Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
TPHA0M002306.14ON58558528530.0
Kwal_56.223876.14ON54347313860.0
Kpol_1032.56.14ON68050413860.0
KLTH0C11396g6.14ON55047613640.0
Skud_5.296.14ON60844613680.0
KLLA0D00979g6.14ON56147313630.0
Suva_5.76.14ON66445513660.0
Smik_5.276.14ON60842013600.0
SAKL0E01012g6.14ON54447113460.0
NCAS0F002206.14ON69542913591e-180
YEL060C (PRB1)6.14ON63544613541e-180
KAFR0L003606.14ON50246513361e-180
KNAG0E009206.14ON53148813261e-178
TDEL0G045506.14ON56441413231e-177
CAGL0B03619g6.14ON46844513141e-177
TBLA0A073006.14ON57346513171e-176
NDAI0K028806.14ON70446713081e-173
ZYRO0C07942g6.14ON54843012721e-169
Ecym_30186.14ON57547812461e-165
ACR012C6.14ON54147612081e-160
Kpol_1045.756.14ON47742311911e-158
Skud_15.1646.14ON48241710771e-141
YOR003W (YSP3)6.14ON47842610681e-140
Smik_15.1726.14ON47841210561e-138
Suva_15.1786.14ON47641710551e-138
CAGL0E02651g6.14ON4854209811e-126
KAFR0B065506.14ON4564149781e-126
NCAS0D026306.14ON4514159311e-119
KNAG0F02970singletonON4204068701e-111
NDAI0I022806.14ON4824148701e-110
CAGL0L13266gsingletonON5794346632e-78
TDEL0A072806.313ON4364015092e-57
SAKL0A02002g6.313ON4793935104e-57
Kpol_1028.616.313ON5183235037e-56
NCAS0D043906.313ON4924015011e-55
Smik_3.1496.313ON4913254982e-55
KLTH0A06094g6.313ON4963364965e-55
YCR045C (RRT12)6.313ON4913184903e-54
Kpol_1018.56.313ON4653364884e-54
KAFR0J024506.313ON4784074894e-54
Suva_3.846.313ON5273264906e-54
ZYRO0D08822g6.313ON4904694879e-54
Skud_3.1246.313ON5403264802e-52
CAGL0L10802g6.313ON5173384749e-52
AAR069W6.313ON7683324805e-51
Ecym_21056.313ON6103324674e-50
Kwal_23.61836.313ON4933334605e-50
TBLA0F039706.313ON7343254691e-49
KNAG0I024706.313ON4753554561e-49
NDAI0I005606.313ON4833924473e-48
TPHA0D037606.313ON6073194534e-48
KLLA0F06028g6.313ON5083604072e-42
TBLA0A067006.313ON4973613744e-38
Kwal_33.133721.78ON3772613323e-33
KLTH0F02288g1.78ON3802653182e-31
Kpol_2000.691.78ON3862712981e-28
ZYRO0F16764g1.78ON3863232865e-27
TPHA0B045201.78ON3882802715e-25
TBLA0A054101.78ON3822742326e-20
TDEL0C062301.78ON3642322157e-18
NCAS0A008802.6ON833263920.018
NDAI0F038902.6ON833272920.019
TPHA0P017902.6ON799277900.030
KAFR0A080402.6ON766261850.13
CAGL0J07546g2.6ON789264840.14
Suva_14.1062.6ON809262820.23
YNL238W (KEX2)2.6ON814263820.27
Smik_14.972.6ON814268810.31
SAKL0G00440g2.6ON836264780.87
Skud_14.1012.6ON819263770.93
TBLA0B001302.6ON842263771.2
ZYRO0F15598g2.6ON790266742.1
TDEL0D00190singletonON55236732.5
TPHA0A052005.85ON99153742.5
KLLA0D19811g2.6ON756263723.7
Kpol_1015.82.6ON843282715.0
TPHA0A058403.525ON389103706.3
KLLA0E11133gsingletonON460188707.2
AEL208W5.85ON98777708.1
KAFR0G015203.137ON15791669.4
Ecym_64862.6ON781946910.0
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= TPHA0M00230
         (585 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

TPHA0M00230 Chr13 (45121..46878) [1758 bp, 585 aa] {ON} Anc_6.14...  1103   0.0  
Kwal_56.22387 s56 (107327..108958) [1632 bp, 543 aa] {ON} YEL060...   538   0.0  
Kpol_1032.5 s1032 (6368..8410) [2043 bp, 680 aa] {ON} (6368..841...   538   0.0  
KLTH0C11396g Chr3 complement(936878..938530) [1653 bp, 550 aa] {...   530   0.0  
Skud_5.29 Chr5 complement(39160..40986) [1827 bp, 608 aa] {ON} Y...   531   0.0  
KLLA0D00979g Chr4 (86703..88388) [1686 bp, 561 aa] {ON} similar ...   529   0.0  
Suva_5.7 Chr5 complement(15849..17843) [1995 bp, 664 aa] {ON} YE...   530   0.0  
Smik_5.27 Chr5 complement(42408..44234) [1827 bp, 608 aa] {ON} Y...   528   0.0  
SAKL0E01012g Chr5 (75498..77132) [1635 bp, 544 aa] {ON} similar ...   523   0.0  
NCAS0F00220 Chr6 (32791..34878) [2088 bp, 695 aa] {ON} Anc_6.14 ...   528   e-180
YEL060C Chr5 complement(40046..41953) [1908 bp, 635 aa] {ON}  PR...   526   e-180
KAFR0L00360 Chr12 (64781..66289) [1509 bp, 502 aa] {ON} Anc_6.14...   519   e-180
KNAG0E00920 Chr5 complement(174432..176027) [1596 bp, 531 aa] {O...   515   e-178
TDEL0G04550 Chr7 complement(829468..831162) [1695 bp, 564 aa] {O...   514   e-177
CAGL0B03619g Chr2 (361572..362978) [1407 bp, 468 aa] {ON} simila...   510   e-177
TBLA0A07300 Chr1 complement(1815683..1817404) [1722 bp, 573 aa] ...   511   e-176
NDAI0K02880 Chr11 complement(651446..653560) [2115 bp, 704 aa] {...   508   e-173
ZYRO0C07942g Chr3 complement(605044..606690) [1647 bp, 548 aa] {...   494   e-169
Ecym_3018 Chr3 (33738..35465) [1728 bp, 575 aa] {ON} similar to ...   484   e-165
ACR012C Chr3 complement(378750..380375) [1626 bp, 541 aa] {ON} S...   469   e-160
Kpol_1045.75 s1045 complement(174970..176403) [1434 bp, 477 aa] ...   463   e-158
Skud_15.164 Chr15 (291471..292919) [1449 bp, 482 aa] {ON} YOR003...   419   e-141
YOR003W Chr15 (331455..332891) [1437 bp, 478 aa] {ON}  YSP3Putat...   416   e-140
Smik_15.172 Chr15 (298772..300208) [1437 bp, 478 aa] {ON} YOR003...   411   e-138
Suva_15.178 Chr15 (305907..307337) [1431 bp, 476 aa] {ON} YOR003...   410   e-138
CAGL0E02651g Chr5 (251868..253325) [1458 bp, 485 aa] {ON} simila...   382   e-126
KAFR0B06550 Chr2 (1359770..1361140) [1371 bp, 456 aa] {ON} Anc_6...   381   e-126
NCAS0D02630 Chr4 (506222..507577) [1356 bp, 451 aa] {ON} Anc_6.14     363   e-119
KNAG0F02970 Chr6 (563666..564928) [1263 bp, 420 aa] {ON}              339   e-111
NDAI0I02280 Chr9 complement(519169..520617) [1449 bp, 482 aa] {O...   339   e-110
CAGL0L13266g Chr12 (1418408..1420147) [1740 bp, 579 aa] {ON} som...   259   2e-78
TDEL0A07280 Chr1 complement(1276408..1277718) [1311 bp, 436 aa] ...   200   2e-57
SAKL0A02002g Chr1 (176105..177544) [1440 bp, 479 aa] {ON} simila...   201   4e-57
Kpol_1028.61 s1028 (138312..139868) [1557 bp, 518 aa] {ON} (1383...   198   7e-56
NCAS0D04390 Chr4 complement(836796..838274) [1479 bp, 492 aa] {O...   197   1e-55
Smik_3.149 Chr3 complement(206258..207733) [1476 bp, 491 aa] {ON...   196   2e-55
KLTH0A06094g Chr1 complement(513667..515157) [1491 bp, 496 aa] {...   195   5e-55
YCR045C Chr3 complement(208135..209610) [1476 bp, 491 aa] {ON}  ...   193   3e-54
Kpol_1018.5 s1018 (14365..15762) [1398 bp, 465 aa] {ON} (14365.....   192   4e-54
KAFR0J02450 Chr10 complement(469452..470888) [1437 bp, 478 aa] {...   192   4e-54
Suva_3.84 Chr3 complement(121533..123116) [1584 bp, 527 aa] {ON}...   193   6e-54
ZYRO0D08822g Chr4 (754340..755812) [1473 bp, 490 aa] {ON} simila...   192   9e-54
Skud_3.124 Chr3 complement(192464..194086) [1623 bp, 540 aa] {ON...   189   2e-52
CAGL0L10802g Chr12 complement(1159230..1160783) [1554 bp, 517 aa...   187   9e-52
AAR069W Chr1 (460781..463087) [2307 bp, 768 aa] {ON} Syntenic ho...   189   5e-51
Ecym_2105 Chr2 (185014..186846) [1833 bp, 610 aa] {ON} similar t...   184   4e-50
Kwal_23.6183 s23 complement(1485143..1486624) [1482 bp, 493 aa] ...   181   5e-50
TBLA0F03970 Chr6 complement(985334..987538) [2205 bp, 734 aa] {O...   185   1e-49
KNAG0I02470 Chr9 complement(479068..480495) [1428 bp, 475 aa] {O...   180   1e-49
NDAI0I00560 Chr9 (114935..116386) [1452 bp, 483 aa] {ON} Anc_6.313    176   3e-48
TPHA0D03760 Chr4 complement(792115..793938) [1824 bp, 607 aa] {O...   179   4e-48
KLLA0F06028g Chr6 (576687..578213) [1527 bp, 508 aa] {ON} some s...   161   2e-42
TBLA0A06700 Chr1 (1634983..1636476) [1494 bp, 497 aa] {ON} Anc_6...   148   4e-38
Kwal_33.13372 s33 (190864..191997) [1134 bp, 377 aa] {ON} YCR045...   132   3e-33
KLTH0F02288g Chr6 (186895..188037) [1143 bp, 380 aa] {ON} weakly...   127   2e-31
Kpol_2000.69 s2000 complement(151054..152214) [1161 bp, 386 aa] ...   119   1e-28
ZYRO0F16764g Chr6 complement(1390437..1391597) [1161 bp, 386 aa]...   114   5e-27
TPHA0B04520 Chr2 complement(1065861..1067027) [1167 bp, 388 aa] ...   108   5e-25
TBLA0A05410 Chr1 (1328472..1329620) [1149 bp, 382 aa] {ON} Anc_1...    94   6e-20
TDEL0C06230 Chr3 complement(1135740..1136834) [1095 bp, 364 aa] ...    87   7e-18
NCAS0A00880 Chr1 (173726..176227) [2502 bp, 833 aa] {ON} Anc_2.6...    40   0.018
NDAI0F03890 Chr6 complement(921561..924062) [2502 bp, 833 aa] {O...    40   0.019
TPHA0P01790 Chr16 complement(373247..375646) [2400 bp, 799 aa] {...    39   0.030
KAFR0A08040 Chr1 complement(1609550..1611850) [2301 bp, 766 aa] ...    37   0.13 
CAGL0J07546g Chr10 complement(733686..736055) [2370 bp, 789 aa] ...    37   0.14 
Suva_14.106 Chr14 (196428..198857) [2430 bp, 809 aa] {ON} YNL238...    36   0.23 
YNL238W Chr14 (202428..204872) [2445 bp, 814 aa] {ON}  KEX2Subti...    36   0.27 
Smik_14.97 Chr14 (181672..184116) [2445 bp, 814 aa] {ON} YNL238W...    36   0.31 
SAKL0G00440g Chr7 (41016..43526) [2511 bp, 836 aa] {ON} similar ...    35   0.87 
Skud_14.101 Chr14 (191111..193570) [2460 bp, 819 aa] {ON} YNL238...    34   0.93 
TBLA0B00130 Chr2 (12377..14905) [2529 bp, 842 aa] {ON} Anc_2.6 Y...    34   1.2  
ZYRO0F15598g Chr6 complement(1278928..1281300) [2373 bp, 790 aa]...    33   2.1  
TDEL0D00190 Chr4 (29971..31629) [1659 bp, 552 aa] {ON}                 33   2.5  
TPHA0A05200 Chr1 complement(1168851..1171826) [2976 bp, 991 aa] ...    33   2.5  
KLLA0D19811g Chr4 complement(1672338..1674608) [2271 bp, 756 aa]...    32   3.7  
Kpol_1015.8 s1015 complement(19725..20576,20692..20940,20990..20...    32   5.0  
TPHA0A05840 Chr1 complement(1325537..1326706) [1170 bp, 389 aa] ...    32   6.3  
KLLA0E11133g Chr5 (979660..981042) [1383 bp, 460 aa] {ON} some s...    32   7.2  
AEL208W Chr5 (240780..243743) [2964 bp, 987 aa] {ON} Syntenic ho...    32   8.1  
KAFR0G01520 Chr7 (342499..342972) [474 bp, 157 aa] {ON} Anc_3.13...    30   9.4  
Ecym_6486 Chr6 complement(941694..944039) [2346 bp, 781 aa] {ON}...    31   10.0 

>TPHA0M00230 Chr13 (45121..46878) [1758 bp, 585 aa] {ON} Anc_6.14
           YOR003W
          Length = 585

 Score = 1103 bits (2853), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 541/585 (92%), Positives = 541/585 (92%)

Query: 1   MLGGSVHSSARVSLSWPRXXXXXXXXXXXXQLYNMKLQNTXXXXXXXXXXXXXXXXPALD 60
           MLGGSVHSSARVSLSWPR            QLYNMKLQNT                PALD
Sbjct: 1   MLGGSVHSSARVSLSWPRYNYTTTIHNYHTQLYNMKLQNTLVSAVIAASVAEALVIPALD 60

Query: 61  QGRGRGHALDHGPNNNNNVPXXXXXXXXXXXXXXXXVKDVTDQILAYYQHASPASRGLEL 120
           QGRGRGHALDHGPNNNNNVP                VKDVTDQILAYYQHASPASRGLEL
Sbjct: 61  QGRGRGHALDHGPNNNNNVPAFMMRAAAAPASAMEMVKDVTDQILAYYQHASPASRGLEL 120

Query: 121 AALHDNGVGTADHDRYIIVFKKGVFKEQVDQHLKMMSALFRRLSEEQRPAAAPGASALRD 180
           AALHDNGVGTADHDRYIIVFKKGVFKEQVDQHLKMMSALFRRLSEEQRPAAAPGASALRD
Sbjct: 121 AALHDNGVGTADHDRYIIVFKKGVFKEQVDQHLKMMSALFRRLSEEQRPAAAPGASALRD 180

Query: 181 GFDRVMDTFEVAGAFSGYIATVASPKIVDFIRLNPLVDYVEKDSVVHSLDETQNNAPWGL 240
           GFDRVMDTFEVAGAFSGYIATVASPKIVDFIRLNPLVDYVEKDSVVHSLDETQNNAPWGL
Sbjct: 181 GFDRVMDTFEVAGAFSGYIATVASPKIVDFIRLNPLVDYVEKDSVVHSLDETQNNAPWGL 240

Query: 241 ARISHREGLNLGNFNKYLYASNSAGKGVTAYVVDTGISVSHLEFGERAKWGKTIPINDYD 300
           ARISHREGLNLGNFNKYLYASNSAGKGVTAYVVDTGISVSHLEFGERAKWGKTIPINDYD
Sbjct: 241 ARISHREGLNLGNFNKYLYASNSAGKGVTAYVVDTGISVSHLEFGERAKWGKTIPINDYD 300

Query: 301 IDGNGHGTHCAGTIGSEHYGVAKGANLVAVKVLRSDGSGTMSDVLKGVEWVALEHTKHLE 360
           IDGNGHGTHCAGTIGSEHYGVAKGANLVAVKVLRSDGSGTMSDVLKGVEWVALEHTKHLE
Sbjct: 301 IDGNGHGTHCAGTIGSEHYGVAKGANLVAVKVLRSDGSGTMSDVLKGVEWVALEHTKHLE 360

Query: 361 ESRKDKNSNYKGATANMSLGGGKSPALDQAVNAAVKAGVHFAVAAGNENQDACNSSPAAA 420
           ESRKDKNSNYKGATANMSLGGGKSPALDQAVNAAVKAGVHFAVAAGNENQDACNSSPAAA
Sbjct: 361 ESRKDKNSNYKGATANMSLGGGKSPALDQAVNAAVKAGVHFAVAAGNENQDACNSSPAAA 420

Query: 421 ENAITVGASTLSDDRAYFSNYGKCVDIFAPGLNILSTYIGTNDATATLSGTSMASPHVAG 480
           ENAITVGASTLSDDRAYFSNYGKCVDIFAPGLNILSTYIGTNDATATLSGTSMASPHVAG
Sbjct: 421 ENAITVGASTLSDDRAYFSNYGKCVDIFAPGLNILSTYIGTNDATATLSGTSMASPHVAG 480

Query: 481 LLTYLLSLQPDKGSEFYVPNSELTPLQMKKKIIDYATKNALADLPADTPNKLIYNGGFNS 540
           LLTYLLSLQPDKGSEFYVPNSELTPLQMKKKIIDYATKNALADLPADTPNKLIYNGGFNS
Sbjct: 481 LLTYLLSLQPDKGSEFYVPNSELTPLQMKKKIIDYATKNALADLPADTPNKLIYNGGFNS 540

Query: 541 TDFWASAAAPQSHKVKTNRYSLGSFLDSIQDSNNHWFNFDNMNIF 585
           TDFWASAAAPQSHKVKTNRYSLGSFLDSIQDSNNHWFNFDNMNIF
Sbjct: 541 TDFWASAAAPQSHKVKTNRYSLGSFLDSIQDSNNHWFNFDNMNIF 585

>Kwal_56.22387 s56 (107327..108958) [1632 bp, 543 aa] {ON} YEL060C
           (PRB1) - vacuolar protease B [contig 185] FULL
          Length = 543

 Score =  538 bits (1386), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 281/473 (59%), Positives = 348/473 (73%), Gaps = 34/473 (7%)

Query: 135 RYIIVFKKGVFKEQVDQHLKMMS--------------ALFRRLSEEQRPAAAPGASALRD 180
           RYI+VFK  V  E+VD H++++S              A F    +E+    A      R+
Sbjct: 83  RYIVVFKDRVLPEEVDFHMEVVSEAHAQSVGKLDANDAFFEATMDEEMGIMATS----RE 138

Query: 181 GFDRVMDTFEVAGAFSGYIATVASPKIVDFIRLNPLVDYVEKDSVVHSLD-ETQNNAPWG 239
           G   ++D+F+V G   GYI    + +IVDFIR+NPLV +VE+DS+V++ + +TQN APWG
Sbjct: 139 G--GILDSFDVNGMLRGYIGYF-TQEIVDFIRMNPLVAFVEQDSMVYANEFDTQNGAPWG 195

Query: 240 LARISHREGLNLGNFNKYLYASNSAGKGVTAYVVDTGISVSHLEFGERAKWGKTIPINDY 299
           L+RISHRE LNLG+FNKYLY  ++AGKGVT+YV+DTGI++ H +F  RA WGKT+P ND 
Sbjct: 196 LSRISHREKLNLGSFNKYLY-DDAAGKGVTSYVIDTGINIDHKDFEGRAAWGKTVPTNDL 254

Query: 300 DIDGNGHGTHCAGTIGSEHYGVAKGANLVAVKVLRSDGSGTMSDVLKGVEWVALEHTKHL 359
           D DGNGHGTHCAGTI S+HYGVAK AN+VAVKVLRS+GSG+MSDV+KGVE+ A  H   +
Sbjct: 255 DQDGNGHGTHCAGTIASKHYGVAKNANVVAVKVLRSNGSGSMSDVVKGVEFAAKSHQDAV 314

Query: 360 EESRKDKNSNYKGATANMSLGGGKSPALDQAVNAAVKAGVHFAVAAGNENQDACNSSPAA 419
           ++++K     +KG+TANMSLGGGKSPALD AVNAAVKAG+HFAVAAGNENQDACNSSPAA
Sbjct: 315 KKNKK----GFKGSTANMSLGGGKSPALDMAVNAAVKAGIHFAVAAGNENQDACNSSPAA 370

Query: 420 AENAITVGASTLSDDRAYFSNYGKCVDIFAPGLNILSTYIGTNDATATLSGTSMASPHVA 479
           AENAITVGASTL+DDRAYFSN+GKCVDIFAPGLN+LSTYIG+  ATATLSGTSMASPHVA
Sbjct: 371 AENAITVGASTLADDRAYFSNWGKCVDIFAPGLNVLSTYIGSETATATLSGTSMASPHVA 430

Query: 480 GLLTYLLSLQPDKGSEFYVPNSELTPLQMKKKIIDYATKNALADLPADTPNKLIYNGGFN 539
           GLLTY LSLQPD  SE++     +TP Q+KKK+I Y+TKNAL DLP DT N LIYNGG  
Sbjct: 431 GLLTYFLSLQPDSDSEYFHAAGGITPSQLKKKLIAYSTKNALGDLPEDTVNYLIYNGGGQ 490

Query: 540 ST-DFWASAAAPQSHKVKTNRYS-LGSFLDSIQDSNNHWFN-----FDNMNIF 585
              DFW      +    K N  S   S +D++++  +  +      F+ +NI 
Sbjct: 491 DLDDFWVKDLEEKVADAKDNTASEFESIIDALEEKTDGLYEEIREIFEGLNII 543

>Kpol_1032.5 s1032 (6368..8410) [2043 bp, 680 aa] {ON} (6368..8410)
           [2043 nt, 681 aa]
          Length = 680

 Score =  538 bits (1386), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 287/504 (56%), Positives = 363/504 (72%), Gaps = 34/504 (6%)

Query: 97  VKDVTDQILAYYQHASPASRGLELAALHDNGVGTADH----DRYIIVFKKGVFKEQVDQH 152
           V  VT QI   ++ A  +   ++ A LH       ++    ++YIIVFKK V  + +  H
Sbjct: 196 VDSVTQQI---FESAEKSGEKVKYAPLHSMENTKYENLVIPNKYIIVFKKDVSVKDMQIH 252

Query: 153 LKMMSALFRRLSEEQRPAAAPGASALRDGFDRVMDTFEVAGAFSGYIATVASPKIVDFIR 212
             +++    R   +    +   +S++  G +   + F VA  F GYI    + ++V FIR
Sbjct: 253 KDLIA----RAQFQYASVSDETSSSILGGIE---EAFNVANLFHGYIGHF-NEQLVQFIR 304

Query: 213 LNPLVDYVEKDSVVHSLD-ETQNNAPWGLARISHREGLNLGNFNKYLYASNSAGKGVTAY 271
           L+P+VD+VE+DS+VH+ + +TQNNAPWGLARISHR+GLNLG++NKYLY  + AG+GVTAY
Sbjct: 305 LSPIVDFVEQDSIVHANEVDTQNNAPWGLARISHRDGLNLGSYNKYLY-DDVAGEGVTAY 363

Query: 272 VVDTGISVSHLEFGERAKWGKTIPINDYDIDGNGHGTHCAGTIGSEHYGVAKGANLVAVK 331
           V+DTGI++ H EFG RA WGKTIP ND D+DGNGHGTHCAGTI S++YGVAK A +VAVK
Sbjct: 364 VIDTGINIKHKEFGGRAVWGKTIPENDQDVDGNGHGTHCAGTIASKNYGVAKNAEVVAVK 423

Query: 332 VLRSDGSGTMSDVLKGVEWVALEHTKHLEESRKDKNSNYKGATANMSLGGGKSPALDQAV 391
           VLRSDGSGTMSDVLKGVE+ A  H K L E +K     +KG+TANMSLGGGKS +LD AV
Sbjct: 424 VLRSDGSGTMSDVLKGVEYAAFSHQKALREKKK----GFKGSTANMSLGGGKSRSLDLAV 479

Query: 392 NAAVKAGVHFAVAAGNENQDACNSSPAAAENAITVGASTLSDDRAYFSNYGKCVDIFAPG 451
           +AAVK+G+HFAVAAGNENQDACNSSPAA+ENAITVGASTLSDDRAYFSN+GKCVD+FAPG
Sbjct: 480 DAAVKSGIHFAVAAGNENQDACNSSPAASENAITVGASTLSDDRAYFSNWGKCVDVFAPG 539

Query: 452 LNILSTYIGTNDATATLSGTSMASPHVAGLLTYLLSLQPDKGSEFYVPNS-ELTPLQMKK 510
           LNILSTYIG+++ATATLSGTSMASPHVAGLL+Y LS+QPD  SEF+   S  ++P Q+KK
Sbjct: 540 LNILSTYIGSDEATATLSGTSMASPHVAGLLSYFLSMQPDADSEFFSSGSNSISPAQLKK 599

Query: 511 KIIDYATKNALADLPADTPNKLIYNGGFNSTDFW----ASAAAPQSHKVKTNRYSLGSFL 566
           K+I Y+TKN   DLP  TPN L+YN G N +DFW     S+A P     +   + L   +
Sbjct: 600 KLIAYSTKNLFQDLPEKTPNLLVYNAGHNISDFWKPKSESSAEPNE---RAKEFELEDLV 656

Query: 567 DSIQDSNNHWFN-----FDNMNIF 585
           DS Q   + W N     F+ M++F
Sbjct: 657 DSAQWIADTWLNGIQQVFERMDLF 680

>KLTH0C11396g Chr3 complement(936878..938530) [1653 bp, 550 aa] {ON}
           similar to uniprot|P09232 Saccharomyces cerevisiae
           YEL060C PRB1 Vacuolar proteinase B (yscB) a serine
           protease of the subtilisin family involved in protein
           degradation in the vacuole and required for full protein
           degradation during sporulation
          Length = 550

 Score =  530 bits (1364), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 278/476 (58%), Positives = 350/476 (73%), Gaps = 32/476 (6%)

Query: 135 RYIIVFKKGVFKEQVDQHLKMMS-----ALFRRLSEEQRPAAAPGASALRD---GFDR-- 184
           RYI+VFK+ +  E+VD H +++S     ++ +  S  +   +       RD    + R  
Sbjct: 82  RYIVVFKQNLSPEEVDFHKQIVSEAHLQSVAKLESTHEFFTSTENFVEDRDFELDYQRSF 141

Query: 185 --------VMDTFEVAGAFSGYIATVASPKIVDFIRLNPLVDYVEKDSVVHSLD-ETQNN 235
                   + D+F+V+G  +GYI    + +IVDFIR+NPLVD+VE+DSVV + +  TQN 
Sbjct: 142 SAQTREGGIQDSFDVSGLLTGYIGYF-TDEIVDFIRMNPLVDFVEQDSVVFAQEFGTQNG 200

Query: 236 APWGLARISHREGLNLGNFNKYLYASNSAGKGVTAYVVDTGISVSHLEFGERAKWGKTIP 295
           APWGL+RISHRE LNLG+FNKYLY  + AGKGVT+YV+DTG++V H +F  RA WGKTIP
Sbjct: 201 APWGLSRISHREKLNLGSFNKYLY-DDDAGKGVTSYVIDTGVNVDHKDFEGRASWGKTIP 259

Query: 296 INDYDIDGNGHGTHCAGTIGSEHYGVAKGANLVAVKVLRSDGSGTMSDVLKGVEWVALEH 355
            ND D DGNGHGTHCAGTI S+HYGVAK AN+VAVKVLRS+GSG+MSDV+KGVE+ A  H
Sbjct: 260 TNDLDQDGNGHGTHCAGTIASKHYGVAKNANVVAVKVLRSNGSGSMSDVVKGVEFAAKSH 319

Query: 356 TKHLEESRKDKNSNYKGATANMSLGGGKSPALDQAVNAAVKAGVHFAVAAGNENQDACNS 415
              ++E++K     +KG+TANMSLGGGKSPALD AVNAAVKAG+HFAVAAGNENQDACNS
Sbjct: 320 QDAVKENKK----GFKGSTANMSLGGGKSPALDMAVNAAVKAGIHFAVAAGNENQDACNS 375

Query: 416 SPAAAENAITVGASTLSDDRAYFSNYGKCVDIFAPGLNILSTYIGTNDATATLSGTSMAS 475
           SPA+AENA+TVGASTL+DDRAYFSN+GKCVDIFAPGLN+LSTYIG++ ATATLSGTSMAS
Sbjct: 376 SPASAENAVTVGASTLADDRAYFSNWGKCVDIFAPGLNVLSTYIGSDTATATLSGTSMAS 435

Query: 476 PHVAGLLTYLLSLQPDKGSEFYVPNSELTPLQMKKKIIDYATKNALADLPADTPNKLIYN 535
           PHVAGLLTY LSLQPD  SE++     +TP Q+KKK+I Y+TKN L D+P DT N LI+N
Sbjct: 436 PHVAGLLTYFLSLQPDSDSEYFHAAGGITPSQLKKKLIAYSTKNVLGDIPDDTVNYLIFN 495

Query: 536 GGFNST-DFWASAAAPQSHKVKTNRYSLGSFLDSIQDSNNHWFN-----FDNMNIF 585
           GG     DFW   +     +  T    + SF+D++++  +  +      FD+MNI 
Sbjct: 496 GGGEGLDDFWGKESVVDEVE-DTISSEIESFIDALEEKTDVLYEEIREVFDHMNII 550

>Skud_5.29 Chr5 complement(39160..40986) [1827 bp, 608 aa] {ON}
           YEL060C (REAL)
          Length = 608

 Score =  531 bits (1368), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 275/446 (61%), Positives = 337/446 (75%), Gaps = 15/446 (3%)

Query: 134 DRYIIVFKKGVFKEQVDQHLK-----MMSALFRRLSEEQRPAAAPGASALRDGFDRVMDT 188
           +RYIIVFKKGV +E  D H +      + ++    +E+    +   +S        + D+
Sbjct: 154 NRYIIVFKKGVPQEATDFHKESVHQAQLQSVENLSAEDAFFISTRDSSLSTSETGGIQDS 213

Query: 189 FEVAGAFSGYIATVASPKIVDFIRLNPLVDYVEKDSVVHSLD-ETQNNAPWGLARISHRE 247
           F +   FSGYI    + +I+D IR NPLVD+VE+DSVV + D +TQN+APWGLARISHRE
Sbjct: 214 FNIDNMFSGYIGYF-TQEIIDLIRQNPLVDFVERDSVVEATDFDTQNSAPWGLARISHRE 272

Query: 248 GLNLGNFNKYLYASNSAGKGVTAYVVDTGISVSHLEFGERAKWGKTIPINDYDIDGNGHG 307
            LNLG+FNKYLY  + AG+GVT+YV+DTG++V+H +F +RA WGKTIP+ND D+DGNGHG
Sbjct: 273 RLNLGSFNKYLY-DDDAGRGVTSYVIDTGVNVNHKDFEKRAIWGKTIPLNDEDLDGNGHG 331

Query: 308 THCAGTIGSEHYGVAKGANLVAVKVLRSDGSGTMSDVLKGVEWVALEHTKHLEESRKDKN 367
           THCAGTI S+HYGVAK AN+VAVKVLRS+GSGTMSDV+KGVE+ A  H K  +E +K   
Sbjct: 332 THCAGTIASKHYGVAKNANVVAVKVLRSNGSGTMSDVVKGVEYAARAHQKQAQEKKK--- 388

Query: 368 SNYKGATANMSLGGGKSPALDQAVNAAVKAGVHFAVAAGNENQDACNSSPAAAENAITVG 427
             +KG+TANMSLGGGKSPALD AVNAAV+AG+HFAVAAGNENQDACN+SPA+A+ AITVG
Sbjct: 389 -GFKGSTANMSLGGGKSPALDLAVNAAVEAGIHFAVAAGNENQDACNTSPASADKAITVG 447

Query: 428 ASTLSDDRAYFSNYGKCVDIFAPGLNILSTYIGTNDATATLSGTSMASPHVAGLLTYLLS 487
           ASTLSDDRAYFSN+GKCVDIFAPGLNILSTYIG++DATATLSGTSMASPHVAGLLTY LS
Sbjct: 448 ASTLSDDRAYFSNWGKCVDIFAPGLNILSTYIGSDDATATLSGTSMASPHVAGLLTYFLS 507

Query: 488 LQPDKGSEFY-VPNSELTPLQMKKKIIDYATKNALADLPADTPNKLIYNGGFNS-TDFWA 545
           LQP   SEF+ +    LTP Q+K K+I Y+TK+ L D+P DTPN LIYNGG    + FW 
Sbjct: 508 LQPGSDSEFFEMGQDSLTPQQLKNKLIHYSTKDILFDVPEDTPNALIYNGGGQDLSAFWN 567

Query: 546 SAAAPQSHKVKTNRYSLGSFLDSIQD 571
                 S + K    ++  F+ S  D
Sbjct: 568 DTKKSHSSRFK-QELNMDEFIGSKTD 592

>KLLA0D00979g Chr4 (86703..88388) [1686 bp, 561 aa] {ON} similar to
           uniprot|P09232 Saccharomyces cerevisiae YEL060C PRB1
           Vacuolar proteinase B (yscB) a serine protease of the
           subtilisin family involved in protein degradation in the
           vacuole and required for full protein degradation during
           sporulation
          Length = 561

 Score =  529 bits (1363), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 282/473 (59%), Positives = 343/473 (72%), Gaps = 31/473 (6%)

Query: 134 DRYIIVFKKGVFKEQVDQHLKMMSA--------------LFRRLSEEQRPAAAPGASALR 179
           +RYIIVFKK    ++V  H +++S                F   S E        A +L 
Sbjct: 99  NRYIIVFKKDASADEVKFHQELVSVEHAKALGSLADNDPFFTATSGEHSEFGVK-AHSLE 157

Query: 180 DGFDRVMDTFEVAGAFSGYIATVASPKIVDFIRLNPLVDYVEKDSVVHSLD-ETQNNAPW 238
            G   + D+F++AG+ SGY+    + +++DFIR +PLV++VE+DS+V S    TQN+APW
Sbjct: 158 GG---IQDSFDIAGSLSGYVGYF-TKEVIDFIRRSPLVEFVEEDSMVFSNSFNTQNSAPW 213

Query: 239 GLARISHREGLNLGNFNKYLYASNSAGKGVTAYVVDTGISVSHLEFGERAKWGKTIPIND 298
           GLARISHRE LNLG+FNKYLY  + AGKGVTAYVVDTG++V+H +F  RA WGKTIP +D
Sbjct: 214 GLARISHREKLNLGSFNKYLY-DDDAGKGVTAYVVDTGVNVNHKDFDGRAVWGKTIPKDD 272

Query: 299 YDIDGNGHGTHCAGTIGSEHYGVAKGANLVAVKVLRSDGSGTMSDVLKGVEWVALEHTKH 358
            D+DGNGHGTHCAGTIGS HYGVAK A++VAVKVLRS+GSGTMSDV+KGVE+VA  H K 
Sbjct: 273 PDVDGNGHGTHCAGTIGSVHYGVAKNADIVAVKVLRSNGSGTMSDVVKGVEYVAEAHKKA 332

Query: 359 LEESRKDKNSNYKGATANMSLGGGKSPALDQAVNAAVKAGVHFAVAAGNENQDACNSSPA 418
           +EE +K     +KG+TANMSLGGGKSPALD AVNAAVKAGVHFAVAAGNENQDACN+SPA
Sbjct: 333 VEEQKK----GFKGSTANMSLGGGKSPALDLAVNAAVKAGVHFAVAAGNENQDACNTSPA 388

Query: 419 AAENAITVGASTLSDDRAYFSNYGKCVDIFAPGLNILSTYIGTNDATATLSGTSMASPHV 478
           AAENAITVGASTLSD+RAYFSN+GKCVDIF PGLNILSTYIG++ ATATLSGTSMA+PHV
Sbjct: 389 AAENAITVGASTLSDERAYFSNWGKCVDIFGPGLNILSTYIGSDTATATLSGTSMATPHV 448

Query: 479 AGLLTYLLSLQPDKGSEFYVPNSELTPLQMKKKIIDYATKNALADLPADTPNKLIYNGGF 538
            GLLTY LSLQPD  SE++     +TP Q+KKK+ID++TKN L+DLP DT N LIYNGG 
Sbjct: 449 VGLLTYFLSLQPDADSEYFHAAGGITPSQLKKKLIDFSTKNVLSDLPEDTVNYLIYNGGG 508

Query: 539 NST-DFWASAAAPQSHKVKTNRYSLGSFLDSIQDSNNHWFN-----FDNMNIF 585
               D W    +          +SL S ++S+    +  F+      D  NI 
Sbjct: 509 QDLDDLWGKDYSIGKEPSANPEFSLESLINSLDSKTDAIFDDVRQLLDQFNII 561

>Suva_5.7 Chr5 complement(15849..17843) [1995 bp, 664 aa] {ON}
           YEL060C (REAL)
          Length = 664

 Score =  530 bits (1366), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 280/455 (61%), Positives = 333/455 (73%), Gaps = 32/455 (7%)

Query: 134 DRYIIVFKKGVFKEQVDQHLKMMSALFRRLSEEQRPAAAPGASALRDGF----------- 182
           +RYIIVFKK V  E+         A F R + +Q    +    A  D F           
Sbjct: 209 NRYIIVFKKDVPPEE---------AAFHRETVQQAQLQSVENLAAEDAFFISTRDAALSS 259

Query: 183 ---DRVMDTFEVAGAFSGYIATVASPKIVDFIRLNPLVDYVEKDSVVHSLD-ETQNNAPW 238
                + D+F +   FSGYI    + +IVD IR NPLVD+VEKDSVV + D +TQN+APW
Sbjct: 260 SEAGGIQDSFNIDSLFSGYIGYF-TQEIVDLIRQNPLVDFVEKDSVVEATDFDTQNSAPW 318

Query: 239 GLARISHREGLNLGNFNKYLYASNSAGKGVTAYVVDTGISVSHLEFGERAKWGKTIPIND 298
           GLAR+SHRE LNLG+FNKYLY  + AG+GVT+YV+DTG++V+H +F +RA WGKTIP+ND
Sbjct: 319 GLARVSHRERLNLGSFNKYLY-DDDAGRGVTSYVIDTGVNVNHKDFEKRAIWGKTIPLND 377

Query: 299 YDIDGNGHGTHCAGTIGSEHYGVAKGANLVAVKVLRSDGSGTMSDVLKGVEWVALEHTKH 358
            D+DGNGHGTHCAGTI S+HYGVAK AN+VAVKVLRS+GSGTMSDVLKGVE+ A  H K 
Sbjct: 378 EDLDGNGHGTHCAGTIASKHYGVAKNANVVAVKVLRSNGSGTMSDVLKGVEYAAKAHQKQ 437

Query: 359 LEESRKDKNSNYKGATANMSLGGGKSPALDQAVNAAVKAGVHFAVAAGNENQDACNSSPA 418
            EE +K     +KG+TANMSLGGGKSPALD AVNAAV+AG+HFAVAAGNENQDACN+SPA
Sbjct: 438 AEEKKK----GFKGSTANMSLGGGKSPALDLAVNAAVEAGIHFAVAAGNENQDACNTSPA 493

Query: 419 AAENAITVGASTLSDDRAYFSNYGKCVDIFAPGLNILSTYIGTNDATATLSGTSMASPHV 478
           +A+ AITVGASTLSDDRAYFSNYGKCVD+FAPGLNILSTYIG+++ATATLSGTSMASPHV
Sbjct: 494 SADKAITVGASTLSDDRAYFSNYGKCVDVFAPGLNILSTYIGSDEATATLSGTSMASPHV 553

Query: 479 AGLLTYLLSLQPDKGSEFY-VPNSELTPLQMKKKIIDYATKNALADLPADTPNKLIYNGG 537
           AGLLTY LSLQP   SEF+ +    LTP Q+KKK+I Y+TK+ L D+P DTPN LIYNGG
Sbjct: 554 AGLLTYFLSLQPGSDSEFFEMGQDSLTPQQLKKKLIHYSTKDILFDIPDDTPNALIYNGG 613

Query: 538 FNS-TDFWASAAAPQSHKVKTNRYSLGSFLDSIQD 571
               + FW       S        +L  F+ S  D
Sbjct: 614 GQDLSAFWNDTKKSHSSSGFKQELNLDEFIGSKTD 648

>Smik_5.27 Chr5 complement(42408..44234) [1827 bp, 608 aa] {ON}
           YEL060C (REAL)
          Length = 608

 Score =  528 bits (1360), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 269/420 (64%), Positives = 332/420 (79%), Gaps = 16/420 (3%)

Query: 134 DRYIIVFKKGVFKEQVDQHLKMMSALFRRLSEEQRPAAAPGASALRDGF------DRVMD 187
           +RYI+VFKKGV +E+V+ H + +    +  S E   A     ++ RD +        + D
Sbjct: 154 NRYIVVFKKGVPEEEVNFHKESVHQA-QLQSVENLSAEDAFFTSTRDTYLSTSEAGGIQD 212

Query: 188 TFEVAGAFSGYIATVASPKIVDFIRLNPLVDYVEKDSVVHSLD-ETQNNAPWGLARISHR 246
           +F +   FSGYI    + +I+D IR NPLVD+VE+DSVV + + +TQN+APWGLARISHR
Sbjct: 213 SFNIDNIFSGYIGYF-TQEIIDLIRQNPLVDFVERDSVVEATEFDTQNSAPWGLARISHR 271

Query: 247 EGLNLGNFNKYLYASNSAGKGVTAYVVDTGISVSHLEFGERAKWGKTIPINDYDIDGNGH 306
           E LNLG+FNKYLY  + AG+GVT+YV+DTG++++H +F +RA WGKTIP+ND D+DGNGH
Sbjct: 272 ERLNLGSFNKYLY-DDDAGRGVTSYVIDTGVNINHKDFEKRAIWGKTIPLNDEDLDGNGH 330

Query: 307 GTHCAGTIGSEHYGVAKGANLVAVKVLRSDGSGTMSDVLKGVEWVALEHTKHLEESRKDK 366
           GTHCAGTI S+HYGVAK AN+VAVKVLRS+GSGTMSDV+KGVE+ A  H K  +E +K  
Sbjct: 331 GTHCAGTIASKHYGVAKNANVVAVKVLRSNGSGTMSDVVKGVEYAAKAHQKQAQEKKK-- 388

Query: 367 NSNYKGATANMSLGGGKSPALDQAVNAAVKAGVHFAVAAGNENQDACNSSPAAAENAITV 426
              +KG+TANMSLGGGKSPALD AVNAAV+AG+HFAVAAGNENQDACN+SPA+A+ AITV
Sbjct: 389 --GFKGSTANMSLGGGKSPALDLAVNAAVEAGIHFAVAAGNENQDACNTSPASADKAITV 446

Query: 427 GASTLSDDRAYFSNYGKCVDIFAPGLNILSTYIGTNDATATLSGTSMASPHVAGLLTYLL 486
           GASTLSDDRAYFSN+GKCVD+FAPGLNILSTYIG+++ATATLSGTSMASPHVAGLLTY L
Sbjct: 447 GASTLSDDRAYFSNWGKCVDVFAPGLNILSTYIGSDEATATLSGTSMASPHVAGLLTYFL 506

Query: 487 SLQPDKGSEFY-VPNSELTPLQMKKKIIDYATKNALADLPADTPNKLIYNGGFNS-TDFW 544
           SLQP   SEF+ +    LTP Q+KKK+I Y+TK+ L D+P DTPN LIYNGG    + FW
Sbjct: 507 SLQPGSDSEFFELGQDSLTPQQLKKKLIHYSTKDILFDIPEDTPNFLIYNGGGQDLSAFW 566

>SAKL0E01012g Chr5 (75498..77132) [1635 bp, 544 aa] {ON} similar to
           uniprot|P09232 Saccharomyces cerevisiae YEL060C PRB1
           Vacuolar proteinase B (yscB) a serine protease of the
           subtilisin family involved in protein degradation in the
           vacuole and required for full protein degradation during
           sporulation
          Length = 544

 Score =  523 bits (1346), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 275/471 (58%), Positives = 343/471 (72%), Gaps = 27/471 (5%)

Query: 135 RYIIVFKKGVFKEQVDQHLKMMS-----ALFRRLSEEQRPAAAPGAS-----ALRDGFDR 184
           RYIIVFKK    E++  H +++S     ++ +  S++   AA  G++     A +     
Sbjct: 81  RYIIVFKKDATPEEISFHKEIISEAHAESVAKLDSKDSFFAATKGSADEYGIAAKSSEGG 140

Query: 185 VMDTFEVAGAFSGYIATVASPKIVDFIRLNPLVDYVEKDSVVHSLD-ETQNNAPWGLARI 243
           + ++F++A   +GYI    + ++VDFIR+N  V+++EKDS+V + + +TQN APWGL+RI
Sbjct: 141 IQESFDIANMLNGYIGYF-TDEVVDFIRMNQWVEFIEKDSLVFASEFDTQNGAPWGLSRI 199

Query: 244 SHREGLNLGNFNKYLYASNSAGKGVTAYVVDTGISVSHLEFGERAKWGKTIPINDYDIDG 303
           SHRE LNLG+FNKYLY  + AGKGVT+YV+DTGI+V+H +F  RA WGKT+P ND D DG
Sbjct: 200 SHRERLNLGSFNKYLY-DDDAGKGVTSYVIDTGINVNHKDFNGRAVWGKTVPQNDEDADG 258

Query: 304 NGHGTHCAGTIGSEHYGVAKGANLVAVKVLRSDGSGTMSDVLKGVEWVALEHTKHLEESR 363
           NGHGTHCAGTI SEHYGVAK A +VA+KVLRS+GSGTMSDV+KGVE+ A  H    +E+ 
Sbjct: 259 NGHGTHCAGTIASEHYGVAKNAEVVAIKVLRSNGSGTMSDVVKGVEFAAQSH----QEAS 314

Query: 364 KDKNSNYKGATANMSLGGGKSPALDQAVNAAVKAGVHFAVAAGNENQDACNSSPAAAENA 423
           K     +KG+TANMSLGGGKSPALD AVNAAVKAG+HFAVAAGNENQDACN+SPAAAENA
Sbjct: 315 KKNKKGFKGSTANMSLGGGKSPALDLAVNAAVKAGIHFAVAAGNENQDACNTSPAAAENA 374

Query: 424 ITVGASTLSDDRAYFSNYGKCVDIFAPGLNILSTYIGTNDATATLSGTSMASPHVAGLLT 483
           ITVGASTLSDDRAYFSN+GKCVDIFAPGLN+LSTYIG+  ATATLSGTSMASPHVAGLLT
Sbjct: 375 ITVGASTLSDDRAYFSNWGKCVDIFAPGLNVLSTYIGSETATATLSGTSMASPHVAGLLT 434

Query: 484 YLLSLQPDKGSEFYVPNSELTPLQMKKKIIDYATKNALADLPADTPNKLIYNGGFNS-TD 542
           Y LSLQPD  SEF+   S +TP Q+KKK+I Y+TK+ L +LP DTPN LIYNGG    +D
Sbjct: 435 YFLSLQPDSDSEFF-QASGITPAQLKKKLIAYSTKDVLYELPEDTPNYLIYNGGGQDLSD 493

Query: 543 FWASAAAPQSHKVKTN---RYSLGSFLDSIQDSNNHWFN-----FDNMNIF 585
           FW  +      +        + L   ++S     +  F      FD +NI 
Sbjct: 494 FWGKSEEQVKEEGSIQDFKDFKLSELIESFDTKTDLLFEEVRSVFDKLNII 544

>NCAS0F00220 Chr6 (32791..34878) [2088 bp, 695 aa] {ON} Anc_6.14
           YEL060C
          Length = 695

 Score =  528 bits (1359), Expect = e-180,   Method: Compositional matrix adjust.
 Identities = 271/429 (63%), Positives = 331/429 (77%), Gaps = 13/429 (3%)

Query: 134 DRYIIVFKKGVFKEQVDQHLKMMSAL-FRRLSEEQRPAAAPGASALRD---GFDRVMDTF 189
           +RYI+VFKK +  E+VD H ++++ +     ++  +      ASA+ D       ++ TF
Sbjct: 101 NRYIVVFKKSILPEEVDFHKELINQIQLESAAKLPKDDKFFSASAIEDESINQGGILTTF 160

Query: 190 EVAGAFSGYIATVASPKIVDFIRLNPLVDYVEKDSVVHSLD-ETQNNAPWGLARISHREG 248
            ++   +GY+      ++++ IR+NPLV+YVEKDS+V + + + QNNAPWGLARISHRE 
Sbjct: 161 NISNLLNGYVGYFTD-EVLELIRMNPLVEYVEKDSLVQATEFDNQNNAPWGLARISHRER 219

Query: 249 LNLGNFNKYLYASNSAGKGVTAYVVDTGISVSHLEFGERAKWGKTIPINDYDIDGNGHGT 308
           LNLG+FNKYLY  + AGKGVT YV+DTGI+  H +F +RA WGKTIP+ND DIDGNGHGT
Sbjct: 220 LNLGSFNKYLY-DDDAGKGVTCYVIDTGINTEHNDFNKRAVWGKTIPLNDKDIDGNGHGT 278

Query: 309 HCAGTIGSEHYGVAKGANLVAVKVLRSDGSGTMSDVLKGVEWVALEHTKHLEESRKDKNS 368
           HCAGTI S HYGVAK A +VAVKVLRS+GSG+MSDV+KGVE+ A  H K    + K+K  
Sbjct: 279 HCAGTIASTHYGVAKNAEVVAVKVLRSNGSGSMSDVIKGVEFAAESHIK----AAKEKKK 334

Query: 369 NYKGATANMSLGGGKSPALDQAVNAAVKAGVHFAVAAGNENQDACNSSPAAAENAITVGA 428
            +KG+TANMSLGGGKSP LD AVNAAV AG+HFAVAAGNENQDACN+SPA+AE AITVGA
Sbjct: 335 GFKGSTANMSLGGGKSPTLDLAVNAAVDAGIHFAVAAGNENQDACNTSPASAERAITVGA 394

Query: 429 STLSDDRAYFSNYGKCVDIFAPGLNILSTYIGTNDATATLSGTSMASPHVAGLLTYLLSL 488
           STLSDDRAYFSN+GKCVDIFAPGLNILSTYIG +DATATLSGTSMASPHVAGLLTY LSL
Sbjct: 395 STLSDDRAYFSNWGKCVDIFAPGLNILSTYIGDDDATATLSGTSMASPHVAGLLTYFLSL 454

Query: 489 QPDKGSEFYVPNSELTPLQMKKKIIDYATKNALADLPADTPNKLIYNG-GFNSTDFWASA 547
           QP   SEF+ P +ELTP QMKKK+I+Y++K+ L DLP  TPNKLI+NG G N  D W   
Sbjct: 455 QPGSDSEFFDP-TELTPAQMKKKLINYSSKDVLFDLPEGTPNKLIFNGAGGNLDDLWNKK 513

Query: 548 AAPQSHKVK 556
           +  +  KVK
Sbjct: 514 SQEEDIKVK 522

>YEL060C Chr5 complement(40046..41953) [1908 bp, 635 aa] {ON}
           PRB1Vacuolar proteinase B (yscB), a serine protease of
           the subtilisin family; involved in protein degradation
           in the vacuole and required for full protein degradation
           during sporulation; activity inhibited by Pbi2p
          Length = 635

 Score =  526 bits (1354), Expect = e-180,   Method: Compositional matrix adjust.
 Identities = 270/446 (60%), Positives = 336/446 (75%), Gaps = 15/446 (3%)

Query: 134 DRYIIVFKKGVFKEQVDQHLK-----MMSALFRRLSEEQRPAAAPGASALRDGFDRVMDT 188
           +RYIIVFK+G  +E++D H +      + ++    +E+    +    S        + D+
Sbjct: 181 NRYIIVFKRGAPQEEIDFHKENVQQAQLQSVENLSAEDAFFISTKDTSLSTSEAGGIQDS 240

Query: 189 FEVAGAFSGYIATVASPKIVDFIRLNPLVDYVEKDSVVHSLD-ETQNNAPWGLARISHRE 247
           F +   FSGYI    + +IVD IR NPLVD+VE+DS+V + + +TQN+APWGLARISHRE
Sbjct: 241 FNIDNLFSGYIGYF-TQEIVDLIRQNPLVDFVERDSIVEATEFDTQNSAPWGLARISHRE 299

Query: 248 GLNLGNFNKYLYASNSAGKGVTAYVVDTGISVSHLEFGERAKWGKTIPINDYDIDGNGHG 307
            LNLG+FNKYLY  + AG+GVT+YV+DTG++++H +F +RA WGKTIP+ND D+DGNGHG
Sbjct: 300 RLNLGSFNKYLY-DDDAGRGVTSYVIDTGVNINHKDFEKRAIWGKTIPLNDEDLDGNGHG 358

Query: 308 THCAGTIGSEHYGVAKGANLVAVKVLRSDGSGTMSDVLKGVEWVALEHTKHLEESRKDKN 367
           THCAGTI S+HYGVAK AN+VAVKVLRS+GSGTMSDV+KGVE+ A  H K  +E +K   
Sbjct: 359 THCAGTIASKHYGVAKNANVVAVKVLRSNGSGTMSDVVKGVEYAAKAHQKEAQEKKK--- 415

Query: 368 SNYKGATANMSLGGGKSPALDQAVNAAVKAGVHFAVAAGNENQDACNSSPAAAENAITVG 427
             +KG+TANMSLGGGKSPALD AVNAAV+ G+HFAVAAGNENQDACN+SPA+A+ AITVG
Sbjct: 416 -GFKGSTANMSLGGGKSPALDLAVNAAVEVGIHFAVAAGNENQDACNTSPASADKAITVG 474

Query: 428 ASTLSDDRAYFSNYGKCVDIFAPGLNILSTYIGTNDATATLSGTSMASPHVAGLLTYLLS 487
           ASTLSDDRAYFSN+GKCVD+FAPGLNILSTYIG++DATATLSGTSMASPHVAGLLTY LS
Sbjct: 475 ASTLSDDRAYFSNWGKCVDVFAPGLNILSTYIGSDDATATLSGTSMASPHVAGLLTYFLS 534

Query: 488 LQPDKGSEFY-VPNSELTPLQMKKKIIDYATKNALADLPADTPNKLIYNGGFNS-TDFWA 545
           LQP   SEF+ +    LTP Q+KKK+I Y+TK+ L D+P DTPN LIYNGG    + FW 
Sbjct: 535 LQPGSDSEFFELGQDSLTPQQLKKKLIHYSTKDILFDIPEDTPNVLIYNGGGQDLSAFWN 594

Query: 546 SAAAPQSHKVKTNRYSLGSFLDSIQD 571
                 S   K    ++  F+ S  D
Sbjct: 595 DTKKSHSSGFK-QELNMDEFIGSKTD 619

>KAFR0L00360 Chr12 (64781..66289) [1509 bp, 502 aa] {ON} Anc_6.14
           YOR003W
          Length = 502

 Score =  519 bits (1336), Expect = e-180,   Method: Compositional matrix adjust.
 Identities = 275/465 (59%), Positives = 340/465 (73%), Gaps = 26/465 (5%)

Query: 120 LAALHDNGVGTADHDRYIIVFKKGVFKEQVDQHLKMMSALFRRLSEE---------QRPA 170
           LA +H+         RYIIVFK GV KEQ+  H ++++ L  + S           Q   
Sbjct: 46  LAPVHNADAENIIPHRYIIVFKDGVSKEQIQFHKELITTLHLQQSSAFSNDFTEYLQTDI 105

Query: 171 AAPGASALRDGFDRVMDTFEVAGAFSGYIATVASPKIVDFIRLNPLVDYVEKDSVVHSLD 230
             P   ++R     ++  F+++   SGYIA + S +++ FIRLNPL+ ++E D++VH+ D
Sbjct: 106 NVP--ESMRQSLGGIVSDFDISSLLSGYIAYL-SDELLHFIRLNPLIAFIEHDTMVHTTD 162

Query: 231 -ETQNNAPWGLARISHREGLNLGNFNKYLYASNSAGKGVTAYVVDTGISVSHLEFGERAK 289
             TQNNAPWGLARISHRE LNL NFNKYLY  + AGK V AYV+DTG+ V+H+EF  RA 
Sbjct: 163 FNTQNNAPWGLARISHRESLNLANFNKYLY-DDDAGKNVDAYVIDTGVDVNHVEFHSRAH 221

Query: 290 WGKTIPINDYDIDGNGHGTHCAGTIGSEHYGVAKGANLVAVKVLRSDGSGTMSDVLKGVE 349
           WGKTIP+ND DIDGNGHGTH AGTIGS+HYGVAK  N++AVKVLRS+GSG+MSDV+KGVE
Sbjct: 222 WGKTIPLNDQDIDGNGHGTHVAGTIGSQHYGVAKSVNIIAVKVLRSNGSGSMSDVVKGVE 281

Query: 350 WVALEHTKHLEESRKDKNSNYKGATANMSLGGGKSPALDQAVNAAVKAGVHFAVAAGNEN 409
           +     + HLE  + +KN   KG+ ANMSLGGGKSPALD AVNAAVKAG+HFAVAAGNEN
Sbjct: 282 FAV---SSHLERMKNEKN--LKGSVANMSLGGGKSPALDLAVNAAVKAGIHFAVAAGNEN 336

Query: 410 QDACNSSPAAAENAITVGASTLSDDRAYFSNYGKCVDIFAPGLNILSTYIGTN-DATATL 468
           Q+ACNSSPA+AE A+TVGAST+SD+RAYFSN+G+CVDIFAPGLNILSTYIG N D TATL
Sbjct: 337 QNACNSSPASAEQAVTVGASTISDERAYFSNWGECVDIFAPGLNILSTYIGANDDVTATL 396

Query: 469 SGTSMASPHVAGLLTYLLSLQPDKGSEFYVPNSELTPLQMKKKIIDYATKNALADLPADT 528
           SGTSMASPHVAGLL Y LSLQP+K SEF      ++  Q+KKK+I+YATK+ L DLP  T
Sbjct: 397 SGTSMASPHVAGLLAYYLSLQPEKSSEF--STRAISTSQLKKKLIEYATKDVLEDLPEGT 454

Query: 529 PNKLIYNGGFNS-TDFW--ASAAAPQSHKVKTNRYS-LGSFLDSI 569
           PN LIYNGG    +DFW   ++  P S+ +  N +S L +  D +
Sbjct: 455 PNVLIYNGGGQDLSDFWNLQNSKIPGSNYIGYNYFSKLKTLFDDL 499

>KNAG0E00920 Chr5 complement(174432..176027) [1596 bp, 531 aa] {ON}
           Anc_6.14 YOR003W
          Length = 531

 Score =  515 bits (1326), Expect = e-178,   Method: Compositional matrix adjust.
 Identities = 271/488 (55%), Positives = 352/488 (72%), Gaps = 34/488 (6%)

Query: 109 QHASPASRGLELAALHDNGVGTADH----DRYIIVFKKGVFKEQVDQHLKMMSALFRRLS 164
           +H   A    ELA L+  G   +      ++YII+FK+GV  EQ+  H +++  +    S
Sbjct: 67  KHGKEAHDEEELAPLYTPGSALSASSSRSNKYIILFKEGVTAEQISAHKQLLQQVLLETS 126

Query: 165 EEQRPAAAPGASALRDGFDRVMDTFEVAGAFSGYIATVASPKIVDFIRLNPLVDYVEKDS 224
           +     +A G  A       V+D+F++ G  SGY+A + SP +++ +R +P V  VE+DS
Sbjct: 127 D----VSAQGIVA------DVLDSFDLEGVLSGYVAEL-SPMVLELVRRSPFVQLVEQDS 175

Query: 225 VVHSLD-ETQNNAPWGLARISHREGLNLGNFNKYLYASNSAGKGVTAYVVDTGISVSHLE 283
            VH+ + +TQNNAPWGLARISHR+ L+LG+FNKYLY  ++AG+GV +Y++DTGI+V H E
Sbjct: 176 EVHTNEFDTQNNAPWGLARISHRDPLSLGSFNKYLY-DDAAGEGVDSYIIDTGINVKHKE 234

Query: 284 FGERAKWGKTIPINDYDIDGNGHGTHCAGTIGSEHYGVAKGANLVAVKVLRSDGSGTMSD 343
           F  RA+WGKTIP ND+D DGNGHGTHCAGTI S+HYGVAK AN++AVKVLRS+GSG+MSD
Sbjct: 235 FEGRAQWGKTIPDNDFDEDGNGHGTHCAGTIASKHYGVAKRANVIAVKVLRSNGSGSMSD 294

Query: 344 VLKGVEWVALEHTKHLEESRKDKNSNYKGATANMSLGGGKSPALDQAVNAAVKAGVHFAV 403
           V+ GVE+ A +H        K  +  +KG+TANMSLGGGKSP+LD+ V+AAVK G+HF+V
Sbjct: 295 VIMGVEFAAKQHAS----KAKSNDKKFKGSTANMSLGGGKSPSLDRVVDAAVKLGLHFSV 350

Query: 404 AAGNENQDACNSSPAAAENAITVGASTLSDDRAYFSNYGKCVDIFAPGLNILSTYIGTND 463
           AAGNENQDACN+SPAA+E AITVGASTLSDDRAYFSN+G CVDIFAPGLNILSTY G++D
Sbjct: 351 AAGNENQDACNTSPAASERAITVGASTLSDDRAYFSNWGSCVDIFAPGLNILSTYTGSDD 410

Query: 464 ATATLSGTSMASPHVAGLLTYLLSLQPDKGSEFYVPNSELTPLQMKKKIIDYATKNALAD 523
           ATATLSGTSMASPHVAGLLTY LSLQP+K S+F   ++++TP Q+KKK++DY+TK  L D
Sbjct: 411 ATATLSGTSMASPHVAGLLTYFLSLQPEKSSQFGT-SAQITPEQLKKKLLDYSTKGVLFD 469

Query: 524 LPADTPNKLIYN-GGFNSTDFWASAAAPQSHKVKTNRYSLGSFLDSIQDSNNHWFN---- 578
           LP DTPN LIYN GG + +DFW          +  + Y      D++  S++  F     
Sbjct: 470 LPEDTPNALIYNGGGADLSDFWGDKGKKSHKPLFAHEY------DNVWASSDAMFEQVRA 523

Query: 579 -FDNMNIF 585
            F  +NIF
Sbjct: 524 MFGKLNIF 531

>TDEL0G04550 Chr7 complement(829468..831162) [1695 bp, 564 aa] {ON}
           Anc_6.14 YOR003W
          Length = 564

 Score =  514 bits (1323), Expect = e-177,   Method: Compositional matrix adjust.
 Identities = 266/414 (64%), Positives = 324/414 (78%), Gaps = 12/414 (2%)

Query: 135 RYIIVFKKGVFKEQVDQHLKMMS-ALFRRLSEEQRPAAAPGASALRDGFDRVMDTFEVAG 193
           RYI+V K     E++  H++ ++ +  + + E  +      A  +R     + D+F+VAG
Sbjct: 114 RYIVVLKHSS-PEEIALHMEAITQSQLQSVGELAQDDPFFSAQGVRT-TGGIQDSFDVAG 171

Query: 194 AFSGYIATVASPKIVDFIRLNPLVDYVEKDSVVHSLD-ETQNNAPWGLARISHREGLNLG 252
             +GY+       +V+ IR +P+VD+VE DS VH+ + +TQN APWGL+RISHRE LNLG
Sbjct: 172 LLNGYVGYFTD-AVVELIRKSPMVDFVEMDSPVHASEFDTQNGAPWGLSRISHRERLNLG 230

Query: 253 NFNKYLYASNSAGKGVTAYVVDTGISVSHLEFGERAKWGKTIPINDYDIDGNGHGTHCAG 312
           +FNKYL+  + AGKGVT+YV+DTGI+V H +F  RA WGKTIP ND D+DGNGHGTHCAG
Sbjct: 231 SFNKYLF-DDEAGKGVTSYVIDTGINVKHQDFEGRAHWGKTIPTNDEDLDGNGHGTHCAG 289

Query: 313 TIGSEHYGVAKGANLVAVKVLRSDGSGTMSDVLKGVEWVALEHTKHLEESRKDKNSNYKG 372
           TI S+HYGVAKGA++VAVKVLRS+GSG+MSDV+KGVE+ A  H K +    KDK   +KG
Sbjct: 290 TIASKHYGVAKGADVVAVKVLRSNGSGSMSDVIKGVEFAAQSHQKAV----KDKKKGFKG 345

Query: 373 ATANMSLGGGKSPALDQAVNAAVKAGVHFAVAAGNENQDACNSSPAAAENAITVGASTLS 432
           +TANMSLGGGKSPALD AVNAAVKAG+HFAVAAGNENQDACN+SPAAAE A+TVGASTLS
Sbjct: 346 STANMSLGGGKSPALDLAVNAAVKAGIHFAVAAGNENQDACNTSPAAAEQAVTVGASTLS 405

Query: 433 DDRAYFSNYGKCVDIFAPGLNILSTYIGTNDATATLSGTSMASPHVAGLLTYLLSLQPDK 492
           DDRAYFSNYGKCVDIFAPGLNILSTYIG++DATATLSGTSMASPHVAGLLTY LSLQPD 
Sbjct: 406 DDRAYFSNYGKCVDIFAPGLNILSTYIGSDDATATLSGTSMASPHVAGLLTYFLSLQPDS 465

Query: 493 GSEFYVPNSE-LTPLQMKKKIIDYATKNALADLPADTPNKLIYNGGFNSTD-FW 544
            S+F+   S+ +TP Q+KKK+I Y+TK+ L DLP DTPN LIYNGG +    FW
Sbjct: 466 DSDFFDAGSQGVTPEQLKKKLIAYSTKDILYDLPEDTPNALIYNGGGHGLKGFW 519

>CAGL0B03619g Chr2 (361572..362978) [1407 bp, 468 aa] {ON} similar
           to uniprot|P09232 Saccharomyces cerevisiae YEL060c PRB1
           protease B or uniprot|P25036 Saccharomyces cerevisiae
           YOR003w YSP3
          Length = 468

 Score =  510 bits (1314), Expect = e-177,   Method: Compositional matrix adjust.
 Identities = 281/445 (63%), Positives = 332/445 (74%), Gaps = 19/445 (4%)

Query: 135 RYIIVFKKGVFKEQVDQHLKMMSAL----FRRLSEEQRPAAAPGASALRDGFDRVMDTFE 190
           +YI+V KKGV  E V   L  +SA      R L +E        A  L  G   + D F 
Sbjct: 5   KYIVVLKKGVSPEAVATFLNDVSAAHAAAIRDLPKEHDFFNFVNAEGLPRG--GIKDLFN 62

Query: 191 VAGAFSGYIATVASPKIVDFIRLNPLVDYVEKDSVVHSLD-ETQNNAPWGLARISHREGL 249
           +   F G I     P +V  +  + +V++VE+DSVVH+ + +TQNNAPWGLARISHR+ L
Sbjct: 63  INDLFQGLIGYFPEP-VVKLLEKSDIVEFVERDSVVHASNFDTQNNAPWGLARISHRDRL 121

Query: 250 NLGNFNKYLYASNSAGKGVTAYVVDTGISVSHLEFGERAKWGKTIPINDYDIDGNGHGTH 309
           NLGNFNKYLY  N+ G+GVTAYV+DTGI+V H+EF  RA+WGKTIP+ND DIDGNGHGTH
Sbjct: 122 NLGNFNKYLY-DNAGGEGVTAYVIDTGINVKHVEFDGRAQWGKTIPLNDLDIDGNGHGTH 180

Query: 310 CAGTIGSEHYGVAKGANLVAVKVLRSDGSGTMSDVLKGVEWVALEHTKHLEESRKDKNSN 369
           CAGTI S+HYG+AK AN+VAVKVL+SDGSGTMSDV+KGVE+ A     HL+ES+ +K   
Sbjct: 181 CAGTIASKHYGIAKKANVVAVKVLKSDGSGTMSDVIKGVEYAA---QAHLKESKNNKK-- 235

Query: 370 YKGATANMSLGGGKSPALDQAVNAAVKAGVHFAVAAGNENQDACNSSPAAAENAITVGAS 429
           +KG+TANMSLGGGKSPALD AVNAAV AG+HFAVAAGNENQDACN+SPA+AE AITVGAS
Sbjct: 236 FKGSTANMSLGGGKSPALDMAVNAAVSAGIHFAVAAGNENQDACNTSPASAEKAITVGAS 295

Query: 430 TLSDDRAYFSNYGKCVDIFAPGLNILSTYIG-TNDATATLSGTSMASPHVAGLLTYLLSL 488
           TLSDDRAYFSN+GKCVDIFAPGLNILSTYIG TN  TA+LSGTSMASPHVAGLLTY LSL
Sbjct: 296 TLSDDRAYFSNWGKCVDIFAPGLNILSTYIGDTNRETASLSGTSMASPHVAGLLTYFLSL 355

Query: 489 QPDKGSEFYVPNSE-LTPLQMKKKIIDYATKNALADLP-ADTPNKLIYNG-GFNSTDFWA 545
           QPD  SEFY  +   +TP Q+KKK+I Y+TKN L DLP  D+PN LIYNG G +   FW 
Sbjct: 356 QPDSDSEFYDASKHGVTPAQLKKKLIAYSTKNVLTDLPDPDSPNLLIYNGAGGDLGVFWN 415

Query: 546 SAAA-PQSHKVKTNRYSLGSFLDSI 569
           S +A  QS +    R +    LDS+
Sbjct: 416 STSADEQSAEHPEQRIAAELGLDSL 440

>TBLA0A07300 Chr1 complement(1815683..1817404) [1722 bp, 573 aa]
           {ON} Anc_6.14 YOR003W
          Length = 573

 Score =  511 bits (1317), Expect = e-176,   Method: Compositional matrix adjust.
 Identities = 275/465 (59%), Positives = 346/465 (74%), Gaps = 19/465 (4%)

Query: 110 HASPASRGLELAALHDNGVGTADHDRYIIVFKKGVFKEQVDQHLKMMSALFRRLSEEQRP 169
           + SPA   L   +LH   +      RYII FKK V  E++D H + ++ L ++ S  Q P
Sbjct: 106 YESPAIAPLYSQSLHPQNIIP---HRYIITFKKDVAPEEIDFHQQSINEL-QQQSIAQLP 161

Query: 170 AAAPGASALRDGFDR---VMDTFEVAGAFSGYIATVASPKIVDFIRLNPLVDYVEKDSVV 226
              P  +++ +G D    ++D+F +     GYI    +  ++DFIRLNPLV +VE+DS V
Sbjct: 162 HDHPYFNSV-EGLDLQQPIIDSFNINSLLQGYIGYF-TDDVIDFIRLNPLVQFVEQDSTV 219

Query: 227 HSLD-ETQNNAPWGLARISHREGLNLGNFNKYLYASNSAGKGVTAYVVDTGISVSHLEFG 285
           +  + +TQN APWGLARISHRE LNLG+FNKYL+  + AG+GVTAYV+DTG++V H +F 
Sbjct: 220 NINEFDTQNGAPWGLARISHRERLNLGSFNKYLF-DDKAGEGVTAYVIDTGVNVEHNDFE 278

Query: 286 ERAKWGKTIPINDYDIDGNGHGTHCAGTIGSEHYGVAKGANLVAVKVLRSDGSGTMSDVL 345
            RA WGKTIP ND D+DGNGHGTHCAGTI S+HYGVAK AN+VAVKVLRS+GSG+MSDVL
Sbjct: 279 GRASWGKTIPNNDEDLDGNGHGTHCAGTIASKHYGVAKNANVVAVKVLRSNGSGSMSDVL 338

Query: 346 KGVEWVALEHTKHLEESRKDKNSNYKGATANMSLGGGKSPALDQAVNAAVKAGVHFAVAA 405
           KGVE+    H   +    K+K S +KG+TANMSLGGGKSP+LD AVNAAVKAG+HFAVAA
Sbjct: 339 KGVEYATASHLADV----KNKKSGFKGSTANMSLGGGKSPSLDLAVNAAVKAGIHFAVAA 394

Query: 406 GNENQDACNSSPAAAENAITVGASTLSDDRAYFSNYGKCVDIFAPGLNILSTYIGTNDAT 465
           GNENQDACN+SPA+A+ AITVGASTLSDDRAYFSN+GKCVD+FAPGLNILSTYIG++DAT
Sbjct: 395 GNENQDACNTSPASAKYAITVGASTLSDDRAYFSNWGKCVDVFAPGLNILSTYIGSDDAT 454

Query: 466 ATLSGTSMASPHVAGLLTYLLSLQPDKGSEFYVPNS-ELTPLQMKKKIIDYATKNALADL 524
           ATLSGTSMASPHVAGLL+Y LSLQP++ SEF       +TP Q+KK++I Y TK+ L D+
Sbjct: 455 ATLSGTSMASPHVAGLLSYFLSLQPEQDSEFATSRKGGITPAQLKKRLISYGTKDILLDI 514

Query: 525 PADTPNKLIYNG-GFNSTDFW--ASAAAPQSHKVKTNRYSLGSFL 566
           P  TPN L++NG G + +DFW  +  A  +S++V  N   +G  L
Sbjct: 515 PELTPNVLVFNGAGQDLSDFWNISKPADLESNEVYKNLDLVGDVL 559

>NDAI0K02880 Chr11 complement(651446..653560) [2115 bp, 704 aa] {ON}
           Anc_6.14
          Length = 704

 Score =  508 bits (1308), Expect = e-173,   Method: Compositional matrix adjust.
 Identities = 271/467 (58%), Positives = 346/467 (74%), Gaps = 24/467 (5%)

Query: 134 DRYIIVFKKGVFKEQVDQHLKMMSALFRRLSEEQRP-------AAAPGASALRDGFDRVM 186
           ++YIIVFK  +  +++  H +++S + ++ +    P        +     + R+G   ++
Sbjct: 241 NKYIIVFKDSINIDEISYHKELISEIQQQSASRLPPHHHFFHSTSEEEEESFRNG--GII 298

Query: 187 DTFEVAGAFSGYIATVASPKIVDFIRLNPLVDYVEKDSVVHSLD-ETQNNAPWGLARISH 245
            +F +    SGY +   + +++D IRLNPLV YVE+DS+V + +  TQNNAPWGL+RISH
Sbjct: 299 SSFNINNILSGY-SGYFTQEVIDLIRLNPLVKYVERDSIVQTTEFNTQNNAPWGLSRISH 357

Query: 246 REGLNLGNFNKYLYASNSAGKGVTAYVVDTGISVSHLEFGERAKWGKTIPINDYDIDGNG 305
           RE LNLG+FNKYLY  + AGKGVT +V+DTGI+V+H++FG+RA WGKTIP ND DIDGNG
Sbjct: 358 RERLNLGSFNKYLY-DDDAGKGVTCFVIDTGINVNHVDFGKRAIWGKTIPSNDQDIDGNG 416

Query: 306 HGTHCAGTIGSEHYGVAKGANLVAVKVLRSDGSGTMSDVLKGVEWVALEHTKHLEESRKD 365
           HGTHCAGTI S HYGVAK A +VAVKVLRS+GSG+MSDV+KGVE+ A  H  + E+++KD
Sbjct: 417 HGTHCAGTIASTHYGVAKNAEVVAVKVLRSNGSGSMSDVIKGVEFAAETHLNN-EKNKKD 475

Query: 366 KNSNYKGATANMSLGGGKSPALDQAVNAAVKAGVHFAVAAGNENQDACNSSPAAAENAIT 425
               YKG+TANMSLGGGKSP LD AVNAAV+AG+HF+VAAGNENQDACNSSPA+AENAIT
Sbjct: 476 ----YKGSTANMSLGGGKSPTLDLAVNAAVEAGIHFSVAAGNENQDACNSSPASAENAIT 531

Query: 426 VGASTLSDDRAYFSNYGKCVDIFAPGLNILSTYIGT-NDATATLSGTSMASPHVAGLLTY 484
           VGASTLSDDRAYFSN+G+CVD+FAPGLNILSTY+G  ND TATLSGTSMASPHVAGLLTY
Sbjct: 532 VGASTLSDDRAYFSNWGRCVDVFAPGLNILSTYVGDGNDNTATLSGTSMASPHVAGLLTY 591

Query: 485 LLSLQPDKGSEFYVPNSE--LTPLQMKKKIIDYATKNALADLPADTPNKLIYNG-GFNST 541
            LSLQPD  S F+   S+  +TP Q+KKK+I Y+T + L DLP  TPNKLIYNG G + +
Sbjct: 592 FLSLQPDSKSGFFNSKSDGKITPEQLKKKLIAYSTSDILYDLPDGTPNKLIYNGAGGDIS 651

Query: 542 DFWASAAAPQSHK--VKTNRYSLGSFLDSIQDSNNHWFNFDNM-NIF 585
           D W      Q+H+     ++ +  + +DS   S      FD + N+F
Sbjct: 652 DLWNGKVQEQAHEEPAHEDKINFENLVDSDSMSGKTDLFFDQIRNVF 698

>ZYRO0C07942g Chr3 complement(605044..606690) [1647 bp, 548 aa] {ON}
           similar to uniprot|P09232 Saccharomyces cerevisiae
           YEL060C PRB1 Vacuolar proteinase B (yscB) a serine
           protease of the subtilisin family involved in protein
           degradation in the vacuole and required for full protein
           degradation during sporulation
          Length = 548

 Score =  494 bits (1272), Expect = e-169,   Method: Compositional matrix adjust.
 Identities = 259/430 (60%), Positives = 320/430 (74%), Gaps = 22/430 (5%)

Query: 133 HDRYIIVFKKGVFKEQVDQHLKMMSALFRRLSE-EQRPAAAPGASALRDGFDRVMD---- 187
            +RYII+FKKGV  +++  H +++  +   L E  Q P        +R   D V D    
Sbjct: 90  ENRYIILFKKGVNPQEIGFHRELIEQV--HLQEVSQLPEEHSFFEGIR--LDGVYDSPLG 145

Query: 188 ----TFEVAGAFSGYIATVASPKIVDFIRLNPLVDYVEKDSVVHSLD-ETQNNAPWGLAR 242
               TF++ G   GY     S K++D IR++PL++ VE+DSVV++   +T+N APWGLAR
Sbjct: 146 GIDHTFDINGMLMGYSGYFPS-KVLDVIRMSPLIEMVEQDSVVYTQKADTENGAPWGLAR 204

Query: 243 ISHREGLNLGNFNKYLYASNSAGKGVTAYVVDTGISVSHLEFGERAKWGKTIPINDYDID 302
           ISHRE LNLG++NKYLY     G GVT+YV+DTG++V H +FG RAKWGKTIP  D D D
Sbjct: 205 ISHRERLNLGSYNKYLY-DEQGGSGVTSYVIDTGVNVHHNQFGGRAKWGKTIPAGDLDED 263

Query: 303 GNGHGTHCAGTIGSEHYGVAKGANLVAVKVLRSDGSGTMSDVLKGVEWVALEHTKHLEES 362
           GNGHGTHCAGTIGS  YGVAKGA++VAVKVLRS+GSG+MSDVLKGVEW A +H    + +
Sbjct: 264 GNGHGTHCAGTIGSSTYGVAKGADIVAVKVLRSNGSGSMSDVLKGVEWAAQDH----QNA 319

Query: 363 RKDKNSNYKGATANMSLGGGKSPALDQAVNAAVKAGVHFAVAAGNENQDACNSSPAAAEN 422
            K K   +KG+TANMSLGGGKSP+LDQAVNAAV AG++FAVAAGNE+QDACN+SPA+A  
Sbjct: 320 VKQKKPGFKGSTANMSLGGGKSPSLDQAVNAAVAAGLNFAVAAGNEDQDACNTSPASASG 379

Query: 423 AITVGASTLSDDRAYFSNYGKCVDIFAPGLNILSTYIGTNDATATLSGTSMASPHVAGLL 482
            ITVGASTLSDDRAYFSNYGKCVD+FAPGLNILSTYIG++ +TATLSGTSMASPHVAGLL
Sbjct: 380 PITVGASTLSDDRAYFSNYGKCVDVFAPGLNILSTYIGSDSSTATLSGTSMASPHVAGLL 439

Query: 483 TYLLSLQPDKGSEFYVPNSELTPLQMKKKIIDYATKNALADLPADTPNKLIYNGGFNS-T 541
            Y LSLQP   SEF    S ++P Q+KKK++ ++TK+ L+D+P+ TPN LIYNGG    +
Sbjct: 440 AYFLSLQPGSDSEFDA-GSSISPDQLKKKLLAFSTKDVLSDIPSGTPNLLIYNGGGGDLS 498

Query: 542 DFWASAAAPQ 551
            FW S    Q
Sbjct: 499 GFWGSKEVAQ 508

>Ecym_3018 Chr3 (33738..35465) [1728 bp, 575 aa] {ON} similar to
           Ashbya gossypii ACR012C
          Length = 575

 Score =  484 bits (1246), Expect = e-165,   Method: Compositional matrix adjust.
 Identities = 265/478 (55%), Positives = 331/478 (69%), Gaps = 30/478 (6%)

Query: 118 LELAALHDNGVGTADHDRYIIVFKKGVFKEQVDQHLKMMSALFRRLSEEQRPAAA----- 172
           ++LA+L DN    A   RYI++FK GV    V  H  +++        +  P  +     
Sbjct: 97  MKLASLSDNS--RAIPHRYIVIFKDGVTDYDVGMHQDLVTTAHMETIAQLDPGHSFFDAT 154

Query: 173 -----PGASALRDGFDRVMDTFEVAGAFSGYIATVASPKIVDFIRLNPLVDYVEKDSVVH 227
                 G SA R     + + FE+AG+  GY     +  ++D IR + LV  +E+DS+VH
Sbjct: 155 EGMHHEGISA-RSVEGGIEEMFEIAGSLRGYFGYF-TDGMLDLIRESGLVKLIEQDSIVH 212

Query: 228 SLD-ETQNNAPWGLARISHREGLNLGNFNKYLYASNSAGKGVTAYVVDTGISVSHLEFGE 286
           + D ETQ  APWGLAR+SHRE LNLG+FNKYLY  N AGKGVTAYV+DTGI++ H+EF  
Sbjct: 213 ASDFETQTGAPWGLARVSHRERLNLGSFNKYLYDDN-AGKGVTAYVIDTGINIDHVEFEG 271

Query: 287 RAKWGKTIPINDYDIDGNGHGTHCAGTIGSEHYGVAKGANLVAVKVLRSDGSGTMSDVLK 346
           RA+WGKTIP ND D DGNGHGTHCAGTI S+ YGVAK A +VAVKVLR++G+GTMSDVL+
Sbjct: 272 RAQWGKTIPSNDADYDGNGHGTHCAGTIASKTYGVAKNAKVVAVKVLRTNGTGTMSDVLR 331

Query: 347 GVEWVALEHTKHLEESRKDKNSNYKGATANMSLGGGKSPALDQAVNAAVKAGVHFAVAAG 406
           GVE+V  EH K         + N+KG+TANMSLGGGKS AL+ AV+AAV AG+HFAVAAG
Sbjct: 332 GVEYVVAEHRK------ASGDPNFKGSTANMSLGGGKSAALELAVDAAVAAGIHFAVAAG 385

Query: 407 NENQDACNSSPAAAENAITVGASTLSDDRAYFSNYGKCVDIFAPGLNILSTYIGTNDATA 466
           NENQDACN+SPA+++  ITV ASTLSDDRAYFSN+G CVDIFAPGLNILSTYIG++ A A
Sbjct: 386 NENQDACNTSPASSKKCITVAASTLSDDRAYFSNWGSCVDIFAPGLNILSTYIGSDTAVA 445

Query: 467 TLSGTSMASPHVAGLLTYLLSLQPDKGSEFYVPNSELTPLQMKKKIIDYATKNALADLPA 526
           TLSGTSMASPHVAGLL Y LSLQPD GSE+Y   S ++P  +KKKI+ Y +KN L ++PA
Sbjct: 446 TLSGTSMASPHVAGLLAYFLSLQPDSGSEYYT-GSSISPEALKKKIVAYGSKNLLNNVPA 504

Query: 527 DTPNKLIYNGGFNSTD-FWASAA-APQSHKV-----KTNRYSLGSFLDSIQDSNNHWF 577
            T N LI+NGG  S D FW S     +  KV     K + +   S +D +  +++  F
Sbjct: 505 RTANNLIFNGGGGSLDSFWNSKCDGCEQEKVSSSHGKADDFESESLMDCLHSTSHSLF 562

>ACR012C Chr3 complement(378750..380375) [1626 bp, 541 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YEL060C
           (PRB1) and YOR003W (YSP3)
          Length = 541

 Score =  469 bits (1208), Expect = e-160,   Method: Compositional matrix adjust.
 Identities = 260/476 (54%), Positives = 333/476 (69%), Gaps = 33/476 (6%)

Query: 135 RYIIVFKKGVFKEQVDQHLKMMSAL----FRRLSEEQ---RPAAAP----GASALRDGFD 183
           +YI+VF++GV  E+   H++++ A       RL E+    R         G +A R    
Sbjct: 74  KYIVVFREGVSDEEAAFHMELVEAAHAESVARLDEQHAFFRSTRGENNEFGIAATR-AEG 132

Query: 184 RVMDTFEVAGAFSGYIATVASPKIVDFIRLNPLVDYVEKDSVVHSLD-ETQNNAPWGLAR 242
            +   F +     GY+    +  +V  +R NP V +VE+DS+V + D  TQN APWGLAR
Sbjct: 133 GIEGEFALGEQLRGYVGYF-TEDMVGLLRSNPHVHFVEEDSMVFASDFTTQNGAPWGLAR 191

Query: 243 ISHREGLNLGNFNKYLYASNSAGKGVTAYVVDTGISVSHLEFGERAKWGKTIPINDYDID 302
           +SHRE LN G+FNKYLY  NS G+GVT+YV+DTGI++ H++F +RA WGKTIP ND D D
Sbjct: 192 VSHREKLNSGSFNKYLYDDNS-GEGVTSYVIDTGINIDHVDFEDRALWGKTIPNNDADYD 250

Query: 303 GNGHGTHCAGTIGSEHYGVAKGANLVAVKVLRSDGSGTMSDVLKGVEWVALEHTKHLEES 362
           GNGHGTHCAGTI S+ YGVAK AN+VAVKVLRS+G+G+MSDVL+GVE+    H K  E++
Sbjct: 251 GNGHGTHCAGTIASKTYGVAKKANVVAVKVLRSNGTGSMSDVLRGVEYAVKAHRKAAEKA 310

Query: 363 RKDKNSNYKGATANMSLGGGKSPALDQAVNAAVKAGVHFAVAAGNENQDACNSSPAAAEN 422
            K     +KG+TANMSLGGG+S ALD AV+AAV AG+HFAVAAGNENQDACN+SPAA++ 
Sbjct: 311 DK----GFKGSTANMSLGGGRSQALDLAVDAAVDAGIHFAVAAGNENQDACNTSPAASQK 366

Query: 423 AITVGASTLSDDRAYFSNYGKCVDIFAPGLNILSTYIGTNDATATLSGTSMASPHVAGLL 482
           AITVGASTL+DDRAYFSN+G+CVD+FAPG+NILSTYIG++ A ATLSGTSMASPHVAGLL
Sbjct: 367 AITVGASTLADDRAYFSNWGRCVDLFAPGMNILSTYIGSDTAVATLSGTSMASPHVAGLL 426

Query: 483 TYLLSLQPDKGSEFYVPNSELTPLQMKKKIIDYATKNALADLPADTPNKLIYN-GGFNST 541
           TY LSLQPD  SEF    + ++P  +KKK+ID+ TK+AL+ LPA T N LIYN GG + +
Sbjct: 427 TYFLSLQPDGDSEFRNKQT-ISPEVLKKKVIDFGTKDALSSLPARTANVLIYNGGGADLS 485

Query: 542 DFWASAAAPQSHKVKT---NRYSLGSFLD----SIQDSNNHWFN-----FDNMNIF 585
           DFW +     S    T   +  ++GS LD     ++ S +  F+      D MNI 
Sbjct: 486 DFWGNKPKKVSGPKFTYADDEEAMGSDLDRLIHELESSTDAMFSGFRTILDRMNII 541

>Kpol_1045.75 s1045 complement(174970..176403) [1434 bp, 477 aa]
           {ON} complement(174972..176405) [1434 nt, 478 aa]
          Length = 477

 Score =  463 bits (1191), Expect = e-158,   Method: Compositional matrix adjust.
 Identities = 246/423 (58%), Positives = 308/423 (72%), Gaps = 26/423 (6%)

Query: 136 YIIVFKKGVFKEQVDQHLKMMSALFRRLSEEQRP----------AAAPGASALRDGFDRV 185
           YI+VF +GV + ++  H++ MS L +  S    P          ++   ++ L  G   V
Sbjct: 39  YIVVFNEGVTQNEISLHIETMSQL-QLQSVTDLPYDHEFFTISTSSDVNSNGLLGG---V 94

Query: 186 MDTFEVAGAFSGYIATVASPKIVDFIRLNPLVDYVEKDSVVHSLD-ETQNNAPWGLARIS 244
            D F++     GY   + + ++V+F+RL+PLV ++E+DS+VH+ +  TQ NAPWGLARIS
Sbjct: 95  RDMFKIGNDLHGYTG-MFTDEVVEFLRLSPLVKFIERDSMVHTTEATTQYNAPWGLARIS 153

Query: 245 HREGLNLGNFNKYLYASNSAGKGVTAYVVDTGISVSHLEFGERAKWGKTIPINDYDIDGN 304
           HR  LNL  FNKYLY  +  GKGV AYV+DTGI++++++FG RA WGKTIP  + ++DGN
Sbjct: 154 HRSRLNLSTFNKYLY-DDLGGKGVKAYVIDTGINITNVDFGGRAYWGKTIPAGEANVDGN 212

Query: 305 GHGTHCAGTIGSEHYGVAKGANLVAVKVLRSDGSGTMSDVLKGVEWVALEHTKHLEESRK 364
           GHGTH AGTI S HYGVAK   + AVKVLRS+G+G+MSDVLKGVE+V   H       R 
Sbjct: 213 GHGTHVAGTIASIHYGVAKQVKVYAVKVLRSNGAGSMSDVLKGVEYVVGAH------QRD 266

Query: 365 DKNSNYKGATANMSLGGGKSPALDQAVNAAVKAGVHFAVAAGNENQDACNSSPAAAENAI 424
              + +KG+ ANMSLGGGKS +LD AVNAAV AGVHFAVAAGNENQDACN+SPAAAE AI
Sbjct: 267 VGTAGFKGSVANMSLGGGKSRSLDLAVNAAVGAGVHFAVAAGNENQDACNTSPAAAERAI 326

Query: 425 TVGASTLSDDRAYFSNYGKCVDIFAPGLNILSTYIGTNDATATLSGTSMASPHVAGLLTY 484
           TVGASTLSD RAYFSN+G+CV IFAPGLNILSTYIG+ DATATLSGTSMASPH+AGL+ Y
Sbjct: 327 TVGASTLSDSRAYFSNWGQCVSIFAPGLNILSTYIGSPDATATLSGTSMASPHIAGLVAY 386

Query: 485 LLSLQPDKGSEFYVPN--SELTPLQMKKKIIDYATKNALADLPADTPNKLIYNG-GFNST 541
            LSLQP   S+FY     + +TP Q+KKKI+ + TKNAL DLPA+TPN + YNG G +  
Sbjct: 387 FLSLQPAVKSQFYSQGQATAITPDQLKKKIVAFGTKNALRDLPANTPNVIAYNGAGKSLE 446

Query: 542 DFW 544
           DFW
Sbjct: 447 DFW 449

>Skud_15.164 Chr15 (291471..292919) [1449 bp, 482 aa] {ON} YOR003W
           (REAL)
          Length = 482

 Score =  419 bits (1077), Expect = e-141,   Method: Compositional matrix adjust.
 Identities = 215/417 (51%), Positives = 291/417 (69%), Gaps = 15/417 (3%)

Query: 135 RYIIVFKKGVFKEQVDQHLKMMSALFR----RLSEEQRPAAAPGASALRD-GFDRVMDTF 189
           RYIIVF + +    ++ H +M+    +    +++E+        ASA  +  F  +  +F
Sbjct: 72  RYIIVFNEDITNRLIESHTQMIQKAQKVSVSKITEDDSFLRTVSASASPNPQFGGIDISF 131

Query: 190 EVAGAFSGYIATVASPKIVDFIRLNPLVDYVEKDSVVH-SLDETQNNAPWGLARISHREG 248
           ++ G F GY     + ++++ +  +PLV ++E +S V  S    Q +APWGL RISHRE 
Sbjct: 132 DINGLFRGYTGYF-TDEVIEIVFQDPLVKFIEHESTVRISNSSRQEDAPWGLHRISHRER 190

Query: 249 LNLGNFNKYLYASNSAGKGVTAYVVDTGISVSHLEFGERAKWGKTIPINDYDIDGNGHGT 308
              G   +YLY  ++AG GVT+YV+DTGI   H +F  RAKWG  IP ND   D NGHGT
Sbjct: 191 AKYGQDLEYLY-EDAAGTGVTSYVLDTGIDTEHEDFEGRAKWGAVIPENDEASDLNGHGT 249

Query: 309 HCAGTIGSEHYGVAKGANLVAVKVLRSDGSGTMSDVLKGVEWVALEHTKHLEESRKDKNS 368
           HCAG IGS H+GVAK  N++AVKVLRS+G GT+SDV+KG+E+VA  H      S K + S
Sbjct: 250 HCAGIIGSRHFGVAKNTNILAVKVLRSNGEGTVSDVIKGIEYVAKNHIA----SSKKRGS 305

Query: 369 NYKGATANMSLGGGKSPALDQAVNAAVKAGVHFAVAAGNENQDACNSSPAAAENAITVGA 428
            +KG+TAN+SLG  KSPA++ AVNAAV  GVHFA+AAGNE++DAC SSPA AE +ITVGA
Sbjct: 306 KFKGSTANLSLGSSKSPAMEMAVNAAVDCGVHFAIAAGNEDEDACLSSPAGAEKSITVGA 365

Query: 429 STLSDDRAYFSNYGKCVDIFAPGLNILSTYIGTNDATATLSGTSMASPHVAGLLTYLLSL 488
           ST SDDRA+FSN+G CVD+FAPG+NI+STYIG+ +AT +LSGTSMA+PHVAG+L+YLLSL
Sbjct: 366 STFSDDRAFFSNWGTCVDVFAPGINIMSTYIGSRNATLSLSGTSMAAPHVAGILSYLLSL 425

Query: 489 QPDKGSEFYVPNSELTPLQMKKKIIDYATKNALADLPADTPNKLIYNGGFNSTD-FW 544
           QP + SEF+     ++P Q+K+KI+ ++T+  L D+  +TPN+L+YNGG    D FW
Sbjct: 426 QPAQDSEFFYDT--VSPQQLKEKILKFSTRGVLGDVNEETPNRLVYNGGGKKLDEFW 480

>YOR003W Chr15 (331455..332891) [1437 bp, 478 aa] {ON}  YSP3Putative
           precursor to the subtilisin-like protease III
          Length = 478

 Score =  416 bits (1068), Expect = e-140,   Method: Compositional matrix adjust.
 Identities = 216/426 (50%), Positives = 290/426 (68%), Gaps = 33/426 (7%)

Query: 135 RYIIVFKKGVFKEQVDQHLKMMSALFRRLSEEQRPAAAPGASALRDGFDRVM-------- 186
           RY+IVF + +  +Q+  H++++         ++  + + G     D F RV+        
Sbjct: 70  RYVIVFNEDISLQQIQSHMQVV---------QKDHSTSVGKLTENDAFWRVISSSVSSKS 120

Query: 187 ------DTFEVAGAFSGYIATVASPKIVDFIRLNPLVDYVEKDSVVH-SLDETQNNAPWG 239
                 + F++ G F GY     + +I+  I  +P++ +VE+++ V  S    Q  APWG
Sbjct: 121 QFGGIDNFFDINGLFRGYTGYF-TDEIIKIISQDPIIKFVEQETTVKISNSSLQEEAPWG 179

Query: 240 LARISHREGLNLGNFNKYLYASNSAGKGVTAYVVDTGISVSHLEFGERAKWGKTIPINDY 299
           L R+SHRE    G   +YLY  ++AGKGVT+YV+DTGI   H +F  RA+WG  IP ND 
Sbjct: 180 LHRVSHREKPKYGQDLEYLY-EDAAGKGVTSYVLDTGIDTEHEDFEGRAEWGAVIPANDE 238

Query: 300 DIDGNGHGTHCAGTIGSEHYGVAKGANLVAVKVLRSDGSGTMSDVLKGVEWVALEHTKHL 359
             D NGHGTHCAG IGS+H+GVAK   +VAVKVLRS+G GT+SDV+KG+E+V  EH    
Sbjct: 239 ASDLNGHGTHCAGIIGSKHFGVAKNTKIVAVKVLRSNGEGTVSDVIKGIEYVTKEHI--- 295

Query: 360 EESRKDKNSNYKGATANMSLGGGKSPALDQAVNAAVKAGVHFAVAAGNENQDACNSSPAA 419
            ES K KN  +KG+TAN+SLG  KS A++ AVNAAV +GVHFA+AAGNE++DAC SSPA 
Sbjct: 296 -ESSKKKNKEFKGSTANLSLGSSKSLAMEMAVNAAVDSGVHFAIAAGNEDEDACLSSPAG 354

Query: 420 AENAITVGASTLSDDRAYFSNYGKCVDIFAPGLNILSTYIGTNDATATLSGTSMASPHVA 479
           AE +ITVGAST SDDRA+FSN+G CVD+FAPG+NI+STYIG+ +AT +LSGTSMASPHVA
Sbjct: 355 AEKSITVGASTFSDDRAFFSNWGTCVDVFAPGINIMSTYIGSRNATLSLSGTSMASPHVA 414

Query: 480 GLLTYLLSLQPDKGSEFYVPNSELTPLQMKKKIIDYATKNALADLPADTPNKLIYNGGFN 539
           G+L+Y LSLQP   SEF+  N   +P ++K+K++ ++T+  L D+  DTPNKLIYNGG  
Sbjct: 415 GILSYFLSLQPAPDSEFF--NDAPSPQELKEKVLKFSTQGVLGDIGDDTPNKLIYNGGGK 472

Query: 540 STD-FW 544
             D FW
Sbjct: 473 KLDGFW 478

>Smik_15.172 Chr15 (298772..300208) [1437 bp, 478 aa] {ON} YOR003W
           (REAL)
          Length = 478

 Score =  411 bits (1056), Expect = e-138,   Method: Compositional matrix adjust.
 Identities = 215/412 (52%), Positives = 293/412 (71%), Gaps = 20/412 (4%)

Query: 135 RYIIVFKKGVFKEQVDQHLKMM----SALFRRLSEEQRPAAAPGASALRD----GFDRVM 186
           RYI+VF + +  + ++ H KM+    S    +L+E+        +S   D    G D   
Sbjct: 70  RYIVVFNEDISIKSIESHRKMVQEAHSVSVSKLAEDDVFLEVVSSSIAPDLQLGGID--- 126

Query: 187 DTFEVAGAFSGYIATVASPKIVDFIRLNPLVDYVEKDSVVH-SLDETQNNAPWGLARISH 245
            +F++ G F GY A   + +I++ +  +PL+ ++E++S V  S    Q +APWGL RISH
Sbjct: 127 SSFDINGLFRGY-AGYFTDEILNLVSQDPLIKFIEQESTVRLSNTSMQKDAPWGLHRISH 185

Query: 246 REGLNLGNFNKYLYASNSAGKGVTAYVVDTGISVSHLEFGERAKWGKTIPINDYDIDGNG 305
           RE    G   +YLY  ++AG+GVT+YV+DTGI   H +F  RA WG  IP ND   D NG
Sbjct: 186 REKAKYGQDLEYLY-EDAAGRGVTSYVLDTGIDTEHEDFEGRAVWGAVIPGNDEASDLNG 244

Query: 306 HGTHCAGTIGSEHYGVAKGANLVAVKVLRSDGSGTMSDVLKGVEWVALEHTKHLEESRKD 365
           HGTHCAG IGS+HYGVAK   LVAVKVLRS+G GT+SDV+KG+E+VA EH   +E SRK 
Sbjct: 245 HGTHCAGIIGSKHYGVAKNTKLVAVKVLRSNGEGTVSDVIKGIEYVAREH---IESSRK- 300

Query: 366 KNSNYKGATANMSLGGGKSPALDQAVNAAVKAGVHFAVAAGNENQDACNSSPAAAENAIT 425
           K+  +KG+TAN+SLG  KS A++ AV+AAV +GVHFA+AAGNEN+DAC SSPA A+ +IT
Sbjct: 301 KSKEFKGSTANLSLGSSKSLAMEMAVDAAVDSGVHFAIAAGNENEDACLSSPAGAQKSIT 360

Query: 426 VGASTLSDDRAYFSNYGKCVDIFAPGLNILSTYIGTNDATATLSGTSMASPHVAGLLTYL 485
           VGAST SDDRA+FSN+G CVD+FAPG+NI+STYIG+ +AT +LSGTSMA+PHVAG+L+Y 
Sbjct: 361 VGASTFSDDRAFFSNWGTCVDVFAPGINIMSTYIGSRNATLSLSGTSMAAPHVAGMLSYF 420

Query: 486 LSLQPDKGSEFYVPNSELTPLQMKKKIIDYATKNALADLPADTPNKLIYNGG 537
           LSLQP   SE++  ++ L+P ++K+K++ ++T   L D+  +TPN+LIYNGG
Sbjct: 421 LSLQPAPDSEYF--DNALSPQELKEKVLKFSTHGVLGDIGDNTPNRLIYNGG 470

>Suva_15.178 Chr15 (305907..307337) [1431 bp, 476 aa] {ON} YOR003W
           (REAL)
          Length = 476

 Score =  410 bits (1055), Expect = e-138,   Method: Compositional matrix adjust.
 Identities = 213/417 (51%), Positives = 291/417 (69%), Gaps = 17/417 (4%)

Query: 135 RYIIVFKKGVFKEQVDQHLKMMSAL----FRRLSEEQRPAAAPGASALRD-GFDRVMDTF 189
           RYII F +      ++ H +M+  +      +L+++   A     SA  D  F  +   F
Sbjct: 70  RYIIAFHEDSSVRSIESHKRMIQEVQNESVSKLAKDD--AFFVSTSAPSDLQFGGIDSFF 127

Query: 190 EVAGAFSGYIATVASPKIVDFIRLNPLVDYVEKDSVVHSLDET-QNNAPWGLARISHREG 248
           ++ G F GY     + +++  +  +P++ ++E++S V   + T Q  APWGL RISHRE 
Sbjct: 128 DINGLFRGYTGYF-TEEVIKRVLQDPIIKFIEQESTVKVTNSTFQEEAPWGLHRISHREK 186

Query: 249 LNLGNFNKYLYASNSAGKGVTAYVVDTGISVSHLEFGERAKWGKTIPINDYDIDGNGHGT 308
              G   +YLY  ++AG+GVT+YV+DTGI ++H +F  RA WG  IP ND   D NGHGT
Sbjct: 187 AKYGQDLEYLY-EDAAGRGVTSYVLDTGIDINHEDFEGRAVWGAVIPDNDEASDLNGHGT 245

Query: 309 HCAGTIGSEHYGVAKGANLVAVKVLRSDGSGTMSDVLKGVEWVALEHTKHLEESRKDKNS 368
           HCAG IGS H+GV K  NLVAVKVLRS+G GT+SDV+KG+E+V  +H     +S K    
Sbjct: 246 HCAGIIGSRHFGVTKNTNLVAVKVLRSNGEGTVSDVIKGIEYVVKDHI----DSSKKGGP 301

Query: 369 NYKGATANMSLGGGKSPALDQAVNAAVKAGVHFAVAAGNENQDACNSSPAAAENAITVGA 428
            +KG+TAN+SLG  KSPA++ AVNAAV++GVHFA+AAGNE++DAC SSPA AE +ITVGA
Sbjct: 302 KFKGSTANLSLGSSKSPAMEMAVNAAVESGVHFAIAAGNEDEDACLSSPAGAEKSITVGA 361

Query: 429 STLSDDRAYFSNYGKCVDIFAPGLNILSTYIGTNDATATLSGTSMASPHVAGLLTYLLSL 488
           ST SDDRA+FS++G CVD+FAPG+NILSTYIG+ +A+ +LSGTSMA+PHVAG+L+Y LSL
Sbjct: 362 STFSDDRAFFSDWGTCVDVFAPGVNILSTYIGSRNASLSLSGTSMAAPHVAGILSYFLSL 421

Query: 489 QPDKGSEFYVPNSELTPLQMKKKIIDYATKNALADLPADTPNKLIYNGGFNSTD-FW 544
           QP   SEF+  +S ++P Q+K+KII+++T+  L D+  DTPN+LIYNGG    D FW
Sbjct: 422 QPSSDSEFF--DSTVSPQQLKEKIINFSTQGVLGDVGEDTPNRLIYNGGGRKLDNFW 476

>CAGL0E02651g Chr5 (251868..253325) [1458 bp, 485 aa] {ON} similar
           to uniprot|P25036 Saccharomyces cerevisiae YOR003w YSP3
           or uniprot|P09232 Saccharomyces cerevisiae YEL060c PRB1
          Length = 485

 Score =  382 bits (981), Expect = e-126,   Method: Compositional matrix adjust.
 Identities = 211/420 (50%), Positives = 284/420 (67%), Gaps = 17/420 (4%)

Query: 134 DRYIIVFKKGVFKEQVDQHLKMM-----SALFRRLSEEQRPAAAPGASALRDGFDRVMDT 188
           +RYI++FK  V  +++  HL  +     S++F + S+  +       S    G       
Sbjct: 76  NRYIVLFKDFVTDKEIQSHLSAIEEINSSSIFLQDSDFGKATQYNDISTRGIGLQH---E 132

Query: 189 FEVAGAFSGYIATVASPKIVDFIRLNPLVDYVEKDSVVHSLD-ETQNNAPWGLARISHRE 247
           F +  + +GYI    +     FI  +PLV+ VE DS+V   + + Q + PWGL RIS RE
Sbjct: 133 FSIGRSMTGYIGYF-TETTAKFIANSPLVELVEHDSIVRINNYKMQEHVPWGLGRISQRE 191

Query: 248 GLNLGNFNKYLYASNSAGKGVTAYVVDTGISVSHLEFGERAKWGKTIPINDYDIDGNGHG 307
            L +    ++ +  +  GK    +V+DTGI V H +F  RA WGKTI  ND D D NGHG
Sbjct: 192 KLPILG-KRFYHYDDRGGKDTVTFVIDTGIYVDHEDFEGRASWGKTIVENDNDYDLNGHG 250

Query: 308 THCAGTIGSEHYGVAKGANLVAVKVLRSDGSGTMSDVLKGVEWVALEHTKHLEESRKDKN 367
           THCAGTI S+HYG+AK A ++AVKVLRSDGSG+MSDV++GVE+  +E    L++++    
Sbjct: 251 THCAGTIASKHYGIAKQAEVIAVKVLRSDGSGSMSDVIRGVEY-TVEAYNDLKKTK---- 305

Query: 368 SNYKGATANMSLGGGKSPALDQAVNAAVKAGVHFAVAAGNENQDACNSSPAAAENAITVG 427
           SN KGA  NMSLG  KS AL++A++AA  AG+ FAVAAGNE+ DACNSSPA+A + ITVG
Sbjct: 306 SNLKGAAGNMSLGAWKSYALNRAMDAAAAAGISFAVAAGNESDDACNSSPASAWSPITVG 365

Query: 428 ASTLSDDRAYFSNYGKCVDIFAPGLNILSTYIGTNDATATLSGTSMASPHVAGLLTYLLS 487
            STLSDD A+FSNYG+CVDIFAPG+NI+STYIG+ +AT +LSGTSM+SPHVAG+L Y LS
Sbjct: 366 GSTLSDDVAFFSNYGRCVDIFAPGVNIMSTYIGSKNATESLSGTSMSSPHVAGVLAYYLS 425

Query: 488 LQPDKGSEFYVPNSELTPLQMKKKIIDYATKNALADLPADTPNKLIYN-GGFNSTDFWAS 546
           LQPD  S+FY  +S ++P  +KKK+++YAT   L+ LPA+T N L+YN GG N + FW +
Sbjct: 426 LQPDHKSQFYHEHSAISPKILKKKVLNYATNGTLSYLPAETVNLLVYNGGGKNLSKFWGT 485

>KAFR0B06550 Chr2 (1359770..1361140) [1371 bp, 456 aa] {ON} Anc_6.14
           YOR003W
          Length = 456

 Score =  381 bits (978), Expect = e-126,   Method: Compositional matrix adjust.
 Identities = 198/414 (47%), Positives = 273/414 (65%), Gaps = 25/414 (6%)

Query: 134 DRYIIVFKKGVFKEQVDQHLKMMSALFRRLSEEQRPAAAPGASALRDGFDRVMDTFEVAG 193
           D+YI++FK      + + H K +    +  S E            +D     ++ F++  
Sbjct: 62  DQYIVIFKNSAMMAEKELHFKQLKNFIKTYSYEWDE---------KDDHKSNLNIFKIGT 112

Query: 194 AFSGYIATVASPKIVDFIRLNPLVDYVEKDSVVHSLD-ETQNNAPWGLARISHREGLNLG 252
             SGYI      + +  +R +P+V  +E DS VH+L  + Q + PWGL+RIS R  + +G
Sbjct: 113 TLSGYILR-GPIETLQLLRQDPIVQLIEPDSKVHALKLKIQEDTPWGLSRISQRPRVRIG 171

Query: 253 NFNKYLYASNSAGKGVTAYVVDTGISVSHLEFGERAKWGKTIPINDYDIDGNGHGTHCAG 312
               Y Y   ++G  VTAYV+DTGI +SH +F  RA+WGKTI  ND D D +GHGTH AG
Sbjct: 172 QDQLYYYDDATSG-NVTAYVLDTGIMISHEQFNGRARWGKTIVPNDVDEDNSGHGTHVAG 230

Query: 313 TIGSEHYGVAKGANLVAVKVLRSDGSGTMSDVLKGVEWVALEHTKHLEESRKDKNSNY-K 371
            I S+ +GVAK   +VAVKVLRS+G G MSDVLKG+E+V  +H+K         N NY K
Sbjct: 231 IIASDKFGVAKTCEVVAVKVLRSNGEGDMSDVLKGIEFVVDDHSK---------NKNYSK 281

Query: 372 GATANMSLGGGKSPALDQAVNAAVKAGVHFAVAAGNENQDACNSSPAAAENAITVGASTL 431
           G+  N+SLG  KSPAL  A++AA+   +HFAVAAGNEN DAC +SPA A  AITVGAS  
Sbjct: 282 GSVVNLSLGASKSPALVLAIDAAISENIHFAVAAGNENMDACYTSPADARRAITVGASIF 341

Query: 432 SDDRAYFSNYGKCVDIFAPGLNILSTYIGTNDATATLSGTSMASPHVAGLLTYLLSLQPD 491
           SD+RA+FSN+G+CVD+FAPG+N++STYIG+++AT +LSGTS A+P+ AGL+ Y LSLQPD
Sbjct: 342 SDERAFFSNWGECVDVFAPGMNVMSTYIGSDNATLSLSGTSAAAPYTAGLIAYYLSLQPD 401

Query: 492 KGSEFYVPNSELTPLQMKKKIIDYATKNALADLPADTPNKLIYNG-GFNSTDFW 544
           K S ++    E+TP ++K+KI+ + +K+ L +LP +TPN +IYNG G N + FW
Sbjct: 402 KDSGYF--TGEMTPSKLKEKIVAFGSKDVLYELPENTPNIVIYNGAGRNLSHFW 453

>NCAS0D02630 Chr4 (506222..507577) [1356 bp, 451 aa] {ON} Anc_6.14
          Length = 451

 Score =  363 bits (931), Expect = e-119,   Method: Compositional matrix adjust.
 Identities = 186/415 (44%), Positives = 266/415 (64%), Gaps = 24/415 (5%)

Query: 134 DRYIIVFKKGVFKEQVDQHLKMMSALFRRLSEEQRPAAAPGASALRDGFDRVMDTFEVAG 193
           ++YI++FK      Q + HL  +++       +                  ++ +F++A 
Sbjct: 55  NQYIVLFKSDTTDIQRETHLATLNSWLLNTDPQYT----------------ILHSFQLAH 98

Query: 194 AFSGYIATVASPKIVDFIRLNPLVDYVEKDSVVHSL-DETQNNAPWGLARISHREGLNLG 252
              GY + +   +++  +  +P++  +E+DS VH+L  + Q ++PWGLARIS RE L L 
Sbjct: 99  DLQGYTSRLPE-QLIRSLATDPIIQSIEQDSYVHALGRQKQIDSPWGLARISQRERLKLL 157

Query: 253 NFNKYLYASNSAGKGVTAYVVDTGISVSHLEFGERAKWGKTI-PINDYDIDGNGHGTHCA 311
               Y Y  + A      Y++DTGI+ +H EF  RAKWG    P+     D NGHGTHCA
Sbjct: 158 QDQFYHYDDSGASSNTKCYILDTGINENHNEFQGRAKWGAVFTPMEPNQEDENGHGTHCA 217

Query: 312 GTIGSEHYGVAKGANLVAVKVLRSDGSGTMSDVLKGVEWVALEHTKHLEESRKDKNSNYK 371
           G IGS  YGVAK   L+AVKVL + G G MS V++G+E+V  +H + +   +K   + +K
Sbjct: 218 GVIGSHEYGVAKNTTLIAVKVLDARGDGEMSAVIRGIEYVTQQHEQDM---KKQDQTGFK 274

Query: 372 GATANMSLGGGKSPALDQAVNAAVKAGVHFAVAAGNENQDACNSSPAAAENAITVGASTL 431
           G+  N+SLG GKSPAL + + AAVK GVHFAVAAGNE+ DAC++SPA + +A+TVGAS+ 
Sbjct: 275 GSVINLSLGAGKSPALLRVIEAAVKLGVHFAVAAGNEDDDACSTSPADSPHALTVGASSF 334

Query: 432 SDDRAYFSNYGKCVDIFAPGLNILSTYIGT-NDATATLSGTSMASPHVAGLLTYLLSLQP 490
           SDDR +FSN+G CVD+FAPG+NI+STYIG  N+ T +LSGTSM++P V GL+ Y LSLQP
Sbjct: 335 SDDRVFFSNWGPCVDVFAPGINIMSTYIGPHNNETTSLSGTSMSAPFVTGLIAYFLSLQP 394

Query: 491 DKGSEFYVPNSELTPLQMKKKIIDYATKNALADLPADTPNKLIYNGGFNS-TDFW 544
           D  S+FY   +  TP Q+K KII ++T+  L ++P  TPN+++YNGG +S  DFW
Sbjct: 395 DTKSQFYTGITSPTPYQLKYKIISFSTEGVLHEIPEGTPNRIVYNGGGHSLKDFW 449

>KNAG0F02970 Chr6 (563666..564928) [1263 bp, 420 aa] {ON} 
          Length = 420

 Score =  339 bits (870), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 181/406 (44%), Positives = 255/406 (62%), Gaps = 34/406 (8%)

Query: 134 DRYIIVFKKGVFKEQVDQHLKMMSALFRRLSEEQRPAAAPGASALRDGFDRVMDTFEVAG 193
           + ++++FK  V +E+V+  L +++  F     EQ                     F +A 
Sbjct: 43  NEFLVMFKPMVDREEVEVGLSVLAGRFPLAQFEQ---------------------FHIAD 81

Query: 194 AFSGYIATVASPKIVDFIRLNPLVDYVEKDSVVHSLDET-QNNAPWGLARISHREGLNLG 252
              G+         V F+   P V+ VE +S V++L+ T Q + PWGL R+S R+ + +G
Sbjct: 82  ELIGFTVKNFPFHNVYFLLQIPFVEMVETNSKVYALNVTVQEDVPWGLMRLSQRDRVRIG 141

Query: 253 NFNKYLYASNSAGKGVTAYVVDTGISVSHLEFGERAKWGKTIPINDYDIDGNGHGTHCAG 312
           +   Y Y +  + K V  Y++DTGI V H EF  RA+WGKTI  ND D D NGHGTHCAG
Sbjct: 142 DEQVYRYDTRGSAKDVNVYILDTGIQVDHEEFEGRARWGKTIAWNDPDRDDNGHGTHCAG 201

Query: 313 TIGSEHYGVAKGANLVAVKVLRSDGSGTMSDVLKGVEWVALEH-TKHLEESRKDKNSNYK 371
            +G   YGVAK ANL+AVKVL + G G MSDV++G+E+   EH T++ +E R        
Sbjct: 202 IVGGATYGVAKEANLIAVKVLHATGDGEMSDVIRGIEFAVNEHLTRNQDEVR-------- 253

Query: 372 GATANMSLGGGKSPALDQAVNAAVKAGVHFAVAAGNENQDACNSSPAAAENAITVGASTL 431
           G+  N+SLG G+SPAL + V AA+  GVHFAVAAGNE+ +AC SSPA  +  +TVG ST 
Sbjct: 254 GSIINLSLGAGESPALQRVVTAALNKGVHFAVAAGNEDDNACYSSPANIDGVVTVGGSTF 313

Query: 432 SDDRAYFSNYGKCVDIFAPGLNILSTYIG-TNDATATLSGTSMASPHVAGLLTYLLSLQP 490
           SDDRA+FSN+G C+D+FAPG+N+ S+Y+G   + T +LSGTS ++PHVAGL+ YLLSL+P
Sbjct: 314 SDDRAFFSNWGPCIDVFAPGVNVKSSYVGAAKNKTLSLSGTSTSAPHVAGLMAYLLSLEP 373

Query: 491 DKGSEFYVPNSELTPLQMKKKIIDYATKNALADLPADTPNKLIYNG 536
           D  S+F+   S   P Q+K+K++  AT+  L ++P DT N +I+NG
Sbjct: 374 DTKSQFHTAWS--NPAQLKQKLVSLATEGKLFEVPDDTANLMIFNG 417

>NDAI0I02280 Chr9 complement(519169..520617) [1449 bp, 482 aa] {ON} 
          Length = 482

 Score =  339 bits (870), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 188/414 (45%), Positives = 268/414 (64%), Gaps = 21/414 (5%)

Query: 134 DRYIIVFKKGVFKEQVDQHLKMMSALFRRLSEEQRPAAAPGASALRDGFDRVMDTFEVAG 193
           D+YI++F+      Q+ +  + +S+L    +++           + D + +V+  F+++ 
Sbjct: 65  DQYIVLFENDTTDLQISRFEQFLSSLIEEDNQKYN---------VNDNYSKVLSRFQISN 115

Query: 194 AFSGYIATVASPKIVDFIRLN-----PLVDYVEKDSVVH-SLDETQNNAPWGLARISHRE 247
              G I        ++ ++ N      ++  +E+DS VH +   TQ ++ WGL+RIS R 
Sbjct: 116 DTKGMIIRAPIDDFLEDVKNNIFNYQKIIKIIERDSYVHMNKFTTQIDSSWGLSRISQRN 175

Query: 248 GLNLGNFNKYLYASNSAGKGVTAYVVDTGISVSHLEFGERAKWGKTIPINDYDI-DGNGH 306
            L L     Y Y  N +GKGV  Y++DTGI+ +H+EF  RA WG ++P+ +  + D NGH
Sbjct: 176 HLKLLQDQFYFYDDNGSGKGVDCYILDTGINSNHIEFEGRASWGVSLPVTEPSLEDSNGH 235

Query: 307 GTHCAGTIGSEHYGVAKGANLVAVKVLRSDGSGTMSDVLKGVEWVALEHTKHLEE--SRK 364
           GTHCAG IGS+ YGVAK  NL+AVKVL   G G+MSDV+ G+E+VA  HT       S  
Sbjct: 236 GTHCAGIIGSKTYGVAKETNLIAVKVLDFKGDGSMSDVILGLEFVANSHTNKTNNISSSS 295

Query: 365 DKNSNYKGATANMSLGGGKSPALDQAVNAAVKAGVHFAVAAGNENQDACNSSPAAAENAI 424
             +S +KG+  N+SLG  KSP+LD A+ +A K G+H  VAAGNE++DAC +SPA +   I
Sbjct: 296 SVHSEFKGSVVNLSLGAPKSPSLDIALESAKKIGIHITVAAGNEDEDACMTSPADSPAVI 355

Query: 425 TVGASTLSDDRAYFSNYGKCVDIFAPGLNILSTYIG-TNDATATLSGTSMASPHVAGLLT 483
           TVGAS+ SDDRA+FSN+G CVD+FAPG+NI STYIG  N+ T +LSG+SM+SP V+GL  
Sbjct: 356 TVGASSFSDDRAFFSNWGPCVDVFAPGINIKSTYIGPNNNETLSLSGSSMSSPFVSGLTA 415

Query: 484 YLLSLQPDKGSEFYVPNSELTPLQMKKKIIDYATKNALADLPADTPNKLIYNGG 537
           Y LSLQPD  S+F+  +S +TP Q+K+KIID++T   L +LP DT NKL+YNGG
Sbjct: 416 YYLSLQPDVSSQFH--DSLMTPDQLKRKIIDFSTNGMLKELPLDTANKLVYNGG 467

>CAGL0L13266g Chr12 (1418408..1420147) [1740 bp, 579 aa] {ON} some
           similarities with uniprot|P09232 Saccharomyces
           cerevisiae YEL060c or uniprot|P25036 Saccharomyces
           cerevisiae YOR003w YSP3
          Length = 579

 Score =  259 bits (663), Expect = 2e-78,   Method: Compositional matrix adjust.
 Identities = 161/434 (37%), Positives = 243/434 (55%), Gaps = 26/434 (5%)

Query: 135 RYIIVFKKGVFKEQVDQHLKMMSALFRRLSEEQRPAAAPGASALRDG------FDRVMDT 188
           RYI++FK   +  ++  H++ ++ L  R S    P   P     RD          V+ T
Sbjct: 72  RYIVMFKNFAYTNEIKLHIQTVAKLQLRGSISLAPND-PFFHHTRDKEFSTEELGGVLYT 130

Query: 189 FEVAGAFSGYIATVASPKIVDFIRLNPLVDYVEKDSVVHSLD-ETQNNAPWGLARISHRE 247
           F++   F+GY+      ++V+FIR   +VDYVE DS++   D ET +N+ W LARISHR 
Sbjct: 131 FDIGSGFNGYVGYFTD-EVVEFIRKQSIVDYVEMDSILTIDDKETDSNSHWHLARISHRP 189

Query: 248 GLNLGNFNKYLYASNSAGKGVTAYVVDTGISVSHLEFGERAKWGKTIPINDYDIDGNGHG 307
            L L NFN+Y +  N  G+ + AY++DTG+  +H  + ER   G  I  N+ + D NGHG
Sbjct: 190 KLGLSNFNEYKFDPN-GGQNIDAYILDTGVYQTHAYYIERTIRGIVITPNEDERDMNGHG 248

Query: 308 THCAGTIGSEHYGVAKGANLVAVKVLRSDGSGTMSDVLKGVEWVALEHTKHLEESRKDKN 367
           T  AG +G    GVA+ A L+ VKVL   G GT+S+++KG+ +V   H + +E+      
Sbjct: 249 TEMAGLVGGREVGVARKATLIDVKVLNWQGRGTVSNIIKGLSFVNHHHPQRIEK------ 302

Query: 368 SNYKGATANMSLGGGKSPALDQAVNAAVKAGVHFAVAAGNENQDACNSSPAAAENAITVG 427
           +   GA    S+ G KS +L+ A +  V +G+H  V AG +  +ACNSSPA++   ITV 
Sbjct: 303 NGVLGAVVLFSISGAKSRSLNTAFDKMVSSGIHVVVGAGTKGINACNSSPASSSKPITVA 362

Query: 428 ASTLSDDRAYFSNYGKCVDIFAPGLNILSTY--IGTNDATATLS--GTSMASPHVAGLLT 483
             +++D+     N+G CVDI+ PG  + +TY  +  N  T  +S  G+S A+  VAGLL 
Sbjct: 363 GMSITDEPIDRGNWGSCVDIYGPGDRVRTTYPNLERNQFTNEISVTGSSAAAAQVAGLLA 422

Query: 484 YLLSLQPDKGSEFYVPNSELTPLQMKKKIIDYATKNALADLPADTPNKLIYNG-GFNSTD 542
           Y  SLQP  G+   +P   LTP ++K+++ID+ TK  L +L   +PN + +NG G N   
Sbjct: 423 YFASLQPGLGTPDVIP---LTPEELKERLIDFGTKGKLTNLERMSPNIIAFNGAGGNLDS 479

Query: 543 FW--ASAAAPQSHK 554
           F+   S   P + K
Sbjct: 480 FFNDGSEIVPTATK 493

>TDEL0A07280 Chr1 complement(1276408..1277718) [1311 bp, 436 aa]
           {ON} Anc_6.313 YCR045C
          Length = 436

 Score =  200 bits (509), Expect = 2e-57,   Method: Compositional matrix adjust.
 Identities = 149/401 (37%), Positives = 210/401 (52%), Gaps = 51/401 (12%)

Query: 177 ALRDGFD-RVMDTFEVAGAFSGYIATVASPK-IVDFIRLNPLVDYVEKDSVVHSLDE--- 231
           +++  FD +V  TF   G+F     ++  P+ +VD IR +PLV  V  +    + DE   
Sbjct: 45  SIKSFFDCKVRRTFSF-GSFRAL--SIDVPRDLVDRIRRSPLVAEVVPNIQFVAYDEHDF 101

Query: 232 -----------TQNNAPWGLARISHREGLNL----------GNFNKYLYASNSAGKGVTA 270
                       Q  AP  L+R+S R  L            G+FN Y Y +   G G+ A
Sbjct: 102 EGWNFNSRFIRRQRGAPRHLSRLSRRSQLPYDFEEEDDNYEGSFN-YYYDNKHRGDGINA 160

Query: 271 YVVDTGISVSHLEFGERAKWGKTIPINDYDIDGNGHGTHCAGTIGSEHYGVAKGANLVAV 330
           Y++DTGI   H EFG RA +G+ +   +   DGNGHGTH AG +GS  YGVAK   LV V
Sbjct: 161 YIIDTGIYKEHAEFGGRAVFGEDL-TGEGPGDGNGHGTHVAGIVGSSKYGVAKDITLVEV 219

Query: 331 KVLRSDGSGTMSDVLKGVEWVALEHTKHLEESRKDKNSNYKGATANMSLGGGKSPALDQA 390
           K L + G G ++ V+  +E+ A+ H +         +S  KG   N+SLG  ++  ++QA
Sbjct: 220 KALTAKGQGNLTTVISAMEF-AVNHCR---------SSEGKGCVINLSLGAIRNSVINQA 269

Query: 391 VNAAVKAGVHFAVAAGNENQDACNSSPAAAENAITVGA-STLSDDRAYFSNYGKCVDIFA 449
           V AA +AG+   VAAGN N +AC +SPA+A  AITVGA    +D  A FSN+G CVDIFA
Sbjct: 270 VKAAHEAGIVVVVAAGNSNINACLNSPASAPEAITVGAFDDRTDSIAKFSNWGSCVDIFA 329

Query: 450 PGLNILSTYIGTNDATATLSGTSMASPHVAGLLTYLLSLQPDKGSEFYVPNSELTPLQMK 509
           PG+ + S     +      SGTSMASP + GL   LL    D+G    VP  ++    +K
Sbjct: 330 PGVRVKSLASAPHLKPILFSGTSMASPSITGLAAILL----DEG----VPYDKIKDYILK 381

Query: 510 KKIIDYATKNALADLPADTPNKLIYNGGFNSTDFWASAAAP 550
               D   +  L   P  TPN++ +NG   + D +++A  P
Sbjct: 382 MATNDVFQRRTLVFKPG-TPNRVAFNGVKKNDDKFSNAVYP 421

>SAKL0A02002g Chr1 (176105..177544) [1440 bp, 479 aa] {ON} similar
           to uniprot|P25381 Saccharomyces cerevisiae YCR045C
           Hypothetical ORF
          Length = 479

 Score =  201 bits (510), Expect = 4e-57,   Method: Compositional matrix adjust.
 Identities = 147/393 (37%), Positives = 201/393 (51%), Gaps = 55/393 (13%)

Query: 184 RVMDTFEVAGAFSGYIATVASPK-IVDFIRLNPLVDYVEKDSVVHSLDE----------- 231
           R+  TF   G F G+ A    PK  V+ ++ NPLV  V  +SV +  D+           
Sbjct: 51  RISKTFSF-GKFEGFTADF--PKDFVEKLKKNPLVADVVPNSVFNVFDQKEQIAEEYSRR 107

Query: 232 --TQNNAPWGLARISHREGLNLGN-------FNKYLYASNSAGKGVTAYVVDTGISVSHL 282
              Q +AP  LAR+S R  L           FN Y Y     G  V AY++DTGI   H 
Sbjct: 108 YKVQEDAPRHLARLSRRGPLPYSEEDGWYQEFN-YYYDRKHRGDSVNAYIIDTGIYKQHK 166

Query: 283 EFGERAKWGKTIPINDYDIDGNGHGTHCAGTIGSEHYGVAKGANLVAVKVLRSDGSGTMS 342
           + G RA +G  + + +   D NGHGTH AG +GS  +GVAK  NLV VK L + G G ++
Sbjct: 167 DLGGRAYFGADM-VGEGPGDYNGHGTHVAGIVGSRTFGVAKKVNLVEVKALNAKGQGNLT 225

Query: 343 DVLKGVEWVALEHTKHLEESRKDKNSNYKGATANMSLGGGKSPALDQAVNAAVKAGVHFA 402
            V+  +E+ ++ H K           +     AN+SLG  ++  L+QAV AAV++G+   
Sbjct: 226 SVISSIEF-SVNHCKK----------SGMLCVANLSLGSLRNTVLNQAVEAAVESGLVVV 274

Query: 403 VAAGNENQDACNSSPAAAENAITVGA-STLSDDRAYFSNYGKCVDIFAPGLNILSTYIGT 461
           VAAGN N +AC +SPA+A +AITVGA    +D  A FSN+G CVD+FA G+ ++S     
Sbjct: 275 VAAGNSNVNACWNSPASAISAITVGAFDDRTDTIAKFSNWGMCVDVFASGVKVMSLSNMP 334

Query: 462 NDATATLSGTSMASPHVAGLLTYLLSLQPDKGSEFYVPNSELTPLQMKKKIIDYATKNAL 521
                  SGTSMASP VAGL   LL             +S + P  +K+KIID AT+N  
Sbjct: 335 PFKPVAYSGTSMASPSVAGLAAVLL-------------DSGIDPPDIKQKIIDLATENVF 381

Query: 522 AD----LPADTPNKLIYNGGFNSTDFWASAAAP 550
                     TPN++ +NG     D +  A  P
Sbjct: 382 QKRTLVFKPGTPNRIAFNGVRKEDDIFEEAVYP 414

>Kpol_1028.61 s1028 (138312..139868) [1557 bp, 518 aa] {ON}
           (138312..139868) [1557 nt, 519 aa]
          Length = 518

 Score =  198 bits (503), Expect = 7e-56,   Method: Compositional matrix adjust.
 Identities = 136/323 (42%), Positives = 176/323 (54%), Gaps = 42/323 (13%)

Query: 232 TQNNAPWGLARISHREGL--------NLGNFNKYLYASNSAGKGVTAYVVDTGISVSHLE 283
            Q  AP  L RIS R  L            F  Y Y     G  + AY++DTGI   H +
Sbjct: 153 VQYGAPRHLGRISSRGQLPFDIRNENEFKEFIHYYYEDQFKGSNIAAYILDTGIYAEHPD 212

Query: 284 FGERAKWGKTIPINDYDIDGNGHGTHCAGTIGSEHYGVAKGANLVAVKVLRSDGSGTMSD 343
           F  R   G  +   +   D NGHGTH AG +GS+ +GVAK   LV VKVL   GSG ++ 
Sbjct: 213 FENRVIVGADMT-GEGPGDSNGHGTHVAGILGSKTFGVAKNVTLVEVKVLTGRGSGNLTT 271

Query: 344 VLKGVEWVALEHTKHLEESRKDKNSNYKGATANMSLGGGKSPALDQAVNAAVKAGVHFAV 403
           VL G+++ A++H + + E++       K   ANMSLG  ++  ++ A++ A KAG+   V
Sbjct: 272 VLSGIQF-AVDHCRLMRETQG------KQCVANMSLGTVRNNIINAAIHEAFKAGLIMVV 324

Query: 404 AAGNENQDACNSSPAAAENAITVGASTLSDDR----AYFSNYGKCVDIFAPGLNI--LST 457
           AAGN N  AC +SPA+A+NAITVGA    DDR    AYFSN+G CVDIFAPG+ I  LS 
Sbjct: 325 AAGNSNVSACWTSPASAKNAITVGA---FDDRTETIAYFSNWGACVDIFAPGVKIRSLSN 381

Query: 458 YIGTNDATATLSGTSMASPHVAGLLTYLLSLQPDKGSEFYVPNSELTPLQMKKKIIDYAT 517
              ++    T SGTSMASP VAGL   LL    DKG E         P  +K K++  +T
Sbjct: 382 SPESHHKHVTHSGTSMASPVVAGLAAILL----DKGVE---------PFDVKDKLLHLST 428

Query: 518 KNALADLPA----DTPNKLIYNG 536
           K+    L       TPNK+ YNG
Sbjct: 429 KDVFNKLTLFFKYGTPNKIAYNG 451

>NCAS0D04390 Chr4 complement(836796..838274) [1479 bp, 492 aa] {ON}
           Anc_6.313
          Length = 492

 Score =  197 bits (501), Expect = 1e-55,   Method: Compositional matrix adjust.
 Identities = 146/401 (36%), Positives = 207/401 (51%), Gaps = 81/401 (20%)

Query: 183 DRVMDTFEVAGAFSGYIATVASPKIVDFIRLNPLVDYVEKDSVVHSLDETQNN------- 235
           D++  TF + G+F G+   + +  +++ I+ NPLV  V  +  VH+ ++ ++        
Sbjct: 56  DKIGKTFSI-GSFKGFTVDL-TDDLLEAIKKNPLVSDVVPNLRVHAFEDVKDEEGDDDGG 113

Query: 236 ------------------APWGLARISHREGLNLGNFN---------KYLYASNSAGKGV 268
                             AP  LAR+S R+ L   +F          KY Y   S G  V
Sbjct: 114 QFDNKMQKGKCSVKVQYGAPRHLARLSRRKQLPY-DFEDKEAYLDSLKYFYDKRSQGASV 172

Query: 269 TAYVVDTGISVSHLEFGERAKWGKTIPINDYDIDG----NGHGTHCAGTIGSEHYGVAKG 324
            AY++D+GI + H EF      G+ IP  D   +G    NGHGTH AG +GS+ YGVAK 
Sbjct: 173 NAYIIDSGIYLEHEEFN-----GRAIPGIDLTGEGSGDYNGHGTHVAGIVGSKSYGVAKK 227

Query: 325 ANLVAVKVLRSDGSGTMSDVLKGVEWVALEHTKHLEESRKDKNSNYKG-ATANMSLGGGK 383
             L+ +KVL   G G+++ VL G+E+      KH +E+ K      KG   AN+SLG  +
Sbjct: 228 VKLIEIKVLNRLGQGSLAMVLGGIEFA----VKHCQETSK------KGRCVANLSLGSMR 277

Query: 384 SPALDQAVNAAVKAGVHFAVAAGNENQDACNSSPAAAENAITVGASTLSDDR----AYFS 439
           +  L++A+ AA+ AG+   VAAGN N +AC  SPA+A  AITVGA    DDR    A FS
Sbjct: 278 TAILNKAIKAAIDAGLVVVVAAGNNNLNACWYSPASAPEAITVGA---FDDRIDAIAKFS 334

Query: 440 NYGKCVDIFAPGLNILSTYIGTNDATATLSGTSMASPHVAGLLTYLLSLQPDKGSEFYVP 499
           N+G+C+DIFAPG+ I S  I  +    T SGTSMASP VAGL    L    D+G      
Sbjct: 335 NWGQCLDIFAPGVVIKSLSIFKDKEDVTYSGTSMASPTVAGLAALTL----DQG------ 384

Query: 500 NSELTPLQMKKKIIDYATKNALAD----LPADTPNKLIYNG 536
              ++  ++K  I++  T N            TPNK+ +NG
Sbjct: 385 ---VSAEEVKDYILEMGTDNVFHRRSLLFKPGTPNKICFNG 422

>Smik_3.149 Chr3 complement(206258..207733) [1476 bp, 491 aa] {ON}
           YCR045C (REAL)
          Length = 491

 Score =  196 bits (498), Expect = 2e-55,   Method: Compositional matrix adjust.
 Identities = 137/325 (42%), Positives = 182/325 (56%), Gaps = 33/325 (10%)

Query: 227 HSLDETQN-----NAPWGLARISHREGLNLGNFNK--------YLYASNSAGKGVTAYVV 273
            +LDE QN     +AP  LARIS    L     +K        Y Y  +  G+ V AY++
Sbjct: 114 ENLDEEQNITYQSDAPRHLARISRHYQLPFDIEDKERYKSWFNYYYEDDYQGQDVNAYIM 173

Query: 274 DTGISVSHLEFGERAKWGKTIPINDYDIDGNGHGTHCAGTIGSEHYGVAKGANLVAVKVL 333
           DTGI   H EF +R   G  +    +  D NGHGTH AG +GS+ YG AK  NLV VKVL
Sbjct: 174 DTGIFADHPEFEDRVIQGIDLTKEGFG-DQNGHGTHVAGLVGSKTYGAAKKVNLVEVKVL 232

Query: 334 RSDGSGTMSDVLKGVEWVALEHTKHLEESRKDKNSNYKGATANMSLGGGKSPALDQAVNA 393
             DGSG  S+VL G+E++ +EH   +   +  K        AN+SLG  +SP ++ AV  
Sbjct: 233 GKDGSGEASNVLSGLEFI-VEHCTRVSRPQGKK------CVANLSLGSFRSPIINMAVEG 285

Query: 394 AVKAGVHFAVAAGNENQDACNSSPAAAENAITVGA-STLSDDRAYFSNYGKCVDIFAPGL 452
           A++ G+ F  AAGN N DA  +SPA+AEN ITVGA     D  A FSN+G CV+IFAPG+
Sbjct: 286 AIEEGIVFVAAAGNFNLDAYWASPASAENVITVGAFDDHIDTIAKFSNWGPCVNIFAPGV 345

Query: 453 NILS-TYIGTNDATATLSGTSMASPHVAGLLTYLLSLQPDKGSEFYVPNSELTPLQMKKK 511
            I S +++  ND T  LSGTSM++P V G+   LLS    KG E  +   EL  L  +  
Sbjct: 346 EIESLSHLNFND-TLVLSGTSMSTPIVTGVAAVLLS----KGIEPEMIAQELEYLSTR-- 398

Query: 512 IIDYATKNALADLPADTPNKLIYNG 536
             +   +  L   P+ TPN+++YNG
Sbjct: 399 --NVFHRRTLFFKPS-TPNQILYNG 420

>KLTH0A06094g Chr1 complement(513667..515157) [1491 bp, 496 aa] {ON}
           similar to uniprot|P25381 Saccharomyces cerevisiae
           YCR045C Hypothetical ORF
          Length = 496

 Score =  195 bits (496), Expect = 5e-55,   Method: Compositional matrix adjust.
 Identities = 136/336 (40%), Positives = 181/336 (53%), Gaps = 48/336 (14%)

Query: 233 QNNAPWGLARISHREGL-----NLG----NFNKYLYASNSAGKGVTAYVVDTGISVSHLE 283
           Q  AP  LARIS R  L     N+     NF+ Y Y    +G  V AYV+DTGI   H +
Sbjct: 135 QKKAPRHLARISRRTALPYDPENISVPATNFS-YYYDDEFSGTCVNAYVIDTGIYKEHPQ 193

Query: 284 FGERAKWGKTIPINDYDIDGNGHGTHCAGTIGSEHYGVAKGANLVAVKVLRSDGSGTMSD 343
              RAK+G  + + +   D NGHGTH AG IGS  +GVAK  +L+ VK L + G G ++ 
Sbjct: 194 LEGRAKFGADL-VGEGPGDFNGHGTHVAGLIGSRKFGVAKDVSLIEVKALNAKGQGNLTS 252

Query: 344 VLKGVEWVALEHTKHLEESRKDKNSNYKGATANMSLGGGKSPALDQAVNAAVKAGVHFAV 403
           V+  +E+       H  +SR+       G  AN+SLG  ++  L+QAV AA++AGV   V
Sbjct: 253 VISAIEFT----VNHCRKSRR-------GCVANLSLGSFRNTVLNQAVEAALEAGVVIVV 301

Query: 404 AAGNENQDACNSSPAAAENAITVGASTLSDDR----AYFSNYGKCVDIFAPGLNILSTYI 459
           AAGN N +AC SSPA++ +AITVGA    DDR    A FSN+G CVDIFAPG+ I S   
Sbjct: 302 AAGNSNANACWSSPASSLSAITVGA---FDDRTDTIARFSNWGNCVDIFAPGVKIESLSN 358

Query: 460 GTNDATATLSGTSMASPHVAGLLTYLLSLQPDKGSEFYVPNSELTPLQMKKKIIDYAT-- 517
                    SGTSMASP V+G++  LL             +S + P  +K ++ID AT  
Sbjct: 359 VPPFKPVAFSGTSMASPIVSGMVANLL-------------DSGIHPFDIKTELIDLATDS 405

Query: 518 ---KNALADLPADTPNKLIYNGGFNSTDFWASAAAP 550
              K  L   P  TPN++ + G   + D +  A  P
Sbjct: 406 VFHKRTLLFKPG-TPNRVAFTGIDKTDDVYEDAVYP 440

>YCR045C Chr3 complement(208135..209610) [1476 bp, 491 aa] {ON}
           RRT12Probable subtilisin-family protease with a role in
           formation of the dityrosine layer of spore walls;
           localizes to the spore wall and also the nuclear
           envelope and ER region in mature spores
          Length = 491

 Score =  193 bits (490), Expect = 3e-54,   Method: Compositional matrix adjust.
 Identities = 132/318 (41%), Positives = 180/318 (56%), Gaps = 36/318 (11%)

Query: 233 QNNAPWGLARISHREGL--NLGNFNKY------LYASNSAGKGVTAYVVDTGISVSHLEF 284
           Q +AP  LARIS    L  ++G+ ++Y       Y  +  G+ V AY++DTGI   H EF
Sbjct: 125 QPDAPRHLARISRHYQLPFDVGDKDRYKSWFNYYYEHDYQGQDVNAYIMDTGIFADHPEF 184

Query: 285 GERAKWGKTIPINDYDIDGNGHGTHCAGTIGSEHYGVAKGANLVAVKVLRSDGSGTMSDV 344
            +R   G  +    +  D NGHGTH AG +GS+ YG AK  NLV VKVL  DGSG  S+V
Sbjct: 185 EDRVIQGIDLTKEGFG-DQNGHGTHVAGLVGSKTYGAAKRVNLVEVKVLGKDGSGEASNV 243

Query: 345 LKGVEWVALEHTKHLEESRKDKNSNYKGATANMSLGGGKSPALDQAVNAAVKAGVHFAVA 404
           L G+E++ +EH   +   +  K        AN+SLG  +SP ++ AV  A++ G+ F  A
Sbjct: 244 LSGLEFI-VEHCTKVSRPQGKK------CVANLSLGSFRSPIINMAVEGAIEEGIVFVAA 296

Query: 405 AGNENQDACNSSPAAAENAITVGA-STLSDDRAYFSNYGKCVDIFAPGLNILS-TYIGTN 462
           AGN N DA  +SPA+AEN ITVGA     D  A FSN+G CV+IFAPG+ I S +++  N
Sbjct: 297 AGNFNLDAYWASPASAENVITVGAFDDHIDTIAKFSNWGPCVNIFAPGVEIESLSHLNYN 356

Query: 463 DATATLSGTSMASPHVAGLLTYLLSLQPDKGSEFYVPNSELTPLQMKKKIIDYATKNALA 522
           D T  LSGTSM++P V G+   LLS    KG E         P  + ++I   +T+N   
Sbjct: 357 D-TLILSGTSMSTPIVTGVAAILLS----KGIE---------PEMIAQEIEYLSTRNVFH 402

Query: 523 D----LPADTPNKLIYNG 536
                    TPN+++YNG
Sbjct: 403 RRTLFFKPSTPNQILYNG 420

>Kpol_1018.5 s1018 (14365..15762) [1398 bp, 465 aa] {ON}
           (14365..15762) [1398 nt, 466 aa]
          Length = 465

 Score =  192 bits (488), Expect = 4e-54,   Method: Compositional matrix adjust.
 Identities = 129/336 (38%), Positives = 184/336 (54%), Gaps = 45/336 (13%)

Query: 233 QNNAPWGLARISHREGL--NLGNFNKY------LYASNSAGKGVTAYVVDTGISVSHLEF 284
           Q  AP  L+R+S R  L  ++ N ++Y       + +   G  V AY++DTGI   H EF
Sbjct: 115 QREAPRHLSRLSRRGQLPYDINNIDRYDNAFDYYFDAKYQGSSVNAYIIDTGIYKEHPEF 174

Query: 285 GERAKWGKTIPINDYDIDGNGHGTHCAGTIGSEHYGVAKGANLVAVKVLRSDGSGTMSDV 344
             R K+   +   +   D NGHGTH AG +GS+ +GVAK  N++ VK L   G G +S +
Sbjct: 175 EGRVKFAIDLT-QEGPGDENGHGTHIAGIVGSKTFGVAKKVNIIDVKALDKKGQGQLSTI 233

Query: 345 LKGVEWVALEHTKHLEESRKDKNSNYKGATANMSLGGGKSPALDQAVNAAVKAGVHFAVA 404
           LK +E+      +H +ES   K        AN+S G  ++  +D+A+  A  AG+   VA
Sbjct: 234 LKALEFT----IRHCKESVDKK------CVANLSFGAIRTAIIDEAIKEAHNAGIVLVVA 283

Query: 405 AGNENQDACNSSPAAAENAITVGASTLSDDR----AYFSNYGKCVDIFAPGLNILS-TYI 459
           AGN N DAC +SPA++++ ITVGA    DDR    A FSN+G CVD+FAPG+ + S ++I
Sbjct: 284 AGNSNIDACWNSPASSKDVITVGA---FDDRTETIARFSNWGSCVDVFAPGVKVKSLSHI 340

Query: 460 GTNDATATLSGTSMASPHVAGLLTYLLSLQPDKGSEFYVPNSELTPLQMKKKIIDYATKN 519
             +D    LSGTSMASP V+G+   LL    DKG         L P  +K KII+ +TKN
Sbjct: 341 NGSDVL-LLSGTSMASPSVSGIAAILL----DKG---------LNPKFVKSKIIESSTKN 386

Query: 520 ALAD----LPADTPNKLIYNGGFNSTDFWASAAAPQ 551
                   +  +TPN +++NG     D +  A  P+
Sbjct: 387 IFHQGTIMIKPNTPNLIVFNGIEKMDDSFEGARFPR 422

>KAFR0J02450 Chr10 complement(469452..470888) [1437 bp, 478 aa] {ON}
           Anc_6.313 YCR045C
          Length = 478

 Score =  192 bits (489), Expect = 4e-54,   Method: Compositional matrix adjust.
 Identities = 144/407 (35%), Positives = 205/407 (50%), Gaps = 53/407 (13%)

Query: 175 ASALRDGFDRVMDTFEVAGAFSGYIATVA---SPKIVDFIRLNPLVDYVEKDSVVHSLDE 231
            ++L+D     M      G F G    +A     KI++ ++ NPLV  +  + +  + + 
Sbjct: 43  TTSLKDYIGSRMGRTLKIGKFKGITMNIAHNKKQKIMEKLKQNPLVADIVPNILFKAFEN 102

Query: 232 ---------------TQNNAPWGLARISHREGL-----NLGNFNK---YLYASNSAGKGV 268
                           Q+ AP  LARIS R+ L     N+ ++ K   Y Y     G  V
Sbjct: 103 DELNNEQTQEYVSHVVQSEAPRHLARISRRDKLPYDFTNVSSYKKSFNYYYGKEHKGADV 162

Query: 269 TAYVVDTGISVSHLEFGERAKWGKTIPINDYDIDGNGHGTHCAGTIGSEHYGVAKGANLV 328
            AY++D+G+S +  +F  R ++G      D + D NGHGTH AG +GS+ YGVAKG  +V
Sbjct: 163 RAYILDSGVSRNLTDFEGRVEFGFDFT-GDGEGDSNGHGTHVAGLVGSKTYGVAKGVTMV 221

Query: 329 AVKVLRSDGSGTMSDVLKGVEWVALEHTKHLEESRKDKNSNYKGATANMSLGGGKSPALD 388
            VK L   G GT+  VL  +E+   +  +H E          K   AN+SLG  K+  ++
Sbjct: 222 DVKCLDEIGFGTLITVLSAIEFAVNDCHEHPE----------KRCVANLSLGSFKNAIIN 271

Query: 389 QAVNAAVKAGVHFAVAAGNENQDACNSSPAAAENAITVGASTLSDDR----AYFSNYGKC 444
           +A+ AA + GV   VAAGN N +AC +SPA+AE AITVGA    DDR    A FSN+G C
Sbjct: 272 KAIQAATEDGVVMVVAAGNFNINACWTSPASAEEAITVGA---FDDRIDTIAKFSNWGPC 328

Query: 445 VDIFAPGLNILSTYIGTNDATATLSGTSMASPHVAGLLTYLLSLQPDKGSEFYVPNSELT 504
           VDI+APG+ + S          + SGTSMASP V G +  LL    DKG    +PN ++ 
Sbjct: 329 VDIYAPGVAVESLANFPMVKNISYSGTSMASPIVCGQVAILL----DKG----IPNDDIK 380

Query: 505 PLQMKKKIIDYATKNALADLPADTPNKLIYNGGFNSTDFWASAAAPQ 551
              +K    D   K  L   P +TPN++++NG     D +     PQ
Sbjct: 381 STLIKMATDDVFQKRTLLFKP-NTPNRVLFNGIEKEDDQYKEYIYPQ 426

>Suva_3.84 Chr3 complement(121533..123116) [1584 bp, 527 aa] {ON}
           YCR045C (REAL)
          Length = 527

 Score =  193 bits (490), Expect = 6e-54,   Method: Compositional matrix adjust.
 Identities = 131/326 (40%), Positives = 178/326 (54%), Gaps = 39/326 (11%)

Query: 229 LDETQN-----NAPWGLARIS--HREGLNLGNFNKY------LYASNSAGKGVTAYVVDT 275
           +DE QN     +AP  LARIS  H+   +L + ++Y       Y     G+GV AY++DT
Sbjct: 152 IDEAQNVTYQPDAPRHLARISRHHQLPFDLEDKDRYKSWFNYYYEDEYQGQGVNAYIMDT 211

Query: 276 GISVSHLEFGERAKWGKTIPINDYDIDGNGHGTHCAGTIGSEHYGVAKGANLVAVKVLRS 335
           GI   H EF +R   G  +    +  D NGHGTH AG +GS  +G AK  +LV VKVL  
Sbjct: 212 GIHAEHPEFEDRVIQGVDLTKEGFG-DENGHGTHVAGLVGSRTFGAAKKVSLVEVKVLGK 270

Query: 336 DGSGTMSDVLKGVEWVALEHTKHLEESRKDKNSNYKGATANMSLGGGKSPALDQAVNAAV 395
           DGSG  S+VL G+E++       +E   K      K   AN+SLG  +SP ++ AV  A+
Sbjct: 271 DGSGEASNVLSGLEFI-------VEHCTKVSRPQGKKCVANLSLGSFRSPIINMAVEGAI 323

Query: 396 KAGVHFAVAAGNENQDACNSSPAAAENAITVGA-STLSDDRAYFSNYGKCVDIFAPGLNI 454
           + G+ F  AAGN N DA  +SPA+AEN ITVGA     D  A FSN+G CV+IFAPG+ I
Sbjct: 324 EEGIVFVAAAGNFNLDAYWASPASAENVITVGAFDDHIDTIAKFSNWGPCVNIFAPGVEI 383

Query: 455 LSTYIGTNDATATLSGTSMASPHVAGLLTYLLSLQPDKGSEFYVPNSELTPLQMKKKIID 514
            S     ++ +  LSGTSM++P V G+   LLS    KG E         P  + ++I  
Sbjct: 384 ESLSHLNDNESLVLSGTSMSTPIVTGVAAVLLS----KGIE---------PELIAQEIEY 430

Query: 515 YATKNALAD----LPADTPNKLIYNG 536
            +T+N            TPN+++YNG
Sbjct: 431 LSTRNVFHRRTLFFKPSTPNQILYNG 456

>ZYRO0D08822g Chr4 (754340..755812) [1473 bp, 490 aa] {ON} similar
           to uniprot|P25381 Saccharomyces cerevisiae YCR045C
           Hypothetical ORF
          Length = 490

 Score =  192 bits (487), Expect = 9e-54,   Method: Compositional matrix adjust.
 Identities = 155/469 (33%), Positives = 216/469 (46%), Gaps = 94/469 (20%)

Query: 128 VGTADHDRYIIVFKK----GVFKEQVDQHLKMMSALFRRLSEEQRPAAAPGASALRDGFD 183
           +G+A  + Y+I FK       F      H K     F                      +
Sbjct: 12  IGSASAEEYLIRFKSPDGFQFFMNSAKDHTKNFKEFFH---------------------N 50

Query: 184 RVMDTFEVAGAFSGYIATVASPKIVDFIRLNPLVDYVEKDSVVHSLDET----------- 232
           ++  TF   G+F G I    S  +V+ IR NPLV  +  +    + D+            
Sbjct: 51  KISHTFSF-GSFRG-ITVDISQDVVEKIRNNPLVADLVPNIQFKAFDDVLGVQELQQNYH 108

Query: 233 -----------------QNNAPWGLARISHREGLNLG---------NFNKYLYASNSAGK 266
                            Q  AP  LAR+S R  L            +FN Y Y  +  G+
Sbjct: 109 GDNLDDEDGFNPFKVKVQGEAPRHLARLSRRAPLPYEFDDELRYEESFNYYYYKWHK-GR 167

Query: 267 GVTAYVVDTGISVSHLEFGERAKWGKTIPINDYDIDGNGHGTHCAGTIGSEHYGVAKGAN 326
            + AY++DTGI   H +F  RA +G+     +   D NGHGTH AG +GS ++GVAK  N
Sbjct: 168 NINAYIIDTGIYKEHKDFCGRAIFGRDF-TGEGPGDRNGHGTHVAGIVGSSNFGVAKKVN 226

Query: 327 LVAVKVLRSDGSGTMSDVLKGVEWVALEHTKHLEESRKDKNSNYKGATANMSLGGGKSPA 386
           L+ VK L + G G ++ V+  VE+ A+ H K         +S  KG  AN+SLG  ++  
Sbjct: 227 LIEVKALNNRGQGNLTTVISAVEF-AVNHCK---------SSGKKGCVANLSLGAVRNSV 276

Query: 387 LDQAVNAAVKAGVHFAVAAGNENQDACNSSPAAAENAITVGA-STLSDDRAYFSNYGKCV 445
           ++QA+ AA +AG+   VAAGN N +AC +SPA+A  AITVGA    +D  A FSN+G CV
Sbjct: 277 INQAIKAAHEAGLIIVVAAGNSNINACWNSPASAPEAITVGAFDDRTDTIAKFSNWGPCV 336

Query: 446 DIFAPGLNILSTYIGTNDATATLSGTSMASPHVAGLLTYLLSLQPDKGSEFYVPNSELTP 505
           DIFA G+ + S            SGTSMASP V GL+  LL    DKG E         P
Sbjct: 337 DIFASGVKVKSLSAFPPHKPIAFSGTSMASPSVTGLVAILL----DKGVE---------P 383

Query: 506 LQMKKKIIDYATKNALAD----LPADTPNKLIYNGGFNSTDFWASAAAP 550
             +K K+++ AT + L          TPN++ +NG     D +  A  P
Sbjct: 384 ENIKAKLVELATHDLLQRRTLFFKPGTPNRIAFNGMEREDDEYDDAVYP 432

>Skud_3.124 Chr3 complement(192464..194086) [1623 bp, 540 aa] {ON}
           YCR045C (REAL)
          Length = 540

 Score =  189 bits (480), Expect = 2e-52,   Method: Compositional matrix adjust.
 Identities = 132/326 (40%), Positives = 175/326 (53%), Gaps = 39/326 (11%)

Query: 229 LDETQN-----NAPWGLARISHREGLNLGNFNK--------YLYASNSAGKGVTAYVVDT 275
           +DE QN     +AP  LARIS    L     +K        Y Y  +  G+ V AY++DT
Sbjct: 165 IDEAQNITYQSDAPRHLARISRHYQLPFDIEDKNRYKSWFNYYYEDDYLGQDVNAYIMDT 224

Query: 276 GISVSHLEFGERAKWGKTIPINDYDIDGNGHGTHCAGTIGSEHYGVAKGANLVAVKVLRS 335
           GI   H EF +R   G  +    +  D NGHGTH AG +GS+ YG AK  NLV VKVL  
Sbjct: 225 GIFSDHPEFEDRVIQGIDLTKEGFG-DQNGHGTHVAGLVGSKTYGAAKKVNLVEVKVLGK 283

Query: 336 DGSGTMSDVLKGVEWVALEHTKHLEESRKDKNSNYKGATANMSLGGGKSPALDQAVNAAV 395
           DGSG  S+VL G+E++ +EH   +   +  K        AN+SLG  +SP ++ AV  A+
Sbjct: 284 DGSGEASNVLSGLEFI-VEHCTRVSRPQGKK------CVANLSLGSFRSPIINMAVEGAI 336

Query: 396 KAGVHFAVAAGNENQDACNSSPAAAENAITVGA-STLSDDRAYFSNYGKCVDIFAPGLNI 454
           + G+ F  AAGN N DA  +SPA+AEN ITVGA     D  A FSN+G CV+IFAPG+ I
Sbjct: 337 EEGIVFVAAAGNFNLDAYWASPASAENVITVGAFDDHIDTIAKFSNWGPCVNIFAPGVEI 396

Query: 455 LSTYIGTNDATATLSGTSMASPHVAGLLTYLLSLQPDKGSEFYVPNSELTPLQMKKKIID 514
            S      + T  LSGTSM++P V G+   LLS    KG E         P  + ++I  
Sbjct: 397 ESLSHLNYEDTLILSGTSMSTPIVTGVAAVLLS----KGIE---------PALIAQEIEY 443

Query: 515 YATKNALAD----LPADTPNKLIYNG 536
            +T+N            T N+++YNG
Sbjct: 444 LSTRNVFHRRTLFFKPSTANQILYNG 469

>CAGL0L10802g Chr12 complement(1159230..1160783) [1554 bp, 517 aa]
           {ON} similar to uniprot|P25381 Saccharomyces cerevisiae
           YCR045c
          Length = 517

 Score =  187 bits (474), Expect = 9e-52,   Method: Compositional matrix adjust.
 Identities = 125/338 (36%), Positives = 176/338 (52%), Gaps = 50/338 (14%)

Query: 231 ETQNNAPWGLARISHREGLNL---------GNFNKYLYASNSAGKGVTAYVVDTGISVSH 281
           +TQ+ AP  LAR+S R  L            +FN Y Y  +  G+ V AYV+D+G+ + H
Sbjct: 158 KTQSEAPRHLARLSRRSQLPYDFNDPTRYESDFNYYYYGWHQ-GRSVNAYVLDSGVMIDH 216

Query: 282 LEFGERAKWGKTIPINDYDIDGNGHGTHCAGTIGSEHYGVAKGANLVAVKVLRSDGSGTM 341
            +F  RA +G     +    D NGHGTH AG IGS+ YGV+K  N++ VKVL S GSGT+
Sbjct: 217 CDFEGRAYYGADFIRSGNSGDQNGHGTHVAGLIGSKTYGVSKKVNIIDVKVLDSVGSGTL 276

Query: 342 SDVLKGVEWVALEHTKHL---------------EESRKDKNSNYKGATANMSLGGGKSPA 386
             V+ G+E+V+  H  +                 E   D +   K    N+SLG  +S  
Sbjct: 277 DTVMSGLEFVS-NHCNYKGKQGKQGKQGKPVWGSEDSHDDDVESKRCVINLSLGTFRSTI 335

Query: 387 LDQAVNAAVKAGVHFAVAAGNENQDACNSSPAAAENAITVGASTLSDDR----AYFSNYG 442
           +++A+   +K G+   VAAGN N +AC +SPA+  + ITVGA    DDR    A FSN+G
Sbjct: 336 INEAIEELIKQGIVVVVAAGNSNMNACWTSPASVADVITVGA---FDDRIDSIAKFSNWG 392

Query: 443 KCVDIFAPGLNILSTYIGTNDATATLSGTSMASPHVAGLLTYLLSLQPDKGSEFYVPNSE 502
            CVDIFAPG+ + S            +GTSMA+P V GL+  LL             +S 
Sbjct: 393 NCVDIFAPGVLVKSLSNKFPYYPIEQTGTSMATPIVTGLVALLL-------------DSG 439

Query: 503 LTPLQMKKKIIDYATKNALAD----LPADTPNKLIYNG 536
           + P Q+KK++ + AT N            TPN++ +NG
Sbjct: 440 IKPTQIKKRLNELATDNIFPRRTLLFKPGTPNRIAFNG 477

>AAR069W Chr1 (460781..463087) [2307 bp, 768 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YCR045C
          Length = 768

 Score =  189 bits (480), Expect = 5e-51,   Method: Compositional matrix adjust.
 Identities = 131/332 (39%), Positives = 179/332 (53%), Gaps = 41/332 (12%)

Query: 233 QNNAPWGLARISHREGLNLG-------NFNKYLYASNSAGKGVTAYVVDTGISVSHLEFG 285
           Q +AP  LAR   R GL           FN Y Y     G+GV  YV+D+GI  SH EF 
Sbjct: 428 QVDAPRHLARTCRRTGLPFDPSGDKEYTFN-YYYDEEHLGEGVNVYVLDSGIYKSHPEFD 486

Query: 286 ERAKWGKTIPINDYDIDGNGHGTHCAGTIGSEHYGVAKGANLVAVKVLRSDGSGTMSDVL 345
            RA +G      +   D NGHGTH AG +GS  +G+AK AN+  +KV+  DG G+ S+++
Sbjct: 487 GRAHFGIDT-TKEGPGDLNGHGTHVAGLVGSRTFGIAKKANIYEIKVMTVDGRGSTSNII 545

Query: 346 KGVEWVALEHTKHLEESRKDKNSNYKGATANMSLGG---GKSPALDQAVNAAVKAGVHFA 402
            GVE+      KH ++S        K   ANMSLGG   G S ALD AV AA++ G+ F 
Sbjct: 546 AGVEFA----VKHCQQSG-------KRCVANMSLGGLSFGHS-ALDSAVEAAIEEGLVFV 593

Query: 403 VAAGNENQDACNSSPAAAENAITVGA-STLSDDRAYFSNYGKCVDIFAPGLNILSTYIGT 461
           VAAGN  + AC  SPA  + AITVGA    SD  A FSNYGKCVDIFAPG+ + S     
Sbjct: 594 VAAGNSKERACWYSPAKVKTAITVGAFDDRSDIIASFSNYGKCVDIFAPGVAVASLSNSP 653

Query: 462 NDATATLSGTSMASPHVAGLLTYLLSLQPDKGSEFYVPNSELTPLQMKKKIIDYATKNAL 521
           ++    L+GTSM++P  AG++  LL    D+G E         P ++K  ++  +TK   
Sbjct: 654 SNTMRVLNGTSMSAPITAGVVAVLL----DQGIE---------PHEVKDHLLSISTKGLF 700

Query: 522 AD---LPADTPNKLIYNGGFNSTDFWASAAAP 550
                + + TP++ ++ G     D +++   P
Sbjct: 701 HKRRLVSSRTPDRALFTGVKREDDSFSTEKFP 732

>Ecym_2105 Chr2 (185014..186846) [1833 bp, 610 aa] {ON} similar to
           Ashbya gossypii AAR069W
          Length = 610

 Score =  184 bits (467), Expect = 4e-50,   Method: Compositional matrix adjust.
 Identities = 132/332 (39%), Positives = 179/332 (53%), Gaps = 41/332 (12%)

Query: 233 QNNAPWGLARISHREGLNLG-------NFNKYLYASNSAGKGVTAYVVDTGISVSHLEFG 285
           Q+ AP  LAR   R GL           FN Y Y +   G+ V  Y++D+GI  SH EF 
Sbjct: 270 QSGAPRHLARNCRRSGLPFDTSGSKDYEFN-YYYDAEHLGETVNVYILDSGIHKSHPEFE 328

Query: 286 ERAKWGKTIPINDYDIDGNGHGTHCAGTIGSEHYGVAKGANLVAVKVLRSDGSGTMSDVL 345
            RA +G     N+   D NGHGTH AG +GS+ YG AK A +  VKV+  DG G+ S+++
Sbjct: 329 GRAVFGIDT-TNEGPGDLNGHGTHVAGLVGSKTYGAAKKATIYEVKVMTVDGRGSTSNII 387

Query: 346 KGVEWVALEHTKHLEESRKDKNSNYKGATANMSLGG---GKSPALDQAVNAAVKAGVHFA 402
            GVE+      KH ++S K          ANMSLGG   G S ALD AV AA++ G+ F 
Sbjct: 388 AGVEFAV----KHCQQSGKK-------CVANMSLGGLSFGHS-ALDSAVEAAIEEGLVFV 435

Query: 403 VAAGNENQDACNSSPAAAENAITVGA-STLSDDRAYFSNYGKCVDIFAPGLNILSTYIGT 461
           VAAGN  + AC  SPA  + AITVGA    SD  A FSNYGKCVDIFAPG+ + S     
Sbjct: 436 VAAGNSKERACWYSPAKVKTAITVGAFDDRSDIIASFSNYGKCVDIFAPGVAVSSLSNSP 495

Query: 462 NDATATLSGTSMASPHVAGLLTYLLSLQPDKGSEFYVPNSELTPLQMKKKIIDYATKNAL 521
            +    L+GTSM++P  AG++  LL    D+G +            +K+++ID +TK   
Sbjct: 496 YNTVRVLNGTSMSAPITAGVVAVLL----DQGVKHE---------DVKERLIDLSTKGVF 542

Query: 522 AD---LPADTPNKLIYNGGFNSTDFWASAAAP 550
                + + TP++ ++NG     D + +   P
Sbjct: 543 HRRRLVSSRTPDRTLFNGVPQEDDVFNAIEYP 574

>Kwal_23.6183 s23 complement(1485143..1486624) [1482 bp, 493 aa]
           {ON} YCR045C - Hypothetical ORF [contig 15] FULL
          Length = 493

 Score =  181 bits (460), Expect = 5e-50,   Method: Compositional matrix adjust.
 Identities = 134/333 (40%), Positives = 182/333 (54%), Gaps = 42/333 (12%)

Query: 233 QNNAPWGLARISHREGL---------NLGNFNKYLYASNSAGKGVTAYVVDTGISVSHLE 283
           Q NAP  LARIS R  L            NF+ Y Y  +  G  V AYV+DTGI   H +
Sbjct: 133 QKNAPRHLARISRRSALPYNPENIAPKTSNFS-YYYDDSFPGTCVNAYVIDTGIFKEHRQ 191

Query: 284 FGERAKWGKTIPINDYDIDGNGHGTHCAGTIGSEHYGVAKGANLVAVKVLRSDGSGTMSD 343
           F  RAK+G  + + +   D NGHGTH AG IGS+ YGVAK  +L+ VK L + G G ++ 
Sbjct: 192 FQGRAKFGADL-VGEGPGDLNGHGTHVAGLIGSQKYGVAKDVSLIEVKALNAKGQGNLTS 250

Query: 344 VLKGVEWVALEHTKHLEESRKDKNSNYKGATANMSLGGGKSPALDQAVNAAVKAGVHFAV 403
           V+  +E+        +   RK K    +G  AN+SLG  ++  L+QAV AA++AGV   V
Sbjct: 251 VISAIEFT-------VNHCRKSK----RGCVANLSLGSFRNSVLNQAVEAALEAGVVVVV 299

Query: 404 AAGNENQDACNSSPAAAENAITVGA-STLSDDRAYFSNYGKCVDIFAPGLNILSTYIGTN 462
           AAGN N +AC SSPA++ +AI+VGA    +D  A FSN+G CVD+FAPG+ I S      
Sbjct: 300 AAGNSNANACWSSPASSLSAISVGAFDDRTDTIARFSNWGNCVDLFAPGVKIASLSNIPP 359

Query: 463 DATATLSGTSMASPHVAGLLTYLLSLQPDKGSEFYVPNSELTPLQMKKKIIDYAT----- 517
             +   SGTSMASP V G++  LL             +S + P  +K+++I+ AT     
Sbjct: 360 FKSVAYSGTSMASPLVTGMVAVLL-------------DSGIHPFDIKEELINTATDSVFH 406

Query: 518 KNALADLPADTPNKLIYNGGFNSTDFWASAAAP 550
           K AL   P  TPN++ + G     D +  A  P
Sbjct: 407 KRALLFKPG-TPNRVAFTGVEKEDDIFEDAVYP 438

>TBLA0F03970 Chr6 complement(985334..987538) [2205 bp, 734 aa] {ON}
           Anc_6.313 YCR045C
          Length = 734

 Score =  185 bits (469), Expect = 1e-49,   Method: Compositional matrix adjust.
 Identities = 132/325 (40%), Positives = 178/325 (54%), Gaps = 38/325 (11%)

Query: 226 VHSLDETQNNAPWGLARISHREGL--NLGNFNK------YLYASNSAGKGVTAYVVDTGI 277
           V S  + Q  AP  LARIS R+ L  N  N N+      Y Y  N  G+GV AYV+DTGI
Sbjct: 280 VKSKFKVQRGAPRHLARISTRDKLPFNFRNANQFEEQLNYYYDDNDKGEGVLAYVIDTGI 339

Query: 278 SVSHLEFGERAKWGKTIPINDYDIDGNGHGTHCAGTIGSEHYGVAKGANLVAVKVLRSDG 337
              H +F +R ++G  +   +   D NGHGTH AG IGS+ YGV K   ++ VK +   G
Sbjct: 340 LKEHKDFEDRVEFGTDLT-GEGAGDLNGHGTHVAGLIGSKTYGVDKKVKIIDVKAVSLTG 398

Query: 338 SGTMSDVLKGVEWVALEHTKHLEESRKDKNSNYKGATANMSLGGGKSPALDQAVNAAVKA 397
           S  +S +++     A+E+T +   SR DK    K    NMSLG      +++AV +A+  
Sbjct: 399 STQLSHIIE-----AIEYTVNDCNSRVDK----KACVVNMSLGSFYVKVINEAVESAIAE 449

Query: 398 GVHFAVAAGNENQDACNSSPAAAENAITVGASTLSDDR----AYFSNYGKCVDIFAPGLN 453
           GV F VAAGN N DAC SSP +++NAITVGA    DDR    A FSN+G+CVDIFA G+ 
Sbjct: 450 GVVFVVAAGNNNIDACWSSPGSSKNAITVGA---FDDRLDVIAKFSNWGECVDIFASGVE 506

Query: 454 ILSTYIGTNDATATLSGTSMASPHVAGLLTYLLS--LQPDKGSEFYVPNSELTPLQMKKK 511
           + S            SGTSMASP V G ++ LLS  ++P+   E      E+  L  K  
Sbjct: 507 VKSLSSQVPYKYIKYSGTSMASPIVCGFVSILLSQGVKPNDVQE------EMVKLSTKGD 560

Query: 512 IIDYATKNALADLPADTPNKLIYNG 536
                T+ +L   P  T N++++NG
Sbjct: 561 F----TRRSLIFKPF-TSNRILFNG 580

>KNAG0I02470 Chr9 complement(479068..480495) [1428 bp, 475 aa] {ON}
           Anc_6.313 YCR045C
          Length = 475

 Score =  180 bits (456), Expect = 1e-49,   Method: Compositional matrix adjust.
 Identities = 133/355 (37%), Positives = 182/355 (51%), Gaps = 48/355 (13%)

Query: 207 IVDFIRLNPLVDYVEKDSVVHSLD-------------ETQNNAPWGLARISHREGLNLGN 253
           ++D I+ +P V  V  + +V + +             + Q  AP  LARIS R  L    
Sbjct: 72  VLDKIKRHPFVKEVVPNIMVKAFEGDAVEDESWLPKMKRQRGAPRHLARISRRMQLPYDM 131

Query: 254 FNK--------YLYASNSAGKGVTAYVVDTGISVSHLEFGERAKWGKTIPINDYDIDGNG 305
            NK        Y Y   + G    AY++DTG+   H EF +R ++G T    + + D NG
Sbjct: 132 NNKTRYRDSFNYYYDRWAQGATTRAYILDTGVMRDHKEFEDRVEFG-TDCTGEGEGDLNG 190

Query: 306 HGTHCAGTIGSEHYGVAKGANLVAVKVLRSDGSGTMSDVLKGVEWVALEHTKHLEESRKD 365
           HGTH AG +GS+ +GVAK   LV VK L + G+GT+  +L  +E+   +  +H E+S+  
Sbjct: 191 HGTHVAGLVGSKTFGVAKHVQLVDVKCLDALGAGTLVSILSALEFAVQDCQEH-EDSQ-- 247

Query: 366 KNSNYKGATANMSLGGGKSPALDQAVNAAVKAGVHFAVAAGNENQDACNSSPAAAENAIT 425
                     NMSLG  KS  L+QA+N   K G+   VAAGN N +AC +SP++A  AIT
Sbjct: 248 -------CVLNMSLGSVKSNILNQAINEVEKKGIVVVVAAGNFNMNACWTSPSSATGAIT 300

Query: 426 VGASTLSDDR----AYFSNYGKCVDIFAPGLNILSTYIGTNDATATLSGTSMASPHVAGL 481
           VGA    DDR    A FSN+G CVDIFAPG+N+ S       +    SGTSMASP V G+
Sbjct: 301 VGA---FDDRFDTIAKFSNWGPCVDIFAPGVNVASLVNRDWPSFVKYSGTSMASPIVCGM 357

Query: 482 LTYLLSLQPDKGSEFYVPNSELTPLQMKKKIIDYATKNALADLPADTPNKLIYNG 536
           +  LL    D G    VP  ++     +        K  L   P  TPN ++YNG
Sbjct: 358 VALLL----DDG----VPPEDIRDYLQELATDGVFKKRTLVFKPG-TPNSVLYNG 403

>NDAI0I00560 Chr9 (114935..116386) [1452 bp, 483 aa] {ON} Anc_6.313
          Length = 483

 Score =  176 bits (447), Expect = 3e-48,   Method: Compositional matrix adjust.
 Identities = 145/392 (36%), Positives = 196/392 (50%), Gaps = 64/392 (16%)

Query: 184 RVMDTFEVAGAFSGYIATVASPKIVDFIRLNPLVDYVEKDSVVHSLD------------- 230
           ++  TF   G+F G    + +  +V  I+ NPLV  V  +  +H+ D             
Sbjct: 55  KISKTFSF-GSFRGLTVNL-TKDVVSAIKENPLVVDVVPNMKIHAFDYDDFENNDGYDDI 112

Query: 231 --------------ETQNNAPWGLARISHREGLNLGNFNK--------YLYASNSAGKGV 268
                         + QN AP  LAR+S R  L     +K        Y Y+    G  V
Sbjct: 113 KQPEELFDKNSYLVKVQNGAPRHLARLSRRMPLPYDFDDKDAYNDSLSYYYSKWHQGTDV 172

Query: 269 TAYVVDTGISVSHLEFGERAKWGKTIPINDYDIDGNGHGTHCAGTIGSEHYGVAKGANLV 328
            AY++D+GI ++  EF  RA  G  +   +   D NGHGTH AG +GS+ YGVAK   LV
Sbjct: 173 NAYIIDSGIDINQEEFEGRATHGLDLT-GEGPGDRNGHGTHVAGLVGSKTYGVAKNVTLV 231

Query: 329 AVKVLRSDGSGTMSDVLKGVEWVALEHTKHLEESRKDKNSNYKGATANMSLGGGKSPALD 388
            VK L   GSG++  V+  +E+V      H  +S+       K   AN+SLG    P L+
Sbjct: 232 EVKALDRQGSGSLITVISALEFVV----NHCGKSKS------KKCVANLSLGAFMMPLLN 281

Query: 389 QAVNAAVKAGVHFAVAAGNENQDACNSSPAAAENAITVGASTLSDDR----AYFSNYGKC 444
           +A+ A V +GV   VAAGN N DAC  SPA+ ++AITVGA    DDR    A FSN+G C
Sbjct: 282 EAIKATVDSGVVVVVAAGNGNIDACWCSPASEKSAITVGAF---DDRIDTIAKFSNWGSC 338

Query: 445 VDIFAPGLNILSTYIGTNDATATLSGTSMASPHVAGLLTYLLSLQPDKGSEFYVPNSELT 504
           VDIFAPG+ I S  I  N  +   SGTSMASP VAG+++ LL    D+G E    N ++ 
Sbjct: 339 VDIFAPGVAISSLSIKDNQKSVEFSGTSMASPQVAGIVSILL----DQGVE----NEDIR 390

Query: 505 PLQMKKKIIDYATKNALADLPADTPNKLIYNG 536
               +    D   K  L   P  TPN++ +NG
Sbjct: 391 DYLFELATDDVFQKRTLLFKPR-TPNRITFNG 421

>TPHA0D03760 Chr4 complement(792115..793938) [1824 bp, 607 aa] {ON}
           Anc_6.313 YCR045C
          Length = 607

 Score =  179 bits (453), Expect = 4e-48,   Method: Compositional matrix adjust.
 Identities = 124/319 (38%), Positives = 173/319 (54%), Gaps = 34/319 (10%)

Query: 231 ETQNNAPWGLARISHREGL--------NLGNFNKYLYASNSAGKGVTAYVVDTGISVSHL 282
           + Q  AP  L ++S R  L            F  Y Y     G     Y++DTG+   H 
Sbjct: 148 DIQFGAPRHLGKLSSRHQLPYNVKDEKEFKEFIHYYYDRYYQGTNSVVYIIDTGVYKEHK 207

Query: 283 EFGERAKWGKTIPINDYDIDGNGHGTHCAGTIGSEHYGVAKGANLVAVKVLRSDGSGTMS 342
           EFG R  +G    I +   D NGHGTH AG IGS+ +GVAK   L  VKVL   G G ++
Sbjct: 208 EFGNRVHFGGDF-IGEGKGDYNGHGTHVAGLIGSKTFGVAKNVTLFDVKVLDQKGFGNLT 266

Query: 343 DVLKGVEWVALEHTKHLEESRKDKNSNYKGATANMSLGGGKSPALDQAVNAAVKAGVHFA 402
            VL+G+E+ A+ + K L++    KN        NMSLG  ++P +++A+  A  +G+   
Sbjct: 267 SVLEGIEF-AVNNCK-LKQQPMGKN-----CVINMSLGTIRNPIINEAIKEAFLSGITPV 319

Query: 403 VAAGNENQDACNSSPAAAENAITVGA-STLSDDRAYFSNYGKCVDIFAPGLNILSTYIGT 461
           VAAGN N  AC +SPA++  AITVGA    +D  A FSN+G+CVDIFAPG+ I S     
Sbjct: 320 VAAGNNNFSACWTSPASSNFAITVGAMDDRTDTIAVFSNWGQCVDIFAPGVRIKSLSNRM 379

Query: 462 NDATATLSGTSMASPHVAGLLTYLLSLQPDKGSEFYVPNSELTPLQMKKKIIDYATKNAL 521
            +     SGTSMASP VAGL+  L+    +KG +           ++K+K+ID ++K+  
Sbjct: 380 LENGVIHSGTSMASPIVAGLVAILM----EKGYK---------CDEIKQKLIDDSSKSIF 426

Query: 522 ADLPA----DTPNKLIYNG 536
           + L       TPN++IYNG
Sbjct: 427 SKLTLFFKYGTPNRVIYNG 445

>KLLA0F06028g Chr6 (576687..578213) [1527 bp, 508 aa] {ON} some
           similarities with uniprot|P25036 Saccharomyces
           cerevisiae YOR003W YSP3 subtilisin-like protease III
          Length = 508

 Score =  161 bits (407), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 136/360 (37%), Positives = 188/360 (52%), Gaps = 54/360 (15%)

Query: 232 TQNNAPWGLARISHREGLNLGNFN------KYLYASNSAGKGVTAYVVDTGISVSHLEFG 285
           +Q+ AP  LARIS R  L +   +      KY Y     G+GV  YV+D+G++  H +F 
Sbjct: 153 SQSRAPRHLARISRRAQLPVIEKDDTSSGLKYHYHEEHQGEGVFVYVLDSGVNHDHPDFE 212

Query: 286 ERAKWGKTIPINDYDIDGNGHGTHCAGTIGSEHYGVAKGANLVAVKVLRSDGSGTMSDVL 345
            RA  G      +   D  GHGTH AG IGS+ YGVAK  N+V VKVL S G GT+++++
Sbjct: 213 GRAMKGIDT-TGEGSGDLVGHGTHVAGLIGSKTYGVAKKVNIVEVKVLDSMGKGTVTNII 271

Query: 346 KGVEWVALEHTKHLEESRKDKNSNYKGATANMSLGG-GKSPALDQAVNAAVKAGVHFAVA 404
           +G+E+V     + + + RK           NMSLG  G    LD+AV+A ++ GV   VA
Sbjct: 272 EGLEYVV---NQCIGKKRK--------CVINMSLGAPGTHSILDKAVSAVIEEGVVVVVA 320

Query: 405 AGNENQDACNSSPAAAENAITVGASTLSDDR----AYFSNYGKCVDIFAPGLNILSTYIG 460
            GN   +AC  SPA    AITV A    DDR    A FSN+G C+DI+APG+N+ S    
Sbjct: 321 GGNSGLNACWYSPAKVRKAITVAA---MDDRTDLMAPFSNWGACIDIWAPGVNVKSLS-N 376

Query: 461 TNDATATLSGTSMASPHVAGLLTYLLSLQPDKGSEFYVPNSELTPLQMKKKIIDYAT--- 517
               T  LSGTSMASP VAG     L    D+G++         P +++K +   AT   
Sbjct: 377 KGRGTFVLSGTSMASPIVAGAAAIYL----DQGAD---------PAEVRKILSKTATRGV 423

Query: 518 --KNALADLPADTPNKLIYNGGFNSTDFWASAAAPQSHKVKTNRYSLGSFLDSIQDSNNH 575
             K A+A  P  TPNK++Y G     D +A A  P   ++K        F+D ++ + + 
Sbjct: 424 FKKRAIAVRPR-TPNKVLYTGNNQEDDEFAYAVYPMIDEIK--------FMDQLKQATSR 474

>TBLA0A06700 Chr1 (1634983..1636476) [1494 bp, 497 aa] {ON}
           Anc_6.313 YCR045C
          Length = 497

 Score =  148 bits (374), Expect = 4e-38,   Method: Compositional matrix adjust.
 Identities = 123/361 (34%), Positives = 170/361 (47%), Gaps = 42/361 (11%)

Query: 232 TQNNAPWGLARISHREGL-NLGNFN-KYLYASNSAGKGVTAYVVDTGISVSHLEFGERAK 289
           TQ NAP  L+R S    L    NF   Y Y  +  G  VT YV+D+GI + H EF  R  
Sbjct: 144 TQFNAPRHLSRASRITKLPTASNFTYNYYYPRDYQGANVTVYVLDSGIRMDHPEFEGRI- 202

Query: 290 WGKTIPINDYDI------DGNGHGTHCAGTIGSEHYGVAKGANLVAVKVLRSDGSGTMSD 343
                 +  YD       D  GHGT  AG IGS+ YGVAK  NL+ +KVL + G G +  
Sbjct: 203 ------LEAYDFTDSGVGDNYGHGTSVAGIIGSKTYGVAKNVNLIDIKVLNNKGKGNVFS 256

Query: 344 VLKGVEWVALEHTKHLEESRKDKNSNYKGATANMSLGGGKSPALDQAVNAAVKAGVHFAV 403
           +L+G++++    TKH EE   + N N      N SLG      L++A      AG+    
Sbjct: 257 ILQGLQFI----TKHCEE---NTNGN---CIINASLGAINIQILNKAFEEVHNAGIPVIC 306

Query: 404 AAGNENQDACNSSPAAAENAITVGASTLSDDR-AYFSNYGKCVDIFAPGLNILSTYIGTN 462
           AAGN   +AC  +PA ++   TVG+    DD  A FSN+G+CVD+ APG+ + +      
Sbjct: 307 AAGNNAVNACWITPAGSKGVFTVGSFDDRDDTIATFSNWGRCVDMMAPGVYVRTLLYTNQ 366

Query: 463 DATATLSGTSMASPHVAGLLTYLLSLQPDKGSEFYVPNSELTPLQMKKKIIDYATKNALA 522
             +   SGTS+++P V GL   LLS    KG    VP   L     K    D       +
Sbjct: 367 KGSRESSGTSVSTPIVTGLAAILLS----KG----VPKENLYDEIRKMGSRDLLRNKEFS 418

Query: 523 DLPADTPNKLIYNGGFNSTDFWASAAAPQSHKVKTNRYSL-GSFLDSIQDSNNHWF--NF 579
            LP  TPN ++  G     D +   A     +    RY+   +F+D++       F  N+
Sbjct: 419 RLPG-TPNLIVNIGPQKEDDVYPDDAYIDEER----RYTTPATFVDTLNQKKRIHFTDNY 473

Query: 580 D 580
           D
Sbjct: 474 D 474

>Kwal_33.13372 s33 (190864..191997) [1134 bp, 377 aa] {ON} YCR045C -
           Hypothetical ORF [contig 118] FULL
          Length = 377

 Score =  132 bits (332), Expect = 3e-33,   Method: Compositional matrix adjust.
 Identities = 95/261 (36%), Positives = 139/261 (53%), Gaps = 17/261 (6%)

Query: 232 TQNNAPWGLARISHREGLNLGNFNKYLYASNSAGKGVTAYVVDTGISVSHLEFGERAKWG 291
            Q +AP  LAR+S +  L  G+   Y+Y SN  G GV  Y++DTGI   H E   R +  
Sbjct: 92  VQEHAPAHLARLSQKSTLR-GSDGTYIYHSN-GGNGVDVYLLDTGIDDLHPELEGRVQKI 149

Query: 292 KTIPINDYDI-DGNGHGTHCAGTIGSEHYGVAKGANLVAVKVLRSDGSGTMSDVLKGVEW 350
             +  N     D +GHGT  AG IGS  +G AK  NL  V+V  S G+ T+  V++    
Sbjct: 150 ADLTSNPVSHGDPHGHGTAVAGVIGSATFGSAKKCNLFDVRVADSTGNATLIGVIR---- 205

Query: 351 VALEHTKHLEESRKDKNSNYKGATANMSLGGGKSPALDQAVNAAVK-AGVHFAVAAGNEN 409
            ALEH   L    +      + +   +     K+  L+ A+ A ++   +   VA GN N
Sbjct: 206 -ALEHASKLASVTQ------RPSVVVIPFTMRKNVILNSAIEAVIRDQSLPVVVAGGNFN 258

Query: 410 QDACNSSPAAAENAITVGA--STLSDDRAYFSNYGKCVDIFAPGLNILSTYIGTNDATAT 467
           Q+AC+SSPA+A  A+T+G+   T  D  A F+NYG C+D FA G+NI S   G  ++   
Sbjct: 259 QNACDSSPASAYGALTIGSIDVTKGDSLAPFTNYGDCIDTFAAGVNITSLTTGDYESNTQ 318

Query: 468 LSGTSMASPHVAGLLTYLLSL 488
            SGTS+++   +G++ Y +SL
Sbjct: 319 YSGTSISAGIASGVVAYYMSL 339

>KLTH0F02288g Chr6 (186895..188037) [1143 bp, 380 aa] {ON} weakly
           similar to uniprot|P25381 Saccharomyces cerevisiae
           YCR045C Hypothetical ORF
          Length = 380

 Score =  127 bits (318), Expect = 2e-31,   Method: Compositional matrix adjust.
 Identities = 95/265 (35%), Positives = 145/265 (54%), Gaps = 22/265 (8%)

Query: 232 TQNNAPWGLARISHREGLNLGNFN---KYLYASNSAGKGVTAYVVDTGISVSHLEFGERA 288
            Q +AP  LAR+S +  L  GN +    Y+Y SN AG GV  Y++DTGI  +H  F  R 
Sbjct: 92  VQQHAPNHLARLSQKSSLRGGNGSDNGAYIYHSN-AGNGVDVYLLDTGIDGTHPAFEGRV 150

Query: 289 KWGKTIPINDYDI-DGNGHGTHCAGTIGSEHYGVAKGANLVAVKVLRSDGSGTMSDVLKG 347
           +       +     D +GHGT  AG IGS  +GVAK  NL  V+V  S G  ++  VL+ 
Sbjct: 151 QKAADFSSDPVATGDPHGHGTAVAGVIGSSVFGVAKKCNLFDVRVANSTGHASLIGVLR- 209

Query: 348 VEWVALEHTKHLEESRKDKNSNYKGATANMSLGGGKSPALDQAVNAAVK-AGVHFAVAAG 406
               ALEH   L    K      + +   + L   ++  L+ AV A V+   +   VAAG
Sbjct: 210 ----ALEHASKLAAVTK------RPSLITIPLEMPRNTILNSAVEAVVRDLSIPVVVAAG 259

Query: 407 NENQDACNSSPAAAENAITVGASTLS--DDRAYFSNYGKCVDIFAPGLNILSTYIGTNDA 464
           NEN+ AC+ SPA A  A+T+G+  ++  D  A F+N+ +CVD+F  G+++ +  +G + +
Sbjct: 260 NENRSACSVSPAGAYGALTIGSIDVARNDALAPFTNFAECVDLFTAGVDVAT--LGLDHS 317

Query: 465 TA-TLSGTSMASPHVAGLLTYLLSL 488
           +   LSGTS+++   +GL+ Y +S+
Sbjct: 318 SEHHLSGTSISAGVASGLVAYYMSI 342

>Kpol_2000.69 s2000 complement(151054..152214) [1161 bp, 386 aa]
           {ON} complement(151054..152214) [1161 nt, 387 aa]
          Length = 386

 Score =  119 bits (298), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 91/271 (33%), Positives = 149/271 (54%), Gaps = 29/271 (10%)

Query: 233 QNNAPWGLARISH---REGLNLGNFNKYLYASNSAGKGVTAYVVDTGISVSHLEFGERAK 289
           QN+AP  LAR+S+      ++  N N +++ S+ AG GV  Y+VD+GI   H  F  R  
Sbjct: 99  QNDAPEHLARLSNGVSNSRVSAKNENAFIFHSH-AGIGVDVYIVDSGIDSQHPAFMNR-H 156

Query: 290 WGKTIPINDYDI---DGNGHGTHCAGTIGSEHYGVAKGANLVAVKVLRSDGSGT-MSDVL 345
             K I + D  I   D +GHGT  AG + S+ +GV K ANL  V+V+ ++ +G  +S +L
Sbjct: 157 ISKLIDLTDNPIPVGDPHGHGTAIAGLVTSDTFGVMKKANLFDVRVVDAESNGVKLSKLL 216

Query: 346 KGVEWVALEHTKHLEESRKDKNSNYKGATANMSLGGGKSPALDQAVNAAVKAGVHFAVAA 405
           K +E++   H++          +  + + A +     K+  L+ A+  ++   +   V A
Sbjct: 217 KSLEFIE-NHSR----------ATMRPSVAVLPFSMSKNAILNSAIE-SMPNSIAIVVPA 264

Query: 406 GNENQDACNSSPAAAENA---ITVGASTL--SDDRAYFSNYGKCVDIFAPGLNILSTYIG 460
           GN++  ACN SPA+A N+   ++VG+     S + A FSNYG+CVD+F  G+ + + +  
Sbjct: 265 GNQHHMACNFSPASARNSQSILSVGSLDYRSSIEIASFSNYGECVDVFTSGVQMDTLHAT 324

Query: 461 TN---DATATLSGTSMASPHVAGLLTYLLSL 488
           TN   +  + +SGTSM+    AG + Y +SL
Sbjct: 325 TNSDENYISKVSGTSMSCAIAAGTVGYYMSL 355

>ZYRO0F16764g Chr6 complement(1390437..1391597) [1161 bp, 386 aa]
           {ON} conserved hypothetical protein
          Length = 386

 Score =  114 bits (286), Expect = 5e-27,   Method: Compositional matrix adjust.
 Identities = 101/323 (31%), Positives = 156/323 (48%), Gaps = 37/323 (11%)

Query: 184 RVMDTFEVAGAFSGYIATVASPKIVDFIRLNPLVDYVEKDSVVHSLDET--QNNAPWGLA 241
            + D FE+ G+F  +    + P I+  +  +P V  + +D  +  L E   QNNAP  L 
Sbjct: 44  EITDIFEL-GSFRAFTGDFSGP-ILQKLYNDPNVLAISRDGSLK-LQEIVLQNNAPSHLV 100

Query: 242 RISHREGLNLGNFNKYLYASNSAGKGVTAYVVDTGISVSH-----LEFGERAKWGKTIPI 296
            +S    L+      ++Y SN  G GV  Y++DTGI + H     L     A   ++ P+
Sbjct: 101 GLSSISPLS---HQPFIYRSN-GGNGVDVYLLDTGIDIKHPNLSKLNILRMADLTQS-PV 155

Query: 297 NDYDIDGNGHGTHCAGTIGSEHYGVAKGANLVAVKVLRSDGSGTMSDVLKGVEWVALEHT 356
                D  GHGT  AG I SE +GV K  NLV V+V  S+G   +S +L+ +        
Sbjct: 156 -PQGTDPQGHGTAMAGIIASETFGVLKKCNLVDVRVADSNGDVKLSTILQALTLTQ---- 210

Query: 357 KHLEESRKDKNSNYKGATANMSLGGGKSPALDQAVNAAVKAGVHFAVAAGNENQDACNSS 416
           +H+E +++            + +  G +P L +A+ A+    V   + AGN  QDA N S
Sbjct: 211 RHIEGTKRP-----SVVVIPLEVEDGNNPILTEAI-ASFDQSVPIIIPAGNNAQDALNFS 264

Query: 417 PA----AAENAITVGASTLSDDRAYFSNYGKCVDIFAPGLNI-------LSTYIGTNDAT 465
           PA      +N I VG+  ++++   F+NYG  VD+F  G  I       L +   +N  T
Sbjct: 265 PANVNPKPKNIIVVGSVDVNNNPTKFTNYGSNVDVFTVGEQITTLQSTDLDSQGLSNSLT 324

Query: 466 ATLSGTSMASPHVAGLLTYLLSL 488
             +SGTS +S   AG++ Y +SL
Sbjct: 325 RQVSGTSASSAITAGVIGYYMSL 347

>TPHA0B04520 Chr2 complement(1065861..1067027) [1167 bp, 388 aa]
           {ON} Anc_1.78
          Length = 388

 Score =  108 bits (271), Expect = 5e-25,   Method: Compositional matrix adjust.
 Identities = 87/280 (31%), Positives = 142/280 (50%), Gaps = 46/280 (16%)

Query: 233 QNNAPWGLARISHREGLNLGNF----NKYLYASNSAGKGVTAYVVDTGISVSHLEFGERA 288
           Q +AP  L R++ ++ +    +    N+Y++ S+++G GV  Y+VDTGI + H  + +  
Sbjct: 97  QTDAPKHLGRLT-KDSIKSSQYHYANNQYIF-SDTSGNGVDIYIVDTGIDIQHPIYLQN- 153

Query: 289 KWGKTIPINDYDI---DGNGHGTHCAGTIGSEHYGVAKGANLVAVKVLRSDGS-GTMSDV 344
              K I +    I   D NGHGT  AG I S+ +GV K ANLV V+V+ ++    TMS V
Sbjct: 154 NIHKLIDLTTSPIPSGDFNGHGTAMAGIINSDPFGVLKSANLVDVRVVDANTKHATMSRV 213

Query: 345 LKGVEWVALEHTKHLEES------RKDKNSNYKGATANMSLGGGKSPALDQAVNAAVKAG 398
           L  +  +     K +  S      + +KN+  + A  N+S    K P +           
Sbjct: 214 LSALSLIEKHEQKTMRPSIIVLPFQTEKNTILESAIENIS---KKIPVI----------- 259

Query: 399 VHFAVAAGNENQDACNSSPAAAE---NAITVGASTLSDDRAY-----FSNYGKCVDIFAP 450
               + AGN++Q+AC  SP   +   N + VG+   S+++ Y     FSNYG CVDI+  
Sbjct: 260 ----IPAGNKHQNACKLSPMGIKKLSNVLVVGSLEYSEEQNYLDIAKFSNYGSCVDIYTS 315

Query: 451 GLNILSTYIGTN---DATATLSGTSMASPHVAGLLTYLLS 487
           G++I +    +N   +    ++GTS +   VAG++ Y +S
Sbjct: 316 GVDISTLKTSSNGGKELIHNVTGTSYSCGIVAGVVGYYMS 355

>TBLA0A05410 Chr1 (1328472..1329620) [1149 bp, 382 aa] {ON} Anc_1.78
          Length = 382

 Score = 94.0 bits (232), Expect = 6e-20,   Method: Compositional matrix adjust.
 Identities = 88/274 (32%), Positives = 131/274 (47%), Gaps = 39/274 (14%)

Query: 232 TQNNAPWGLARISHREGLNLGNFNKYLYASNSAGKGVTAYVVDTGISVSHLEFGERAKWG 291
            Q +AP  L ++   E  +    N+++Y S +AG GV  Y+ DTGI+ +    G  A   
Sbjct: 96  VQKDAPRHLTKLLETEAGD----NEFVYDS-TAGNGVDIYIFDTGIARNSP--GLSASRI 148

Query: 292 KTIP------INDYDIDGNGHGTHCAGTIGSEHYGVAKGANLVAVKVLRSDGSGTMSDVL 345
             +P      I D +I    HGT  +G IGS  +GV K  NL+ V V   +G   MS VL
Sbjct: 149 HDMPGMPGPPIRDQEILE--HGTAMSGLIGSPAFGVLKKCNLIDVNVGDENGKVFMSKVL 206

Query: 346 KGVEWVALEHTKHLEESRKDKNSNYKGATANMSLGGGKSPALDQAVNAAVKAGVHFAVAA 405
           KG+  V  +H KH            + +  N S    K+  L+ A +   +  V  AVAA
Sbjct: 207 KGLNLVQ-QHVKHTN----------RPSVINFSYCTLKNAILNSAFDNFPR-DVPIAVAA 254

Query: 406 GNENQDACNSSPAAAE---NAITVGASTLSDD---RAYFSNYGKCVDIFAPGLNILSTYI 459
           GN  Q  C+ SP   +   + +  G+  ++DD    + FSNYG CV  +APG  +L+  I
Sbjct: 255 GNYKQPGCSFSPVGCQRNKSLLAFGSLLMNDDGITLSDFSNYGSCVGSYAPGEGLLTFGI 314

Query: 460 ------GTNDATATLSGTSMASPHVAGLLTYLLS 487
                  + D    +SGTS +S   AG++ Y ++
Sbjct: 315 PDTSRPNSRDTVIIISGTSGSSALGAGVIGYYMA 348

>TDEL0C06230 Chr3 complement(1135740..1136834) [1095 bp, 364 aa]
           {ON} Anc_1.78
          Length = 364

 Score = 87.4 bits (215), Expect = 7e-18,   Method: Compositional matrix adjust.
 Identities = 75/232 (32%), Positives = 113/232 (48%), Gaps = 19/232 (8%)

Query: 264 AGKGVTAYVVDTGISVSH--LEFGERAKWG--KTIPINDYDIDGNGHGTHCAGTIGSEHY 319
           +G  V  YV DTGI   H  L+     K     + P+     D +GHGT  AG I SE +
Sbjct: 113 SGNLVDVYVFDTGIDFKHPGLQNVNPHKLADFTSSPV-PRGADPHGHGTMMAGLIASETF 171

Query: 320 GVAKGANLVAVKVLRSDGSGTMSDVLKGVEWVALEHTKHLEESRKDKNSNYKGATANMSL 379
           GV K  +LV V+V   DG   +S ++KG+       +  +  +R  K  +       M++
Sbjct: 172 GVLKSCSLVDVRVADKDGEVKLSTLMKGI-------SASVAHARFTKRPSV--FVLPMTI 222

Query: 380 GGGKSPALDQAVNAAVKAGVHFAVAAGNENQDACNSSPAAAENAITVGASTLSDDRAYFS 439
           G  K+  LD  + A  K  +   + AGN+  DAC+ SP    N + +G+    +  A FS
Sbjct: 223 GK-KNHILDNFLQAIPK-DIAIVLPAGNQQTDACDLSPPNDHNILVIGSLDRDNRLADFS 280

Query: 440 NYGKCVDIFAPGLNIL---STYIGTNDATATLSGTSMASPHVAGLLTYLLSL 488
           NYG CVD++  G +IL   ST  G      + +GTS +    AG++ Y +S+
Sbjct: 281 NYGNCVDVYTSGTDILTLRSTDSGNEVLLQSSNGTSASCAIGAGIVGYHMSM 332

>NCAS0A00880 Chr1 (173726..176227) [2502 bp, 833 aa] {ON} Anc_2.6
           YNL238W
          Length = 833

 Score = 40.0 bits (92), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 66/263 (25%), Positives = 102/263 (38%), Gaps = 42/263 (15%)

Query: 256 KYLYASNSAGKGVTAYVVDTGISVSHLE----FGERAKW--GKTIPINDYDIDGNGHGTH 309
           K L+  N  G G+ A +VD G+   +      F     W      P+    +  + HGT 
Sbjct: 182 KQLWYENVTGTGIVAAIVDDGVDYDNDNIKDNFSREGSWDFNDNGPLPKPKLKDDYHGTR 241

Query: 310 CAGTIGSEH------YGVAKGANLVAVKVLRSDGSGTMSDVLKGVEWVALEHTKHLEE-- 361
           CAG I +         GVA  A +  +++L   G  T  D     E  +L H   + +  
Sbjct: 242 CAGEIAASKNNGICGVGVAYDAKVAGIRILS--GELTAED-----EAASLVHALDVNDIY 294

Query: 362 ----SRKDKNSNYKGAT--ANMSLGGGKSPALDQAVNAAVKAGVHFAVAAGNENQ--DAC 413
                 +D  ++ +G T     ++  G +   DQ        G  +  A+GN     D C
Sbjct: 295 SCSWGPRDDGTHLQGPTDLVKKAMIRGVTEGRDQK-------GALYVFASGNGGAYGDNC 347

Query: 414 N-SSPAAAENAITVGASTLSDDRAYFSNYGKCVDIFA----PGLNILSTYIGTNDATATL 468
           N      +  +ITVGA         +S     V +       G  I +T IG +  + T 
Sbjct: 348 NYDGYTNSIYSITVGAIDHKGLHPPYSESCSAVMVVTCSSGSGEFIHTTDIG-DKCSNTH 406

Query: 469 SGTSMASPHVAGLLTYLLSLQPD 491
            GTS A+P  AG+ T +L   P+
Sbjct: 407 GGTSAAAPLAAGVYTLVLQANPE 429

>NDAI0F03890 Chr6 complement(921561..924062) [2502 bp, 833 aa] {ON}
           Anc_2.6 YNL238W
          Length = 833

 Score = 40.0 bits (92), Expect = 0.019,   Method: Compositional matrix adjust.
 Identities = 69/272 (25%), Positives = 107/272 (39%), Gaps = 60/272 (22%)

Query: 256 KYLYASNSAGKGVTAYVVDTGISVSH------------LEFGERAKWGKTIPINDYDIDG 303
           K L+  N  G+G+   +VD G+   +             +F +  +  K    +DY    
Sbjct: 171 KKLWYENITGEGIVVAIVDDGLDYENPDLKDNFSAEGSWDFNDNTQLPKPRLADDY---- 226

Query: 304 NGHGTHCAGTIGSEH------YGVAKGANLVAVKVLRSDGSGTMSDVLKGVEWVALEHTK 357
             HGT CAG I +         GVA  A +  +++L   G  T  D     E  +L H  
Sbjct: 227 --HGTRCAGEIAATKDNGFCGIGVAYNAKVAGIRILS--GELTAED-----EAASLVHAL 277

Query: 358 HLEE------SRKDKNSNYKGAT--ANMSLGGGKSPALDQAVNAAVKAGVHFAVAAGNEN 409
            + +        KD  ++ +G T     ++  G S   D       K G  +  A+GN  
Sbjct: 278 DVNDIYSCSWGPKDDGTHLQGPTDLVKKAMIRGTSDGRD-------KKGAIYVFASGNGG 330

Query: 410 Q--DACN-SSPAAAENAITVGASTLSDDRAYFSNYGK-CVDIFA------PGLNILSTYI 459
              D CN      +  +IT+GA    D +     Y + C  + A       G  I ST I
Sbjct: 331 AFGDNCNYDGYTNSIYSITIGAL---DHKGLHPPYSESCSAVMAVTYSSGSGEYIHSTDI 387

Query: 460 GTNDATATLSGTSMASPHVAGLLTYLLSLQPD 491
           G N  +    GTS A+P  AG+ + +L + P+
Sbjct: 388 G-NKCSDHHGGTSAAAPLAAGIFSLVLQVNPN 418

>TPHA0P01790 Chr16 complement(373247..375646) [2400 bp, 799 aa] {ON}
           Anc_2.6 YNL238W
          Length = 799

 Score = 39.3 bits (90), Expect = 0.030,   Method: Compositional matrix adjust.
 Identities = 70/277 (25%), Positives = 107/277 (38%), Gaps = 75/277 (27%)

Query: 258 LYASNSAGKGVTAYVVDTGISVSHLE----FGERAKW----GKTIP----INDYDIDGNG 305
           ++ S   GKGV A +VD G+  +  +    F E   W     K +P    I+DY      
Sbjct: 156 VWFSGITGKGVVAAIVDDGLDHNSEDLKDNFCEEGSWDFNENKKLPTPKLIDDY------ 209

Query: 306 HGTHCAGTIGSEH-----YGVAKGANLVAVKVLRSDGSGTMSD----VLKGVE------- 349
           HGT CAG I +        GVA GA +  +++L   G  T  D    ++ G++       
Sbjct: 210 HGTRCAGEIAAVKNEYCGLGVAYGAKVAGIRILS--GQITAEDEAASLMYGLDINDIFSC 267

Query: 350 -WVALEHTKHLEESRKDKNSNYKGATANMSLGGGKSPALDQAVNAAVKAGVH-------F 401
            W   +  KHL+                     G S  + +A+    + G +       F
Sbjct: 268 SWGPPDDGKHLQ---------------------GPSDLVKKAMIKGTQEGRNEKGSIYVF 306

Query: 402 AVAAGNENQDACN-SSPAAAENAITVGASTLSDDRAYFSNYGK-CVDIFAPGLNILS-TY 458
           A   G    D CN      +  +IT+GA    D +     Y + C  + A   +  S  Y
Sbjct: 307 ASGNGGHYGDNCNYDGYTNSIYSITIGA---IDHKGLHPPYSESCSAVLAVTYSSGSGEY 363

Query: 459 IGTNDATATLS----GTSMASPHVAGLLTYLLSLQPD 491
           I + D  +  S    GTS A+P  AG+   +L   P+
Sbjct: 364 IHSTDIKSQCSDRHGGTSAAAPLAAGIYALVLEANPE 400

>KAFR0A08040 Chr1 complement(1609550..1611850) [2301 bp, 766 aa]
           {ON} Anc_2.6 YNL238W
          Length = 766

 Score = 37.4 bits (85), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 69/261 (26%), Positives = 100/261 (38%), Gaps = 42/261 (16%)

Query: 258 LYASNSAGKGVTAYVVDTGISVSHLE----FGERAKWG--------KTIPINDYDIDGNG 305
           ++  N  GKGV A VVD G+   + +    F +   W         K    +DY      
Sbjct: 150 VWYQNITGKGVVAAVVDDGLDYENPDIKDNFCKEGSWDFNANTNLPKPTLADDY------ 203

Query: 306 HGTHCAGTI------GSEHYGVAKGANLVAVKVLRSDGSGTMSDVLKG-VEWVALEHTKH 358
           HGT CAG I      G    GVA  A +  +++L   G  T  D     +  + +     
Sbjct: 204 HGTRCAGEIAAVKNNGICGIGVAYDAKVAGIRILS--GEITAEDEAAALINALDINDIYS 261

Query: 359 LEESRKDKNSNYKGATANMSLGGGKSPALDQAVNAAVK-AGVHFAVAAGNENQ--DACN- 414
                +D  ++ +G +  +        AL + VN   K  G  +  A+GN     D CN 
Sbjct: 262 CSWGPQDDGTHLQGPSDLVK------KALIKGVNDGRKNKGAIYVFASGNGGSFGDNCNY 315

Query: 415 SSPAAAENAITVGASTLSDDRAYFSNYGKCVDIFA----PGLNILSTYIGTNDATATLSG 470
                +  +ITVGA    D    +S     V +       G  I +T I  N       G
Sbjct: 316 DGYTNSIYSITVGAIDHKDLHPPYSESCSAVMVVTYSSGSGEYIHTTDIN-NKCNDRHGG 374

Query: 471 TSMASPHVAGLLTYLLSLQPD 491
           TS A+P  AG+ T LL   P+
Sbjct: 375 TSAAAPLAAGIYTLLLQANPN 395

>CAGL0J07546g Chr10 complement(733686..736055) [2370 bp, 789 aa]
           {ON} similar to uniprot|P13134 Saccharomyces cerevisiae
           YNL238w KEX2 endoproteinase of late golgi compartment
          Length = 789

 Score = 37.0 bits (84), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 67/264 (25%), Positives = 103/264 (39%), Gaps = 44/264 (16%)

Query: 256 KYLYASNSAGKGVTAYVVDTGISVSHLE----FGERAKW----GKTIPINDYDIDGNGHG 307
           K ++  N  GKGV A ++D G+  +  +    F +   W     + +P+    +  + HG
Sbjct: 161 KDVWLQNITGKGVVAAIIDDGVDYTSPDLKDNFCKEGSWDFNENQQLPMP--LLSDDNHG 218

Query: 308 THCAGTIGSEH------YGVAKGANLVAVKVLRSDGSGTMSDVLKGVEWVALEHTKHLEE 361
           T CAG I +         GVA  A +  +++L   G  T  D     E  +L H   +  
Sbjct: 219 TRCAGEIAAIRNNNYCGVGVAYDAKVSGIRILS--GPLTAED-----EAASLVHALDV-- 269

Query: 362 SRKDKNSNYKGATANMSLGGGKSPALDQAVNAAVKAG-------VHFAVAAGNENQDACN 414
              D  S   G T +     G SP + +A+   V  G         FA   G  + D CN
Sbjct: 270 --NDIYSCSWGPTDDGKHLQGPSPLVKKAMKKGVTEGRGNKGAIYVFASGNGGMHGDNCN 327

Query: 415 -SSPAAAENAITVGASTLSDDRAYFSNYGK-CVDIFAPGLNILS-TYIGTNDATATL--- 468
                 +  +ITVGA    D +     Y + C  +     +  S  YI + D        
Sbjct: 328 YDGYTNSIYSITVGA---IDHKGLHPPYSESCSAVLVVTYSSGSGEYIHSTDINGGCYDR 384

Query: 469 -SGTSMASPHVAGLLTYLLSLQPD 491
             GTS A+P  AG+   +L   P+
Sbjct: 385 HGGTSAAAPIAAGIYALVLEANPN 408

>Suva_14.106 Chr14 (196428..198857) [2430 bp, 809 aa] {ON} YNL238W
           (REAL)
          Length = 809

 Score = 36.2 bits (82), Expect = 0.23,   Method: Compositional matrix adjust.
 Identities = 65/262 (24%), Positives = 100/262 (38%), Gaps = 46/262 (17%)

Query: 258 LYASNSAGKGVTAYVVDTGISVSHLEFGERAKWGKTIPINDYD------IDGNGHGTHCA 311
           L+ +N  G GV A +VD G+   + +  +      +   ND        +  + HGT CA
Sbjct: 159 LWYNNITGAGVVAAIVDDGLDYENEDLKDNFCAEGSWDFNDNTNLPKPRLSDDYHGTRCA 218

Query: 312 GTI----GSEHYGVAKGAN--LVAVKVLRSDGS----------GTMSDVLKGVEWVALEH 355
           G I    G++  GV  G N  +  +++L  + +          G  ++ +    W   + 
Sbjct: 219 GEIAAKKGNDFCGVGVGYNAKISGIRILSGEITTEDEAASLIYGLDTNDIYSCSWGPADD 278

Query: 356 TKHLE-ESRKDKNSNYKGATANMSLGGGKSPALDQAVNAAVKAGVHFAVAAGNENQDACN 414
            +HL+  S   K +  KG T      G               A   FA   G    D CN
Sbjct: 279 GRHLQGPSDLVKKALVKGVTEGRDSKG---------------AIYVFASGNGGARGDNCN 323

Query: 415 -SSPAAAENAITVGASTLSDDRAYFSNYGKCVDIFAPGLNILS-TYIGTNDATATLS--- 469
                 +  +IT+GA    D    +S    C  + A   +  S  YI ++D     S   
Sbjct: 324 YDGYTNSIYSITIGAIDHKDLHPPYSE--SCSAVMAVTYSSGSGEYIHSSDINGKCSDSH 381

Query: 470 -GTSMASPHVAGLLTYLLSLQP 490
            GTS A+P  AG+ T LL   P
Sbjct: 382 GGTSAAAPLAAGVYTLLLEANP 403

>YNL238W Chr14 (202428..204872) [2445 bp, 814 aa] {ON}
           KEX2Subtilisin-like protease (proprotein convertase), a
           calcium-dependent serine protease involved in the
           activation of proproteins of the secretory pathway
          Length = 814

 Score = 36.2 bits (82), Expect = 0.27,   Method: Compositional matrix adjust.
 Identities = 64/263 (24%), Positives = 98/263 (37%), Gaps = 46/263 (17%)

Query: 258 LYASNSAGKGVTAYVVDTGISVSHLEFGERAKWGKTIPINDYD------IDGNGHGTHCA 311
           L+ +N  G GV A +VD G+   + +  +      +   ND        +  + HGT CA
Sbjct: 159 LWYNNITGAGVVAAIVDDGLDYENEDLKDNFCAEGSWDFNDNTNLPKPRLSDDYHGTRCA 218

Query: 312 GTIGSEH------YGVAKGANLVAVKVLRSDGS----------GTMSDVLKGVEWVALEH 355
           G I ++        GV   A +  +++L  D +          G   + +    W   + 
Sbjct: 219 GEIAAKKGNNFCGVGVGYNAKISGIRILSGDITTEDEAASLIYGLDVNDIYSCSWGPADD 278

Query: 356 TKHLE-ESRKDKNSNYKGATANMSLGGGKSPALDQAVNAAVKAGVHFAVAAGNENQDACN 414
            +HL+  S   K +  KG T      G               A   FA   G    D CN
Sbjct: 279 GRHLQGPSDLVKKALVKGVTEGRDSKG---------------AIYVFASGNGGTRGDNCN 323

Query: 415 -SSPAAAENAITVGASTLSDDRAYFSNYGKCVDIFAPGLNILS-TYIGTNDATATLS--- 469
                 +  +IT+GA    D    +S    C  + A   +  S  YI ++D     S   
Sbjct: 324 YDGYTNSIYSITIGAIDHKDLHPPYSE--GCSAVMAVTYSSGSGEYIHSSDINGRCSNSH 381

Query: 470 -GTSMASPHVAGLLTYLLSLQPD 491
            GTS A+P  AG+ T LL   P+
Sbjct: 382 GGTSAAAPLAAGVYTLLLEANPN 404

>Smik_14.97 Chr14 (181672..184116) [2445 bp, 814 aa] {ON} YNL238W
           (REAL)
          Length = 814

 Score = 35.8 bits (81), Expect = 0.31,   Method: Compositional matrix adjust.
 Identities = 64/268 (23%), Positives = 100/268 (37%), Gaps = 58/268 (21%)

Query: 258 LYASNSAGKGVTAYVVDTGISVSH------------LEFGERAKWGKTIPINDYDIDGNG 305
           ++ +N  G GV A +VD G+   +             +F +     K   ++DY      
Sbjct: 159 VWYNNITGAGVVAAIVDDGLDYENEDLKDNFCAEGSWDFNDNTNLPKPRLLDDY------ 212

Query: 306 HGTHCAGTIGSEH------YGVAKGANLVAVKVLRSDGS----------GTMSDVLKGVE 349
           HGT CAG I ++        GV   A +  +++L  + +          G  ++ +    
Sbjct: 213 HGTRCAGEIAAKKGNNFCGIGVGYNAKISGIRILSGELTTEDEAASLIYGLDTNDIYSCS 272

Query: 350 WVALEHTKHLE-ESRKDKNSNYKGATANMSLGGGKSPALDQAVNAAVKAGVHFAVAAGNE 408
           W   +  +HL+  S   K +  KG T      G               A   FA   G  
Sbjct: 273 WGPADDGRHLQGPSDLVKKALVKGVTEGRDSKG---------------AIYVFASGNGGA 317

Query: 409 NQDACN-SSPAAAENAITVGASTLSDDRAYFSNYGKCVDIFAPGLNILS-TYIGTNDATA 466
           + D CN      +  +IT+GA    D    +S    C  + A   +  S  YI ++D   
Sbjct: 318 HGDNCNYDGYTNSIYSITIGAIDHKDLHPPYSE--GCSAVMAVTYSSGSGEYIHSSDING 375

Query: 467 TLS----GTSMASPHVAGLLTYLLSLQP 490
             S    GTS A+P  AG+ T LL   P
Sbjct: 376 RCSNSHGGTSAAAPLAAGVYTLLLEANP 403

>SAKL0G00440g Chr7 (41016..43526) [2511 bp, 836 aa] {ON} similar to
           uniprot|P13134 YNL238W Saccharomyces cerevisiae KEX2
           Subtilisin-like protease (proprotein convertase)
          Length = 836

 Score = 34.7 bits (78), Expect = 0.87,   Method: Compositional matrix adjust.
 Identities = 68/264 (25%), Positives = 100/264 (37%), Gaps = 49/264 (18%)

Query: 258 LYASNSAGKGVTAYVVDTGISVSHLE----FGERAKW--GKTIPINDYDIDGNGHGTHCA 311
           L+  N  G GV A +VD G+   + +    F     W      P+    +  + HGT CA
Sbjct: 183 LWYENITGHGVVAAIVDDGLDYENRDLKDNFCAEGSWDFNDNTPLPKPRLRDDYHGTRCA 242

Query: 312 GTIGSEH-----YGVAKGANLVAVKVLRSDGSGTMSDVLKGVEWVALEHTKHLEESRKDK 366
           G I +        GVA  A +  +++L   G  T  D     E  +L +   +     D 
Sbjct: 243 GEIAAVKNDACGVGVAYNAKVAGIRILS--GEITSED-----EAASLVYGLGV----NDI 291

Query: 367 NSNYKGATANMSLGGGKSPALDQAVNAAVKAGVH-----------FAVAAGNENQDACN- 414
            S   G   +    G +  A D+ V  A+  GV            FA   G    D CN 
Sbjct: 292 YSCSWGPADD----GRQMQAPDELVKKAIVKGVLEGRDEKGALYVFASGNGGLYDDNCNY 347

Query: 415 SSPAAAENAITVGASTLSDDRAYFSNYGK-CVDIFA------PGLNILSTYIGTNDATAT 467
                +  +ITVGA    D +     Y + C  +         G +I ST +  N  +  
Sbjct: 348 DGYTNSIYSITVGA---IDHKGLHPPYAEACSAVLVVTYSSGSGEHIHSTDVN-NQCSHR 403

Query: 468 LSGTSMASPHVAGLLTYLLSLQPD 491
             GTS A+P  AG+ + +L   PD
Sbjct: 404 HGGTSAAAPLAAGIYSLVLEANPD 427

>Skud_14.101 Chr14 (191111..193570) [2460 bp, 819 aa] {ON} YNL238W
           (REAL)
          Length = 819

 Score = 34.3 bits (77), Expect = 0.93,   Method: Compositional matrix adjust.
 Identities = 62/263 (23%), Positives = 99/263 (37%), Gaps = 48/263 (18%)

Query: 258 LYASNSAGKGVTAYVVDTGISVSHLEFGERAKWGKTIPINDYD------IDGNGHGTHCA 311
           L+ +N  G GV A +VD G+   + +  +      +   ND        +  + HGT CA
Sbjct: 159 LWYNNITGAGVVAAIVDDGLDYENEDLKDNFCAEGSWDFNDNTNLPKPRLSDDYHGTRCA 218

Query: 312 GTIGSEH------YGVAKGANLVAVKVLRSDGS----------GTMSDVLKGVEWVALEH 355
           G I ++        GV   A +  +++L  D +          G  ++ +    W   + 
Sbjct: 219 GEIAAKKGNNFCGVGVGYNAKISGIRILSGDITTEDEAASLIYGLDTNDIYSCSWGPADD 278

Query: 356 TKHLE-ESRKDKNSNYKGATANMSLGGGKSPALDQAVNAAVKAGVHFAVAAGNENQDACN 414
            +HL+  +   K +  KG T      G               A   FA   G    D CN
Sbjct: 279 GRHLQGPNDLVKKALVKGVTQGRDSKG---------------AIYVFASGNGGARGDNCN 323

Query: 415 -SSPAAAENAITVGASTLSDDRAYFSNYGKCVDI--FAPGLNILSTYIGTND----ATAT 467
                 +  +IT+GA    D    +S     V +  ++ G      YI ++D     + T
Sbjct: 324 YDGYTNSIYSITIGAIDHKDLHPPYSEGCSAVMVVTYSSGSG---EYIHSSDINGGCSNT 380

Query: 468 LSGTSMASPHVAGLLTYLLSLQP 490
             GTS A+P  AG+ T LL   P
Sbjct: 381 HGGTSAAAPLAAGVYTLLLEANP 403

>TBLA0B00130 Chr2 (12377..14905) [2529 bp, 842 aa] {ON} Anc_2.6
           YNL238W
          Length = 842

 Score = 34.3 bits (77), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 62/263 (23%), Positives = 103/263 (39%), Gaps = 47/263 (17%)

Query: 258 LYASNSAGKGVTAYVVDTGISVSHLEFGERAKWGKTIPINDYD------IDGNGHGTHCA 311
           ++  N  GK VT  +VD G+   + +  ++  +  +   ND        +  + HGT CA
Sbjct: 160 VWRGNITGKNVTVAIVDDGVDYENEDLKDKFCFEGSWDFNDNTAKPKPRLSDDYHGTRCA 219

Query: 312 GTIGSEH-----YGVAKGANLVAVKVLRSDGSGTMSD----VLKGVE--------WVALE 354
           G I +        GVA  A++  +++L   G  T+ D    ++ G++        W   +
Sbjct: 220 GEIAAVRNDYCGVGVAFDAHISGLRILS--GELTVEDEAAALIYGLKYNDIFSCSWGPPD 277

Query: 355 HTKHLEESRKDKNSNYKGATANMSLGGGKSPALDQAVNAAVKAGVHFAVAAGNENQDACN 414
             +HL+                 +   G     D+     V A  + A++  N N D   
Sbjct: 278 DGQHLQGPYD---------LVKKAFIKGIQDGRDEKGAIYVFASGNGAISGDNCNYDGYT 328

Query: 415 SSPAAAENAITVGASTLSDDRAYFSNYGK-CVDIFAPGLNILS-TYIGTNDATATLS--- 469
           +S      +IT+GA    D R     Y + C  + A   +  S  +I T D     S   
Sbjct: 329 NSIY----SITIGA---IDHRGLHPAYSESCSAVMAVTYSSGSGKFIETTDINGKCSTHH 381

Query: 470 -GTSMASPHVAGLLTYLLSLQPD 491
            GTS A+P  AG+   LL   P+
Sbjct: 382 GGTSAAAPLAAGVYALLLEANPE 404

>ZYRO0F15598g Chr6 complement(1278928..1281300) [2373 bp, 790 aa]
           {ON} similar to uniprot|P13134 YNL238W Saccharomyces
           cerevisiae KEX2 Subtilisin-like protease (proprotein
           convertase)
          Length = 790

 Score = 33.1 bits (74), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 64/266 (24%), Positives = 102/266 (38%), Gaps = 53/266 (19%)

Query: 258 LYASNSAGKGVTAYVVDTGISVSHLE----FGERAKW--GKTIPINDYDIDGNGHGTHCA 311
           L+  N  G GV A +VD G+     +    F +   W       +    +D + HGT CA
Sbjct: 152 LWYENITGHGVVAAIVDDGLDYESEDLKDNFCKEGSWDFNDNTKLPKPRLDDDYHGTRCA 211

Query: 312 GTIGSE-----HYGVAKGANLVAVKVLRSDGSGTM--SDVLKGVE--------WVALEHT 356
           G I +        GVA  A L  +++L  + +     + ++ G++        W   +  
Sbjct: 212 GEIAAVPNDFCAVGVAFNAKLSGIRILSGEITAEQEAASLIYGLDINDIYSCSWGPADDG 271

Query: 357 KHLEESRKDKNSNYKGAT--ANMSLGGGKSPALDQAVNAAVKAGVHFAVAAGNENQ--DA 412
           +HL+           G T     +L  G     D       K G  +  A+GN     D 
Sbjct: 272 RHLQ-----------GPTDLVRKALVKGVQEGRD-------KKGALYVFASGNGGAFGDN 313

Query: 413 CN-SSPAAAENAITVGASTLSDDRAYFSNYGK-CVDIFAPGLNILS-TYIGTND----AT 465
           CN      +  +ITVGA    D +    +Y + C  +     +  S  +I T D     +
Sbjct: 314 CNYDGYTNSIYSITVGA---LDHKGLHPSYSESCSALMVTTYSSGSGEFIHTTDIKGQCS 370

Query: 466 ATLSGTSMASPHVAGLLTYLLSLQPD 491
            T  GTS A+P  AG+   +L   P+
Sbjct: 371 ETHGGTSAAAPLAAGIYALILEANPN 396

>TDEL0D00190 Chr4 (29971..31629) [1659 bp, 552 aa] {ON} 
          Length = 552

 Score = 32.7 bits (73), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 15/36 (41%), Positives = 20/36 (55%), Gaps = 1/36 (2%)

Query: 545 ASAAAPQSHKV-KTNRYSLGSFLDSIQDSNNHWFNF 579
           AS AA   H V K N YS+  F + + D  NHW+ +
Sbjct: 269 ASYAANVMHMVPKMNSYSIDEFFEVVPDDQNHWYQY 304

>TPHA0A05200 Chr1 complement(1168851..1171826) [2976 bp, 991 aa]
           {ON} Anc_5.85 YGR240C
          Length = 991

 Score = 33.1 bits (74), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 19/53 (35%), Positives = 31/53 (58%), Gaps = 3/53 (5%)

Query: 351 VALEHTKHLEES--RKDKNSNYKGATANMSLGGGKSPALDQAVNAAVKAGVHF 401
           +A +  + L++S   K KN + K   A M+  GG SP ++ AV A V+ G+H+
Sbjct: 188 IAKDAAEFLQKSLINKSKNGSIKKKIAVMT-SGGDSPGMNAAVRAVVRTGIHY 239

>KLLA0D19811g Chr4 complement(1672338..1674608) [2271 bp, 756 aa]
           {ON} uniprot|P09231 Kluyveromyces lactis KLLA0D19811g
           KEX1 protease precursor
          Length = 756

 Score = 32.3 bits (72), Expect = 3.7,   Method: Compositional matrix adjust.
 Identities = 68/263 (25%), Positives = 98/263 (37%), Gaps = 47/263 (17%)

Query: 258 LYASNSAGKGVTAYVVDTGISVSHLE----FGERAKW--GKTIPINDYDIDGNGHGTHCA 311
           L+  N  G GV A +VD G+   + +    F     W      P+    +  + HGT CA
Sbjct: 148 LWKENITGYGVVAALVDDGLDYENEDLKDNFCVEGSWDFNDNNPLPKPRLKDDYHGTRCA 207

Query: 312 GTIGSEH-----YGVAKGANLVAVKVLRSDGSGTMSDVLKGVEWVALEHTKHLEESRKDK 366
           G I +        GVA  + +  +++L   G  T  D     E  +L +         D 
Sbjct: 208 GEIAAFRNDICGVGVAYNSKVSGIRILS--GQITAED-----EAASLIYGL-------DV 253

Query: 367 NSNYKGATANMSLGGGKSPALDQAVNAAVKAGVH-----------FAVAAGNENQDACN- 414
           N  Y   +   S  G    A D  V  A+  GV            FA   G    D+CN 
Sbjct: 254 NDIYS-CSWGPSDDGKTMQAPDTLVKKAIIKGVTEGRDAKGALYVFASGNGGMFGDSCNF 312

Query: 415 SSPAAAENAITVGASTLSDDRAYFSNYGKCVDI--FAPGLNILSTYIGTND----ATATL 468
                +  +ITVGA         +S     V +  ++ G      YI T D     + T 
Sbjct: 313 DGYTNSIFSITVGAIDWKGLHPPYSESCSAVMVVTYSSGS---GNYIKTTDLDEKCSNTH 369

Query: 469 SGTSMASPHVAGLLTYLLSLQPD 491
            GTS A+P  AG+ T +L   P+
Sbjct: 370 GGTSAAAPLAAGIYTLVLEANPN 392

>Kpol_1015.8 s1015
           complement(19725..20576,20692..20940,20990..20998,
           21041..22462) [2532 bp, 843 aa] {ON}
           complement(19725..20576,20692..20940,20990..20998,
           21041..22462) [2532 nt, 844 aa]
          Length = 843

 Score = 32.0 bits (71), Expect = 5.0,   Method: Compositional matrix adjust.
 Identities = 67/282 (23%), Positives = 96/282 (34%), Gaps = 85/282 (30%)

Query: 258 LYASNSAGKGVTAYVVDTGISVSH------------LEFGERAKWGKTIPINDYDIDGNG 305
           L+     GKGV   +VD G+                 +F E     K +  +DY      
Sbjct: 155 LWYEGITGKGVVVAIVDDGLDYESEDLKDNFCKEGSWDFNENQNLPKPLLYDDY------ 208

Query: 306 HGTHCAGTIGSEH-----YGVAKGANLVAVKVLRSDGSGTMSD----VLKGVE------- 349
           HGT CAG I +        GVA G+ +  +++L   G  T  D    ++ G++       
Sbjct: 209 HGTRCAGEIAAAKNEYCGLGVAYGSKVSGIRILS--GQITAEDEAASLVYGLDVNDIYSC 266

Query: 350 -WVALEHTKHLE---------------ESRKDKNSNYKGATANMSLGGGKSPALDQAVNA 393
            W   +  KHL+               E R +K S Y  A+ N  + G      D   N+
Sbjct: 267 SWGPPDDGKHLQGPSELVKKSLLKGIQEGRGEKGSIYVFASGNGGMFGDNC-NYDGYTNS 325

Query: 394 AVKAGVHFAVAAGNENQDACNSSPAAAENAITVGASTLSDDRAYFSNY----GKCVDIFA 449
                V  A+       D     P  AE+   V   T S     F +     GKC D   
Sbjct: 326 IYSITVS-AI-------DHKGMHPPYAESCSAVMVVTYSSGSGEFIHSTDINGKCSD--- 374

Query: 450 PGLNILSTYIGTNDATATLSGTSMASPHVAGLLTYLLSLQPD 491
                              SGTS A+P  AG+   +L   P+
Sbjct: 375 -----------------RHSGTSAAAPLAAGIYALVLEANPN 399

>TPHA0A05840 Chr1 complement(1325537..1326706) [1170 bp, 389 aa]
           {ON} Anc_3.525 YGL212W
          Length = 389

 Score = 31.6 bits (70), Expect = 6.3,   Method: Compositional matrix adjust.
 Identities = 30/103 (29%), Positives = 47/103 (45%), Gaps = 16/103 (15%)

Query: 484 YLLSLQPDKGSEFYVPNSELTPLQMKKKIIDYAT------KNALADLPADTPNKLIYNGG 537
           Y  S++  KG +      E+ PL   K+  D+ T      K    +LP + P + I N  
Sbjct: 25  YPFSIKVTKGDDSSAHTIEIGPLL--KRYSDFYTLKKNLEKEFAMELPYELPKRTINNL- 81

Query: 538 FNSTDFWASAAAPQSHKVKTNRYSLGSFL-DSIQDS-NNHWFN 578
                FW+S ++  S  +K  +Y L +FL D + DS +  W N
Sbjct: 82  -----FWSSQSSLDSDVIKERKYKLRNFLFDLLNDSFDTRWRN 119

>KLLA0E11133g Chr5 (979660..981042) [1383 bp, 460 aa] {ON} some
           similarities with uniprot|Q03508 Saccharomyces
           cerevisiae YMR265C Hypothetical ORF
          Length = 460

 Score = 31.6 bits (70), Expect = 7.2,   Method: Compositional matrix adjust.
 Identities = 40/188 (21%), Positives = 75/188 (39%), Gaps = 30/188 (15%)

Query: 100 VTDQILAYYQHASPASRGLELAALHDNGVGTADHDRYIIV----FKKGVFKEQV----DQ 151
           V ++ +  +Q     SRG +   L    + TA +   +IV    F   V +  +    ++
Sbjct: 128 VIEEAMKQFQEDFELSRGFDAVCLKKEQMTTASYKTSLIVSLLDFYSNVNQISIYDDRER 187

Query: 152 HLKMMSALFRRLSEEQRPAAAPGASALRDGFDRVMDTFEVAGAFSGYIATVASPKIVDFI 211
           H KM     +  +E  RPA  P                 +  A   Y+ +    ++V   
Sbjct: 188 HCKMFREFLKNYAETVRPALIPSVV--------------IVPAIFYYLPSDVEIELVH-- 231

Query: 212 RLNPLVDYVEKDSVVHSLDETQNNAPWGLARISHREGLNLGNFNKYLYASNSAGKGVTAY 271
             N + D    + +V S++E + +      +  ++ G++ GNFN + +  NSA     A 
Sbjct: 232 --NMVAD---SNKIVQSINERKKHQKHQKKKSFNKSGVSNGNFNIF-HLHNSAMHSSYAL 285

Query: 272 VVDTGISV 279
            V+T I +
Sbjct: 286 DVETTIRL 293

>AEL208W Chr5 (240780..243743) [2964 bp, 987 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YGR240C (PFK1)
          Length = 987

 Score = 31.6 bits (70), Expect = 8.1,   Method: Compositional matrix adjust.
 Identities = 27/77 (35%), Positives = 38/77 (49%), Gaps = 7/77 (9%)

Query: 337 GSGTMSDVLKGVEWVALEHTKHLEESRKDKNSNYKGATANMSLGGGKSPALDQAVNAAVK 396
           GSG    + +G E  A    + L E+    +S  K   A M+  GG SP ++ AV A V+
Sbjct: 175 GSGETHRLAQGRE-TAAALMRSLRETPGAPDSKPKKKLAVMT-SGGDSPGMNAAVRAVVR 232

Query: 397 AGVH-----FAVAAGNE 408
           AG++     FAV  G E
Sbjct: 233 AGIYYGCDVFAVYEGYE 249

>KAFR0G01520 Chr7 (342499..342972) [474 bp, 157 aa] {ON} Anc_3.137
           YGR076C
          Length = 157

 Score = 30.0 bits (66), Expect = 9.4,   Method: Composition-based stats.
 Identities = 21/91 (23%), Positives = 40/91 (43%), Gaps = 7/91 (7%)

Query: 476 PHVA----GLLTYLLSLQPDKGSEFYVPNSELTPLQMKKKIID---YATKNALADLPADT 528
           PH+      + T+ ++  P   ++  V N+   PL  ++++ D    A +  + DL    
Sbjct: 25  PHIKYANEAVSTHAVNANPFIANKHPVTNTYHNPLYSRRRMSDIYKLAYRYGIQDLLPPI 84

Query: 529 PNKLIYNGGFNSTDFWASAAAPQSHKVKTNR 559
            NK  +   +NS  F      P+ HK + N+
Sbjct: 85  QNKAFFEEKYNSKKFMKGVLQPKGHKHELNQ 115

>Ecym_6486 Chr6 complement(941694..944039) [2346 bp, 781 aa] {ON}
           similar to Ashbya gossypii ABL203W
          Length = 781

 Score = 31.2 bits (69), Expect = 10.0,   Method: Compositional matrix adjust.
 Identities = 26/94 (27%), Positives = 39/94 (41%), Gaps = 19/94 (20%)

Query: 258 LYASNSAGKGVTAYVVDTGISVSHLE----FGERAKWGKTI------PINDYDIDGNGHG 307
           L+ +N  G GV A +VD G+     +    F     W          PI    +  + HG
Sbjct: 152 LWYNNITGHGVVAAIVDDGLDYESEDLKDNFCAEGSWDFNANTALPKPI----LGDDNHG 207

Query: 308 THCAGTIGSEH-----YGVAKGANLVAVKVLRSD 336
           T CAG I +        GVA  A +  +++L +D
Sbjct: 208 TRCAGEIAAAKNKVCGVGVAYNAKVSGIRILSAD 241

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.314    0.131    0.385 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 59,600,087
Number of extensions: 2576435
Number of successful extensions: 5478
Number of sequences better than 10.0: 100
Number of HSP's gapped: 5334
Number of HSP's successfully gapped: 100
Length of query: 585
Length of database: 53,481,399
Length adjustment: 115
Effective length of query: 470
Effective length of database: 40,294,809
Effective search space: 18938560230
Effective search space used: 18938560230
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (22.0 bits)
S2: 69 (31.2 bits)