: 375 LKFSLGGNCKTVMIVCISPSSTHYDETLNTLTYANRAKDIKTK 417

>AGR253W Chr7 (1218744..1220873) [2130 bp, 709 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YPR141C (KAR3)
          Length = 709

 Score =  155 bits (392), Expect = 2e-38,   Method: Compositional matrix adjust.
 Identities = 116/363 (31%), Positives = 172/363 (47%), Gaps = 62/363 (17%)

Query: 46  GSNEISINTSDDIVSGLTAQLNSKTYTVDKVFGPSANQRLIFEEIAEPLFNDFLRGYNCT 105
           G+  ++IN ++        ++ S  +  D +F PS   + IFEEI + L    L GYN  
Sbjct: 397 GAQSLTINRNE-------GRILSYNFQFDMIFEPSHTNKEIFEEIRQ-LVQSSLDGYNVC 448

Query: 106 VLVYGMTSTGKTYTMTGDEKLYKGDLSDSAGIIPRVL---FKLFETIEFQSDNYVIKCSF 162
           +  YG T +GKTYTM     L  GD     G+IP  L   FK    ++ +  NY ++C +
Sbjct: 449 IFAYGQTGSGKTYTM-----LNAGD-----GMIPMTLSHIFKWTANLKERGWNYEMECEY 498

Query: 163 IELYNEELKDLLIDSNNTKLKKLRIFDXXXXXXXXXXXXXXXXXHFISGMDLRKXXXXXX 222
           IE+YNE + DL           LR F                  H               
Sbjct: 499 IEIYNETILDL-----------LRDFKSHDNIDEILDSQKHDIRH--------------- 532

Query: 223 XXXXXXTAIQNGNASIYIQNLEEFHIKNAREGIQLLQKGLKYRQVASTKMNDVSSRSHTI 282
                     +     YI N+    + +  +   +L+K  K R  A+T+ N+ SSRSH++
Sbjct: 533 ---------DHEKQGTYITNVTRMKMTSTSQVDTILKKASKMRSTAATRSNERSSRSHSV 583

Query: 283 FTINLYKE--HKGEIFKISKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVIN 340
           F +++     H GE  +  K+NLVDLAGSE I+ S    +R +E  +IN+SL  LG VI 
Sbjct: 584 FMVHINGRNLHTGETSQ-GKLNLVDLAGSERINSSAVTGERLRETQNINKSLSCLGDVIY 642

Query: 341 SIADKNI---HIPFRESKLTRLLQDSLGGNTKTALIATISPAKLNAEETCSTLEYATKAK 397
           ++   +    +IPFR SKLT LLQ SL G++KT +   I P   +  ET ++L +A+K  
Sbjct: 643 ALNTPDAGKRYIPFRNSKLTYLLQYSLVGDSKTLMFVNIPPDPNHISETLNSLRFASKVN 702

Query: 398 SIK 400
           S K
Sbjct: 703 STK 705

>KNAG0A07880 Chr1 complement(1254698..1256992) [2295 bp, 764 aa]
           {ON} Anc_3.479 YPR141C
          Length = 764

 Score =  155 bits (393), Expect = 2e-38,   Method: Compositional matrix adjust.
 Identities = 114/339 (33%), Positives = 165/339 (48%), Gaps = 59/339 (17%)

Query: 70  TYTVDKVFGPSANQRLIFEEIAEPLFNDFLRGYNCTVLVYGMTSTGKTYTMTGDEKLYKG 129
           ++  DK+F    +   +F+E+ + L    L GYN  +  YG T +GKTYTM     L+  
Sbjct: 471 SFKFDKIFDTGESNDEVFKEVGQ-LVQSSLDGYNVCIFAYGQTGSGKTYTM-----LHPN 524

Query: 130 DLSDSAGIIPRVLFKLFETIE---FQSDNYVIKCSFIELYNEELKDLL-IDSNNTKLKKL 185
           D     G+IP  +  +F+ +E    +   Y I C F+E+YNE + DLL  + N T     
Sbjct: 525 D-----GVIPATISHIFDWVENLKERGWEYKISCQFVEIYNENIVDLLRSNENGTPWVNA 579

Query: 186 RIFDXXXXXXXXXXXXXXXXXHFISGMDLRKXXXXXXXXXXXXTAIQNGNASIYIQNLEE 245
              D                       DL K            T I N    +       
Sbjct: 580 GKCDVRHDH------------------DLGK------------TTITNATTCVL------ 603

Query: 246 FHIKNAREGI-QLLQKGLKYRQVASTKMNDVSSRSHTIFTINLYK-EHKGEIFKISKMNL 303
                ++E + ++L++  K R  AST  N+ SSRSH+IF I L+   HK +      +NL
Sbjct: 604 ----ESKESVDKVLKRATKLRSTASTLSNEHSSRSHSIFIIELHGVNHKTKEESCGVLNL 659

Query: 304 VDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSIADKNI--HIPFRESKLTRLLQ 361
           VDLAGSE +  S    +R +E  +IN+SL  LG VI ++ DKN   HIPFR SKLT LLQ
Sbjct: 660 VDLAGSERVHSSQVTGERLRETQNINRSLSCLGDVIYALNDKNTKRHIPFRNSKLTYLLQ 719

Query: 362 DSLGGNTKTALIATISPAKLNAEETCSTLEYATKAKSIK 400
            SL GN+KT +   ISP+  +  ET ++L +A+K  + +
Sbjct: 720 YSLVGNSKTLMFVNISPSSSHINETINSLRFASKVNATR 758

>Ecym_1200 Chr1 (402658..405159) [2502 bp, 833 aa] {ON} similar to
           Ashbya gossypii AER441C
          Length = 833

 Score =  156 bits (394), Expect = 2e-38,   Method: Compositional matrix adjust.
 Identities = 105/342 (30%), Positives = 170/342 (49%), Gaps = 63/342 (18%)

Query: 71  YTVDKVFGPSANQRLIFEEIAEPLFNDFLRGYNCTVLVYGMTSTGKTYTMTGDEKLYKGD 130
           +  DK+F   A Q+ +F     PL +  + G+N TV  YG T  GKT+T++G        
Sbjct: 130 FMFDKLFDVEATQQDVFLGTTRPLLDSIIDGFNGTVFAYGATGCGKTFTISG-------- 181

Query: 131 LSDSAGIIPRVLFKLFETIEFQSDN--YVIKCSFIELYNEELKDLLIDSNNTKLKKLRIF 188
             ++ GII   + +LF+ IE   D   + +  S++E+YNE ++DLL    +T  +KL I 
Sbjct: 182 TPENPGIIFLTMQELFQRIENLKDTKTFQLTVSYLEIYNEMIRDLL--EPDTPSQKLIIR 239

Query: 189 DXXXXXXXXXXXXXXXXXHFISGMDLRKXXXXXXXXXXXXTAIQNGNASIYIQNLEEFHI 248
                                                      ++ + +  + NL     
Sbjct: 240 -------------------------------------------EDTDNTTTVANLSYHTP 256

Query: 249 KNAREGIQLLQKGLKYRQVASTKMNDVSSRSHTIFTINLYKEHKGEIFKISK----MNLV 304
           ++ ++ + L+ KG   R  + T  N+ SSRSH +  I++ +  +    K  K    ++++
Sbjct: 257 RSVQDVMDLVIKGNINRTTSPTDANETSSRSHAVLQIHVVQSSRSVDLKEDKTYATLSII 316

Query: 305 DLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSIADKN----IHIPFRESKLTRLL 360
           DLAGSE  S +  + +R  E  +IN+SLL LG  IN++         H+P+R+SKLTRLL
Sbjct: 317 DLAGSERASATKNRGERLHEGSNINKSLLALGNCINALCMTGRRTYCHVPYRDSKLTRLL 376

Query: 361 QDSLGGNTKTALIATISPAKLNAEETCSTLEYATKAKSIKNK 402
           + SLGGN KT +I  +SP+  + +ET +TL+YA +AK IK K
Sbjct: 377 KFSLGGNCKTVMIVCVSPSSAHYDETLNTLKYANRAKDIKTK 418

>Kpol_1013.7 s1013 (11880..13742) [1863 bp, 620 aa] {ON}
           (11880..13742) [1863 nt, 621 aa]
          Length = 620

 Score =  153 bits (387), Expect = 4e-38,   Method: Compositional matrix adjust.
 Identities = 108/344 (31%), Positives = 171/344 (49%), Gaps = 63/344 (18%)

Query: 71  YTVDKVFGPSANQRLIFEEIAEPLFNDFLRGYNCTVLVYGMTSTGKTYTMTGDEKLYKGD 130
           YT D VF P A+   ++    +PL +    G+N TV  YGMT +GKTYTM+G        
Sbjct: 104 YTYDNVFHPDASNFDVYAATCKPLIDKLFDGFNSTVFAYGMTGSGKTYTMSG-------- 155

Query: 131 LSDSAGIIP----RVLFKLFETIEFQSDNYVIKCSFIELYNEELKDLLIDSNNTKLKKLR 186
           +  +AG+IP     +  K+F++   ++  Y    S++E+YNE++ DLL    +   K LR
Sbjct: 156 VDGNAGLIPLSVAYMYSKIFDSTIHENKKYDTLVSYLEIYNEKIYDLL--ETDFDPKPLR 213

Query: 187 IFDXXXXXXXXXXXXXXXXXHFISGMDLRKXXXXXXXXXXXXTAIQNGNASIYIQNLEEF 246
                                 +  + +R                 + N  + +  L E 
Sbjct: 214 ------------------SSIAVPELKIR----------------DDPNYGVRVIGLTEK 239

Query: 247 HIKNAREGIQLLQKGLKYRQVASTKMNDVSSRSHTIFTINLYKE--HKGEIFKISKMNLV 304
             ++  E +  ++ G K+R+ +ST  N  SSRSH I  I L       GE+   S ++L 
Sbjct: 240 RCQSHEELLNWIKLGDKHRKTSSTDFNTRSSRSHAIILIRLISSDLSSGEVV-TSTLSLC 298

Query: 305 DLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSIADK---------NIHIPFRESK 355
           DLAGSE ++   AQ++R +E   IN+SLL LG VI+ ++ +         N HIP+R+SK
Sbjct: 299 DLAGSERVT---AQHERRQEGSFINKSLLALGTVISKLSAEVNNSTESVNNSHIPYRDSK 355

Query: 356 LTRLLQDSLGGNTKTALIATISPAKLNAEETCSTLEYATKAKSI 399
           LTR+LQ +L GN+    I TI  +     E+ +TL +A++AK++
Sbjct: 356 LTRILQPALSGNSIVTTICTIDTSVDATNESVNTLRFASRAKNV 399

>CAGL0D04994g Chr4 complement(482176..484254) [2079 bp, 692 aa] {ON}
           similar to uniprot|P17119 Saccharomyces cerevisiae
           YPR141c KAR3 kinesin-related protein
          Length = 692

 Score =  151 bits (381), Expect = 4e-37,   Method: Compositional matrix adjust.
 Identities = 116/338 (34%), Positives = 169/338 (50%), Gaps = 55/338 (16%)

Query: 71  YTVDKVFGPSANQRLIFEEIAEPLFNDFLRGYNCTVLVYGMTSTGKTYTMTGDEKLYKGD 130
           +  DK+F        IF+E+ + L    L GYN  +  YG T +GKTYTM     L  GD
Sbjct: 397 FKFDKIFDQQETNDEIFKEVGQ-LIQSSLDGYNVCIFAYGQTGSGKTYTM-----LNPGD 450

Query: 131 LSDSAGIIPRVLFKLFETIE---FQSDNYVIKCSFIELYNEELKDLLIDSNNTKLKKLRI 187
                GI+P  +  +F  I+    +  +Y + C FIE+YNE + DLL     ++    R 
Sbjct: 451 -----GIVPATINHIFSWIDKLAARGWSYKVSCEFIEIYNENIVDLLRSGAPSQENNDRN 505

Query: 188 FDXXXXXXXXXXXXXXXXXHFISGMDLRKXXXXXXXXXXXXTAIQNGNASIYIQNLEEFH 247
            D                    S  ++R                     + YI N+    
Sbjct: 506 AD--------------------SKHEIRHDQELK---------------TTYITNITTC- 529

Query: 248 IKNAREGI-QLLQKGLKYRQVASTKMNDVSSRSHTIFTINLYKEHKGEIFKISK-MNLVD 305
           + ++R+ + ++L++  K R  AST  N+ SSRSH+IF I+L  +++G   K    +NLVD
Sbjct: 530 VLDSRDTVDKVLKRANKLRSTASTAANEHSSRSHSIFIIHLEGKNEGTGEKSQGILNLVD 589

Query: 306 LAGSENISRSGAQNQRAKEAGSINQSLLTLGRVI---NSIADKNIHIPFRESKLTRLLQD 362
           LAGSE ++ S    +R +E  SIN+SL  LG VI   NS   +  HIPFR SKLT LLQ 
Sbjct: 590 LAGSERLNSSMVVGERLRETQSINKSLSCLGDVIHALNSPDGQKRHIPFRNSKLTYLLQY 649

Query: 363 SLGGNTKTALIATISPAKLNAEETCSTLEYATKAKSIK 400
           SL G++KT +   ISPA L+  ET ++L +A+K  + K
Sbjct: 650 SLIGSSKTLMFVNISPAALHLNETINSLRFASKVNNTK 687

>NCAS0F03470 Chr6 complement(695163..697259) [2097 bp, 698 aa] {ON}
           Anc_3.479 YPR141C
          Length = 698

 Score =  149 bits (375), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 113/360 (31%), Positives = 174/360 (48%), Gaps = 61/360 (16%)

Query: 55  SDDIVSGLTAQLNSKT-----YTVDKVFGPSANQRLIFEEIAEPLFNDFLRGYNCTVLVY 109
           S +++ G+    N+ T     +  DK+F  +     +F+E+ + L    L GYN  +  Y
Sbjct: 383 SMEVMKGIEVNNNNATQIPQRFKFDKIFNQTDTNADVFKEVGQ-LVQSSLDGYNVCIFAY 441

Query: 110 GMTSTGKTYTMTGDEKLYKGDLSDSAGIIPRVLFKLF---ETIEFQSDNYVIKCSFIELY 166
           G T +GKTYTM          L    GIIP  +  +F   + ++ +  +Y I C F+E+Y
Sbjct: 442 GQTGSGKTYTM----------LRPKDGIIPSTIKHIFNWTKNLKERGWHYEIDCQFVEIY 491

Query: 167 NEELKDLLIDSNNTKLKKLRIFDXXXXXXXXXXXXXXXXXHFISGMDLRKXXXXXXXXXX 226
           NE + DLL  S+N   + +                     +  +  ++R           
Sbjct: 492 NENIIDLLRSSSNDDTRNI-------------------DSNIPTKHEIRHDQE------- 525

Query: 227 XXTAIQNGNASIYIQNLEEFHIKNAREGIQLLQKGLKYRQVASTKMNDVSSRSHTIFTIN 286
                   N +  I N+   ++ +      +L++  K R  AST  N+ SSRSH+IF I+
Sbjct: 526 --------NRNTTITNIVTRNLDSEETADNILKRANKLRSTASTGSNEHSSRSHSIFIIH 577

Query: 287 LYKEHK---GEIFKISKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSIA 343
           L   +     E + I  +NLVDLAGSE I+ S     R +E  +IN+SL  LG VI+++ 
Sbjct: 578 LRGSNSLTGEESYGI--LNLVDLAGSERINSSQVTGDRLRETQNINRSLSCLGDVIHALG 635

Query: 344 DKN---IHIPFRESKLTRLLQDSLGGNTKTALIATISPAKLNAEETCSTLEYATKAKSIK 400
             +    HIPFR SKLT LLQ SL GN+KT +   ISP+  +  ET ++L +A+K  S K
Sbjct: 636 GPDQGKRHIPFRNSKLTYLLQYSLTGNSKTLMFVNISPSANHINETINSLRFASKVNSTK 695

>KLLA0D05951g Chr4 (509713..511719) [2007 bp, 668 aa] {ON} similar
           to uniprot|P28743 Saccharomyces cerevisiae YPL155C KIP2
           Kinesin-related motor protein involved in mitotic
           spindle positioning
          Length = 668

 Score =  147 bits (370), Expect = 8e-36,   Method: Compositional matrix adjust.
 Identities = 101/341 (29%), Positives = 163/341 (47%), Gaps = 56/341 (16%)

Query: 71  YTVDKVFGPSANQRLIFEEIAEPLFNDFLRGYNCTVLVYGMTSTGKTYTMTGDEKLYKGD 130
           +  D VF P  N   ++E +A P+ +    G+NCT+  YGMT +GKTYTM+G +      
Sbjct: 106 FNFDHVFSPEMNNDRVYETMALPMIDKLFEGFNCTIFAYGMTGSGKTYTMSGSK------ 159

Query: 131 LSDSAGIIPRVLFKLFETIE--FQSDNYVIKCSFIELYNEELKDLLIDSNNTKLKKLRIF 188
                GIIP  +  +F+ I        + ++ S++E+YNE                 RIF
Sbjct: 160 --SGPGIIPMCVDTIFDRINVGLPRKKFTVRVSYLEIYNE-----------------RIF 200

Query: 189 DXXXXXXXXXXXXXXXXXHFISGMDLRKXXXXXXXXXXXXTAIQNG-NASIYIQNLEEFH 247
           D                 +   G  L                +++     + +  L E +
Sbjct: 201 DLL---------------NLPQGKTLNSNIMVPSSTLTNDLKLRDDLKYGVKVVGLVERN 245

Query: 248 IKNAREGIQLLQKGLKYRQVASTKMNDVSSRSHTIFTINLY--KEHKGEIFKISKMNLVD 305
           + + +E ++ +  G   R+   T  N  SSRSH +  I ++   E  GE   +S ++L D
Sbjct: 246 VSSNKELMKCISIGDHNRKTGETDFNTRSSRSHAVVLIRVFCTDEITGEQV-MSTLSLCD 304

Query: 306 LAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSIA------DKNI-HIPFRESKLTR 358
           LAGSE   R+  Q +R KE   IN+SLL LG VI+ ++        N+ HIP+R+SKLTR
Sbjct: 305 LAGSE---RATGQQERRKEGAYINKSLLALGTVISKLSMESSGLSTNVGHIPYRDSKLTR 361

Query: 359 LLQDSLGGNTKTALIATISPAKLNAEETCSTLEYATKAKSI 399
           +LQ +L G++  A I T+      + E+ +T+ +A++AK+I
Sbjct: 362 ILQPALSGDSLVATICTVDTRPETSTESINTIRFASRAKNI 402

>KAFR0H02410 Chr8 complement(460353..462329) [1977 bp, 658 aa] {ON}
           Anc_8.678 YPL155C
          Length = 658

 Score =  146 bits (369), Expect = 1e-35,   Method: Compositional matrix adjust.
 Identities = 111/365 (30%), Positives = 169/365 (46%), Gaps = 67/365 (18%)

Query: 63  TAQLNSKTYTVDKVFGPSANQRLIFEEIAEPLFNDFLRGYNCTVLVYGMTSTGKTYTMTG 122
           T   N+  Y  D VF P  +   I++  A PL +    G+N T+  YGMT +GKTYTM G
Sbjct: 125 TINTNNDEYKFDHVFSPHVDNFEIYKTTAIPLIDKLFTGFNATLFCYGMTGSGKTYTMMG 184

Query: 123 DEKLYKGDLSDSAGIIPRVLFKLFETIEFQSDN---YVIKCSFIELYNEELKDLLIDSNN 179
           D +       +  GI+P  +  LF  +   S N   Y +  S++E+YNE++ DLL D   
Sbjct: 185 DNE-------NPDGIVPLSVSLLFNQV-LNSRNDKKYDVILSYLEIYNEKIYDLLDDDRT 236

Query: 180 TKLKKLRIFDXXXXXXXXXXXXXXXXXHFISGMDLRKXXXXXXXXXXXXTAIQNGNASIY 239
             L     F                    ++  +LR               ++ G   + 
Sbjct: 237 NHLLTPSRFTSTPSR--------------LNSSELR-----------IRDDLEYG---VK 268

Query: 240 IQNLEEFHIKNAREGIQLLQKGLKYRQVASTKMNDVSSRSHTIFTINLYKEHKGEIFKIS 299
           I  L E     ++E ++ ++ G   R+ + T+ N  SSRSH +  + L   +  +  K S
Sbjct: 269 ITGLNEERCDTSQELMKWIKYGDSNRKTSETEYNLRSSRSHAVILVRLVTHNVIDGSKTS 328

Query: 300 K-MNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSIADKNI----------- 347
             + L DLAGSE   R+  Q +R KE   IN+SLL LG VI+ ++ +++           
Sbjct: 329 STLTLCDLAGSE---RAAGQQERRKEGAFINKSLLALGTVISKLSAESLSNSKHVSNPMG 385

Query: 348 -------------HIPFRESKLTRLLQDSLGGNTKTALIATISPAKLNAEETCSTLEYAT 394
                        HIP+R+SKLTRLLQ +L GN+    I TI P      ET +TL +A+
Sbjct: 386 PPASPSLNSNGNNHIPYRDSKLTRLLQPALSGNSAVTTICTIDPRMETYAETINTLRFAS 445

Query: 395 KAKSI 399
           +AK++
Sbjct: 446 RAKNV 450

>Kpol_505.39 s505 complement(87351..89429) [2079 bp, 692 aa] {ON}
           complement(87351..89429) [2079 nt, 693 aa]
          Length = 692

 Score =  146 bits (369), Expect = 1e-35,   Method: Compositional matrix adjust.
 Identities = 108/338 (31%), Positives = 167/338 (49%), Gaps = 56/338 (16%)

Query: 71  YTVDKVFGPSANQRLIFEEIAEPLFNDFLRGYNCTVLVYGMTSTGKTYTMTGDEKLYKGD 130
           +  D++F      + +F+EI + L    L GYN  +  YG T +GKT+TM          
Sbjct: 397 FQFDRIFDQHEVNKDVFDEIGQ-LVQSSLDGYNVCIFAYGQTGSGKTFTM---------- 445

Query: 131 LSDSAGIIPRVLFKLFE---TIEFQSDNYVIKCSFIELYNEELKDLLIDSNNTKLKKLRI 187
           L+ + G+IP  +  +F+   +++ +   Y + C F+E+YNE + DLL +  + +L ++  
Sbjct: 446 LNPNDGMIPATIDHIFDWTDSLKERGWEYEVSCQFVEIYNENIIDLLREETSAELDEI-- 503

Query: 188 FDXXXXXXXXXXXXXXXXXHFISGMDLRKXXXXXXXXXXXXTAIQNGNASIYIQNLEEFH 247
                              H     D+R             T I N   SI         
Sbjct: 504 --------------TNNGRH-----DIR------HDSDKRITTITNIKTSI--------- 529

Query: 248 IKNAREGIQLLQKGLKYRQVASTKMNDVSSRSHTIFTINLYKEHK--GEIFKISKMNLVD 305
           +K+      L++K  K R  A+T  N+ SSRSH+IF I+L   +   GE      +NLVD
Sbjct: 530 LKSKDSVDFLIKKATKLRATATTAANERSSRSHSIFIIHLRGSNNITGE-SSYGILNLVD 588

Query: 306 LAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSIADKNI---HIPFRESKLTRLLQD 362
           LAGSE ++ S  +  R +E  +IN+SL  LG VI+++   +    HIPFR SKLT LLQ 
Sbjct: 589 LAGSERLNSSQVEGARLRETQNINKSLSCLGDVIHALGSSDASKRHIPFRNSKLTYLLQY 648

Query: 363 SLGGNTKTALIATISPAKLNAEETCSTLEYATKAKSIK 400
           SL GN+KT +   ISP +   +ET ++L +A+K  + K
Sbjct: 649 SLTGNSKTLMFVNISPTQQQIQETLNSLRFASKVNTTK 686

>SAKL0H06490g Chr8 complement(571300..573273) [1974 bp, 657 aa] {ON}
           similar to uniprot|P28743 Saccharomyces cerevisiae
           YPL155C KIP2 Kinesin-related motor protein involved in
           mitotic spindle positioning
          Length = 657

 Score =  145 bits (367), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 102/342 (29%), Positives = 169/342 (49%), Gaps = 60/342 (17%)

Query: 71  YTVDKVFGPSANQRLIFEEIAEPLFNDFLRGYNCTVLVYGMTSTGKTYTMTGDEKLYKGD 130
           ++ D VF P+ +   ++EE A P+     +G+N T+  YGMT +GKT+TM+G        
Sbjct: 147 FSFDHVFHPTNDNFAVYEETARPMIEKLFQGFNSTIFAYGMTGSGKTFTMSGT------- 199

Query: 131 LSDSAGIIPRVLFKLFETIEFQSDN---YVIKCSFIELYNEELKDLLIDSNNTKLKKLRI 187
            S+  G+IP  +  +F  I  +S N   + +K S++E+YNE++ DLL    N ++ K   
Sbjct: 200 -SNEPGLIPLSVNDIFSNIMSKSLNNQRFDVKVSYLEIYNEKIYDLL----NYQVSKGSF 254

Query: 188 FDXXXXXXXXXXXXXXXXXHFISGMDLRKXXXXXXXXXXXXTAIQNGNASIYIQNLEEFH 247
                                 +G++L+                 +    + +  L E  
Sbjct: 255 GTKT------------------TGIELKIR--------------DDSKYGVKVIGLTEQE 282

Query: 248 IKNAREGIQLLQKGLKYRQVASTKMNDVSSRSHTIFTINL-YKEHKGEIFKISKMNLVDL 306
           +  + + ++ +  G   R+   T  N  SSRSH I  I L   + K  +   S ++L DL
Sbjct: 283 VDTSEDVMKWIALGNSNRKTGETDFNSRSSRSHAIVLIRLTCTDLKSGLETTSTLSLCDL 342

Query: 307 AGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSIADKNI---------HIPFRESKLT 357
           AGSE   R+ AQ +R KE   IN+SLL LG VI+ ++ ++          HIP+R+SKLT
Sbjct: 343 AGSE---RATAQRERRKEGAFINKSLLALGTVISKLSAESTQNMGVGGGHHIPYRDSKLT 399

Query: 358 RLLQDSLGGNTKTALIATISPAKLNAEETCSTLEYATKAKSI 399
           R+LQ +L G+     I T+     ++ ET +T+ +A++AK+I
Sbjct: 400 RILQPALSGDGIVTTICTVDAHAESSAETINTIRFASRAKNI 441

>TDEL0A06240 Chr1 (1092814..1094727) [1914 bp, 637 aa] {ON}
           Anc_8.678 YPL155C
          Length = 637

 Score =  144 bits (364), Expect = 4e-35,   Method: Compositional matrix adjust.
 Identities = 135/440 (30%), Positives = 206/440 (46%), Gaps = 70/440 (15%)

Query: 71  YTVDKVFGPSANQRLIFEEIAEPLFNDFLRGYNCTVLVYGMTSTGKTYTMTGDEKLYKGD 130
           +T D+VF  +     I+E  + P+ +  L+G+N TV  YGMT +GKT+TMTG E      
Sbjct: 112 FTFDRVFPANCTNLDIYEASSRPMIDKLLQGFNATVFAYGMTGSGKTFTMTGTE------ 165

Query: 131 LSDSAGIIPRVLFKLFETIEFQS----DNYVIKCSFIELYNEELKDLLIDSNNTKLKKLR 186
             D AG+IP  +  LF  I   S      Y +  S++E+YNE++ DLL   +  K     
Sbjct: 166 --DEAGLIPLSVTYLFSKILEHSMRGTSKYEVVVSYLEIYNEKIYDLLDCESENKFN--- 220

Query: 187 IFDXXXXXXXXXXXXXXXXXHFISGMDLRKXXXXXXXXXXXXTAIQNGNASIYIQNLEEF 246
                                F+SG                   ++ G   + I  L E 
Sbjct: 221 ---------------STPSRMFLSGT---PRSSGGPVELRIRDDLKYG---VRITGLTEK 259

Query: 247 HIKNAREGIQLLQKGLKYRQVASTKMNDVSSRSHTIFTINLYKE--HKGEIFKISKMNLV 304
             +++ E  + +Q G K R+ + T  N  SSRSH I  + L       GE    S ++L 
Sbjct: 260 RCESSEELSRWIQIGDKNRKTSETIYNTRSSRSHAIVLVRLNNTDLRSGETVS-STLSLC 318

Query: 305 DLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVI------------------NSIADKN 346
           DLAGSE   ++ +Q +R KE   IN+SLL LG VI                   +  + N
Sbjct: 319 DLAGSE---KAVSQYERRKEGAFINKSLLALGTVISKLSSESLSKNGPPTFTSTNPTEPN 375

Query: 347 IHIPFRESKLTRLLQDSLGGNTKTALIATISPAKLNAEETCSTLEYATKAKS----IKNK 402
            HIP+R+SKLTR+LQ +L GN+    I TI      A ET +T+ +A++AK+    +  +
Sbjct: 376 THIPYRDSKLTRILQPALSGNSIITTICTIDTRNEAASETVNTIRFASRAKNVTLQVAKR 435

Query: 403 PQL--GSIIMKDVRLKDLNNELAKIKRDLTSTKQKDGVYMTQNHYKDLTNDLESYKTEIQ 460
           P +  GS   KD  +++L  +L K  + +   KQ+  +  + +H  D T D  S  T ++
Sbjct: 436 PAVGTGSYNEKDQTIENLTQQLEKQHQLVMRLKQRTSM-TSSSHNDDSTVDPNS--TLLK 492

Query: 461 ECDRIVKSLELQNALLLKDK 480
             +R++K  +L N   L DK
Sbjct: 493 AENRVLK-CKLSNCEKLLDK 511

>Ecym_4407 Chr4 (846516..848651) [2136 bp, 711 aa] {ON} similar to
           Ashbya gossypii AGR253W
          Length = 711

 Score =  144 bits (364), Expect = 6e-35,   Method: Compositional matrix adjust.
 Identities = 110/341 (32%), Positives = 158/341 (46%), Gaps = 55/341 (16%)

Query: 68  SKTYTVDKVFGPSANQRLIFEEIAEPLFNDFLRGYNCTVLVYGMTSTGKTYTMTGDEKLY 127
           S  +  DK+F P      +F+EI + L    L GYN  +  YG T +GKTYTM     L 
Sbjct: 414 SYNFHFDKIFEPHNTNADVFQEICQ-LVQCSLDGYNVCIFAYGQTGSGKTYTM-----LN 467

Query: 128 KGDLSDSAGIIPRVLFKLFETIE---FQSDNYVIKCSFIELYNEELKDLLIDSNNTKLKK 184
            GD     G+IP  L  +F+  E        Y + C +IE+YNE + DLL          
Sbjct: 468 PGD-----GMIPMTLSHIFQWTEDLMEHGWRYEMDCEYIEIYNETILDLL---------- 512

Query: 185 LRIFDXXXXXXXXXXXXXXXXXHFISGMDLRKXXXXXXXXXXXXTAIQNGNASIYIQNLE 244
            R F+                 H                         + N +  I N+ 
Sbjct: 513 -REFNSNDNIDDILESQKHEIRH------------------------DHDNHATSITNVT 547

Query: 245 EFHIKNAREGIQLLQKGLKYRQVASTKMNDVSSRSHTIFT--INLYKEHKGEIFKISKMN 302
           +  + +  +   +L++  + R  A T+ N+ SSRSH++F   IN + +  GE+    K+N
Sbjct: 548 KMKMTSQEQVDSMLKRASRMRSTACTRSNERSSRSHSVFMVHINGHNDQTGEVSH-GKLN 606

Query: 303 LVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVI---NSIADKNIHIPFRESKLTRL 359
           L+DLAGSE I+ S     R +E  +IN+SL  LG VI   NS      HIPFR SKLT L
Sbjct: 607 LIDLAGSERINSSLVTGDRLRETQNINKSLSCLGDVIYALNSPDAAKRHIPFRNSKLTYL 666

Query: 360 LQDSLGGNTKTALIATISPAKLNAEETCSTLEYATKAKSIK 400
           LQ SL G++KT +   I   + +  ET ++L +A+K  S K
Sbjct: 667 LQYSLIGDSKTLMFVNIPSDQKHTNETLNSLRFASKVNSTK 707

>KLTH0D11286g Chr4 (922942..924978) [2037 bp, 678 aa] {ON} similar
           to uniprot|P28743 Saccharomyces cerevisiae YPL155C KIP2
           Kinesin-related motor protein involved in mitotic
           spindle positioning
          Length = 678

 Score =  144 bits (362), Expect = 8e-35,   Method: Compositional matrix adjust.
 Identities = 104/350 (29%), Positives = 166/350 (47%), Gaps = 60/350 (17%)

Query: 71  YTVDKVFGPSANQRLIFEEIAEPLFNDFLRGYNCTVLVYGMTSTGKTYTMTGDEKLYKGD 130
           +  DKVF P  N   ++EEI +P+ +   +GYN T+  YGMT +GKT+TM+G        
Sbjct: 140 FWFDKVFSPQTNNYGVYEEIGKPMIDKLFQGYNATIFAYGMTGSGKTFTMSGTR------ 193

Query: 131 LSDSAGIIPRVLFKLFETIEFQSDN---YVIKCSFIELYNEELKDLL-IDSNNTKLKKLR 186
             D AG+I   + ++F  I  +S N   Y ++ S++E+YNE++ DLL   S  +      
Sbjct: 194 --DEAGLILLSVEQIFSQIMKESVNNKSYEVRVSYLEIYNEKIYDLLNYPSAKSPGGTYG 251

Query: 187 IFDXXXXXXXXXXXXXXXXXHFISGMDLRKXXXXXXXXXXXXTAIQNGNASIYIQNLEEF 246
            F                     +G +L                  +    + +  L E 
Sbjct: 252 SFQSKNVPG--------------AGAEL--------------PVRDDARHGVRVVGLTEQ 283

Query: 247 HIKNAREGIQLLQKGLKYRQVASTKMNDVSSRSHTIFTINL-YKEHKGEIFKISKMNLVD 305
            + ++ + ++ ++ G   R+   T  N  SSRSH I TI +   E        S ++L D
Sbjct: 284 QVHSSEDVLRKIELGNSNRRTGETDYNTRSSRSHAIVTIKVTCTELLSGTDTTSTLSLCD 343

Query: 306 LAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSIAD----------------KNIHI 349
           LAGSE   R+  Q++R KE   IN+SLL LG VI+ ++                  N H+
Sbjct: 344 LAGSE---RAAGQHERRKEGAFINKSLLALGTVISKLSAVSGASGGGAATPPPTFGNSHV 400

Query: 350 PFRESKLTRLLQDSLGGNTKTALIATISPAKLNAEETCSTLEYATKAKSI 399
           P+R+SKLTR+LQ +L G++    I TI        ET +T+ +A++AK++
Sbjct: 401 PYRDSKLTRILQPALSGDSIVTTICTIDTKPDAMSETVNTIRFASRAKNV 450

>CAGL0M02189g Chr13 complement(261290..263308) [2019 bp, 672 aa]
           {ON} similar to uniprot|P28743 Saccharomyces cerevisiae
           YPL155c KIP2 kinesin-related protein
          Length = 672

 Score =  142 bits (359), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 110/362 (30%), Positives = 169/362 (46%), Gaps = 74/362 (20%)

Query: 71  YTVDKVFGPSANQRLIFEEIAEPLFNDFLRGYNCTVLVYGMTSTGKTYTMTGDEKLYKGD 130
           +T D VF    +   I+ +  +PL +  + GYN T+  YGMT +GKT+TM+G E      
Sbjct: 133 FTFDHVFSTGCSNFDIYGKTTQPLIDRLIEGYNATIFAYGMTGSGKTFTMSGTE------ 186

Query: 131 LSDSAGIIPRVLFKLF----ETIEFQSDNYVIKCSFIELYNEELKDLL--IDSNNTKLKK 184
             +  G+IP  +  LF    E    +++   +  S++E+YNE++ DLL     +N +   
Sbjct: 187 --EEKGLIPLSVSYLFSSLLEKTNTENEKSEVWVSYLEIYNEKINDLLDVASGSNVQNTP 244

Query: 185 LRIFDXXXXXXXXXXXXXXXXXHFISGMDLRKXXXXXXXXXXXXTAIQNGNASIYIQNLE 244
            R+F                  H  S  DL+                 +    + +  L 
Sbjct: 245 SRLF---------------TSTHTSSSGDLKIR--------------DDSECGVRVVGLT 275

Query: 245 EFHIKNAREGIQLLQKGLKYRQVASTKMNDVSSRSHTIFTINLYKE--HKGEIFKISKMN 302
           +     + E +  + KG K R+ + T+ N  SSRSH I  I L  +    GE   I  ++
Sbjct: 276 QKRCDTSEEVLDWINKGNKNRKTSETEFNTRSSRSHAIVMIRLISKDIRTGEQ-NIRTLS 334

Query: 303 LVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVIN--------------------SI 342
           L DLAGSE   R   QN+R KE   IN+SLL LG VI+                    S+
Sbjct: 335 LCDLAGSE---RGVGQNERRKEGAFINRSLLALGTVISRLSAENNGSHHTGRAANSQQSL 391

Query: 343 ADKNI-----HIPFRESKLTRLLQDSLGGNTKTALIATISPAKLNAEETCSTLEYATKAK 397
           A  N      HIP+R+SKLTRLLQ +L G++    + TI  A  ++ ET +TL +A+++K
Sbjct: 392 ASPNGSSSGNHIPYRDSKLTRLLQPALSGDSVVVALCTIDLAHESSSETLNTLRFASRSK 451

Query: 398 SI 399
           ++
Sbjct: 452 NV 453

>TPHA0D01270 Chr4 (264339..266429) [2091 bp, 696 aa] {ON} Anc_8.678
           YPL155C
          Length = 696

 Score =  142 bits (359), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 104/353 (29%), Positives = 168/353 (47%), Gaps = 58/353 (16%)

Query: 71  YTVDKVFGPSANQRLIFEEIAEPLFNDFLRGYNCTVLVYGMTSTGKTYTMTGDEKLYKGD 130
           + +D++F    +   I+ E+ +PL +    GYN T+  YGMT +GKT+TM+G +      
Sbjct: 109 FRLDRIFDCDVSNLEIYSELCKPLIDKLAMGYNATLFAYGMTGSGKTFTMSGTQ------ 162

Query: 131 LSDSAGIIPRVLFKLFETIE----FQSDNYVIKCSFIELYNEELKDLLIDSNNTKLKKLR 186
             +  G+IP  +  LF TI          Y +  S++E+YNE+L DLL D+N        
Sbjct: 163 --EDTGLIPLSISHLFNTINEENLLGKKKYEMLVSYMEIYNEKLYDLL-DTN-------- 211

Query: 187 IFDXXXXXXXXXXXXXXXXXHFISGMDLRKXXXXXXXXXXXXTAIQNGNASIYIQNLEEF 246
           +                    F S  DLR                 +    I +  L E 
Sbjct: 212 VEGVNFGYSSNLQTPPRFGNSFNSAQDLRIR--------------DDAQYGIKVVGLSEH 257

Query: 247 HIKNAREGIQLLQKGLKYRQVASTKMNDVSSRSHTIFTINLYK-EHKGEIFKISKMNLVD 305
              +  + ++ ++ G K ++++ T+ N  SSRSH+I  + L   + +  I   S ++L D
Sbjct: 258 RCSSKDDLMKWVRIGDKNKKISETEYNSRSSRSHSILLVRLIATDLETGIVTTSTLSLCD 317

Query: 306 LAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSIADK-------------------N 346
           LAGSE   ++ +Q +R KE   IN+SLL LG VI  ++ +                   N
Sbjct: 318 LAGSE---KATSQQERRKEGAFINKSLLALGTVIAKLSSESNQHRNADNVNHQETSNPNN 374

Query: 347 IHIPFRESKLTRLLQDSLGGNTKTALIATISPAKLNAEETCSTLEYATKAKSI 399
            HIP+R+SKLTR+LQ +L GN+    I T+      + ET +TL +A++AK++
Sbjct: 375 SHIPYRDSKLTRILQPALSGNSIITTICTVDIRSDASSETLNTLRFASRAKNV 427

>ZYRO0F07414g Chr6 (600148..602112) [1965 bp, 654 aa] {ON} similar
           to uniprot|P28743 Saccharomyces cerevisiae YPL155C KIP2
           Kinesin-related motor protein involved in mitotic
           spindle positioning
          Length = 654

 Score =  140 bits (354), Expect = 8e-34,   Method: Compositional matrix adjust.
 Identities = 107/360 (29%), Positives = 167/360 (46%), Gaps = 56/360 (15%)

Query: 71  YTVDKVFGPSANQRLIFEEIAEPLFNDFLRGYNCTVLVYGMTSTGKTYTMTGDEKLYKGD 130
           +  D VF  + N   ++ + ++P+ +    G N TV  YGMT +GKT+TM G E      
Sbjct: 122 FKYDHVFKTACNNVEVYAQTSKPMIDRVFEGLNATVFAYGMTGSGKTFTMAGTE------ 175

Query: 131 LSDSAGIIPRVLFKLFETI---EFQSDN-YVIKCSFIELYNEELKDLLIDSNNTKLKKLR 186
             ++ G+IP  +  L+  +     Q D+ + I  S++E+YNE++ DLL   N  K     
Sbjct: 176 --ETLGLIPLSVAYLYSRVMEESLQGDSRFEIAVSYLEIYNEKIYDLLDCENELK----- 228

Query: 187 IFDXXXXXXXXXXXXXXXXXHFISGMDLRKXXXXXXXXXXXXTAIQNGNASIYIQNLEEF 246
                                  + M  R                ++    + I  L E 
Sbjct: 229 -------------PTAATSSRMFAHMGTRSSKTPVELKLR-----EDSKYGVKIVGLTER 270

Query: 247 HIKNAREGIQLLQKGLKYRQVASTKMNDVSSRSHTIFTINLYKEHKGEIFKISK-MNLVD 305
             +++ E ++ ++ G K R+   T  N  SSRSH I  I L K    E   +S  ++L D
Sbjct: 271 RCESSDELLKWIRIGDKSRKTGETTYNTRSSRSHAIVMIRLTKTDLKEGTSVSSTLSLCD 330

Query: 306 LAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSIADKNI-------------HIPFR 352
           LAGSE   ++   N+R KE   IN+SLL LG VI+ ++ ++              HIP+R
Sbjct: 331 LAGSE---KAVTHNERRKEGAFINKSLLALGTVISKLSAESTSHRNGGSSSPVTGHIPYR 387

Query: 353 ESKLTRLLQDSLGGNTKTALIATISPAKLNAEETCSTLEYATKAKSIK----NKPQLGSI 408
           +SKLTR+LQ +L GN     I TI      + ET +TL +A++AK++      KP L S+
Sbjct: 388 DSKLTRILQPALSGNGVVTTICTIDTRPDASSETLNTLRFASRAKNVSLHIFRKPLLPSM 447

>NDAI0B05770 Chr2 complement(1400232..1402523) [2292 bp, 763 aa]
           {ON} Anc_3.479
          Length = 763

 Score =  141 bits (355), Expect = 1e-33,   Method: Compositional matrix adjust.
 Identities = 115/346 (33%), Positives = 164/346 (47%), Gaps = 59/346 (17%)

Query: 71  YTVDKVFGPSANQRLIFEEIAEPLFNDFLRGYNCTVLVYGMTSTGKTYTMTGDEKLYKGD 130
           +  DK+F  +     +F+E+ + L    L GYN  +  YG T +GKTYTM          
Sbjct: 453 FKFDKIFNQNETNDDVFKEVGQ-LVQSSLDGYNVCIFAYGQTGSGKTYTM---------- 501

Query: 131 LSDSAGIIPRVLFKLF---ETIEFQSDNYVIKCSFIELYNEELKDLLIDS--NNTKLKKL 185
           L    GIIP  +  +F     ++ +   Y I+C F+E+YNE + DLL +   NN K+  L
Sbjct: 502 LHPKDGIIPATISHIFNWTNNLKERGWKYEIECEFVEIYNENIVDLLRNEHDNNGKVNDL 561

Query: 186 RIFDXXXXXXXXXXXXXXXXXHFISGMDLRKXXXXXXXXXXXXTAIQNGNASIYIQNLEE 245
                                H     ++R             T  +  ++ I + N+  
Sbjct: 562 ----------LASPSQSNSTKH-----EIRHDPETQTTKVTNITTCK-LDSKITVDNI-- 603

Query: 246 FHIKNAREGIQLLQKGLKYRQVASTKMNDVSSRSHTIFTINL--YKEHKGE-IFKISKMN 302
                       L++  K R  AST  N+ SSRSH+IF I+L    E  GE  + I  +N
Sbjct: 604 ------------LRRANKLRSTASTLSNEHSSRSHSIFIIHLKGTNEITGEKSYGI--LN 649

Query: 303 LVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSIAD--------KNIHIPFRES 354
           LVDLAGSE I+ S    +R +E  +IN+SL  LG VI+++          K  HIPFR S
Sbjct: 650 LVDLAGSERINSSQVTGERLRETQNINRSLSCLGDVIHALTGSEKDKENAKKRHIPFRNS 709

Query: 355 KLTRLLQDSLGGNTKTALIATISPAKLNAEETCSTLEYATKAKSIK 400
           KLT LLQ SL GN+KT +   ISP+     ET ++L +A+K  S K
Sbjct: 710 KLTYLLQYSLIGNSKTLMFVNISPSINYVNETLNSLRFASKVNSAK 755

>Kwal_26.8806 s26 (950736..952883) [2148 bp, 715 aa] {ON} YPL155C
           (KIP2) - kinesin-related protein [contig 68] FULL
          Length = 715

 Score =  140 bits (353), Expect = 1e-33,   Method: Compositional matrix adjust.
 Identities = 114/422 (27%), Positives = 201/422 (47%), Gaps = 70/422 (16%)

Query: 71  YTVDKVFGPSANQRLIFEEIAEPLFNDFLRGYNCTVLVYGMTSTGKTYTMTGDEKLYKGD 130
           +  D VF P +N   ++++I +P+ +   +GYN  +  YGMT +GKT+TM+G        
Sbjct: 139 FKFDNVFRPQSNNYEVYQQIGKPMIDRLFQGYNAIIFAYGMTGSGKTFTMSGT------- 191

Query: 131 LSDSAGIIPRVLFKLFETIEFQS---DNYVIKCSFIELYNEELKDLLIDSNNTKLKKLRI 187
             + AG+I   +  +F  I  +S    ++ +  S++E+YNE++ DL        L +  +
Sbjct: 192 -PEEAGLISLSVEHIFAQIMSESLANKSFQVTVSYLEIYNEKIYDL--------LNQSSL 242

Query: 188 FDXXXXXXXXXXXXXXXXXHFISGMDLRKXXXXXXXXXXXXTAIQNGNASIYIQNLEEFH 247
                              H  +G +L                  +    + +  L E  
Sbjct: 243 KSPGGGSGGGYGSFSSKPTH-AAGTEL--------------PVRDDSKHGVRVMGLTEQR 287

Query: 248 IKNAREGIQLLQKGLKYRQVASTKMNDVSSRSHTIFTINLY-KEHKGEIFKISKMNLVDL 306
           + ++ + ++ +  G   R+   T  N  SSRSH I T+NL   +        S ++L DL
Sbjct: 288 VYSSEDVLKWISLGDTNRRTGETDYNTRSSRSHAIVTLNLACTDLVSGAETTSTLSLCDL 347

Query: 307 AGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSIADK---------NIHIPFRESKLT 357
           AGSE   R+  Q++R KE   IN+SLL LG VI+ ++           N HIP+R+SKLT
Sbjct: 348 AGSE---RAAGQHERRKEGAFINKSLLALGTVISKLSASSMHTTPSFGNSHIPYRDSKLT 404

Query: 358 RLLQDSLGGNTKTALIATISPAKLNA-EETCSTLEYATKAKSI-----KNKPQLGSIIMK 411
           R+LQ +L G +    I TI   +L+A  ET +T+ +A++AK++     +N+ +L     K
Sbjct: 405 RILQPALSGESIVTTICTID-TRLDAMSETVNTIRFASRAKNVSMTVKRNEAELAH--EK 461

Query: 412 DVRLKDLNNEL-------AKIKRDLTSTKQKDGVYMTQNHYKDLTNDLESYKTEIQECDR 464
           D  + +L  +L        ++KR+    +Q   +Y+       L  + ++ K ++Q C+R
Sbjct: 462 DALIHNLRRQLDEQQELIWELKRNQEKCEQTPDLYL-------LRKESDALKRKLQLCER 514

Query: 465 IV 466
           ++
Sbjct: 515 LL 516

>KLTH0F14498g Chr6 complement(1188459..1190567) [2109 bp, 702 aa]
           {ON} similar to uniprot|P17119 Saccharomyces cerevisiae
           YPR141C KAR3 Minus-end-directed microtubule motor that
           functions in mitosis and meiosis localizes to the
           spindle pole body and localization is dependent on
           functional Cik1p required for nuclear fusion during
           mating potential Cdc28p substrate
          Length = 702

 Score =  140 bits (352), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 111/345 (32%), Positives = 160/345 (46%), Gaps = 71/345 (20%)

Query: 71  YTVDKVFGPSANQRLIFEEIAEPLFNDFLRGYNCTVLVYGMTSTGKTYTMTGDEKLYKGD 130
           +T D+ F        +F EI + L    L GYN  +  YG T +GKT+TM          
Sbjct: 409 FTFDRCFSAQETNGDVFSEIGQ-LIQSSLDGYNVCIFAYGQTGSGKTFTM---------- 457

Query: 131 LSDSAGIIPRVLFKLFETIEFQSD---NYVIKCSFIELYNEELKDLL------IDSNNTK 181
           L+ + GIIP  L  +F  +E   +    Y I   F+E+YNE +KDL       +D     
Sbjct: 458 LNPNDGIIPSTLNHIFLWVEKLKELGWVYEITSQFVEIYNENIKDLFKENDADVDDTGES 517

Query: 182 LKKLRIFDXXXXXXXXXXXXXXXXXHFISGMDLRKXXXXXXXXXXXXTAIQNGNASIYIQ 241
           LK                             ++R                 N + + +I 
Sbjct: 518 LK----------------------------FEIRH---------------DNESRTTHIT 534

Query: 242 NLEEFHIKNAREGI-QLLQKGLKYRQVASTKMNDVSSRSHTIFTINL--YKEHKGEIFKI 298
           N+    +  +RE + ++L++ LK R  A+T  N  SSRSH++F I L  Y    GE    
Sbjct: 535 NITVCKL-TSREMVNRMLRRALKMRSTAATVANSRSSRSHSVFIIKLDGYNTISGEK-ST 592

Query: 299 SKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSIADKNI---HIPFRESK 355
             +NLVDLAGSE I     Q +R +E  +IN+SL  LG VI+++   +    HIPFR SK
Sbjct: 593 GTLNLVDLAGSERIHSLQPQAERLRETQNINKSLSCLGDVIHALGSADASKRHIPFRNSK 652

Query: 356 LTRLLQDSLGGNTKTALIATISPAKLNAEETCSTLEYATKAKSIK 400
           LT LLQ SL G++KT +   +SP   +  ET ++L +A K  S K
Sbjct: 653 LTYLLQYSLMGDSKTLMFVNVSPCANSMLETLNSLRFAAKVNSTK 697

>Kpol_1050.103 s1050 complement(235625..237718) [2094 bp, 697 aa]
           {ON} complement(235625..237718) [2094 nt, 698 aa]
          Length = 697

 Score =  139 bits (349), Expect = 3e-33,   Method: Compositional matrix adjust.
 Identities = 117/399 (29%), Positives = 188/399 (47%), Gaps = 62/399 (15%)

Query: 6   QKIEDDTDEMNIMVAVRCRGRNKREXXXXXXXXXXXPDVMGSNEISINTSDDIVSGLTAQ 65
           +K+ +   E+   + V CR R   +            D  G+  ++++    + +G    
Sbjct: 350 RKVHNQIQELRGNIRVFCRVRPTDDDTNIIKVHGFDSDT-GTQSLTLDIKRPMTNG---- 404

Query: 66  LNSKTYTVDKVFGPSANQRLIFEEIAEPLFNDFLRGYNCTVLVYGMTSTGKTYTMTGDEK 125
             S  +  DK+F    + R +F E+ E L    L G+N  +  YG T +GKTYTM     
Sbjct: 405 --SVNFQFDKIFNYDESNRQVFGEVKE-LVQSALDGHNVCIFTYGQTGSGKTYTM----- 456

Query: 126 LYKGDLSDSAGIIPRVLFKLFE---TIEFQSDNYVIKCSFIELYNEELKDLLIDSNNTKL 182
                L++  GIIP  L  + +   +++     Y +K  F+E+YN+              
Sbjct: 457 -----LNEEDGIIPSTLDHIIDWTSSMKKLGWQYGLKIKFVEIYND-------------- 497

Query: 183 KKLRIFDXXXXXXXXXXXXXXXXXHFISGMDLRKXXXXXXXXXXXXTAIQNGNASIYIQN 242
              RIFD                     G    K            T + N     +   
Sbjct: 498 ---RIFDLLN-----------------DGKGKHKECEVRHDDIGRRTELTNVITREF--Q 535

Query: 243 LEEFHIK-NAREGIQLLQKGLKYRQVASTKMNDVSSRSHTIFTINLYKEHKGEIFKISK- 300
           LEE  I+ N RE  +L+Q+  K R+ A T MN+ SSRSH++F + +   +K    +    
Sbjct: 536 LEEDLIESNRRELQELVQRLNKVRRTAKTAMNNRSSRSHSVFIVEVEGFNKDSEERCKGV 595

Query: 301 MNLVDLAGSENISRSG-AQNQRAKEAGSINQSLLTLGRVINSI--ADKNIHIPFRESKLT 357
           +NLVDLAGSE ++RSG    +R +E   IN+SL ++G VI+++     ++HIPFR +KLT
Sbjct: 596 LNLVDLAGSERMNRSGLVDKERIEETKQINKSLSSVGDVIHALRQGSGSLHIPFRNTKLT 655

Query: 358 RLLQDSLGGNTKTALIATISPAKLNAEETCSTLEYATKA 396
            LL+ SL G++KT ++ T+SP+  +  ET ++L +ATK 
Sbjct: 656 YLLKHSLQGSSKTLMLVTVSPSNSSRNETMNSLRFATKV 694

>YPL155C Chr16 complement(257216..259336) [2121 bp, 706 aa] {ON}
           KIP2Kinesin-related motor protein involved in mitotic
           spindle positioning, stabilizes microtubules by
           targeting Bik1p to the plus end; Kip2p levels are
           controlled during the cell cycle
          Length = 706

 Score =  135 bits (339), Expect = 6e-32,   Method: Compositional matrix adjust.
 Identities = 108/369 (29%), Positives = 173/369 (46%), Gaps = 78/369 (21%)

Query: 71  YTVDKVFGPSANQRLIFEEIAEPLFNDFLRGYNCTVLVYGMTSTGKTYTMTGDEKLYKGD 130
           +  D VF        ++E  ++P+ +  L G+N T+  YGMT +GKT+TM+G+E+     
Sbjct: 163 FKFDHVFASHCTNLEVYERTSKPMIDKLLMGFNATIFAYGMTGSGKTFTMSGNEQ----- 217

Query: 131 LSDSAGIIPRVLFKLFETIEFQSDN----YVIKCSFIELYNEELKDLL---IDSNNTKLK 183
                G+IP  +  LF  I  QS N    + +  S++E+YNE + DLL   ++ + +++ 
Sbjct: 218 ---ELGLIPLSVSYLFTNIMEQSMNGDKKFDVIISYLEIYNERIYDLLESGLEESGSRIS 274

Query: 184 -KLRIFDXXXXXXXXXXXXXXXXXHFISGMDLRKXXXXXXXXXXXXTAIQNGNASIYIQN 242
              R++                      G++L+                 +    + +  
Sbjct: 275 TPSRLYMSKSNSNGL-------------GVELKIR--------------DDSQYGVKVIG 307

Query: 243 LEEFHIKNAREGIQLLQKGLKYRQVASTKMNDVSSRSHTIFTINLYKEH-KGEIFKISKM 301
           L E   +++ E ++ +  G K R++  T  N  SSRSH I  I L   + K    + S +
Sbjct: 308 LTERRCESSEELLRWIAVGDKSRKIGETDYNARSSRSHAIVLIRLTSTNVKNGTSRSSTL 367

Query: 302 NLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSI-ADK------NI------- 347
           +L DLAGSE   R+  Q +R KE   IN+SLL LG VI+ + ADK      NI       
Sbjct: 368 SLCDLAGSE---RATGQQERRKEGSFINKSLLALGTVISKLSADKMNSVGSNIPSPSASG 424

Query: 348 -----------------HIPFRESKLTRLLQDSLGGNTKTALIATISPAKLNAEETCSTL 390
                            HIP+R+SKLTRLLQ +L G++    I T+      A ET +TL
Sbjct: 425 SSSSSGNATNNGTSPSNHIPYRDSKLTRLLQPALSGDSIVTTICTVDTRNDAAAETMNTL 484

Query: 391 EYATKAKSI 399
            +A++AK++
Sbjct: 485 RFASRAKNV 493

>Ecym_2395 Chr2 complement(766148..768211) [2064 bp, 687 aa] {ON}
           similar to Ashbya gossypii ACR145W
          Length = 687

 Score =  134 bits (336), Expect = 1e-31,   Method: Compositional matrix adjust.
 Identities = 102/352 (28%), Positives = 163/352 (46%), Gaps = 68/352 (19%)

Query: 71  YTVDKVFGPSANQRLIFEEIAEPLFNDFLRGYNCTVLVYGMTSTGKTYTMTGDEKLYKGD 130
           +  D VF        ++  + +P+ +   +GYN T+  YGMT +GKT+TM+G ++     
Sbjct: 145 FQFDHVFTKEVTNSEVYMALGQPIVDKLFQGYNATIFAYGMTGSGKTFTMSGTKQ----- 199

Query: 131 LSDSAGIIPRVLFKLF-----ETIEFQSDNYVIKCSFIELYNEELKDLL-IDSNNTKLKK 184
                G+IP  +  +F     ET +     Y +K S++E+YNE++ DLL I   N  +  
Sbjct: 200 ---DPGLIPLCVGNMFDRVMEETSKSTEHKYEVKVSYLEIYNEKIYDLLSITEANGAVAS 256

Query: 185 LRIFDXXXXXXXXXXXXXXXXXHFISGMDLRKXXXXXXXXXXXXTAIQNGNASIYIQNLE 244
            ++                      SG+ +R                 +    + + +L 
Sbjct: 257 RQLGRNS------------------SGLKIR----------------DDSKYGVKVVDLT 282

Query: 245 EFHIKNAREGIQLLQKGLKYRQVASTKMNDVSSRSHTIFTINLYK-EHKGEIFKISKMNL 303
           E  +++  E I+ +  G K R+   T  N  SSRSH I  + L + E K      S ++L
Sbjct: 283 EQQVESHGEVIKWIAAGDKNRKTGETDFNSRSSRSHAIVLLRLTRCELKTGTEVTSTLSL 342

Query: 304 VDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSIADKNI---------------- 347
            DLAGSE   R+  Q  R KE   IN+SLL LG VI  ++  +                 
Sbjct: 343 CDLAGSE---RAVTQLVRRKEGAFINKSLLALGTVIAKLSANSAGSGSGSNGQPPSAMGG 399

Query: 348 HIPFRESKLTRLLQDSLGGNTKTALIATISPAKLNAEETCSTLEYATKAKSI 399
           HIP+R+SKLTR+LQ +L G++    I TI     +  ET +T+ +A++AK+I
Sbjct: 400 HIPYRDSKLTRILQPALTGDSIITTICTIDSKSESNSETTNTVRFASRAKNI 451

>TDEL0B07270 Chr2 complement(1280163..1282097) [1935 bp, 644 aa]
           {ON} Anc_2.633 YKL079W
          Length = 644

 Score =  130 bits (327), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 118/382 (30%), Positives = 174/382 (45%), Gaps = 93/382 (24%)

Query: 64  AQLNSKTYTVDKVFGPSANQR-----LIFEEIAEPLFNDFLRGYNCTVLVYGMTSTGKTY 118
           A  N K + VD++F P A  +     +I + +A+ LFN    GYN  ++ YG T +GKT 
Sbjct: 64  AGQNLKLFRVDQIFNPGAQTKDTTSSIIGDSVAQ-LFN----GYNVAIMAYGQTDSGKTS 118

Query: 119 TMTGDEKLYKGDLSDSAGIIPRVLFKLFETIEFQSDN---YVIKCSFIELYNEELKDLLI 175
           TM G     KGD     G+I  V  ++F T+E  S+N   Y I  S IE+  E ++DLL 
Sbjct: 119 TMFG---YNKGD-----GVINGVCKQIFTTVETGSENNIDYSISLSIIEVNCESIRDLLA 170

Query: 176 DSNNTKLKKLRIFDXXXXXXXXXXXXXXXXXHFISGMDLRKXXXXXXXXXXXXTAIQNGN 235
             +  K  KLR                         +D +K                   
Sbjct: 171 PLSEQKPLKLR-------------------------LDSKK------------------- 186

Query: 236 ASIYIQNLEEFHIKNAREGIQLLQKGLKYRQVASTKMNDVSSRSHTIFTINL-YKEHKGE 294
           +SI I+NL   ++ +  E +   +KG   R +AS       SRS  I  I +  +++  E
Sbjct: 187 SSISIKNLRCVYVTSLLEALSYCEKG---RSLAS-------SRSSVIIRITVEQRDNVKE 236

Query: 295 IFKISKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSIA----------- 343
           +FK     LVDL  S+ I +        +    INQS++TL  V  S+A           
Sbjct: 237 VFKTGSFQLVDLGSSDKIDKQNNLGISPENTKKINQSMVTLENVARSLAGTEQSVKNGRP 296

Query: 344 -DKNIHIPFRESKLTRLLQDSLGGNTKTALIATISPAKLNAEETCSTLEYATKAKSIK-- 400
              N +IP++ES LT+LLQ+++GGN KT L+   S AK + EET +TL +    K +K  
Sbjct: 297 RSGNYYIPYKESCLTQLLQETIGGNCKTTLVLMCSTAKQDEEETLNTLNFGANMKLVKNL 356

Query: 401 ---NKPQLGSIIMKDVRLKDLN 419
              NK    S  M D+ +KD +
Sbjct: 357 FQQNKAGTNSKAMLDLLMKDFD 378

>NDAI0E02090 Chr5 complement(423630..425687) [2058 bp, 685 aa] {ON} 
          Length = 685

 Score =  130 bits (328), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 109/361 (30%), Positives = 165/361 (45%), Gaps = 62/361 (17%)

Query: 71  YTVDKVFGPSANQRLIFEEIAEPLFNDFLRGYNCTVLVYGMTSTGKTYTMTGDEKLYKGD 130
           +  D VF    +   I++ I  P+ +   +G+N T+  YGMT +GKTYTM G  +  + D
Sbjct: 137 FKFDHVFNSFVSNLEIYQVINRPMIDKLFQGFNSTIFAYGMTGSGKTYTMMGCPEREQKD 196

Query: 131 LSDSAGIIPRVLFKLFETIEFQS----DNYVIKCSFIELYNEELKDLLIDSNNTKLKKLR 186
                G+IP  +  LF  I  ++      + I  S++E+YNE++ DLL D NN       
Sbjct: 197 -----GLIPLSVSYLFTKIMEETLDGDKKFEIVLSYLEIYNEKIYDLLGDENNNNNNNNG 251

Query: 187 IFDXXXXXXXXXXXXXXXXXHFISGMDLRKXXXXXXXXXXXXTAIQNGNASIYIQNLEEF 246
                                F + + +R                 +    + +  L E 
Sbjct: 252 TL------AFGTPTRNNNNICFQNELKIR----------------DDSKYGVRVIGLTEK 289

Query: 247 HIKNAREGIQLLQKGLKYRQVASTKMNDVSSRSHTIFTINLYKEHKGEIFKISK-MNLVD 305
             +++ E +  + KG K R+ A T  N  SSRSH I  I L      +   IS  ++L D
Sbjct: 290 RCESSEELMNWIIKGDKIRKTAETDFNARSSRSHAIVLIRLTTSDMKDGTSISSTLSLCD 349

Query: 306 LAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSIA---DKNI--------------- 347
           LAGSE   R+  Q +R KE   IN+SLL LG VI+ ++   +KN                
Sbjct: 350 LAGSE---RATGQQERRKEGAFINKSLLALGTVISKLSTESNKNRSPTLPSPPLSSSSSS 406

Query: 348 ---------HIPFRESKLTRLLQDSLGGNTKTALIATISPAKLNAEETCSTLEYATKAKS 398
                    HIP+R+SKLTRLLQ +L G++    I TI     ++ ET +TL +A++AK+
Sbjct: 407 TSINSSVPGHIPYRDSKLTRLLQPALSGDSIVTTICTIDTKNESSAETLNTLRFASRAKN 466

Query: 399 I 399
           I
Sbjct: 467 I 467

>Skud_16.127 Chr16 complement(228817..230937) [2121 bp, 706 aa] {ON}
           YPL155C (REAL)
          Length = 706

 Score =  129 bits (323), Expect = 5e-30,   Method: Compositional matrix adjust.
 Identities = 105/369 (28%), Positives = 164/369 (44%), Gaps = 78/369 (21%)

Query: 71  YTVDKVFGPSANQRLIFEEIAEPLFNDFLRGYNCTVLVYGMTSTGKTYTMTGDEKLYKGD 130
           +  D VF        ++E   +P+ +  L G+N T+  YGMT +GKT+TM+G+E+     
Sbjct: 163 FKFDHVFASHCTNLEVYERTGKPMIDKLLMGFNATIFAYGMTGSGKTFTMSGNEQ----- 217

Query: 131 LSDSAGIIPRVLFKLFETIEFQS----DNYVIKCSFIELYNEELKDL----LIDSNNTKL 182
                G+IP  +  LF  I  QS      + +  S++E+YNE + DL    L +S +   
Sbjct: 218 ---ELGLIPLSVSYLFSNIMEQSMDGDKKFDVIISYLEIYNERIYDLLESGLEESGSRPG 274

Query: 183 KKLRIFDXXXXXXXXXXXXXXXXXHFISGMDLRKXXXXXXXXXXXXTAIQNGNASIYIQN 242
              R +                      G++L+                 +    + +  
Sbjct: 275 TPSRSYMGKSNSNAM-------------GVELKIR--------------DDSKYGVKVIG 307

Query: 243 LEEFHIKNAREGIQLLQKGLKYRQVASTKMNDVSSRSHTIFTINLYK-EHKGEIFKISKM 301
           L E   ++  E ++ +  G K R++  T  N  SSRSH I  I L   +      + S +
Sbjct: 308 LTERRCESTEELLRWIGIGDKSRKIGETDYNTRSSRSHAIVLIRLTSTDVNNGTSRSSTL 367

Query: 302 NLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSIA-------DKNI------- 347
           +L DLAGSE   R+  Q +R KE   IN+SLL LG VI+ ++       D NI       
Sbjct: 368 SLCDLAGSE---RATGQQERRKEGSFINKSLLALGTVISKLSADKTTSVDSNISTTPTGS 424

Query: 348 -----------------HIPFRESKLTRLLQDSLGGNTKTALIATISPAKLNAEETCSTL 390
                            HIP+R+SKLTRLLQ +L G++    I T+      A ET +TL
Sbjct: 425 SGSSSGSITGNSGIPSNHIPYRDSKLTRLLQPALSGDSIVTTICTVDTRNDAAAETMNTL 484

Query: 391 EYATKAKSI 399
            +A++AK++
Sbjct: 485 RFASRAKNV 493

>ACR145W Chr3 (605114..607171) [2058 bp, 685 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YPL155C (KIP2)
          Length = 685

 Score =  127 bits (319), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 102/374 (27%), Positives = 175/374 (46%), Gaps = 69/374 (18%)

Query: 71  YTVDKVFGPSANQRLIFEEIAEPLFNDFLRGYNCTVLVYGMTSTGKTYTMTGDEKLYKGD 130
           +  D VF      + +++ +  P+ +    GYN T+  YGMT +GKT+TM+G+++     
Sbjct: 146 FQFDHVFTKGVCNQEVYQALGVPIIDKLFEGYNATIFAYGMTGSGKTFTMSGNKQ----- 200

Query: 131 LSDSAGIIPRVLFKLFETIEFQ----SDNYVIKCSFIELYNEELKDLL--IDSNNTKLKK 184
                G+IP+ +  +F+ I  +    S  Y +K S++E+YNE++ DLL  +D       +
Sbjct: 201 ---EPGLIPQCVGNIFDRISSEHHGASLAYEVKVSYLEIYNEKIYDLLNYVDRQAGSTGQ 257

Query: 185 LRIFDXXXXXXXXXXXXXXXXXHFISGMDLRKXXXXXXXXXXXXTAIQNGNASIYIQNLE 244
                                    +G+ +R                 +    + + +L 
Sbjct: 258 --------------------PSRNATGLKIR----------------DDSKYGVKVVDLT 281

Query: 245 EFHIKNAREGIQLLQKGLKYRQVASTKMNDVSSRSHTIFTINLYK-EHKGEIFKISKMNL 303
           E  + +  + ++ +  G + R+   T  N  SSRSH I  + L + + K      S ++L
Sbjct: 282 EQLVSSHEDVMKWIATGDRNRKTGETDFNTRSSRSHAIVLLRLTRYDLKTGSEATSTLSL 341

Query: 304 VDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSIA------------DKNIHIPF 351
            DLAGSE   R+  Q  R KE   IN+SLL LG VI  ++                HIP+
Sbjct: 342 CDLAGSE---RAVTQIVRRKEGAFINKSLLALGTVIAKLSMLGSQANGLQPSPAAGHIPY 398

Query: 352 RESKLTRLLQDSLGGNTKTALIATISPAKLNAEETCSTLEYATKAKSIK---NKPQLGSI 408
           R+SKLTR+LQ +L G++    I TI     ++ ET +T+ +A++AK+I     K ++ S 
Sbjct: 399 RDSKLTRILQPALTGDSIITTICTIDSKAESSTETTNTVRFASRAKNIALNVRKNEMDSH 458

Query: 409 IMKDVRLKDLNNEL 422
             KD  +++L  +L
Sbjct: 459 AEKDTIIQNLRKQL 472

>Smik_6.352 Chr6 (564913..567060) [2148 bp, 715 aa] {ON} YPL155C
           (REAL)
          Length = 715

 Score =  126 bits (317), Expect = 3e-29,   Method: Compositional matrix adjust.
 Identities = 103/371 (27%), Positives = 168/371 (45%), Gaps = 76/371 (20%)

Query: 71  YTVDKVFGPSANQRLIFEEIAEPLFNDFLRGYNCTVLVYGMTSTGKTYTMTGDEKLYKGD 130
           +  D VF        ++E+ ++P+ +  L G+N T+  YGMT +GKT+TM+G+E+     
Sbjct: 163 FKFDHVFASHCTNLEVYEKTSKPMIDKLLMGFNATIFAYGMTGSGKTFTMSGNEQ----- 217

Query: 131 LSDSAGIIPRVLFKLFETIEFQSDN----YVIKCSFIELYNEELKDLLIDSNNTKLKKLR 186
                G+IP  +  LF  I  QS N    + +  S++E+YNE + D L++S         
Sbjct: 218 ---ELGLIPLSVSYLFTNIMEQSMNGDKKFDVVISYLEIYNERIYD-LLESG-------- 265

Query: 187 IFDXXXXXXXXXXXXXXXXXHFISGMDLRKXXXXXXXXXXXXTAIQNGNASIYIQNLEEF 246
           + +                     G++L+                 +    + +  L E 
Sbjct: 266 LEESGSRLGTPSRSYMSKNNSNALGVELKIR--------------DDSQYGVKVIGLTER 311

Query: 247 HIKNAREGIQLLQKGLKYRQVASTKMNDVSSRSHTIFTINLYK-EHKGEIFKISKMNLVD 305
             +++ + ++ +  G K R++  T  N  SSRSH I  I L   + +    + S ++L D
Sbjct: 312 RCESSEDLLRWIAVGDKSRKIGETDYNARSSRSHAIVLIRLTSTDVRDGTSRSSTLSLCD 371

Query: 306 LAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSI-ADK------------------- 345
           LAGSE   R+  Q +R KE   IN+SLL LG VI+ + ADK                   
Sbjct: 372 LAGSE---RATGQQERRKEGSFINKSLLALGTVISKLSADKTNSVGSIIPTTPTSSGNSS 428

Query: 346 -----------------NIHIPFRESKLTRLLQDSLGGNTKTALIATISPAKLNAEETCS 388
                            + HIP+R+SKLTRLLQ +L G++    I T+      A ET +
Sbjct: 429 SSSSSSSGSIVSNSNTSSNHIPYRDSKLTRLLQPALSGDSIVTTICTVDTRNDAAAETMN 488

Query: 389 TLEYATKAKSI 399
           TL +A++AK++
Sbjct: 489 TLRFASRAKNV 499

>KNAG0J01720 Chr10 (314395..316272) [1878 bp, 625 aa] {ON} Anc_8.678
           YPL155C
          Length = 625

 Score =  125 bits (313), Expect = 7e-29,   Method: Compositional matrix adjust.
 Identities = 121/451 (26%), Positives = 198/451 (43%), Gaps = 95/451 (21%)

Query: 64  AQLNSKTYTVDKVFGPSANQRLIFEEIAEPLFNDFLRGYNCTVLVYGMTSTGKTYTMTG- 122
           A  +   +  D VFGP+A    +F E+   L      G N T+L YG T +GKTYTM G 
Sbjct: 120 AHWDQGDFQFDHVFGPTATNEDLFAELGGGLVEKLFDGCNATLLAYGTTGSGKTYTMVGH 179

Query: 123 DEKLYK--GDLSDSAGIIPRVLFKLFETIEFQSDNYVIKCSFIELYNEELKDLLIDSNNT 180
           ++ + K  GD          V  ++    + +     +  S++E+YNE++ DLL  ++N 
Sbjct: 180 NDGIVKMCGDC---------VFTRMLNAADERQVKRSVTVSYLEIYNEKICDLL--NSNC 228

Query: 181 KLKKLRIFDXXXXXXXXXXXXXXXXXHFISGMDLRKXXXXXXXXXXXXTAIQNGNASIYI 240
           + ++L++ D                                                + +
Sbjct: 229 RNEELKVRDDPVL-------------------------------------------GVKV 245

Query: 241 QNLEEFHIKNAREGIQLLQKGLKYRQVASTKMNDVSSRSHTIFTINLYKEH--KGEIFKI 298
             + E     A E ++ +  G   R+   T  N  SSRSH I  + L   +   G     
Sbjct: 246 HGVLEQKCDTAEELMKWVSVGEAVRKTGKTDYNMRSSRSHAIIQVKLITTNLLNGTTH-F 304

Query: 299 SKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSIADK------------- 345
           + ++L DLAGSE  S    Q +R KE   IN+SLL LG VI+ ++ +             
Sbjct: 305 NTLSLCDLAGSEKASE---QLERRKEGSFINKSLLALGTVISKLSAESNAHDSSRPSSGS 361

Query: 346 --NIHIPFRESKLTRLLQDSLGGNTKTALIATISPAKLNAEETCSTLEYATKA------- 396
             N HIP+R+SKLTRLLQ +L  ++    I TI P K    ET +TL +A++A       
Sbjct: 362 LNNSHIPYRDSKLTRLLQPALCNDSVVTAICTIDPTKEAMTETVNTLRFASRAKNVSLNV 421

Query: 397 --KSIKNKPQLGSIIMKDVRLKDLNN---ELAKIKRDLTSTKQKDGVYMTQNHYKDLTND 451
             KSI  +P       KD R++ L     E   I  +L   +Q  G  + + + +    +
Sbjct: 422 SRKSISYRPD-SQDAEKDKRVRSLTKLVEEQDLIISNLKKQQQHAGSALQRPNSRTALLE 480

Query: 452 LES--YKTEIQECDRIV--KSLELQNALLLK 478
            E+   + ++Q C+R++   S+ELQ++ +++
Sbjct: 481 AENRVLRDKLQHCERLLDNDSVELQDSQIME 511

>TPHA0D04190 Chr4 complement(899419..901437) [2019 bp, 672 aa] {ON} 
          Length = 672

 Score =  122 bits (305), Expect = 8e-28,   Method: Compositional matrix adjust.
 Identities = 102/337 (30%), Positives = 159/337 (47%), Gaps = 60/337 (17%)

Query: 70  TYTVDKVFGPSANQRLIFEEIAEPLFNDFLRGYNCTVLVYGMTSTGKTYTMTGDEKLYKG 129
            +T DK+FG   +   +F++I   L    L GYN  +  YG T +GKTYTM         
Sbjct: 383 AFTFDKIFGMQDDNYEVFDDIKN-LVQSSLDGYNVCIFTYGQTGSGKTYTM--------- 432

Query: 130 DLSDSAGIIPRVLFKLFETIEFQSD------NYVIKCSFIELYNEELKDLLIDSNNTKLK 183
            L++  GII + +  +   + F  +       Y ++  FIE+YNE ++DLL    N + K
Sbjct: 433 -LNEKDGIIMQTIEYI---VHFAGNLHKLGWEYELEVEFIEIYNETIRDLL----NPEAK 484

Query: 184 KLRIFDXXXXXXXXXXXXXXXXXHFISGMDLRKXXXXXXXXXXXXTAIQNGNA-SIYIQN 242
                                  H I   D +             T + N +  +I + +
Sbjct: 485 ---------------------HQHVIRHDDKK-----------GTTEVTNTHKITIKLTH 512

Query: 243 LEEFHIKNAREGIQLLQKGLKYRQVASTKMNDVSSRSHTIFTINLYKEHK-GEIFKISKM 301
            E+  I  + +  QL++ G   R   ST MN+ SSRSH++F + +   ++  +     ++
Sbjct: 513 NEDDEIAKSAQIRQLIRNGNNTRNTKSTHMNNASSRSHSVFMMKITGHNRITQEHSTGRL 572

Query: 302 NLVDLAGSENISRSG--AQNQRAKEAGSINQSLLTLGRVINSIADKNIHIPFRESKLTRL 359
           NLVDLAGSE + +       +  KE  SIN+SL  L  VI+S+  +  +IPFR SKLT L
Sbjct: 573 NLVDLAGSERLQQQEQITSQETLKETTSINKSLTCLADVIHSMKHRQPYIPFRNSKLTYL 632

Query: 360 LQDSLGGNTKTALIATISPAKLNAEETCSTLEYATKA 396
           L++SL   +KT +   ISP   +  ET ++L  A K 
Sbjct: 633 LKNSLINKSKTLMYVNISPNINSIRETINSLRLARKV 669

>Suva_16.155 Chr16 complement(266334..268448) [2115 bp, 704 aa] {ON}
           YPL155C (REAL)
          Length = 704

 Score =  120 bits (300), Expect = 4e-27,   Method: Compositional matrix adjust.
 Identities = 104/365 (28%), Positives = 160/365 (43%), Gaps = 70/365 (19%)

Query: 71  YTVDKVFGPSANQRLIFEEIAEPLFNDFLRGYNCTVLVYGMTSTGKTYTMTGDEKLYKGD 130
           +  D VF        ++E  ++P+ +  L G+N T+  YGMT +GKT+TM+G+E+     
Sbjct: 163 FEFDHVFASHCTNLEVYERTSKPMIDKLLVGFNATIFAYGMTGSGKTFTMSGNEQ----- 217

Query: 131 LSDSAGIIPRVLFKLFETIEFQSDN----YVIKCSFIELYNEELKDLLIDSNNTKLKKLR 186
                G+IP  +  LF  +   S N    + +  S++E+YNE                 R
Sbjct: 218 ---ELGLIPLSVSYLFSNVMELSMNGDKKFDVIISYLEIYNE-----------------R 257

Query: 187 IFDXXXXXXXXXXXXXXXXXHFISGMDLRKXXXXXXXXXXXXTAIQNGNASIYIQNLEEF 246
           I+D                     G   +                Q G   + +  L E 
Sbjct: 258 IYDLLESGLEESLSRPSTPSRLYMG---KGNSNGLSAELKIRDDTQYG---VKVIGLTER 311

Query: 247 HIKNAREGIQLLQKGLKYRQVASTKMNDVSSRSHTIFTINLYK-EHKGEIFKISKMNLVD 305
             +++ E ++ +  G K R++  T  N  SSRSH I  I L   + +    + S ++L D
Sbjct: 312 RCESSEELLKWIAIGDKSRKIGETDYNARSSRSHAIVLIRLTSTDLESGTSRSSTLSLCD 371

Query: 306 LAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSI-ADK------NIH-IP------- 350
           LAGSE   R+  Q +R KE   IN+SLL LG VI+ + ADK      NIH  P       
Sbjct: 372 LAGSE---RATGQQERRKEGSFINKSLLALGTVISKLSADKINPTGSNIHTTPTNTGSSS 428

Query: 351 ----------------FRESKLTRLLQDSLGGNTKTALIATISPAKLNAEETCSTLEYAT 394
                           +R+SKLTRLLQ +L G++    I T+      A ET +TL +A+
Sbjct: 429 SGTVTSNNNIPNNHIPYRDSKLTRLLQPALSGDSIVTTICTVDTRNDAAAETINTLRFAS 488

Query: 395 KAKSI 399
           +AK++
Sbjct: 489 RAKNV 493

>Kpol_1019.11 s1019 complement(20458..22401) [1944 bp, 647 aa] {ON}
           complement(20458..22401) [1944 nt, 648 aa]
          Length = 647

 Score =  113 bits (283), Expect = 4e-25,   Method: Compositional matrix adjust.
 Identities = 111/400 (27%), Positives = 184/400 (46%), Gaps = 87/400 (21%)

Query: 51  SINTSDDIVSGLTA-QLNSKTYTVDKVFGPSANQRLIFEEIAEPLFNDFLRGYNCTVLVY 109
           SIN +D  ++G +  Q+ +  Y  DKVF  S +  +  +E  E      L+GYN +++ Y
Sbjct: 52  SINFTDTQLTGFSKDQVVNTQYKFDKVFA-SNDTGVEHQEFIESNLESLLQGYNTSIVTY 110

Query: 110 GMTSTGKTYTMTGDEKLYKGDLSDSAGIIPRVLFKLFETIEFQSDN------YVIKCSFI 163
           G + TGK++ + G+++          G+I ++L KLF  I+ +  N      Y +K SF+
Sbjct: 111 GQSGTGKSFELYGEQQ---------DGLIFQLLTKLFNRIDEEMGNNNKNIHYTVKFSFL 161

Query: 164 ELYNEELKDLLIDSNNTKLKKLRIFDXXXXXXXXXXXXXXXXXHFISGMDLRKXXXXXXX 223
           E+Y E++ DL+ DS + K K L+I D                                  
Sbjct: 162 EVYQEKMFDLM-DSPSVK-KHLKINDS--------------------------------- 186

Query: 224 XXXXXTAIQNGNASIYIQNLEEFHIKNAREGIQLLQKGLKYRQVASTKMNDVSSRSHTIF 283
                T   NG     ++NL    +    E   L+   L  ++    + N++  RSHTI 
Sbjct: 187 -----TYAMNG---FQVENLRTTQVLTLEELKILINICLLNQK---ERHNNLIQRSHTIM 235

Query: 284 TINLYKEHK-GEIFKISKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSI 342
            +++ K +K  E   +S + +VDLAGS+ I ++ +     ++A  IN  + ++  VIN +
Sbjct: 236 EVSIEKRNKLDESITMSSLYIVDLAGSDPIGKNSSSGITTEDAKKINHQIKSVNDVINGL 295

Query: 343 ADKN------------IH-IPFRESKLTRLLQDSLGGNTKTALIATISPAKLNAEETCST 389
              N            +H +P++ S LTRLL D LGGN KT  + T S  K +  ET ST
Sbjct: 296 VVMNREGGIMTDISTLMHKVPYKSSILTRLLLDPLGGNCKTTFLLTSSLKKNDWNETLST 355

Query: 390 LEYATKAKSIKNKPQLG----------SIIMKDVRLKDLN 419
           L++    KS    P++            I + D++LK+ N
Sbjct: 356 LKFGYNCKSANTNPRINRFGLNSKATMDIFLTDMKLKEDN 395

>KAFR0B06590 Chr2 complement(1368106..1370226) [2121 bp, 706 aa]
           {ON} Anc_3.479 YPR141C
          Length = 706

 Score =  110 bits (276), Expect = 3e-24,   Method: Compositional matrix adjust.
 Identities = 69/149 (46%), Positives = 90/149 (60%), Gaps = 4/149 (2%)

Query: 256 QLLQKGLKYRQVASTKMNDVSSRSHTIFTINLY-KEHKGEIFKISKMNLVDLAGSENISR 314
           ++L +  K R  ASTK N+ SSRSH+IF I+L+ K  K        +NLVDLAGSE I+ 
Sbjct: 554 KVLHRATKLRSTASTKSNEHSSRSHSIFIIHLHGKNSKTNEDSYGILNLVDLAGSERINS 613

Query: 315 SGAQNQRAKEAGSINQSLLTLGRVI---NSIADKNIHIPFRESKLTRLLQDSLGGNTKTA 371
           S    +R +E   IN+SL  LG VI   NS   K  HIPFR SKLT LL+ SL GN+KT 
Sbjct: 614 SQVSGERLRETQHINKSLSCLGDVIHALNSSEHKERHIPFRNSKLTHLLKYSLSGNSKTL 673

Query: 372 LIATISPAKLNAEETCSTLEYATKAKSIK 400
           +   IS +  +  ET ++L +A+K  S K
Sbjct: 674 MFVNISASLNHVNETINSLRFASKVNSTK 702

 Score = 73.6 bits (179), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 41/116 (35%), Positives = 60/116 (51%), Gaps = 14/116 (12%)

Query: 62  LTAQLNSKTYTVDKVFGPSANQRLIFEEIAEPLFNDFLRGYNCTVLVYGMTSTGKTYTMT 121
           +T   N+  Y  DK+F    +   IF+E+ + L    L GYN  +  YG T +GKT+TM 
Sbjct: 412 ITKNNNTNKYKFDKIFDQFESNSEIFKEVGQ-LVQSALDGYNVCIFAYGQTGSGKTFTM- 469

Query: 122 GDEKLYKGDLSDSAGIIP---RVLFKLFETIEFQSDNYVIKCSFIELYNEELKDLL 174
                    L+ S GIIP   R +F   + ++ +   Y I C F+E+YNE + DLL
Sbjct: 470 ---------LNPSDGIIPSTVRHIFTWIDNLKERGWEYQINCQFVEIYNENIIDLL 516

>TPHA0D03200 Chr4 complement(659182..661356) [2175 bp, 724 aa] {ON}
           Anc_3.479 YPR141C
          Length = 724

 Score =  110 bits (274), Expect = 6e-24,   Method: Compositional matrix adjust.
 Identities = 68/150 (45%), Positives = 93/150 (62%), Gaps = 8/150 (5%)

Query: 257 LLQKGLKYRQVASTKMNDVSSRSHTIFTINLYKEHKGEIFKISK---MNLVDLAGSENIS 313
           +L+K  K R  A+T  N+ SSRSH++F I  Y + K EI   S    +NLVDLAGSE ++
Sbjct: 571 VLKKATKLRATAATNSNERSSRSHSVFMI--YLKGKNEITGDSSEGILNLVDLAGSERLN 628

Query: 314 RSGAQNQRAKEAGSINQSLLTLGRVINSIADKN---IHIPFRESKLTRLLQDSLGGNTKT 370
            S A   R +E  +IN+SL  LG VI+++   +    HIPFR SKLT LLQ SL G++KT
Sbjct: 629 SSQAVGARLRETQNINKSLSCLGDVIHALGQNDNTKRHIPFRNSKLTYLLQYSLTGSSKT 688

Query: 371 ALIATISPAKLNAEETCSTLEYATKAKSIK 400
            +   ISP K +  ET ++L +A+K  S K
Sbjct: 689 LMFVNISPTKSHLNETINSLRFASKVNSTK 718

 Score = 73.6 bits (179), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 40/112 (35%), Positives = 60/112 (53%), Gaps = 14/112 (12%)

Query: 68  SKTYTVDKVFGPSANQRLIFEEIAEPLFNDFLRGYNCTVLVYGMTSTGKTYTMTGDEKLY 127
           S+ Y  D++F  + +   +F+EI + L    L G+N  +  YG T +GKTYTM       
Sbjct: 427 SQIYKFDRIFDQADSNTEVFKEIGQ-LVQSSLDGHNVCIFAYGQTGSGKTYTM------- 478

Query: 128 KGDLSDSAGIIPRVLFKLFETIEFQSDN---YVIKCSFIELYNEELKDLLID 176
              L+D+ G+IP  +  +F+  E   +    Y I C FIE+YNE + DLL D
Sbjct: 479 ---LNDNDGMIPATISHIFDWTESMKEKGWIYDISCQFIEIYNEGIIDLLRD 527

>SAKL0F03168g Chr6 (261405..263525) [2121 bp, 706 aa] {ON} similar
           to uniprot|P17119 Saccharomyces cerevisiae YPR141C KAR3
           Minus-end-directed microtubule motor that functions in
           mitosis and meiosis localizes to the spindle pole body
           and localization is dependent on functional Cik1p
           required for nuclear fusion during mating potential
           Cdc28p substrate
          Length = 706

 Score =  109 bits (272), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 66/149 (44%), Positives = 92/149 (61%), Gaps = 6/149 (4%)

Query: 257 LLQKGLKYRQVASTKMNDVSSRSHTIFTINL--YKEHKGEIFKISKMNLVDLAGSENISR 314
           LL++  K R  A+T  N+ SSRSH++F I L  Y  + GE  +   +NLVDLAGSE I+ 
Sbjct: 554 LLKRAAKLRSTAATGSNERSSRSHSVFIIKLRGYNSNTGEECQ-GTLNLVDLAGSERINA 612

Query: 315 SGAQNQRAKEAGSINQSLLTLGRVINSIADKNI---HIPFRESKLTRLLQDSLGGNTKTA 371
           S     R +E  +IN+SL  LG VI+++A  +    HIPFR SKLT LLQ SL G++KT 
Sbjct: 613 SQVTGDRLRETQNINKSLSCLGDVIHALASPDASKRHIPFRNSKLTYLLQYSLLGDSKTL 672

Query: 372 LIATISPAKLNAEETCSTLEYATKAKSIK 400
           +   ISP   +  ET ++L +A+K  S +
Sbjct: 673 MFVNISPCLDHFNETLNSLRFASKVNSTR 701

 Score = 70.9 bits (172), Expect = 9e-12,   Method: Compositional matrix adjust.
 Identities = 43/112 (38%), Positives = 55/112 (49%), Gaps = 14/112 (12%)

Query: 71  YTVDKVFGPSANQRLIFEEIAEPLFNDFLRGYNCTVLVYGMTSTGKTYTMTGDEKLYKGD 130
           +  DK+F P  +   IFEEI + L    L GYN  +  YG T +GKTYTM          
Sbjct: 413 FKFDKIFDPENSNDDIFEEIRQ-LVQSSLDGYNVCIFAYGQTGSGKTYTM---------- 461

Query: 131 LSDSAGIIPRVLFKLFETIEF---QSDNYVIKCSFIELYNEELKDLLIDSNN 179
           L    G+IP  L  +F+ I     +   Y I   FIE+YNE + DLL   NN
Sbjct: 462 LHPQNGMIPSTLDHIFQWIHLLKERGWEYEISSQFIEIYNETIIDLLRGLNN 513

>YKL079W Chr11 (286603..288573) [1971 bp, 656 aa] {ON}  SMY1Protein
           that interacts with Myo2p, proposed to be involved in
           exocytosis; N-terminal domain is related to the motor
           domain of kinesins
          Length = 656

 Score =  107 bits (266), Expect = 4e-23,   Method: Compositional matrix adjust.
 Identities = 99/351 (28%), Positives = 154/351 (43%), Gaps = 75/351 (21%)

Query: 70  TYTVDKVFGPSANQRLIFEEIAEPLFNDFLRGYNCTVLVYGMTSTGKTYTMTGDEKLYKG 129
           T+  DKVF  +A Q  + + +  P+ ND L GYN TV+ YG + +GK+Y++ G +     
Sbjct: 74  TFQFDKVFDANATQEDVQKFLVHPIINDVLNGYNGTVITYGPSFSGKSYSLIGSK----- 128

Query: 130 DLSDSAGIIPRVLFKLFETIE----FQSDNYVIKCSFIELYNEELKDLLIDSNNTKLKKL 185
              +S GI+P +   LF+T+E     + D++ +     E+Y E+  DLL+     K  KL
Sbjct: 129 ---ESEGILPNICKTLFDTLEKNEETKGDSFSVSVLAFEIYMEKTYDLLVPLPERKPLKL 185

Query: 186 RIFDXXXXXXXXXXXXXXXXXHFISGMDLRKXXXXXXXXXXXXTAIQNGNASIYIQNLEE 245
                                   S MDL                         I+++  
Sbjct: 186 H--------------------RSSSKMDLE------------------------IKDICP 201

Query: 246 FHI---KNAREGIQLLQKGLKYRQVASTKMNDVSSRSHTIFTINL-YKEHKGEIFKISKM 301
            H+   ++ R  IQ +Q  +  R     K     SRSH +F +++  +  K +I K S +
Sbjct: 202 AHVGSYEDLRSYIQAVQ-NVGNRMACGDKTE--RSRSHLVFQLHVEQRNRKDDILKNSSL 258

Query: 302 NLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSIA---------DKNIHI-PF 351
            LVDL G+E   +             +NQS+  L   + S++          K  H   +
Sbjct: 259 YLVDLHGAEKFDKRTESTLSQDALKKLNQSIEALKNTVRSLSMKERDSAYSAKGSHSSAY 318

Query: 352 RESKLTRLLQDSLGGNTKTALIATISPAKLNAEETCSTLEYATKAKSIKNK 402
           RES+LT +L+DSLGGN KT +I T   +  N   T STLE+    + I NK
Sbjct: 319 RESQLTEVLKDSLGGNRKTKVILTCFLS--NVPTTLSTLEFGDSIRQINNK 367

>YPR141C Chr16 complement(815734..817923) [2190 bp, 729 aa] {ON}
           KAR3Minus-end-directed microtubule motor that functions
           in mitosis and meiosis, localizes to the spindle pole
           body and localization is dependent on functional Cik1p,
           required for nuclear fusion during mating; potential
           Cdc28p substrate
          Length = 729

 Score =  106 bits (265), Expect = 8e-23,   Method: Compositional matrix adjust.
 Identities = 65/148 (43%), Positives = 90/148 (60%), Gaps = 4/148 (2%)

Query: 257 LLQKGLKYRQVASTKMNDVSSRSHTIFTINLYKEH-KGEIFKISKMNLVDLAGSENISRS 315
           +L+K  K R  AST  N+ SSRSH+IF I+L   + K        +NLVDLAGSE I+ S
Sbjct: 577 ILKKANKLRSTASTASNEHSSRSHSIFIIHLSGSNAKTGAHSYGTLNLVDLAGSERINVS 636

Query: 316 GAQNQRAKEAGSINQSLLTLGRVINSIADKNI---HIPFRESKLTRLLQDSLGGNTKTAL 372
                R +E  +IN+SL  LG VI+++   +    HIPFR SKLT LLQ SL G++KT +
Sbjct: 637 QVVGDRLRETQNINKSLSCLGDVIHALGQPDSTKRHIPFRNSKLTYLLQYSLTGDSKTLM 696

Query: 373 IATISPAKLNAEETCSTLEYATKAKSIK 400
              ISP+  +  ET ++L +A+K  S +
Sbjct: 697 FVNISPSSSHINETLNSLRFASKVNSTR 724

 Score = 71.2 bits (173), Expect = 7e-12,   Method: Compositional matrix adjust.
 Identities = 44/122 (36%), Positives = 63/122 (51%), Gaps = 16/122 (13%)

Query: 63  TAQLNSKTYTVDKVFGPSANQRLIFEEIAEPLFNDFLRGYNCTVLVYGMTSTGKTYTMTG 122
           TAQ++   +  DK+F        +F+E+ + L    L GYN  +  YG T +GKT+TM  
Sbjct: 430 TAQVHE--FKFDKIFDQQDTNVDVFKEVGQ-LVQSSLDGYNVCIFAYGQTGSGKTFTM-- 484

Query: 123 DEKLYKGDLSDSAGIIPRVLFKLFETI---EFQSDNYVIKCSFIELYNEELKDLLIDSNN 179
              L  GD     GIIP  +  +F  I   + +  +Y + C FIE+YNE + DLL   NN
Sbjct: 485 ---LNPGD-----GIIPSTISHIFNWINKLKTKGWDYKVNCEFIEIYNENIVDLLRSDNN 536

Query: 180 TK 181
            K
Sbjct: 537 NK 538

>TDEL0F03640 Chr6 complement(666365..668479) [2115 bp, 704 aa] {ON}
           Anc_3.479 YPR141C
          Length = 704

 Score =  106 bits (264), Expect = 9e-23,   Method: Compositional matrix adjust.
 Identities = 68/150 (45%), Positives = 92/150 (61%), Gaps = 6/150 (4%)

Query: 256 QLLQKGLKYRQVASTKMNDVSSRSHTIFTINLYKEH--KGEIFKISKMNLVDLAGSENIS 313
           +LL++  K R  AST  N+ SSRSH+IF ++L  E+   GE      +NLVDLAGSE I+
Sbjct: 548 ELLKRANKLRSTASTACNERSSRSHSIFIVHLSGENVLTGERSH-GILNLVDLAGSERIN 606

Query: 314 RSGAQNQRAKEAGSINQSLLTLGRVINSIADKNI---HIPFRESKLTRLLQDSLGGNTKT 370
            S    +R +E  SIN+SL  LG VI+++   +    HIPFR SKLT LLQ SL GN+KT
Sbjct: 607 TSQVIGERLRETQSINKSLSCLGDVIHALGSADASKRHIPFRNSKLTYLLQYSLTGNSKT 666

Query: 371 ALIATISPAKLNAEETCSTLEYATKAKSIK 400
            +   IS    +  ET ++L +A+K  S K
Sbjct: 667 LMFVNISGNPNHTNETLNSLRFASKVNSTK 696

 Score = 67.8 bits (164), Expect = 8e-11,   Method: Compositional matrix adjust.
 Identities = 35/107 (32%), Positives = 55/107 (51%), Gaps = 14/107 (13%)

Query: 71  YTVDKVFGPSANQRLIFEEIAEPLFNDFLRGYNCTVLVYGMTSTGKTYTMTGDEKLYKGD 130
           +  D++F        +F+EI + L    L GYN  +  YG T +GKTYTM          
Sbjct: 403 FKFDRIFNEKETNYDVFQEIGQ-LVQSSLDGYNVCIFAYGQTGSGKTYTM---------- 451

Query: 131 LSDSAGIIPRVLFKLF---ETIEFQSDNYVIKCSFIELYNEELKDLL 174
           L+ + GIIP  +  +F   + ++ +   Y + C F+E+YNE + DLL
Sbjct: 452 LNPTDGIIPATITHIFNWTKNLKERGWRYDVSCQFVEIYNETIADLL 498

>KLLA0B10956g Chr2 (958985..961057) [2073 bp, 690 aa] {ON} similar
           to uniprot|P17119 Saccharomyces cerevisiae YPR141C KAR3
           Minus-end-directed microtubule motor that functions in
           mitosis and meiosis localizes to the spindle pole body
           and localization is dependent on functional Cik1p
           required for nuclear fusion during mating potential
           Cdc28p substrate
          Length = 690

 Score =  106 bits (264), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 63/147 (42%), Positives = 93/147 (63%), Gaps = 4/147 (2%)

Query: 257 LLQKGLKYRQVASTKMNDVSSRSHTIFTINLYKEHK--GEIFKISKMNLVDLAGSENISR 314
           +L+   K + +A+T  N+ SSRSH++FTI ++  +   GE      +NLVDLAGSE I  
Sbjct: 541 VLRTANKTKSIAATNSNERSSRSHSVFTIRIHGTNSITGEASD-GVLNLVDLAGSERIDT 599

Query: 315 SGAQNQRAKEAGSINQSLLTLGRVINSIADKNI-HIPFRESKLTRLLQDSLGGNTKTALI 373
           S     R +E  +IN+SL  LG VI ++  K++ HIPFR SKLT LLQ SL G++KT + 
Sbjct: 600 SNVTGDRLRETQNINKSLSCLGDVIYALNGKDMKHIPFRNSKLTYLLQYSLIGDSKTLMF 659

Query: 374 ATISPAKLNAEETCSTLEYATKAKSIK 400
             +SP+  + +ET ++L +A+K  S K
Sbjct: 660 VNVSPSSNHVKETLNSLRFASKVNSTK 686

 Score = 75.5 bits (184), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 39/107 (36%), Positives = 58/107 (54%), Gaps = 14/107 (13%)

Query: 71  YTVDKVFGPSANQRLIFEEIAEPLFNDFLRGYNCTVLVYGMTSTGKTYTMTGDEKLYKGD 130
           +  DKVF  +A+ R +FEE+ + L    L GYN  +  YG T +GKTYTM          
Sbjct: 404 FLFDKVFSSNASNRDVFEEVGQ-LIQSSLDGYNVCIFAYGQTGSGKTYTM---------- 452

Query: 131 LSDSAGIIPRVLFKLFETIEF---QSDNYVIKCSFIELYNEELKDLL 174
           ++D  G+IP  L  +F+       +  +Y  +  FIE+YNE++ DLL
Sbjct: 453 MNDPDGVIPMTLDHIFDWTHLLKERGWDYSFEAQFIEIYNEQIVDLL 499

>Skud_16.435 Chr16 complement(769308..771497) [2190 bp, 729 aa] {ON}
           YPR141C (REAL)
          Length = 729

 Score =  105 bits (262), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 65/148 (43%), Positives = 90/148 (60%), Gaps = 4/148 (2%)

Query: 257 LLQKGLKYRQVASTKMNDVSSRSHTIFTINLYKEH-KGEIFKISKMNLVDLAGSENISRS 315
           +L+K  K R  AST  N+ SSRSH+IF I+L   + K        +NLVDLAGSE I+ S
Sbjct: 577 ILKKANKLRSTASTASNEHSSRSHSIFMIHLSGSNAKTGAQSYGTLNLVDLAGSERINIS 636

Query: 316 GAQNQRAKEAGSINQSLLTLGRVINSIADKNI---HIPFRESKLTRLLQDSLGGNTKTAL 372
                R +E  +IN+SL  LG VI+++   +    HIPFR SKLT LLQ SL G++KT +
Sbjct: 637 QVVGDRLRETQNINKSLSCLGDVIHALGQPDSTKRHIPFRNSKLTYLLQYSLTGDSKTLM 696

Query: 373 IATISPAKLNAEETCSTLEYATKAKSIK 400
              ISP+  +  ET ++L +A+K  S +
Sbjct: 697 FVNISPSSSHINETLNSLRFASKVNSTR 724

 Score = 67.4 bits (163), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 38/109 (34%), Positives = 55/109 (50%), Gaps = 18/109 (16%)

Query: 71  YTVDKVFGPSANQRLIFEEIAEPLFNDFLRGYNCTVLVYGMTSTGKTYTM--TGDEKLYK 128
           +  DK+F        +F+E+ + L    L GYN  +  YG T +GKT+TM  TGD     
Sbjct: 436 FKFDKIFDQQNTNEDVFKEVGQ-LVQSSLDGYNVCIFAYGQTGSGKTFTMLNTGD----- 489

Query: 129 GDLSDSAGIIPRVLFKLFETI---EFQSDNYVIKCSFIELYNEELKDLL 174
                  GIIP  +  +F  I   + +  +Y + C FIE+YNE + DLL
Sbjct: 490 -------GIIPSTISHIFSWINKLKTKGWDYKVNCEFIEIYNENIVDLL 531

>Smik_16.388 Chr16 complement(687227..689416) [2190 bp, 729 aa] {ON}
           YPR141C (REAL)
          Length = 729

 Score =  105 bits (261), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 65/148 (43%), Positives = 90/148 (60%), Gaps = 4/148 (2%)

Query: 257 LLQKGLKYRQVASTKMNDVSSRSHTIFTINLYKEH-KGEIFKISKMNLVDLAGSENISRS 315
           +L+K  K R  AST  N+ SSRSH+IF I+L   + K        +NLVDLAGSE I+ S
Sbjct: 577 ILKKANKLRSTASTASNEHSSRSHSIFIIHLSGSNTKTGAQSYGTLNLVDLAGSERINIS 636

Query: 316 GAQNQRAKEAGSINQSLLTLGRVINSIADKNI---HIPFRESKLTRLLQDSLGGNTKTAL 372
                R +E  +IN+SL  LG VI+++   +    HIPFR SKLT LLQ SL G++KT +
Sbjct: 637 QVVGDRLRETQNINKSLSCLGDVIHALGQPDSTKRHIPFRNSKLTYLLQYSLTGDSKTLM 696

Query: 373 IATISPAKLNAEETCSTLEYATKAKSIK 400
              ISP+  +  ET ++L +A+K  S +
Sbjct: 697 FVNISPSSSHINETLNSLRFASKVNSTR 724

 Score = 68.6 bits (166), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 42/119 (35%), Positives = 61/119 (51%), Gaps = 16/119 (13%)

Query: 63  TAQLNSKTYTVDKVFGPSANQRLIFEEIAEPLFNDFLRGYNCTVLVYGMTSTGKTYTMTG 122
           TAQ++   +  DK+F        +F+E+ + L    L GYN  +  YG T +GKT+TM  
Sbjct: 430 TAQVHE--FKFDKIFDQKDTNADVFKEVGQ-LVQSSLDGYNVCIFAYGQTGSGKTFTM-- 484

Query: 123 DEKLYKGDLSDSAGIIPRVLFKLFETI---EFQSDNYVIKCSFIELYNEELKDLLIDSN 178
              L  GD     GIIP  +  +F  I   + +  +Y + C FIE+YNE + DLL   N
Sbjct: 485 ---LNPGD-----GIIPSTISHIFNWINKLKTKGWDYEVNCEFIEIYNENIVDLLRSDN 535

>NCAS0C01350 Chr3 complement(246839..248806) [1968 bp, 655 aa] {ON}
           Anc_8.678
          Length = 655

 Score =  104 bits (259), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 74/204 (36%), Positives = 111/204 (54%), Gaps = 24/204 (11%)

Query: 237 SIYIQNLEEFHIKNAREGIQLLQKGLKYRQVASTKMNDVSSRSHTIFTINLYKEHKGEIF 296
            + +  L E   +++ E ++ +++G  +R+ A T  N  SSRSH I  I L   +  +  
Sbjct: 278 GVRVMGLREQRCESSEELMKWIRRGDSHRKTAETDYNARSSRSHAIVLIRLTNTNVIDGT 337

Query: 297 KISK-MNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSI------------- 342
            IS  ++L DLAGSE   R+  Q +R KE   IN+SLL LG VI+ +             
Sbjct: 338 SISSTLSLCDLAGSE---RATGQQERRKEGAFINKSLLALGTVISKLSAESTAASHGNSP 394

Query: 343 -ADKNIHIPFRESKLTRLLQDSLGGNTKTALIATISPAKLNAEETCSTLEYATKAKSIK- 400
            A+ N HIP+R+SKLTR+LQ +L G++    I TI   K +A ET +TL +A++AK++  
Sbjct: 395 NANGNGHIPYRDSKLTRILQPALSGDSIVTTICTIDTQKESAAETLNTLRFASRAKNVSL 454

Query: 401 ---NKPQLGSIIM--KDVRLKDLN 419
               KP + S     KD R+  LN
Sbjct: 455 HVNRKPLMNSTDGNDKDQRIAKLN 478

 Score = 61.2 bits (147), Expect = 9e-09,   Method: Compositional matrix adjust.
 Identities = 39/108 (36%), Positives = 57/108 (52%), Gaps = 8/108 (7%)

Query: 71  YTVDKVFGPSANQRLIFEEIAEPLFNDFLRGYNCTVLVYGMTSTGKTYTMTGDEKLYKGD 130
           +  D V+ P  +   I+E I +P+ +   +G+N TV  YGMT +GKTYTM G       D
Sbjct: 135 FKFDHVYSPHVSNLEIYESINKPMIDKLFQGFNATVFAYGMTGSGKTYTMMGSGG----D 190

Query: 131 LSDSAGIIP---RVLF-KLFETIEFQSDNYVIKCSFIELYNEELKDLL 174
             D  G+IP     LF K+ E        + +  S++E+YNE + DLL
Sbjct: 191 GGDDDGLIPLSVSYLFSKVIEVGLVGERKFDVLLSYLEIYNERIYDLL 238

>Suva_16.469 Chr16 complement(811946..814141) [2196 bp, 731 aa] {ON}
           YPR141C (REAL)
          Length = 731

 Score =  103 bits (258), Expect = 5e-22,   Method: Compositional matrix adjust.
 Identities = 64/149 (42%), Positives = 90/149 (60%), Gaps = 4/149 (2%)

Query: 256 QLLQKGLKYRQVASTKMNDVSSRSHTIFTINLYK-EHKGEIFKISKMNLVDLAGSENISR 314
           ++L++  K R  AST  N+ SSRSH+IF I+L     K        +NLVDLAGSE I+ 
Sbjct: 575 RVLKRANKLRSTASTASNEHSSRSHSIFIIHLSGLNAKTGAQSYGTLNLVDLAGSERINI 634

Query: 315 SGAQNQRAKEAGSINQSLLTLGRVINSIADKNI---HIPFRESKLTRLLQDSLGGNTKTA 371
           S     R +E  +IN+SL  LG VI+++   +    HIPFR SKLT LLQ SL G++KT 
Sbjct: 635 SQVVGDRLRETQNINKSLSCLGDVIHALGQPDSAKRHIPFRNSKLTYLLQYSLTGDSKTL 694

Query: 372 LIATISPAKLNAEETCSTLEYATKAKSIK 400
           +   ISP+  +  ET ++L +A+K  S +
Sbjct: 695 MFVNISPSSSHINETLNSLRFASKVNSTR 723

 Score = 70.1 bits (170), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 40/112 (35%), Positives = 58/112 (51%), Gaps = 14/112 (12%)

Query: 71  YTVDKVFGPSANQRLIFEEIAEPLFNDFLRGYNCTVLVYGMTSTGKTYTMTGDEKLYKGD 130
           +  DK+F        +F+E+ + L    L GYN  +  YG T +GKT+TM     L  GD
Sbjct: 436 FKFDKIFDQRNTNEDVFKEVGQ-LVQSSLDGYNVCIFAYGQTGSGKTFTM-----LNPGD 489

Query: 131 LSDSAGIIPRVLFKLFETI---EFQSDNYVIKCSFIELYNEELKDLLIDSNN 179
                GIIP  +  +F  I   + +  +Y + C FIE+YNE + DLL + NN
Sbjct: 490 -----GIIPSTISHIFNWINKLKTKGWDYEVNCEFIEIYNENIVDLLRNENN 536

>ZYRO0B04290g Chr2 (353283..355478) [2196 bp, 731 aa] {ON} similar
           to uniprot|P17119 Saccharomyces cerevisiae YPR141C KAR3
           Minus-end-directed microtubule motor that functions in
           mitosis and meiosis localizes to the spindle pole body
           and localization is dependent on functional Cik1p
           required for nuclear fusion during mating potential
           Cdc28p substrate
          Length = 731

 Score =  103 bits (257), Expect = 7e-22,   Method: Compositional matrix adjust.
 Identities = 65/153 (42%), Positives = 90/153 (58%), Gaps = 14/153 (9%)

Query: 257 LLQKGLKYRQVASTKMNDVSSRSHTIFTI------NLYKEHKGEIFKISKMNLVDLAGSE 310
           LL+K  + R  AST  N+ SSRSH++F I      +L  E    I     +NLVDLAGSE
Sbjct: 566 LLRKANRLRSTASTSANERSSRSHSVFIIFLKGSNHLTGEQSDGI-----LNLVDLAGSE 620

Query: 311 NISRSGAQNQRAKEAGSINQSLLTLGRVINSIADKNI---HIPFRESKLTRLLQDSLGGN 367
            I+ S    +R +E  +IN+SL  LG V++++   +    HIPFR SKLT LLQ SL GN
Sbjct: 621 RINSSQVLGERLRETQNINKSLSCLGDVVHALGSNDAAKRHIPFRNSKLTYLLQYSLTGN 680

Query: 368 TKTALIATISPAKLNAEETCSTLEYATKAKSIK 400
           +KT +   IS  + +  ET ++L +A+K  S K
Sbjct: 681 SKTLMFVNISACESHLNETLNSLRFASKVNSTK 713

 Score = 75.1 bits (183), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 41/109 (37%), Positives = 56/109 (51%), Gaps = 14/109 (12%)

Query: 69  KTYTVDKVFGPSANQRLIFEEIAEPLFNDFLRGYNCTVLVYGMTSTGKTYTMTGDEKLYK 128
           + +  D++F  +     +FEEI + L    L GYN  +  YG T +GKTYTM        
Sbjct: 426 QNFKFDRIFDQNETNENVFEEIGQ-LVQSSLDGYNVCIFAYGQTGSGKTYTM-------- 476

Query: 129 GDLSDSAGIIPRVLFKLFETIE---FQSDNYVIKCSFIELYNEELKDLL 174
             L+   GIIP  +  +F  IE    +  NY I C FIE+YNE + DLL
Sbjct: 477 --LNPRNGIIPATISHIFSWIENLKERGWNYEINCQFIEIYNENIADLL 523

>Suva_11.145 Chr11 (272862..274835) [1974 bp, 657 aa] {ON} YKL079W
           (REAL)
          Length = 657

 Score =  102 bits (253), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 99/373 (26%), Positives = 162/373 (43%), Gaps = 76/373 (20%)

Query: 48  NEISINTSDDIVSGLTAQLNSKTYTVDKVFGPSANQRLIFEEIAEPLFNDFLRGYNCTVL 107
           N +   TS+  +   T   +S T+  DKVF  +A Q+ + + + +P  ND L GYN T+L
Sbjct: 54  NTVLFRTSNGPLQNTTGDTHS-TFQFDKVFDANATQKDVQDFLLDPTINDVLSGYNSTIL 112

Query: 108 VYGMTSTGKTYTMTGDEKLYKGDLSDSAGIIPRVLFKLFETIEFQ----SDNYVIKCSFI 163
            YG + +GK+Y++ G +        D  GI+P +   LF T+E +     +N+ +     
Sbjct: 113 TYGPSFSGKSYSLIGPQ--------DGGGILPNICKALFSTLEDREKNKGNNFSVSVLAF 164

Query: 164 ELYNEELKDLLIDSNNTKLKKLRIFDXXXXXXXXXXXXXXXXXHFISGMDLRKXXXXXXX 223
           E+Y E+  DLL+     K  KL                        S MDL         
Sbjct: 165 EIYMEKTYDLLVPLPERKPLKLH--------------------RSSSTMDLE-------- 196

Query: 224 XXXXXTAIQNGNASIYIQNLEEFHI---KNAREGIQLLQKGLKYRQVASTKMNDVSSRSH 280
                           I+++   H+   ++ +  IQ +Q     R   S K     SRSH
Sbjct: 197 ----------------IKDIRPAHVNSFEDLKSYIQSVQNPAN-RMGYSGKAE--RSRSH 237

Query: 281 TIFTINL-YKEHKGEIFKISKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVI 339
            +F +++  +  + +I K S + L+DL G+E   +             +NQS+  L   +
Sbjct: 238 VVFQLHVEQRNRRHDILKNSSLYLIDLHGAEKFDKRIENTLSQDSLKKLNQSIEALKNTV 297

Query: 340 NSIADKNI----------HIPFRESKLTRLLQDSLGGNTKTALIATISPAKLNAEETCST 389
            S+  K++             +RES+LT +L+DSLGGN KT +I T   +  N   T ST
Sbjct: 298 QSLEIKSMDSVYSAKASHSSTYRESQLTEVLKDSLGGNRKTKVILTCFLS--NVPTTLST 355

Query: 390 LEYATKAKSIKNK 402
           L++    + I N+
Sbjct: 356 LKFGDSIRQINNR 368

>Skud_11.148 Chr11 (271990..273960) [1971 bp, 656 aa] {ON} YKL079W
           (REAL)
          Length = 656

 Score = 99.0 bits (245), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 111/430 (25%), Positives = 186/430 (43%), Gaps = 91/430 (21%)

Query: 70  TYTVDKVFGPSANQRLIFEEIAEPLFNDFLRGYNCTVLVYGMTSTGKTYTMTGDEKLYKG 129
           T+  DKVF  +A Q+ + + +  P   D L GYN T+L YG + +GK+Y++ G +     
Sbjct: 74  TFQFDKVFDANATQKDVQDFLVNPTIKDILSGYNSTILTYGPSFSGKSYSLLGSQY---- 129

Query: 130 DLSDSAGIIPRVLFKLFETIE----FQSDNYVIKCSFIELYNEELKDLLIDSNNTKLKKL 185
               + G++P +   LFET+E     +  N+ +     E+Y E+  DLL+     K  KL
Sbjct: 130 ----NEGVLPNICQVLFETLEENEETKGTNFCVSVLAFEIYMEKSYDLLVPLPERKPLKL 185

Query: 186 RIFDXXXXXXXXXXXXXXXXXHFISGMDLRKXXXXXXXXXXXXTAIQNGNASIYIQNLEE 245
                                H  S  DLR                       Y+Q+++ 
Sbjct: 186 H----RSSSKMDLEIKDICPAHIKSYEDLRG----------------------YVQSVQN 219

Query: 246 FHIKNAREGIQLLQKGLKYRQVASTKMNDVSSRSHTIFTINLYKEHKGE-IFKISKMNLV 304
              +  R G                      S+SH +F +++ + ++ E I K S + L+
Sbjct: 220 TENRVGRGG------------------KAERSKSHLVFQLHVEQRNRREDILKNSSLYLI 261

Query: 305 DLAGSENISRSGAQNQRAKEA-GSINQSLLTLGRVINSIADKNIHIPF----------RE 353
           DL G+E   +   +N  +++A   +NQS+  L  ++  +A KN    +          RE
Sbjct: 262 DLHGAEKFEKR-TENTLSQDALKKLNQSIEALKNIVQLLAVKNPDSAYSTKASHSSTYRE 320

Query: 354 SKLTRLLQDSLGGNTKTALIATISPAKLNAEETCSTLEYATKAKSIKNKPQLGSIIMKDV 413
           S+LT +L+DSLGGN K  +I T   +  N   T STLE+    + I NK      +M   
Sbjct: 321 SQLTEVLRDSLGGNRKMKVILTCFLS--NVPTTISTLEFGDNIRQIINK------VMSST 372

Query: 414 RLKDLNNELAKIKRDLTSTKQKDGVYMTQ--------NHYKDLTND---LESYKTEIQEC 462
              ++  ++    +D+   K KD  Y++Q        +  KDL+N+    E  KTE++  
Sbjct: 373 TGLNMKKKMDLFVQDM---KIKDDNYVSQINILKSELDSLKDLSNESSSREDMKTELENY 429

Query: 463 DRIVKSLELQ 472
           ++    L+LQ
Sbjct: 430 EKENVKLKLQ 439

>Smik_11.160 Chr11 (272801..274771) [1971 bp, 656 aa] {ON} YKL079W
           (REAL)
          Length = 656

 Score = 99.0 bits (245), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 100/405 (24%), Positives = 177/405 (43%), Gaps = 83/405 (20%)

Query: 70  TYTVDKVFGPSANQRLIFEEIAEPLFNDFLRGYNCTVLVYGMTSTGKTYTMTGDEKLYKG 129
           T+  DKVF  +A Q  + + +  P  +D L GYN T++ YG + +GK+Y++ G +     
Sbjct: 74  TFKFDKVFDTNATQEDVQDFLVRPSIDDVLSGYNGTIITYGPSFSGKSYSLLGSQ----- 128

Query: 130 DLSDSAGIIPRVLFKLFETIE----FQSDNYVIKCSFIELYNEELKDLLIDSNNTKLKKL 185
              +  GI+P +   LFET+E     + +N+ +     E++ E+  DLL+   N K  KL
Sbjct: 129 ---EGEGILPNICKVLFETLEKNKETKGNNFSVSVLAFEIFMEKTYDLLVPLTNRKPLKL 185

Query: 186 RIFDXXXXXXXXXXXXXXXXXHFISGMDLRKXXXXXXXXXXXXTAIQNGNASIYIQNLEE 245
                                   S MDL                         I+++  
Sbjct: 186 H--------------------RSSSKMDLE------------------------IKDICP 201

Query: 246 FHIKNAREGIQLLQKGLKYRQVASTKMNDVSSRSHTIFTINLYKEHK-GEIFKISKMNLV 304
            HI++ ++    +Q             N   S+SH +F +++ + ++  +I + S + L+
Sbjct: 202 AHIRSYKDLKSYIQSVQNTDNRMGYSGNTERSKSHLVFQLHVEQRNRNADILRKSSLYLI 261

Query: 305 DLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVIN--SIADKNIHIP--------FRES 354
           DL G+E   +             +NQS+  L  ++   S+ D++            +RES
Sbjct: 262 DLHGAERFDKRTEVTLSQDALKKLNQSIEALKNIVRLLSVKDRDSAYSVKASHSSTYRES 321

Query: 355 KLTRLLQDSLGGNTKTALIATISPAKLNAEETCSTLEYATKAKSIKNK----------PQ 404
           +LT +L+DSLGGN KT +I T   +  N   T STLE+    + I NK           +
Sbjct: 322 QLTEVLKDSLGGNRKTKVILTCFLS--NVSTTLSTLEFGECIRQITNKVIDNTTGLNLKK 379

Query: 405 LGSIIMKDVRLKDLNNELAKI---KRDLTSTKQKDGVYMTQNHYK 446
              + ++D++++D NN  ++I   K ++ S K   G  ++Q   K
Sbjct: 380 KMDLFIEDMKIRD-NNYASRINILKAEIDSLKTPSGELVSQGDMK 423

>TPHA0N01650 Chr14 complement(356519..358567) [2049 bp, 682 aa] {ON}
           Anc_2.633 YKL079W
          Length = 682

 Score = 97.8 bits (242), Expect = 4e-20,   Method: Compositional matrix adjust.
 Identities = 96/374 (25%), Positives = 168/374 (44%), Gaps = 82/374 (21%)

Query: 76  VFGPSANQRLIFEEIAEPLFNDFLRGYNCTVLVYGMTSTGKTYTMTGDEKLYKGDLSDSA 135
           +F   +N  LI   I   + ++ + GYN  ++ YG   +GKTY+      LY  D+ DS 
Sbjct: 89  IFDRDSNIDLIGNTIVTGMIDEAMEGYNTALVTYGPKYSGKTYS------LYGNDVDDSF 142

Query: 136 GIIPRVLFK-LFETIEFQSDN------YVIKCSFIELYNEELKDLLIDSNNTKLKKLRIF 188
           G+  +++FK LF  I     +      +++K SF+E++ +++ DLL   N TKL  L+I 
Sbjct: 143 GL-GQIIFKDLFSRINKSVTDSNAKYTFIVKISFLEVWLDKVVDLLAPQNLTKLPHLKI- 200

Query: 189 DXXXXXXXXXXXXXXXXXHFISGMDLRKXXXXXXXXXXXXTAIQNGNASIYIQNLEEFHI 248
                             H                         + +  + + NL + H+
Sbjct: 201 -----------------RHV------------------------SEHKGLPVDNLRQVHV 219

Query: 249 KNAREGIQLLQKGLKYRQVASTKMNDVSSRSHTIFTINLYKEHK-GEIFKISKMNLVDLA 307
            + +E +    + +    V ++K ++   R++TIF IN+ K  K  E    S + LVDLA
Sbjct: 220 ASFKETLYYFNQAM---SVLNSKHDNSFPRTNTIFNINIEKLDKLDESTTSSSIYLVDLA 276

Query: 308 GSENISRSGAQNQRAKEAGSINQSLLTLGRVINSIAD------KNIH------IPFRESK 355
           GS+ I R  +    +++   IN S+ ++  +I S++       KN        +P+  SK
Sbjct: 277 GSDLIDRKNSSGVNSEDVKRINSSIKSVQNIITSLSKLSYSDYKNYEFSLENSVPYDSSK 336

Query: 356 LTRLLQDSLGGNTKTALIATISPAKLNAEETCSTLEYATKAKSIKNKPQLG--------- 406
           L +LL++ LGGN KT  + TIS      ++    L+  T  +  K  PQ+          
Sbjct: 337 LGKLLKEPLGGNCKTNFLFTISMNPEQYDDIIEALQLGTILQDSKTVPQINKFGLNENKT 396

Query: 407 -SIIMKDVRLKDLN 419
            SI +++ +LK+ N
Sbjct: 397 LSIALENFKLKENN 410

>TBLA0C01880 Chr3 (441985..443391) [1407 bp, 468 aa] {ON} Anc_8.678
           YPL155C
          Length = 468

 Score = 91.7 bits (226), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 54/148 (36%), Positives = 89/148 (60%), Gaps = 8/148 (5%)

Query: 255 IQLLQKGLKYRQVASTKMNDVSSRSHTIFTINLYKEHKGEIFKISKMNLVDLAGSENISR 314
           ++L+ +G + R+V ST+ N  SSRSH +  + +  +  G   ++  + L DLAGSE  S 
Sbjct: 241 LELVAQGNRNRRVRSTQHNTGSSRSHAVLRLRI-TDSMGSKARV--LTLCDLAGSERASV 297

Query: 315 SGAQNQRAKEAGSINQSLLTLG---RVINSIADKNIHIPFRESKLTRLLQDSLGGNTKTA 371
              +  RA E G+IN+SL+ LG   R++N     + H+P+R+SKLTRLL+ SL GN    
Sbjct: 298 HD-RGLRA-EGGAINKSLMALGTVVRLLNETGPSSTHVPYRDSKLTRLLKPSLSGNGLVT 355

Query: 372 LIATISPAKLNAEETCSTLEYATKAKSI 399
           ++ T+S +  + E++  TL +A +A  +
Sbjct: 356 MVCTVSLSGTDYEQSLGTLRFARRASGV 383

 Score = 53.9 bits (128), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 38/108 (35%), Positives = 52/108 (48%), Gaps = 22/108 (20%)

Query: 86  IFEEIAEPLFN----DFLRGYNCTVLVYGMTSTGKTYTMTGDEKLYKGDLSDSAGIIPRV 141
           IF    +PL +    D + G   T++ YG T +GKTYTM G +           GI+   
Sbjct: 122 IFVRDCKPLVHRVATDCISG---TIIAYGATGSGKTYTMHGTKA--------EGGIVQLS 170

Query: 142 LFKLFETIEFQSDNYVIKCSFIELYNEELKDLLIDSNNTKLKKLRIFD 189
           +  L   +   S N  I  S++E+YNE L DLL D      K+LRI D
Sbjct: 171 IRDLLTQL---SKNCQITISYLEIYNERLHDLLCDGT----KELRILD 211

>NCAS0H03180 Chr8 (611693..613675) [1983 bp, 660 aa] {ON} Anc_2.633
          Length = 660

 Score = 82.0 bits (201), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 89/370 (24%), Positives = 161/370 (43%), Gaps = 83/370 (22%)

Query: 71  YTVDKVFGPSANQRLIFEEIAEPLFNDFLRGYNCTVLVYGMTSTGKTYTMTGDEKLYKGD 130
           Y  D +F   + +   ++ I + L +D  +GYN T++ YG TS+GK++ + GD       
Sbjct: 86  YQFDSIFDVDSKETEFYDSITDNLIDDISKGYNTTIMTYGPTSSGKSHALFGDPDSTNDG 145

Query: 131 LSDSAGIIPRVLFKLFETIEFQSDNYVIKCS--FIELYNEELKDLLIDSNNTKLKKLRIF 188
           L +   I  R+LF   E      DN    CS    ELY +++ DLL+  NN K  K+ + 
Sbjct: 146 LINH--IADRLLFPQCE------DNLKTLCSISMWELYIDKVYDLLL--NNGKPLKVHV- 194

Query: 189 DXXXXXXXXXXXXXXXXXHFISGMDLRKXXXXXXXXXXXXTAIQNGNASIYIQNLEEFHI 248
                                                       +G+   +I++L + H+
Sbjct: 195 --------------------------------------------HGD---HIRDLHQIHV 207

Query: 249 KNAREGIQLLQKGLKYRQVASTKMNDVSSRSHTIFTINLYKEHKGEIFKISKMNLVDLAG 308
            +  E    L+ G  Y+ ++   ++   S+    F +    + K ++ + S +  +DL G
Sbjct: 208 TSPIEIKDTLKNG--YKNISP--LHHSKSQIFVRFEVQCI-DRKDDVTRCSSITFIDLCG 262

Query: 309 SENISRSGAQNQRAKEAGSINQSLLTLGRVINSIADK----NIHIPFRESKLTRLLQDSL 364
           S+ +++  A    + +    NQ +  L  +I ++ ++    + H  F++S L ++L D L
Sbjct: 263 SDLLTKQNASKLSSDDIKKFNQMIYLLQNLIKTLPEEQSTNSSH--FKDSSLNKILMDYL 320

Query: 365 GGNTKTALIATISPAKLNAEETCSTLEYATKAKSIKNKPQLGSIIMK-----DVRLKDLN 419
           GG+TK  L+  I       E+    ++   KAK IKN P +  I +      D+ ++D+N
Sbjct: 321 GGDTKMTLVVAIDGNTGGYED---AVKLGAKAKLIKNYPTMNKIGLNAKRKMDLLVQDMN 377

Query: 420 ----NELAKI 425
               N LAKI
Sbjct: 378 VKEQNYLAKI 387

>ZYRO0E01078g Chr5 (73042..75048) [2007 bp, 668 aa] {ON} similar to
           uniprot|Q759X8 Ashbya gossypii ADR145C ADR145Cp and
           weakly similar to YKL079W uniprot|P32364 Saccharomyces
           cerevisiae YKL079W SMY1 not believed to act as a kinesin
           colocalizes with Myo2p kinesin heavy chain homolog
          Length = 668

 Score = 80.5 bits (197), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 119/489 (24%), Positives = 201/489 (41%), Gaps = 98/489 (20%)

Query: 71  YTVDKVFGPSANQRLIFEEIAEPLFNDFLRGYNCTVLVYGMTSTGKTYTMTGDEKLYKGD 130
           +  +KV+     Q+ + E+I      + L G+N +++ +G   +GKTYTM G++      
Sbjct: 68  FRFNKVYDVGVRQQEVCEDIIGDNVMELLAGFNVSIMAFGSEGSGKTYTMFGNDH----- 122

Query: 131 LSDSAGIIPRVLFKLFETI----EFQSDNYVIKCSFIELYNEELKDLLIDSNNTKLKKLR 186
                GI+ R+   +F+ +    E   +   I  +F EL+ E + DLL    N+K+ K  
Sbjct: 123 ---EEGIVQRMCQSIFDQLDKLHEDSGNESTISINFFELFAENVYDLLSLQKNSKVLK-- 177

Query: 187 IFDXXXXXXXXXXXXXXXXXHFISGMDLRKXXXXXXXXXXXXTAIQNGNASIY--IQNLE 244
                               H +S   LR                     S+Y  +  + 
Sbjct: 178 -------------TSSDTKTHTLSVKGLRTVSVN----------------SVYELLAYIN 208

Query: 245 EFHIKNAREGIQLLQKGLKYRQVASTKMNDVSSRSHTIFTINLYKEHKGE-IFKISKMNL 303
           E H++              YR+          SRS     I + + +K E   K S + L
Sbjct: 209 EGHLRRCHSDSH-------YRK----------SRSSAFLNITVEQRNKKEETLKHSVLQL 251

Query: 304 VDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSIAD-----------KNIHIPFR 352
           +DLA S+ + ++   +    E  S N S+  L +V+  +++           K+ H   R
Sbjct: 252 IDLASSDKLDKNLKYDISTDEMKSTNSSMQNLHQVVYGLSELESPSSKNHSSKHTH---R 308

Query: 353 ESKLTRLLQDSLGGNTKTALIATISPAKLNAEETCSTLEYATKAKSIKNKP-----QLGS 407
            S+L + LQ ++GG++KT  +   S  K + E T  TL   ++ +SI N P      L S
Sbjct: 309 TSRLAKFLQQAIGGDSKTTAVMLSSTDKADRENTVITLSLGSRLRSIHNFPVQNKMGLNS 368

Query: 408 IIMKDVRLKDLNNE----LAKIKRDLTSTKQKDGVYMTQNHYKDLTNDLESYKTEIQECD 463
             + D+RLK+++      L +IK  L     K G  + QN      N + + K+  ++  
Sbjct: 369 KALLDLRLKNMSTREDSYLTRIKY-LEDEVSKLGGTIQQNK-----NQVSTNKSLTEKNM 422

Query: 464 RIVKSLELQNALLLKDKKASNEVNKLQELN---LNEMTNTLSNIQTTLEIQHKKEQILVE 520
           +++  LEL        K  S E N   + N    NEM+  L N+    E   + +  L E
Sbjct: 423 KLMDQLELYRKSQQTQKSGSEEENLTSQQNGRIQNEMSEVLDNLMEKCERVIQLQMRLDE 482

Query: 521 ELAHSREKS 529
           EL   R+KS
Sbjct: 483 EL---RQKS 488

>TBLA0C00800 Chr3 complement(165244..167325) [2082 bp, 693 aa] {ON}
           Anc_2.633 YKL079W
          Length = 693

 Score = 77.8 bits (190), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 99/390 (25%), Positives = 154/390 (39%), Gaps = 105/390 (26%)

Query: 68  SKTYTVDKVFGPSANQRLIFEEIAEPLFNDFLRGYNCTVLVYGMTSTGKTYTMTGDEKLY 127
           S  Y  DK+F P      I   ++    ND  +GYN T + YG T TGKTYT      LY
Sbjct: 55  SNQYRFDKIFEPEKPDDEINSTLSFACINDLFKGYNSTYISYGQTGTGKTYT------LY 108

Query: 128 KGDLSDSA---------------------------------------------GIIPRVL 142
               +D+                                              G+I +V 
Sbjct: 109 GTAFNDTPTDLDSKNINTNKNVKNDSNISSNSNIQTSASSNKSANSILQKKNYGLISKVG 168

Query: 143 FKLFETIE-----FQSDNYVIKCSFIELYNEELKDLLIDSNNTKLKKLRIFDXXXXXXXX 197
             LFE I+      +   +++  SF+E+Y EE+ DLL   +    KKL +          
Sbjct: 169 NDLFEMIDQIRAIRKGITFLVNISFVEVYKEEVYDLLQHDDTLSNKKLSLHHDMDK---- 224

Query: 198 XXXXXXXXXHFISGMDLRKXXXXXXXXXXXXTAIQNGNASIYIQNLEEFHIKNAREGIQL 257
                        G+D+                         I+N++   I +  E   L
Sbjct: 225 -----------YQGLDI-------------------------IKNVKSVTILDRNELNDL 248

Query: 258 LQKGLKYRQVASTKMNDVSSRSHTIFTINLYKEHKGEIFKI-SKMNLVDLAGSENISRSG 316
           +      R + S   N +  RS TI  I L +  + E  +  S +  VDLAGS+  S+  
Sbjct: 249 IDSS--RRLLHSCHNNGI--RSSTILRIKLLQLDEDEDLETQSTICFVDLAGSDRASKDI 304

Query: 317 AQNQRAKEAGSINQSLLTLGRVINSIAD-KNIHIP---FRESKLTRLLQDSLGGNTKTAL 372
            +    + A   N+ + +L  ++ ++A+ ++I I    +R S LTR+L D L GN KT L
Sbjct: 305 EKGITREAASKYNRVMDSLNSMVYTLANSESISINKSIYRNSHLTRILYDLLAGNHKTNL 364

Query: 373 IATISPAKLNAEETCSTLEYATKAKSIKNK 402
           I + S  K +  ET STL +++ A S+ N+
Sbjct: 365 IFSCSLNKDDEYETFSTLGFSSYASSMSNQ 394

>Kwal_55.21164 s55 complement(713274..715037) [1764 bp, 588 aa]
           {OFF} YPR141C (KAR3) - kinesin-like nuclear fusion
           protein [contig 452] PARTIAL
          Length = 588

 Score = 73.6 bits (179), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 42/109 (38%), Positives = 56/109 (51%), Gaps = 14/109 (12%)

Query: 71  YTVDKVFGPSANQRLIFEEIAEPLFNDFLRGYNCTVLVYGMTSTGKTYTMTGDEKLYKGD 130
           +T D+ FG   + + IF EI + L    L GYN  +  YG T +GKTYTM          
Sbjct: 408 FTFDRCFGAQESNKDIFHEIGQ-LIQSSLDGYNVCIFAYGQTGSGKTYTM---------- 456

Query: 131 LSDSAGIIPRVLFKLFETIEFQSD---NYVIKCSFIELYNEELKDLLID 176
           L+   GIIP  L  +F  +E   +   +Y I   FIE+YNE +KDL  D
Sbjct: 457 LNPEDGIIPSTLNHIFLWVEKLKELGWSYDISSQFIEIYNENIKDLFKD 505

 Score = 33.1 bits (74), Expect = 4.1,   Method: Compositional matrix adjust.
 Identities = 14/31 (45%), Positives = 20/31 (64%)

Query: 257 LLQKGLKYRQVASTKMNDVSSRSHTIFTINL 287
           +L + +K R  A+T  N  SSRSH++F I L
Sbjct: 549 ILVRAMKMRSTAATSANARSSRSHSVFIIKL 579

>Kwal_YGOB_55.21164 s55 complement(713063..713220,713222..715037)
           [1974 bp, 657 aa] {ON} ANNOTATED BY YGOB -
          Length = 657

 Score = 73.6 bits (179), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 42/109 (38%), Positives = 56/109 (51%), Gaps = 14/109 (12%)

Query: 71  YTVDKVFGPSANQRLIFEEIAEPLFNDFLRGYNCTVLVYGMTSTGKTYTMTGDEKLYKGD 130
           +T D+ FG   + + IF EI + L    L GYN  +  YG T +GKTYTM          
Sbjct: 408 FTFDRCFGAQESNKDIFHEIGQ-LIQSSLDGYNVCIFAYGQTGSGKTYTM---------- 456

Query: 131 LSDSAGIIPRVLFKLFETIEFQSD---NYVIKCSFIELYNEELKDLLID 176
           L+   GIIP  L  +F  +E   +   +Y I   FIE+YNE +KDL  D
Sbjct: 457 LNPEDGIIPSTLNHIFLWVEKLKELGWSYDISSQFIEIYNENIKDLFKD 505

 Score = 33.1 bits (74), Expect = 4.2,   Method: Compositional matrix adjust.
 Identities = 14/31 (45%), Positives = 20/31 (64%)

Query: 257 LLQKGLKYRQVASTKMNDVSSRSHTIFTINL 287
           +L + +K R  A+T  N  SSRSH++F I L
Sbjct: 549 ILVRAMKMRSTAATSANARSSRSHSVFIIKL 579

>NDAI0C00480 Chr3 complement(84502..86298) [1797 bp, 598 aa] {ON}
           Anc_2.633
          Length = 598

 Score = 59.7 bits (143), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 87/372 (23%), Positives = 165/372 (44%), Gaps = 91/372 (24%)

Query: 63  TAQLNSKTYTVDKVFGPSANQRLIFEEIAEPLFNDFLRGYNCTVLVYGMTSTGKTYTMTG 122
           T +L+S+ +  D +F  ++ Q    E +      D   GYN + + YG +++GK+ T+  
Sbjct: 61  TLKLDSQDFKFDNIFPTNSEQN---EMLTVSTIKDLFDGYNQSFITYGKSNSGKSDTL-- 115

Query: 123 DEKLYKGDLSDSAGIIPRVLF-KLFETIE-FQSD-------------NYVIKCSFIELYN 167
                    ++  G+I R+LF +LF+ ++   +D              +    S +E+++
Sbjct: 116 --------FNEKDGLI-RLLFEQLFKKVQSLTADNNNNNTREGNNILTFNFSLSMMEIFS 166

Query: 168 -EELKDLLIDS---NNTKLKKLRIFDXXXXXXXXXXXXXXXXXHFISGMDLRKXXXXXXX 223
            E++ DLL +    +N  LK L++                   H I              
Sbjct: 167 SEKIYDLLSNEYTKDNPILKSLKV-----------------HQHDI-------------- 195

Query: 224 XXXXXTAIQNG-NASIYIQNLEEFHIKNAREGIQLLQKGLKYR-QVASTKMNDVSS---R 278
                  I+NG     +++NL    I +  +    LQK  K   Q +S  +N  ++   R
Sbjct: 196 -------IENGIKGDKHVKNLSHIQIASLDD----LQKWFKIGCQRSSAIINAGTAKEKR 244

Query: 279 SHTIFTINLYKEH---KGEIFKISKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTL 335
           S++I    ++ E    K +++K+S ++ +DL G +  ++   Q     E   +N  + + 
Sbjct: 245 SNSIIISKIHLEQVNPKDQLYKLSTLSFIDLYGIDKFTKKDIQ-LTNDEMKKLNTLMSSF 303

Query: 336 GRVINSIADKNIHIPF-----RESKLTRLLQDSLGGNTKTALIATI-SPAKLNAEETCST 389
             +I +++D    +P+     ++S L ++LQD +GGN+KT  I    SP+ +  EE    
Sbjct: 304 QNLITTLSDPK-SLPYTSSLYKDSALNKILQDYIGGNSKTTFIIPFPSPSIIQHEELIEM 362

Query: 390 LEYATKAKSIKN 401
           L++A   KSIKN
Sbjct: 363 LKFAMGLKSIKN 374

>KNAG0M02540 Chr13 (471930..473498) [1569 bp, 522 aa] {ON} Anc_2.633
           YKL079W
          Length = 522

 Score = 59.7 bits (143), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 34/107 (31%), Positives = 60/107 (56%), Gaps = 8/107 (7%)

Query: 69  KTYTVDKVFGPSANQRLIFEEIAEPLFNDFLRGYNCTVLVYGMTSTGKTYTMTGDEKLYK 128
           +T+++DKVF PSA+Q  +   +  P+ ++   G N  +   G + TGKT+TM G + +  
Sbjct: 42  RTFSLDKVFPPSASQADVTAVLLGPIVDNLAHGVNVQMASLGDSQTGKTHTMLGQQGV-- 99

Query: 129 GDLSDSAGIIPRVLFKLFETI-EFQSDNYVIKCSFIELYNEELKDLL 174
                S G++ R+L K+F+ + E +        S +EL N+++ DLL
Sbjct: 100 -----SQGLLQRILTKVFQLMNENEGVTVQYSLSAVELVNDKVYDLL 141

>CAGL0L05104g Chr12 complement(577023..579050) [2028 bp, 675 aa]
           {ON} similar to uniprot|P32364 Saccharomyces cerevisiae
           YKL079w SMY1 kinesin-related protein
          Length = 675

 Score = 59.3 bits (142), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 78/357 (21%), Positives = 143/357 (40%), Gaps = 79/357 (22%)

Query: 71  YTVDKVFGPSANQRLIFEEIAEPLFNDFLRGYNCTVLVYGMTSTGKTYTMTGDEKLYKGD 130
           +  +KV+        I + ++E +  D   GY+ +++ YG   +GK++T+ G+E      
Sbjct: 87  FNFEKVYDVGVPLVDIHKSLSESVLKDIYDGYDVSIISYGEAGSGKSFTLFGNE------ 140

Query: 131 LSDSAGIIPRVLFKLFET-IEFQSDNYVI---KCSFIELYNEELKDLLIDSNNTKLKKLR 186
             DS GII      + +   E + D   I   + S +E+  E++ D+L            
Sbjct: 141 --DSDGIIALTFQDIIQKKRELEKDQNTIVNIQISALEISLEKVYDML------------ 186

Query: 187 IFDXXXXXXXXXXXXXXXXXHFISGMDLRKXXXXXXXXXXXXTAIQNGNASIYIQNLEEF 246
                                     D RK               Q  N   YI +++EF
Sbjct: 187 -----------------------HSADDRKPLKSHHETKKFGLYYQEANNE-YINSIKEF 222

Query: 247 HIKNAREGIQLLQKGLKYRQVASTKMNDVSSRSHTIFTINLYKEHK--GEIFKISKMNLV 304
                   ++L+Q     ++ +  KM+   S SH +   ++ +  +  G I   S +   
Sbjct: 223 D-----RVMKLIQDN---KEASEKKMDSKRSTSHVVIRCSVEQLDRVHGTITS-SNIMFA 273

Query: 305 DLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSI---ADKN--------------- 346
           DL GS    +   Q    +    +N S+  L  V+NS+     KN               
Sbjct: 274 DLCGSNRFEKDVDQKLGVENIKKLNLSISNLESVVNSVLQNQQKNHLYIENKLVPSVNSS 333

Query: 347 --IHIPFRESKLTRLLQDSLGGNTKTALIATISPAKLNAEETCSTLEYATKAKSIKN 401
               +P+++S+LT L+Q++LGGN++T ++      K + EET +TL +  + ++I N
Sbjct: 334 DLQRVPYKDSQLTGLIQEALGGNSRTRVVLNCFDDKSHHEETIATLRFGVQLQNILN 390

>TBLA0A00820 Chr1 (178283..180694) [2412 bp, 803 aa] {ON} Anc_2.633
           YKL079W
          Length = 803

 Score = 58.9 bits (141), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 49/168 (29%), Positives = 84/168 (50%), Gaps = 18/168 (10%)

Query: 235 NASIYIQNLEEFHIKNAREGIQLLQKGLKYRQVASTKMNDVSSRSHTIFTINLYKEH-KG 293
           N+S+ I+NL + ++++  E    L +G   R      M  ++SRS+ +  INL +   + 
Sbjct: 234 NSSLEIENLRQVYVESFEELNSYLIEGRSNRN-----MKHLTSRSNIVIKINLEQVFLED 288

Query: 294 EIFKISKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSIADKNIHIPFRE 353
           ++ K S + L+D+A S+ I ++ +    AKEA  +N  + +    IN +A+     P+ +
Sbjct: 289 QLMKCSSLILLDMAASDYIDKNDSLGISAKEAKKLNYPMESFTSYINLLAETGTS-PYDQ 347

Query: 354 -----------SKLTRLLQDSLGGNTKTALIATISPAKLNAEETCSTL 390
                      S L  ++   +GGN KT  I+TISP   N  ET  TL
Sbjct: 348 QINGKKSNDYNSNLVDIMSIPIGGNCKTLFISTISPLLANQNETFITL 395

 Score = 40.0 bits (92), Expect = 0.032,   Method: Compositional matrix adjust.
 Identities = 18/57 (31%), Positives = 33/57 (57%), Gaps = 1/57 (1%)

Query: 71  YTVDKVFGPSANQR-LIFEEIAEPLFNDFLRGYNCTVLVYGMTSTGKTYTMTGDEKL 126
           + VDKVF     Q  L+  +I +   ++   G+N +++ +G + TGK++TM G+  L
Sbjct: 51  FQVDKVFDRFTKQSDLLSSDIVKNKISELFDGFNSSIIAFGQSGTGKSFTMFGNNSL 107

>KAFR0C04020 Chr3 (802379..804382) [2004 bp, 667 aa] {ON} Anc_2.633
           YKL079W
          Length = 667

 Score = 51.6 bits (122), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 80/297 (26%), Positives = 134/297 (45%), Gaps = 54/297 (18%)

Query: 277 SRSHTIFTINLYKEHKGE-IFKISKMNLVDLAGSENISRSG--AQNQRAKEAGSINQSLL 333
           S+SH I  IN+ + +  E + K   ++  DLA  + I +    +    + E   +N    
Sbjct: 219 SKSHLITKINVEQRNLNEDVVKRGSISFFDLAAIDFIDKDSMVSLGLTSDEVKKLNLEST 278

Query: 334 TLGRVINSIAD----KNIHIPFRESKLTRLLQDSLGGNTKTALIATISPAKLNAEETCST 389
           TL   I S+++     N  IP++ S LT+LL     GN KT +I T S  K N  ET  T
Sbjct: 279 TLKNSIISMSELSENPNAVIPYKNSNLTKLLNQCFMGNMKTTVILTCSMLKSNEAETLET 338

Query: 390 LEYATKAKSIK-----NKPQLGS-----IIMKDVRLKDLN--NELAKIKRDLTSTKQKDG 437
           L+   K +SI      NK  L S     +I++D++ K+ N  N +  ++ +L   +    
Sbjct: 339 LKMGLKLESISSNVHMNKHALNSKKKLDLIVEDMKSKEANYMNRIRLLETELNDLRAS-- 396

Query: 438 VYMTQNHYKDLTNDLESYKTEI-QECDRIVK---SLELQNALLLKDKKASNEVNKLQELN 493
                  Y +  ++  S+K E+ +E  + VK    LE+   LL K  +A +  +K   L 
Sbjct: 397 -------YGEAISETSSFKEEMNKERAKNVKLKEELEVFKKLLQKKGEAQSTHSKEMPLT 449

Query: 494 --------LNEMTNTLSNIQTTLEIQHKKEQILVEELAHSREKSLKMKTVIKEYSEK 542
                   L E + +++ ++ TL+I+              + KS K+  V+K Y EK
Sbjct: 450 DDEEIMQQLIEKSASVAELKATLDIE--------------KHKSFKLNEVLKNYVEK 492

 Score = 44.7 bits (104), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 24/93 (25%), Positives = 48/93 (51%), Gaps = 8/93 (8%)

Query: 86  IFEEIAEPLFNDFLRGYNCTVLVYGMTSTGKTYTMTGDEKLYKGDLSDSAGIIPRVLFKL 145
           ++  I   L N+   GY+  V+ YG   TGK+    G +  Y+G      G++   +  L
Sbjct: 75  LYNGIKGDLINNIFEGYHTGVITYGSAGTGKSSIFYGTDSTYEG------GVVLMFVQDL 128

Query: 146 FETIEFQSDN--YVIKCSFIELYNEELKDLLID 176
           ++ I+   ++  + +  S IE++ E++ DLL++
Sbjct: 129 YDKIDSIGNDTHFTVSLSTIEIHLEKMYDLLVN 161

>KNAG0H00360 Chr8 (51965..54010) [2046 bp, 681 aa] {ON} Anc_2.633
           YKL079W
          Length = 681

 Score = 49.3 bits (116), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 36/139 (25%), Positives = 64/139 (46%), Gaps = 8/139 (5%)

Query: 52  INTSDDIVSGLTAQLNSKTYTVDKVFGPSANQRLIFEEIAEPLFNDFLRGYNCTVLVYGM 111
           + T +D V     +L  ++++  KV    A +   F E+A  + +D L G NC V  YG 
Sbjct: 75  VQTVNDTV----VKLGEQSFSFSKVLNDQATKTEQFTELASKVTDDVLSGINCCVTTYGS 130

Query: 112 TSTGKTYTMTGDEKLYKGDLSDS---AGIIPRVLFKLFETIEFQSDN-YVIKCSFIELYN 167
                +  M G +     +  DS   +G++ +    +F  I+  S + Y +  S  E+Y 
Sbjct: 131 GLAADSLVMFGPQSGNSKEEQDSSRCSGLLQQTCKHIFNAIDSDSTSEYQVSLSLCEVYV 190

Query: 168 EELKDLLIDSNNTKLKKLR 186
           +++ DLL+     K  KL+
Sbjct: 191 DKVFDLLVPVRKRKPLKLQ 209

>NCAS0C05200 Chr3 (1059068..1060786) [1719 bp, 572 aa] {ON}
           Anc_2.633 YKL079W
          Length = 572

 Score = 47.0 bits (110), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 32/105 (30%), Positives = 55/105 (52%), Gaps = 16/105 (15%)

Query: 91  AEPL----FNDFLRGYNCTVLVYGMTSTGKTYTMTGDEKLYKGDLSDSAGIIPRVLFKLF 146
            EPL     N+  RG +C+++ YG ++TGKT+ +               GIIP  + +L+
Sbjct: 65  PEPLVIDNINELTRGVDCSMVTYGQSATGKTHVL----------FDQVRGIIPLFIEQLY 114

Query: 147 ETIEFQSD-NYVIKCSFIELYNE-ELKDLLIDSNNTKLKKLRIFD 189
             +E QSD  Y I  S  E  ++ +++DLL+  N+ + +K   +D
Sbjct: 115 IYLEAQSDLQYQIGLSVWEADSKGKIRDLLVPLNDPQQQKSLKWD 159

 Score = 35.0 bits (79), Expect = 0.98,   Method: Compositional matrix adjust.
 Identities = 48/180 (26%), Positives = 76/180 (42%), Gaps = 40/180 (22%)

Query: 277 SRSHTIFTINLYKEHKGE-IFKISKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTL 335
           S  HT   I+L   +  E  F+   +  VDL   E++                 Q + +L
Sbjct: 192 STFHTFVKISLQLVNCHEDSFRKCCIEFVDLCAQEDVL----------------QLVCSL 235

Query: 336 GRVINSIADKNIHIPFRESKLTRLLQDSLGGNTKTALIATISPAKLNAEETCSTLEYATK 395
             V+++  DK I     +S+  +LL +S+GGN KT  I   S  + N + +  TLE+  K
Sbjct: 236 VAVLSNDNDKKIG--KEKSQFCKLLSNSIGGNRKTTFILACSTLEQNEKISLETLEFGLK 293

Query: 396 AKSIKNKPQLG----------SIIMKDVRLKD---------LNNELAKIK--RDLTSTKQ 434
              + N  Q             ++M D  LKD         L NEL K++  RD ++T +
Sbjct: 294 VSQVVNIIQRKDEPLNCDNKLQLLMDDDSLKDEVYSLQIDVLENELNKLRAIRDNSTTPK 353

>NDAI0G04460 Chr7 complement(1066524..1069940) [3417 bp, 1138 aa]
           {ON} Anc_2.651
          Length = 1138

 Score = 37.7 bits (86), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 21/57 (36%), Positives = 30/57 (52%), Gaps = 5/57 (8%)

Query: 675 IVNDHVNTTKAIIEKSVSDIFKQFQQNM-----EAFAEQNEKLILENLKTVSSDLIQ 726
           ++ D   T  A   KS S +F+Q QQNM      A  EQ    +L   KT+++DL+Q
Sbjct: 920 LLTDEQPTAAASPPKSYSQMFQQTQQNMSNTLSPAITEQGSPAMLHQQKTIATDLLQ 976

>NDAI0E05090 Chr5 (1168389..1171058) [2670 bp, 889 aa] {ON}
           Anc_5.713 YKR099W
          Length = 889

 Score = 35.8 bits (81), Expect = 0.68,   Method: Compositional matrix adjust.
 Identities = 40/144 (27%), Positives = 63/144 (43%), Gaps = 25/144 (17%)

Query: 643 ANLFENLESIKQQYSKLNEYFSNDFFKSNHVTIVNDHVNTTKAIIEKSVSDIFKQFQQNM 702
           ANLF       QQ+  L++   N    SN+VT  NDHVN  + + ++  S I    Q + 
Sbjct: 620 ANLFS--PPSFQQFPDLSQSNFNTDSNSNNVT--NDHVNPVQHLAQQQDSTIISTTQVH- 674

Query: 703 EAFAEQNEKLILENL-------KTVSSDLIQNEMNSFKEHKSEWDISFKKINHCDYLNNS 755
             F+  NE  IL+          +V+S+      +SF    S  D+   +I+H +YL   
Sbjct: 675 --FSSTNESNILDEAIEKSDKQSSVTSNATPGSTDSFSTPGSVPDVGPNRISHFNYL--- 729

Query: 756 YHDQMHTYLRNMKGKLQSSDEIIK 779
                      +K +L SSD + +
Sbjct: 730 --------PPTLKPQLSSSDNVTR 745

>NCAS0C02830 Chr3 (534302..536926) [2625 bp, 874 aa] {ON} Anc_8.401
          Length = 874

 Score = 33.9 bits (76), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 25/72 (34%), Positives = 41/72 (56%), Gaps = 6/72 (8%)

Query: 299 SKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSIADKNIHI---PFRESK 355
           S+  +VD+ G++++ +S  QN   K    +N SLLTLG+ IN++    + I   P  E  
Sbjct: 427 SEFTIVDMNGTQHLGKS--QNVMPKTT-ELNSSLLTLGKSINNLNLDEMPIVISPLAEFL 483

Query: 356 LTRLLQDSLGGN 367
           + R L++S  GN
Sbjct: 484 IRRALKNSRLGN 495

>YOR334W Chr15 (944596..946008) [1413 bp, 470 aa] {ON}
           MRS2Mitochondrial inner membrane Mg(2+) channel,
           required for maintenance of intramitochondrial Mg(2+)
           concentrations at the correct level to support splicing
           of group II introns
          Length = 470

 Score = 33.1 bits (74), Expect = 3.3,   Method: Compositional matrix adjust.
 Identities = 30/121 (24%), Positives = 55/121 (45%), Gaps = 8/121 (6%)

Query: 331 SLLTLGRVINSIADKNIHIP-FRESKLTRLLQDSLGGNTKTALIATISPAKLNAEETCST 389
           ++ TLG  + S+      +P F    L   +++S  G T  A+ + +S   +  ++  ++
Sbjct: 316 TIYTLGFTVASV------LPAFYGMNLKNFIEESEWGFTSVAVFSIVSALYI-TKKNFNS 368

Query: 390 LEYATKAKSIKNKPQLGSIIMKDVRLKDLNNELAKIKRDLTSTKQKDGVYMTQNHYKDLT 449
           L   TK     N P   S+  K      L N+L + ++   STKQ+ GV +  + Y +  
Sbjct: 369 LRSVTKMTMYPNSPANSSVYPKTSASIALTNKLKRRRKWWKSTKQRLGVLLYGSSYTNKA 428

Query: 450 N 450
           N
Sbjct: 429 N 429

>ZYRO0C02926g Chr3 complement(227574..228998) [1425 bp, 474 aa] {ON}
           similar to uniprot|Q08271 Saccharomyces cerevisiae
           YOL132W GAS4 Putative 1,3-beta-glucanosyltransferase has
           similarity to Gas1p localizes to the cell wall
          Length = 474

 Score = 33.1 bits (74), Expect = 3.9,   Method: Compositional matrix adjust.
 Identities = 25/73 (34%), Positives = 33/73 (45%), Gaps = 17/73 (23%)

Query: 395 KAKSIKNKPQLGSIIMKD----------------VRLKDLNNELAKIKRDLTSTKQKDGV 438
           K  S+ N  Q+ S I KD                 R  +LN E AK+ + L S+  KDGV
Sbjct: 332 KTISLPNSDQVSSAIAKDGEINQQAYENKTPSCRARYANLNTE-AKVTKGLASSLIKDGV 390

Query: 439 YMTQNHYKDLTND 451
            + +  Y DLT D
Sbjct: 391 DVAKGEYVDLTED 403

>Kpol_1002.47 s1002 (137553..139292) [1740 bp, 579 aa] {ON}
           (137553..139292) [1740 nt, 580 aa]
          Length = 579

 Score = 32.3 bits (72), Expect = 6.1,   Method: Compositional matrix adjust.
 Identities = 25/91 (27%), Positives = 49/91 (53%), Gaps = 14/91 (15%)

Query: 253 EGIQLLQKGLKYRQVASTKMNDVSSRSHTIFTINLYKEHKGEIFKISKMNLVDLAGSE-- 310
           EG+Q L+  L+++ +    M D+   SH+ + I  Y+++  EI+K S++ ++  + SE  
Sbjct: 390 EGLQNLRNALEHKVI---NMKDIEP-SHSKYAIKTYRQYCSEIYKTSQLEILKSSISELK 445

Query: 311 NISRSGAQNQRAKEAGSINQSLLTLGRVINS 341
           +I +S     + K        LLT+ +V+ S
Sbjct: 446 HIEKSWISESKNK--------LLTMKKVMKS 468

>KNAG0E00960 Chr5 complement(180138..180821) [684 bp, 227 aa] {ON} 
          Length = 227

 Score = 32.0 bits (71), Expect = 6.3,   Method: Compositional matrix adjust.
 Identities = 31/79 (39%), Positives = 48/79 (60%), Gaps = 8/79 (10%)

Query: 446 KDLTNDLESYKTEIQECDRIVKSLELQNALLLKDKKASNEVNKLQELNL-NEMTNTLSNI 504
           K L  ++ SY  + Q  + IV  LELQ  L +K ++ S+   K+QE++L  EMT TL NI
Sbjct: 76  KQLERNVNSY-ADRQRKNNIVSDLELQ--LEMKRQRFSH---KMQEMHLEREMTRTLENI 129

Query: 505 QTTLEIQHKKEQILVEELA 523
           +   + Q K+EQ L+++ A
Sbjct: 130 RHA-QYQLKQEQRLIKQQA 147

>ZYRO0B08536g Chr2 complement(664054..666126) [2073 bp, 690 aa] {ON}
           weakly similar to uniprot|P47166 Saccharomyces
           cerevisiae YJR134C SGM1 Protein of unknown function
           required for wild-type growth rate on galactose and
           mannose localizes to COPI coated vesicles and the Golgi
           apparatus
          Length = 690

 Score = 32.3 bits (72), Expect = 6.4,   Method: Compositional matrix adjust.
 Identities = 29/100 (29%), Positives = 59/100 (59%), Gaps = 13/100 (13%)

Query: 415 LKDLNNELAKIKRDLTSTKQKDGVYMTQNHYKDLTNDLESYKTEIQECDRIVKSLELQNA 474
           +K L  +LA ++ D+  T+++  ++   + Y+ L +  E  +T++Q C+ I+K+L   NA
Sbjct: 197 IKSLRKKLAGMENDIKVTQEE--LFKKISSYEQLFDSHEDLQTQLQNCEVIIKNLRQDNA 254

Query: 475 LLLKDKKASNEVNKLQELNLNEMTNTLSNIQTTLEIQHKK 514
             LKD ++  E NK +E+          ++++TLE++H+K
Sbjct: 255 -QLKDSESQLE-NKKEEVE---------SLRSTLEMEHQK 283

>KLLA0A02937g Chr1 (259865..260296) [432 bp, 143 aa] {ON} some
           similarities with uniprot|Q02205 Saccharomyces
           cerevisiae YKR007W MEH1
          Length = 143

 Score = 30.8 bits (68), Expect = 7.1,   Method: Compositional matrix adjust.
 Identities = 25/72 (34%), Positives = 42/72 (58%), Gaps = 10/72 (13%)

Query: 586 NIKLIKDDVIS---IVTESQELSKKLFLEFSQQIIKETPLILEMFSSDVKKN-----QEL 637
           N KLI   +IS   IV  S +L    +++  ++I+ + PL + + SS +K++     QE 
Sbjct: 60  NDKLIDIGMISNSGIVASSHDLGSS-YVQDQREILHDVPLTV-LPSSKIKQDTRKAIQEF 117

Query: 638 NETYFANLFENL 649
           ++ YFANL +NL
Sbjct: 118 HKKYFANLVKNL 129

>TDEL0H04000 Chr8 (680730..685727) [4998 bp, 1665 aa] {ON} Anc_7.51
            YOR341W
          Length = 1665

 Score = 32.3 bits (72), Expect = 7.2,   Method: Compositional matrix adjust.
 Identities = 32/133 (24%), Positives = 58/133 (43%), Gaps = 13/133 (9%)

Query: 701  NMEAFAEQ-NEKLILENLKTVSSDLIQNEMNSFKEHKSEWDISFKKINHCDYLNN---SY 756
            N  A AE  + +  L+  K VS +  +N   +  E K ++D    K N   YL +    +
Sbjct: 1080 NPVALAEHLDVETALQYSKKVSKNRKKNSKTAHYEQKVKYDPVLAKYNPAKYLGSVSEKF 1139

Query: 757  HDQMHTYLRNMKGKLQSSDEIIKKHMNQIKSNVDSLNSTPKLLNTDRAIGDNYNQIISKR 816
            HD++ +YL +   + +S + +  K    +      L     L+N   A+G     II+ +
Sbjct: 1140 HDKLESYLEDKAKEFKSRESVSAKRFRALM----QLKYMRSLINPGEAVG-----IIASQ 1190

Query: 817  DKLHDHLQISLNS 829
                   Q++LN+
Sbjct: 1191 SVGEPSTQMTLNT 1203

>KNAG0B01860 Chr2 complement(350091..352613) [2523 bp, 840 aa] {ON}
           Anc_1.280 YJL087C
          Length = 840

 Score = 32.3 bits (72), Expect = 7.7,   Method: Compositional matrix adjust.
 Identities = 25/71 (35%), Positives = 37/71 (52%), Gaps = 6/71 (8%)

Query: 476 LLKDKKASNEVNKLQELNLNEMTNTLSNIQTTLEIQHKKEQILVEELA------HSREKS 529
           ++KDK   N  + L EL  NE+ ++L N +  LE  H++  ILV E+        S + S
Sbjct: 540 VVKDKSPDNLFDLLIELPYNEVNSSLINTKIILENLHREYPILVPEIPDENAIKSSFDLS 599

Query: 530 LKMKTVIKEYS 540
           L+ K  IK  S
Sbjct: 600 LEHKIPIKPGS 610

>TBLA0E03940 Chr5 (996079..997800) [1722 bp, 573 aa] {ON} 
          Length = 573

 Score = 32.0 bits (71), Expect = 9.5,   Method: Compositional matrix adjust.
 Identities = 20/58 (34%), Positives = 36/58 (62%), Gaps = 5/58 (8%)

Query: 464 RIVKSLELQNALLLKDKKASNEV--NKLQEL---NLNEMTNTLSNIQTTLEIQHKKEQ 516
           ++ K+LEL + +L K+KK  N +  N++Q+    N N ++NT+SN  T +    K+E+
Sbjct: 369 QLKKNLELCSQVLFKEKKKPNSIVQNQIQKFDNSNFNPISNTISNSSTGINTMKKREK 426

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.313    0.129    0.346 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 96,093,469
Number of extensions: 4451664
Number of successful extensions: 24397
Number of sequences better than 10.0: 1113
Number of HSP's gapped: 24904
Number of HSP's successfully gapped: 1608
Length of query: 939
Length of database: 53,481,399
Length adjustment: 119
Effective length of query: 820
Effective length of database: 39,836,145
Effective search space: 32665638900
Effective search space used: 32665638900
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.9 bits)
S2: 71 (32.0 bits)