Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
TPHA0M002206.12ON78784073e-53
Kpol_1032.36.12ON78791435e-13
ZYRO0F00528g6.12ON77811373e-12
Skud_5.306.12ON74791357e-12
Smik_5.286.12ON74791331e-11
Suva_5.96.12ON73781286e-11
YEL059C-A (SOM1)6.12ON74791287e-11
Ecym_30156.12ON70611234e-10
TDEL0G045906.12ON74641226e-10
ACR014C6.12ON70601227e-10
KLTH0C11484g6.12ON89781132e-08
SAKL0E00924g6.12ON97601123e-08
KLLA0D00880g6.12ON71601095e-08
NCAS0F002106.12ON79801071e-07
Kwal_56.223596.12ON91801011e-06
TBLA0G009906.12ON7880760.005
KAFR0L003506.12ON7175760.005
ZYRO0F09306g8.718ON82076780.010
KNAG0E009306.12ON10960720.030
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= TPHA0M00220
         (78 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

TPHA0M00220 Chr13 (44225..44461) [237 bp, 78 aa] {ON} Anc_6.12 Y...   161   3e-53
Kpol_1032.3 s1032 (3019..3255) [237 bp, 78 aa] {ON} (3019..3255)...    60   5e-13
ZYRO0F00528g Chr6 (51411..51644) [234 bp, 77 aa] {ON} similar to...    57   3e-12
Skud_5.30 Chr5 complement(41436..41657) [222 bp, 74 aa] {ON} YEL...    57   7e-12
Smik_5.28 Chr5 complement(44691..44912) [222 bp, 74 aa] {ON} YEL...    56   1e-11
Suva_5.9 Chr5 complement(18353..18571) [219 bp, 73 aa] {ON} YEL0...    54   6e-11
YEL059C-A Chr5 complement(42400..42624) [225 bp, 74 aa] {ON}  SO...    54   7e-11
Ecym_3015 Chr3 (30115..30327) [213 bp, 70 aa] {ON} similar to As...    52   4e-10
TDEL0G04590 Chr7 complement(838052..838276) [225 bp, 74 aa] {ON}...    52   6e-10
ACR014C Chr3 complement(382776..382988) [213 bp, 70 aa] {ON} Syn...    52   7e-10
KLTH0C11484g Chr3 complement(944502..944771) [270 bp, 89 aa] {ON...    48   2e-08
SAKL0E00924g Chr5 (70494..70787) [294 bp, 97 aa] {ON} similar to...    48   3e-08
KLLA0D00880g Chr4 (82211..82426) [216 bp, 71 aa] {ON} uniprot|P7...    47   5e-08
NCAS0F00210 Chr6 (32317..32556) [240 bp, 79 aa] {ON} Anc_6.12 YE...    46   1e-07
Kwal_56.22359 s56 (64674..64949) [276 bp, 91 aa] {ON} YEL059C-A ...    44   1e-06
TBLA0G00990 Chr7 (251428..251664) [237 bp, 78 aa] {ON} Anc_6.12 ...    34   0.005
KAFR0L00350 Chr12 (63897..64112) [216 bp, 71 aa] {ON} Anc_6.12 Y...    34   0.005
ZYRO0F09306g Chr6 complement(755837..758299) [2463 bp, 820 aa] {...    35   0.010
KNAG0E00930 Chr5 complement(176364..176693) [330 bp, 109 aa] {ON...    32   0.030

>TPHA0M00220 Chr13 (44225..44461) [237 bp, 78 aa] {ON} Anc_6.12
          YEL059C-A
          Length = 78

 Score =  161 bits (407), Expect = 3e-53,   Method: Compositional matrix adjust.
 Identities = 78/78 (100%), Positives = 78/78 (100%)

Query: 1  MAPATPVVDREAVAATLQASKQRNRQECELKALTQYECQFVDLESNRYICRPFKRLFEVC 60
          MAPATPVVDREAVAATLQASKQRNRQECELKALTQYECQFVDLESNRYICRPFKRLFEVC
Sbjct: 1  MAPATPVVDREAVAATLQASKQRNRQECELKALTQYECQFVDLESNRYICRPFKRLFEVC 60

Query: 61 AGTSYETTAQPTNSADRS 78
          AGTSYETTAQPTNSADRS
Sbjct: 61 AGTSYETTAQPTNSADRS 78

>Kpol_1032.3 s1032 (3019..3255) [237 bp, 78 aa] {ON} (3019..3255)
          [237 nt, 79 aa]
          Length = 78

 Score = 59.7 bits (143), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 32/79 (40%), Positives = 45/79 (56%), Gaps = 8/79 (10%)

Query: 1  MAPATPVVDREAVAATLQASK-----QRNRQECELKALTQYECQFVDLESNRYICRPFKR 55
          MAP TP+  RE V   L+  K        + +C L ++TQ++C+F +     YIC PFKR
Sbjct: 1  MAPPTPIQSREEV---LRGKKCLTMVDNKKGKCTLTSITQFQCRFENSYEGEYICLPFKR 57

Query: 56 LFEVCAGTSYETTAQPTNS 74
          LFE C+G   E T + TN+
Sbjct: 58 LFEECSGIRIEVTDRFTNN 76

>ZYRO0F00528g Chr6 (51411..51644) [234 bp, 77 aa] {ON} similar to
          uniprot|Q05676 Saccharomyces cerevisiae YEL059C-A
          Length = 77

 Score = 57.4 bits (137), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 34/81 (41%), Positives = 45/81 (55%), Gaps = 7/81 (8%)

Query: 1  MAPATPVVDREAVA---ATLQASKQRNRQECELKALTQYECQFVDLESNRYICRPFKRLF 57
          MAP TP++  E V+     +Q  K++N+  CELK+LTQ+ C         YIC PFKR+F
Sbjct: 1  MAPPTPILTSEQVSRERERVQILKEKNK--CELKSLTQHLCHAE--APGEYICVPFKRVF 56

Query: 58 EVCAGTSYETTAQPTNSADRS 78
          E C G + E T   TN    S
Sbjct: 57 EKCLGHALEVTDADTNDIQGS 77

>Skud_5.30 Chr5 complement(41436..41657) [222 bp, 74 aa] {ON}
          YEL059C-A (REAL)
          Length = 74

 Score = 56.6 bits (135), Expect = 7e-12,   Method: Compositional matrix adjust.
 Identities = 35/79 (44%), Positives = 43/79 (54%), Gaps = 10/79 (12%)

Query: 1  MAPATPVVDREAVAATLQASKQRNRQECELKALTQYECQFVDLESNRYICRPFKRLFEVC 60
          MAP T +  R+   A L A     R  C+LK L Q+ECQF + +   Y+C PFKRLFE C
Sbjct: 1  MAPPTTIRSRDQALAPLAALDSHTR--CQLKELVQWECQFREAD---YVCFPFKRLFERC 55

Query: 61 -----AGTSYETTAQPTNS 74
               + T YE T   TNS
Sbjct: 56 IAPDKSATDYEVTDTYTNS 74

>Smik_5.28 Chr5 complement(44691..44912) [222 bp, 74 aa] {ON}
          YEL059C-A (REAL)
          Length = 74

 Score = 55.8 bits (133), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 34/79 (43%), Positives = 43/79 (54%), Gaps = 10/79 (12%)

Query: 1  MAPATPVVDREAVAATLQASKQRNRQECELKALTQYECQFVDLESNRYICRPFKRLFEVC 60
          MAP T +  R+   A L A    ++  C+LK L Q+ECQF   +   Y+C PFKRLFE C
Sbjct: 1  MAPPTTIRSRDQALAPLMALD--SQASCQLKELVQWECQF---KGADYVCSPFKRLFEHC 55

Query: 61 A-----GTSYETTAQPTNS 74
                 T+YE T   TNS
Sbjct: 56 VEHGKPATNYEVTDTYTNS 74

>Suva_5.9 Chr5 complement(18353..18571) [219 bp, 73 aa] {ON}
          YEL059C-A (REAL)
          Length = 73

 Score = 53.9 bits (128), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 33/78 (42%), Positives = 42/78 (53%), Gaps = 10/78 (12%)

Query: 1  MAPATPVVDREAVAATLQASKQRNRQECELKALTQYECQFVDLESNRYICRPFKRLFEVC 60
          MAP T +  R+   A L  +   +R  C LK L Q+ECQF   +   Y+C PF+RLFE C
Sbjct: 1  MAPPTTIRARDQALAPL--ATLDSRTHCHLKELVQWECQF---KGADYVCSPFRRLFEHC 55

Query: 61 -----AGTSYETTAQPTN 73
               A T+YE T   TN
Sbjct: 56 TAPGEAATNYEVTDTYTN 73

>YEL059C-A Chr5 complement(42400..42624) [225 bp, 74 aa] {ON}
          SOM1Subunit of the mitochondrial inner membrane
          peptidase, which is required for maturation of
          mitochondrial proteins of the intermembrane space;
          Som1p facilitates cleavage of a subset of substrates;
          contains twin cysteine-x9-cysteine motifs
          Length = 74

 Score = 53.9 bits (128), Expect = 7e-11,   Method: Compositional matrix adjust.
 Identities = 34/79 (43%), Positives = 43/79 (54%), Gaps = 10/79 (12%)

Query: 1  MAPATPVVDREAVAATLQASKQRNRQECELKALTQYECQFVDLESNRYICRPFKRLFEVC 60
          MAP T +  R+   A L  +   ++  C LK L Q+ECQF   E   Y+C PFKRLFE C
Sbjct: 1  MAPPTTIRTRDQALAPL--ATLDSQTNCRLKELVQWECQFKGAE---YVCSPFKRLFEHC 55

Query: 61 -----AGTSYETTAQPTNS 74
               + T+YE T   TNS
Sbjct: 56 IAPDKSATNYEVTDTYTNS 74

>Ecym_3015 Chr3 (30115..30327) [213 bp, 70 aa] {ON} similar to
          Ashbya gossypii ACR014C
          Length = 70

 Score = 52.0 bits (123), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 26/61 (42%), Positives = 35/61 (57%), Gaps = 8/61 (13%)

Query: 1  MAPATPVVDREAVAATLQASKQRNRQECELKALTQYECQFVDLESNRYICRPFKRLFEVC 60
          MAP TP++ R+ V   L  +K     +C L +L Q EC F   + + Y+C PFKRLFE C
Sbjct: 1  MAPPTPIITRDEVEPILSRTK-----DCILASLIQNECHF---DGHNYVCIPFKRLFEEC 52

Query: 61 A 61
           
Sbjct: 53 T 53

>TDEL0G04590 Chr7 complement(838052..838276) [225 bp, 74 aa] {ON}
          Anc_6.12 YEL059C-A
          Length = 74

 Score = 51.6 bits (122), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 28/64 (43%), Positives = 36/64 (56%), Gaps = 6/64 (9%)

Query: 1  MAPATPVVDREAVAATLQASKQRNRQECELKALTQYECQFVDLESNRYICRPFKRLFEVC 60
          MAP TPV+ RE +    Q+      + C LK+LTQ++CQ     S  Y C PFKRLF+ C
Sbjct: 1  MAPPTPVLAREELPEIPQS------KNCVLKSLTQFQCQLRPAGSGLYECVPFKRLFQEC 54

Query: 61 AGTS 64
             S
Sbjct: 55 RDPS 58

>ACR014C Chr3 complement(382776..382988) [213 bp, 70 aa] {ON}
          Syntenic homolog of Saccharomyces cerevisiae YEL059C-A
          (SOM1)
          Length = 70

 Score = 51.6 bits (122), Expect = 7e-10,   Method: Compositional matrix adjust.
 Identities = 28/60 (46%), Positives = 35/60 (58%), Gaps = 8/60 (13%)

Query: 1  MAPATPVVDREAVAATLQASKQRNRQECELKALTQYECQFVDLESNRYICRPFKRLFEVC 60
          MAP TPV+ RE VA  L  S+     +C L +LTQ EC F   +   Y+C PF+RLF  C
Sbjct: 1  MAPPTPVLTREEVAPALATSR-----DCVLASLTQNECHF---DGRGYVCVPFQRLFREC 52

>KLTH0C11484g Chr3 complement(944502..944771) [270 bp, 89 aa] {ON}
          similar to uniprot|Q05676 Saccharomyces cerevisiae
          YEL059C-A SOM1 Protein whose overexpression suppresses
          the imp1 mutation may be required for the function of
          the Imp1p mitochondrial inner membrane peptidase and/or
          the protein sorting machinery
          Length = 89

 Score = 48.1 bits (113), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 30/78 (38%), Positives = 39/78 (50%), Gaps = 11/78 (14%)

Query: 1  MAPATPVVDREAVAATLQASKQRNRQECELKALTQYECQFVDLESNRYICRPFKRLFEVC 60
          MAP T V  +E     L+   ++  + C LKAL Q EC+F     + Y+C PFKRLF+ C
Sbjct: 1  MAPPTLVFGKEE----LKGIWEKAAEPCFLKALVQNECEF---NGHEYVCTPFKRLFKEC 53

Query: 61 AGTS----YETTAQPTNS 74
                   E T Q TN 
Sbjct: 54 GAGKRIVRIEVTDQDTNH 71

>SAKL0E00924g Chr5 (70494..70787) [294 bp, 97 aa] {ON} similar to
          uniprot|Q05676 Saccharomyces cerevisiae YEL059C-A SOM1
          Protein whose overexpression suppresses the imp1
          mutation may be required for the function of the Imp1p
          mitochondrial inner membrane peptidase and/or the
          protein sorting machinery
          Length = 97

 Score = 47.8 bits (112), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 26/60 (43%), Positives = 33/60 (55%), Gaps = 7/60 (11%)

Query: 1  MAPATPVVDREAVAATLQASKQRNRQECELKALTQYECQFVDLESNRYICRPFKRLFEVC 60
          MAP TPV  ++ + + L+  K      C LK+L Q EC F       YIC PFKRLF+ C
Sbjct: 1  MAPPTPVFGKDELESLLKKVKP----PCTLKSLIQNECTF---NGEEYICVPFKRLFKEC 53

>KLLA0D00880g Chr4 (82211..82426) [216 bp, 71 aa] {ON}
          uniprot|P78699 Kluyveromyces lactis KLLA0D00880g SOM1
          Protein SOM1 mitochondrial precursor
          Length = 71

 Score = 46.6 bits (109), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 25/60 (41%), Positives = 31/60 (51%), Gaps = 8/60 (13%)

Query: 1  MAPATPVVDREAVAATLQASKQRNRQECELKALTQYECQFVDLESNRYICRPFKRLFEVC 60
          MAP T ++  +     LQ       + C LK+L Q EC F     N Y+C PFKRLFE C
Sbjct: 1  MAPPTKILGLDTQQRMLQRG-----ENCSLKSLVQNECAF---NGNDYVCTPFKRLFEQC 52

>NCAS0F00210 Chr6 (32317..32556) [240 bp, 79 aa] {ON} Anc_6.12
          YEL059C-A
          Length = 79

 Score = 45.8 bits (107), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 27/80 (33%), Positives = 37/80 (46%), Gaps = 9/80 (11%)

Query: 1  MAPATPVVDREAVAATLQASKQRNRQ-------ECELKALTQYECQFVDLESNRYICRPF 53
          MAP   V  ++ +      S  R  +        C    LTQ++CQ   LE  +YIC PF
Sbjct: 1  MAPPVVVFGKDDIRVKTALSNNRTGETDAETGDGCRQFQLTQFQCQL--LEDGQYICFPF 58

Query: 54 KRLFEVCAGTSYETTAQPTN 73
          KR+F+ C G   E T   +N
Sbjct: 59 KRVFQECQGVRTEVTNVDSN 78

>Kwal_56.22359 s56 (64674..64949) [276 bp, 91 aa] {ON} YEL059C-A
          (SOM1) - involved in mitochondrial inner peptidase
          function [contig 186] FULL
          Length = 91

 Score = 43.5 bits (101), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 32/80 (40%), Positives = 42/80 (52%), Gaps = 13/80 (16%)

Query: 1  MAPATPVVDREAVAATLQASKQRNRQ-ECELKALTQYECQFVDLESNRYICRPFKRLFEV 59
          MAP T V  +E +   L     RN    C  K+LTQ EC F   + ++Y+C PFKR+F+ 
Sbjct: 1  MAPPTVVFGKEELEPLL-----RNVMATCIFKSLTQSECNF---DGHQYVCVPFKRVFKE 52

Query: 60 CA--GTS--YETTAQPTNSA 75
          C   G S   E T + TN A
Sbjct: 53 CKVDGKSIRIEVTDRNTNKA 72

>TBLA0G00990 Chr7 (251428..251664) [237 bp, 78 aa] {ON} Anc_6.12
          YEL059C-A
          Length = 78

 Score = 33.9 bits (76), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 24/80 (30%), Positives = 39/80 (48%), Gaps = 10/80 (12%)

Query: 1  MAPATPVVDREAVAATLQASKQRNRQECELKA-------LTQYECQFVDLESNRYICRPF 53
          MAP   +  +E +   L+   ++NR++   K+       +TQYEC   D +  +  C PF
Sbjct: 1  MAPPVTIQTKEELDI-LEKVNRKNRKDDTKKSAKPKKYSITQYEC--FDNDKGQIECFPF 57

Query: 54 KRLFEVCAGTSYETTAQPTN 73
          KR+F+       E T + TN
Sbjct: 58 KRIFQQVGEYRREITDETTN 77

>KAFR0L00350 Chr12 (63897..64112) [216 bp, 71 aa] {ON} Anc_6.12
          YEL059C-A
          Length = 71

 Score = 33.9 bits (76), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 22/75 (29%), Positives = 34/75 (45%), Gaps = 7/75 (9%)

Query: 1  MAPATPVVDREAVAATLQASKQRNRQECELKALTQYECQFVDLESNRYICRPFKRLFEVC 60
          MAP   V+D +A    ++ +     + C+L +L QY C++         C PFKR+F  C
Sbjct: 1  MAPMIRVMDGDAAEREVKGA-----EGCQLYSLVQYNCEY--RVGGTLECFPFKRMFLEC 53

Query: 61 AGTSYETTAQPTNSA 75
             S +     T S 
Sbjct: 54 LDKSGKLKRVETRSG 68

>ZYRO0F09306g Chr6 complement(755837..758299) [2463 bp, 820 aa] {ON}
           similar to uniprot|P32563 Saccharomyces cerevisiae
           YOR270C VPH1 Subunit of vacuolar-ATPase V0 domain one of
           two isoforms (Vph1p and Stv1p) Vph1p is located in V-
           ATPase complexes of the vacuole while Stv1p is located
           in V-ATPase complexes of the Golgi and endosomes
          Length = 820

 Score = 34.7 bits (78), Expect = 0.010,   Method: Composition-based stats.
 Identities = 26/76 (34%), Positives = 37/76 (48%), Gaps = 5/76 (6%)

Query: 1   MAPATPVVDREAVAATLQASKQRNRQECELKALTQYECQFVDLESNRYICRPFKRLFEVC 60
           +APAT V+D  A  ATL   +    +E    A  Q E Q  DLE  R++ +  ++ F   
Sbjct: 96  LAPATGVIDDHAQNATLLEERLSQMEE----ASEQLELQKADLEQYRFLLQTGEQFFTRD 151

Query: 61  AGT-SYETTAQPTNSA 75
           AG+ S E   Q   +A
Sbjct: 152 AGSLSVEPAFQDPEAA 167

>KNAG0E00930 Chr5 complement(176364..176693) [330 bp, 109 aa] {ON}
          Anc_6.12 YEL059C-A
          Length = 109

 Score = 32.3 bits (72), Expect = 0.030,   Method: Compositional matrix adjust.
 Identities = 20/60 (33%), Positives = 29/60 (48%), Gaps = 9/60 (15%)

Query: 1  MAPATPVVDREAVAATLQASKQRNRQECELKALTQYECQFVDLESNRYICRPFKRLFEVC 60
          MAP   V+ R  V         + +  C LK L Q+ C+    +  ++ C PF+RLFE C
Sbjct: 1  MAPNVRVLTRNDVPLP------QPQDGCVLKELVQFRCEN---DGTQWQCAPFRRLFEQC 51

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.317    0.126    0.365 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 7,036,956
Number of extensions: 202511
Number of successful extensions: 522
Number of sequences better than 10.0: 19
Number of HSP's gapped: 507
Number of HSP's successfully gapped: 19
Length of query: 78
Length of database: 53,481,399
Length adjustment: 50
Effective length of query: 28
Effective length of database: 47,748,099
Effective search space: 1336946772
Effective search space used: 1336946772
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 59 (27.3 bits)