Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
TPHA0M002106.11ON54554528650.0
Kpol_1032.26.11ON53954018750.0
TBLA0G009806.11ON55855216080.0
TDEL0G046006.11ON52853716040.0
ZYRO0F00506g6.11ON55055415980.0
Suva_5.106.11ON55355415870.0
Smik_5.296.11ON55555915780.0
NCAS0F002006.11ON54954915650.0
YEL058W (PCM1)6.11ON55755515630.0
Skud_5.316.11ON55756015530.0
SAKL0E00902g6.11ON54454515360.0
KLTH0C11506g6.11ON54454115140.0
Kwal_56.223556.11ON54153914890.0
CAGL0B03597g6.11ON54054814740.0
KAFR0L003406.11ON54054114630.0
Ecym_30146.11ON55154414390.0
NDAI0K028906.11ON56155314200.0
KLLA0D00858g6.11ON54154414050.0
ACR015W6.11ON55252913850.0
KNAG0E009406.11ON53855613510.0
NDAI0K004108.840ON62693940.010
YMR278W (PGM3)8.840ON62280870.065
NCAS0C004108.840ON625101840.12
TDEL0B005708.840ON63030830.18
Kpol_1068.88.840ON63230820.20
KLLA0D01573g8.840ON60730810.29
KLTH0C03872g8.840ON62161800.40
TPHA0I002508.840ON62998800.41
KLLA0D06809g8.632ON188124770.51
Kwal_27.102588.840ON62030790.56
Skud_13.4508.840ON62280780.70
Smik_13.4918.840ON62280770.80
CAGL0M02981g8.840ON61728770.83
ABL126W8.840ON62486770.86
ZYRO0G14190g8.840ON61028770.86
Suva_13.4668.840ON62228770.91
Kpol_1037.416.54ON436146761.00
Ecym_46118.840ON63030771.0
KAFR0C055505.557ON18770741.1
KNAG0J002708.840ON62547761.2
TBLA0B032508.840ON64328761.2
KLLA0B01309g5.557ON18770721.9
KAFR0B039208.840ON62499742.3
NCAS0H027205.557ON18870712.6
SAKL0D01474g8.840ON62428733.0
NDAI0C057908.587ON70393699.5
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= TPHA0M00210
         (545 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

TPHA0M00210 Chr13 complement(42336..43973) [1638 bp, 545 aa] {ON...  1108   0.0  
Kpol_1032.2 s1032 complement(1049..2668) [1620 bp, 539 aa] {ON} ...   726   0.0  
TBLA0G00980 Chr7 complement(248484..250160) [1677 bp, 558 aa] {O...   624   0.0  
TDEL0G04600 Chr7 (838381..839967) [1587 bp, 528 aa] {ON} Anc_6.1...   622   0.0  
ZYRO0F00506g Chr6 complement(49579..51231) [1653 bp, 550 aa] {ON...   620   0.0  
Suva_5.10 Chr5 (19280..20941) [1662 bp, 553 aa] {ON} YEL058W (REAL)   615   0.0  
Smik_5.29 Chr5 (45538..47205) [1668 bp, 555 aa] {ON} YEL058W (REAL)   612   0.0  
NCAS0F00200 Chr6 complement(30474..32123) [1650 bp, 549 aa] {ON}...   607   0.0  
YEL058W Chr5 (43252..44925) [1674 bp, 557 aa] {ON}  PCM1Essentia...   606   0.0  
Skud_5.31 Chr5 (42262..43935) [1674 bp, 557 aa] {ON} YEL058W (REAL)   602   0.0  
SAKL0E00902g Chr5 complement(68682..70316) [1635 bp, 544 aa] {ON...   596   0.0  
KLTH0C11506g Chr3 (944869..946503) [1635 bp, 544 aa] {ON} simila...   587   0.0  
Kwal_56.22355 s56 complement(62955..64580) [1626 bp, 541 aa] {ON...   578   0.0  
CAGL0B03597g Chr2 complement(359018..360640) [1623 bp, 540 aa] {...   572   0.0  
KAFR0L00340 Chr12 complement(62157..63779) [1623 bp, 540 aa] {ON...   568   0.0  
Ecym_3014 Chr3 complement(28261..29916) [1656 bp, 551 aa] {ON} s...   558   0.0  
NDAI0K02890 Chr11 (655311..656996) [1686 bp, 561 aa] {ON} Anc_6....   551   0.0  
KLLA0D00858g Chr4 complement(80327..81952) [1626 bp, 541 aa] {ON...   545   0.0  
ACR015W Chr3 (383130..384788) [1659 bp, 552 aa] {ON} Syntenic ho...   538   0.0  
KNAG0E00940 Chr5 (176887..178503) [1617 bp, 538 aa] {ON} Anc_6.1...   525   0.0  
NDAI0K00410 Chr11 complement(91807..93687) [1881 bp, 626 aa] {ON...    41   0.010
YMR278W Chr13 (822763..824631) [1869 bp, 622 aa] {ON}  PGM3Phosp...    38   0.065
NCAS0C00410 Chr3 complement(62893..64770) [1878 bp, 625 aa] {ON}...    37   0.12 
TDEL0B00570 Chr2 complement(109270..111162) [1893 bp, 630 aa] {O...    37   0.18 
Kpol_1068.8 s1068 complement(13542..15440) [1899 bp, 632 aa] {ON...    36   0.20 
KLLA0D01573g Chr4 complement(139183..141006) [1824 bp, 607 aa] {...    36   0.29 
KLTH0C03872g Chr3 complement(337765..339630) [1866 bp, 621 aa] {...    35   0.40 
TPHA0I00250 Chr9 (46554..48443) [1890 bp, 629 aa] {ON} Anc_8.840...    35   0.41 
KLLA0D06809g Chr4 complement(587709..588275) [567 bp, 188 aa] {O...    34   0.51 
Kwal_27.10258 s27 complement(265612..267474) [1863 bp, 620 aa] {...    35   0.56 
Skud_13.450 Chr13 (796030..797898) [1869 bp, 622 aa] {ON} YMR278...    35   0.70 
Smik_13.491 Chr13 (805767..807635) [1869 bp, 622 aa] {ON} YMR278...    34   0.80 
CAGL0M02981g Chr13 (335863..337716) [1854 bp, 617 aa] {ON} simil...    34   0.83 
ABL126W Chr2 (159207..161081) [1875 bp, 624 aa] {ON} Syntenic ho...    34   0.86 
ZYRO0G14190g Chr7 (1131206..1133038) [1833 bp, 610 aa] {ON} simi...    34   0.86 
Suva_13.466 Chr13 (805414..807282) [1869 bp, 622 aa] {ON} YMR278...    34   0.91 
Kpol_1037.41 s1037 (100357..101667) [1311 bp, 436 aa] {ON} (1003...    34   1.00 
Ecym_4611 Chr4 (1191367..1193259) [1893 bp, 630 aa] {ON} similar...    34   1.0  
KAFR0C05550 Chr3 complement(1108145..1108708) [564 bp, 187 aa] {...    33   1.1  
KNAG0J00270 Chr10 complement(39750..41627) [1878 bp, 625 aa] {ON...    34   1.2  
TBLA0B03250 Chr2 (757928..759859) [1932 bp, 643 aa] {ON} Anc_8.8...    34   1.2  
KLLA0B01309g Chr2 complement(103734..104297) [564 bp, 187 aa] {O...    32   1.9  
KAFR0B03920 Chr2 (814394..816268) [1875 bp, 624 aa] {ON} Anc_8.8...    33   2.3  
NCAS0H02720 Chr8 complement(535363..535929) [567 bp, 188 aa] {ON...    32   2.6  
SAKL0D01474g Chr4 complement(117178..119052) [1875 bp, 624 aa] {...    33   3.0  
NDAI0C05790 Chr3 (1331269..1333380) [2112 bp, 703 aa] {ON} Anc_8...    31   9.5  

>TPHA0M00210 Chr13 complement(42336..43973) [1638 bp, 545 aa] {ON}
           Anc_6.11 YEL058W
          Length = 545

 Score = 1108 bits (2865), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 533/545 (97%), Positives = 533/545 (97%)

Query: 1   MHWNVLESVFESCCTTRNHRYVYGTAGFRDDATVLDTVMVTTGLLACLRSIALDGKAVGV 60
           MHWNVLESVFESCCTTRNHRYVYGTAGFRDDATVLDTVMVTTGLLACLRSIALDGKAVGV
Sbjct: 1   MHWNVLESVFESCCTTRNHRYVYGTAGFRDDATVLDTVMVTTGLLACLRSIALDGKAVGV 60

Query: 61  MITASHNQPCDNGVKIVEPDGSMLDQSWEPFATELANKASFCHSTQEFKLYLQEKFAQYK 120
           MITASHNQPCDNGVKIVEPDGSMLDQSWEPFATELANKASFCHSTQEFKLYLQEKFAQYK
Sbjct: 61  MITASHNQPCDNGVKIVEPDGSMLDQSWEPFATELANKASFCHSTQEFKLYLQEKFAQYK 120

Query: 121 VDSGITPVLVVGRDSRDSGPRLLQCLNSLAVPLMKPKIIDYGLLTTPQLHFLTNAINTTK 180
           VDSGITPVLVVGRDSRDSGPRLLQCLNSLAVPLMKPKIIDYGLLTTPQLHFLTNAINTTK
Sbjct: 121 VDSGITPVLVVGRDSRDSGPRLLQCLNSLAVPLMKPKIIDYGLLTTPQLHFLTNAINTTK 180

Query: 181 SRAPVTEDDYYSFFMDAWVSITALHGIKVLQSPRLYIDAANGIGGPKVSKLFEVWPQAGQ 240
           SRAPVTEDDYYSFFMDAWVSITALHGIKVLQSPRLYIDAANGIGGPKVSKLFEVWPQAGQ
Sbjct: 181 SRAPVTEDDYYSFFMDAWVSITALHGIKVLQSPRLYIDAANGIGGPKVSKLFEVWPQAGQ 240

Query: 241 FTLVNNHWQTPTLLNNDCGADYVKTNQRLPKNIDPAADSDPATLYCSFDGDADRIVFYYQ 300
           FTLVNNHWQTPTLLNNDCGADYVKTNQRLPKNIDPAADSDPATLYCSFDGDADRIVFYYQ
Sbjct: 241 FTLVNNHWQTPTLLNNDCGADYVKTNQRLPKNIDPAADSDPATLYCSFDGDADRIVFYYQ 300

Query: 301 DAQNSFHLLDGDKISTLFALFISKQLKKAGLTEKISMGVVQTAYANGNSTNYLENVLNIP 360
           DAQNSFHLLDGDKISTLFALFISKQLKKAGLTEKISMGVVQTAYANGNSTNYLENVLNIP
Sbjct: 301 DAQNSFHLLDGDKISTLFALFISKQLKKAGLTEKISMGVVQTAYANGNSTNYLENVLNIP 360

Query: 361 VSCAKTGVKHLHHEAITNYDVGIYFEANGHGTIMFSNKFFETCXXXXXXXXXXXXVKTLL 420
           VSCAKTGVKHLHHEAITNYDVGIYFEANGHGTIMFSNKFFETC            VKTLL
Sbjct: 361 VSCAKTGVKHLHHEAITNYDVGIYFEANGHGTIMFSNKFFETCESLLKENNESLEVKTLL 420

Query: 421 SFAHLINQTVGDAISDMLGVLAVLSIMKLTPSAWDKEYTDLPNLLTKVVVPDRSLFTTTD 480
           SFAHLINQTVGDAISDMLGVLAVLSIMKLTPSAWDKEYTDLPNLLTKVVVPDRSLFTTTD
Sbjct: 421 SFAHLINQTVGDAISDMLGVLAVLSIMKLTPSAWDKEYTDLPNLLTKVVVPDRSLFTTTD 480

Query: 481 QERKLLTPEGAQTKIDAIVAKYKNGRSFVRASGTEDAVRVYAEASTPQDAAALNEEVSKA 540
           QERKLLTPEGAQTKIDAIVAKYKNGRSFVRASGTEDAVRVYAEASTPQDAAALNEEVSKA
Sbjct: 481 QERKLLTPEGAQTKIDAIVAKYKNGRSFVRASGTEDAVRVYAEASTPQDAAALNEEVSKA 540

Query: 541 VLASV 545
           VLASV
Sbjct: 541 VLASV 545

>Kpol_1032.2 s1032 complement(1049..2668) [1620 bp, 539 aa] {ON}
           complement(1049..2668) [1620 nt, 540 aa]
          Length = 539

 Score =  726 bits (1875), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 351/540 (65%), Positives = 425/540 (78%), Gaps = 8/540 (1%)

Query: 9   VFESCCTTRNHRYVYGTAGFRDDATVLDTVMVTTGLLACLRSIALDGKAVGVMITASHNQ 68
           +FE  CTT++H+YVYGTAGFRD+A++L+TVM TTG++ACLRSI+L GKAVGVMITASHN 
Sbjct: 5   LFEKYCTTKDHKYVYGTAGFRDNASILNTVMFTTGIVACLRSISLGGKAVGVMITASHNP 64

Query: 69  PCDNGVKIVEPDGSMLDQSWEPFATELANKASFCHST-QEFKLYLQEKFAQYKVDSG--I 125
           P DNGVKIVEP+G+MLDQSWEP ATELAN A+  +ST  + K Y++EK  ++  +SG  +
Sbjct: 65  PEDNGVKIVEPNGAMLDQSWEPMATELANIAA--NSTFDDLKAYVEEKVKKFSPESGSKV 122

Query: 126 TPVLVVGRDSRDSGPRLLQCLNSLAVPLMKPKIIDYGLLTTPQLHFLTNAINTTKSRAPV 185
            PV+VVGRDSR+SG  LL+CL + A   M  KII+YGLLTTPQLHFLTN IN  KS A V
Sbjct: 123 QPVVVVGRDSRESGSYLLECLLASAENYMNAKIINYGLLTTPQLHFLTNEINVKKSYA-V 181

Query: 186 TEDDYYSFFMDAWVSITALHGIKVLQSPRLYIDAANGIGGPKVSKLFEVWPQAGQFTLVN 245
            E  YY++F+++W  ITALH I  L    L ID ANGIGGPK+ +L + WP A + TLVN
Sbjct: 182 QESSYYNYFIESWNKITALHNITDLYCSSLTIDTANGIGGPKIQELLKSWPFASKVTLVN 241

Query: 246 NHWQTPTLLNNDCGADYVKTNQRLPKNIDPAADSDPATLYCSFDGDADRIVFYYQDAQNS 305
           N W+ P LLN +CGAD+VKTNQ+LP  +  + +S    LYCS+DGDADRIVFY+QD    
Sbjct: 242 NEWEKPDLLNKNCGADFVKTNQKLPNGV--SGNSTENDLYCSYDGDADRIVFYFQDQDKQ 299

Query: 306 FHLLDGDKISTLFALFISKQLKKAGLTEKISMGVVQTAYANGNSTNYLENVLNIPVSCAK 365
           FHLLDGDKISTLFA  I+K L  A L  KIS+GVVQTAYANG+STNYL+  LN+PVSCAK
Sbjct: 300 FHLLDGDKISTLFAKLIAKLLNDANLNSKISLGVVQTAYANGSSTNYLQGTLNVPVSCAK 359

Query: 366 TGVKHLHHEAITNYDVGIYFEANGHGTIMFSNKFFETCXXXXXXXXXXXXVKTLLSFAHL 425
           TGVKHLHHEA+TNYD+G+YFEANGHGTI+FS+ F++ C            V TL++ +HL
Sbjct: 360 TGVKHLHHEAVTNYDIGVYFEANGHGTIIFSDHFYQVCEKELKANSESIAVNTLVALSHL 419

Query: 426 INQTVGDAISDMLGVLAVLSIMKLTPSAWDKEYTDLPNLLTKVVVPDRSLFTTTDQERKL 485
           INQTVGDAISDMLGVL+VLSIMKL+   WD EYTDLPNLLTKV+VPDRS+F TTDQERKL
Sbjct: 420 INQTVGDAISDMLGVLSVLSIMKLSSQQWDNEYTDLPNLLTKVIVPDRSVFITTDQERKL 479

Query: 486 LTPEGAQTKIDAIVAKYKNGRSFVRASGTEDAVRVYAEASTPQDAAALNEEVSKAVLASV 545
           L+PEG Q+KID  ++++ NGRSFVRASGTEDAVRVYAEAS+ ++A  LN  V+K V  SV
Sbjct: 480 LSPEGLQSKIDKAISEFSNGRSFVRASGTEDAVRVYAEASSQEEAKELNALVTKLVKESV 539

>TBLA0G00980 Chr7 complement(248484..250160) [1677 bp, 558 aa] {ON}
           Anc_6.11 YEL058W
          Length = 558

 Score =  624 bits (1608), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 322/552 (58%), Positives = 388/552 (70%), Gaps = 22/552 (3%)

Query: 9   VFESCCTTRNHRYVYGTAGFRDDATVLDTVMVTTGLLACLRSIALDGKAVGVMITASHNQ 68
           +F   C T+NH Y YGTAGFRD A +LDTVM TTG +ACLRS++ DGKAVGVM+TASHN 
Sbjct: 13  LFHKICKTKNHVYTYGTAGFRDKAAILDTVMFTTGFVACLRSLSHDGKAVGVMVTASHNP 72

Query: 69  PCDNGVKIVEPDGSMLDQSWEPFATELANKASFCHSTQEFKLYLQEKFAQYKVDSGITPV 128
           P DNGVKIVEP+GSML Q WEP AT+LAN AS      E   ++  K  +  ++S   P 
Sbjct: 73  PVDNGVKIVEPNGSMLSQDWEPIATDLANLAS-QGKIDELVQFVNAKLIE--LNSNKVPT 129

Query: 129 LVVGRDSRDSGPRLLQCLNSLAVPLMKPKIIDYGLLTTPQLHFLTNAINTTKSRAPVTED 188
           L+VGRDSR+S   LL+CL   ++ L   KI+DY LLTTPQLHFLTNA N  K      E 
Sbjct: 130 LIVGRDSRESSTSLLECLKEGSLKLFDAKIVDYELLTTPQLHFLTNAYNLEKDLPK--ET 187

Query: 189 DYYSFFMDAWVSITALHGIKVLQSPR----LYIDAANGIGGPKVSKLFEVWPQAGQFTLV 244
           DYY  F +AW  + +++      +      L ID+ANGIGGPK+  L + W    +  L+
Sbjct: 188 DYYHHFNNAWDQLISINNDASSSTSNKIESLIIDSANGIGGPKMENLLKYWKTNYKVRLI 247

Query: 245 NNHWQTPTLLNNDCGADYVKTNQRLPKNI--DPAADSDPATLYCSFDGDADRIVFYYQDA 302
           NN+W+ P  LNN+CGADYVKTNQ+LP  I  D   +S    ++CSFDGDADR+VFYYQD 
Sbjct: 248 NNNWKRPESLNNNCGADYVKTNQKLPNGITTDIINESSKNVIHCSFDGDADRVVFYYQDP 307

Query: 303 Q-NSFHLLDGDKISTLFALFISKQLKKAGL--TEKISMGVVQTAYANGNSTNYLENVLNI 359
           Q N+F+LLDGDKISTLFA FIS QLK AG+    +I +GVVQTAYANG+STNYL+  L I
Sbjct: 308 QSNTFNLLDGDKISTLFANFISMQLKLAGIDYENEIKLGVVQTAYANGSSTNYLQQNLKI 367

Query: 360 PVSCAKTGVKHLHHEAITNYDVGIYFEANGHGTIMFSNKFFETCXXXXXXXXXXX----- 414
           PV+CAKTGVKHLHHEA T YD+G+YFEANGHGTI+FS  F++                  
Sbjct: 368 PVACAKTGVKHLHHEACTRYDIGVYFEANGHGTIIFSENFYKIINQKINAESQIENTPKL 427

Query: 415 -XVKTLLSFAHLINQTVGDAISDMLGVLAVLSIMKLTPSAWDKEYTDLPNLLTKVVVPDR 473
             +KTL   + LINQTVGDAISDM+GV+AVL+I+  TP  W+KEYTDLPN L K+VVPDR
Sbjct: 428 RALKTLKVLSALINQTVGDAISDMMGVMAVLAILNWTPQIWNKEYTDLPNKLAKLVVPDR 487

Query: 474 SLFTTTDQERKLLTPEGAQTKIDAIVAKYKNGRSFVRASGTEDAVRVYAEASTPQDAAAL 533
           S+F TTDQERKL +P G Q+KI+ IVAKY+NGRSFVRASGTEDAVRVYAEAS   D   L
Sbjct: 488 SVFETTDQERKLTSPAGLQSKINKIVAKYENGRSFVRASGTEDAVRVYAEAS--DDVNKL 545

Query: 534 NEEVSKAVLASV 545
            +EV  A   SV
Sbjct: 546 CQEVLDATAESV 557

>TDEL0G04600 Chr7 (838381..839967) [1587 bp, 528 aa] {ON} Anc_6.11
           YEL058W
          Length = 528

 Score =  622 bits (1604), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 324/537 (60%), Positives = 383/537 (71%), Gaps = 18/537 (3%)

Query: 6   LESVFESCCTTRNHRYVYGTAGFRDDATVLDTVMVTTGLLACLRSIALDGKAVGVMITAS 65
           LES+ E  CTTR +RYVYGTAGFRDD+  LDTVM  TG++ACLRS  L+GK VGVMITAS
Sbjct: 5   LESLIEQYCTTRGYRYVYGTAGFRDDSEKLDTVMFATGIVACLRSQVLNGKPVGVMITAS 64

Query: 66  HNQPCDNGVKIVEPDGSMLDQSWEPFATELANKASFCHSTQEFKLYLQEKFAQYKV-DSG 124
           HN   DNGVK+VEPDGSML QSWE  ATELAN  +     ++ K     K  Q    +S 
Sbjct: 65  HNPSGDNGVKVVEPDGSMLIQSWESTATELANLLA-NRPLEDIK----AKVGQLTSGESS 119

Query: 125 ITPVLVVGRDSRDSGPRLLQCLNSLAVPLMKPKIIDYGLLTTPQLHFLTNAINTTKSRAP 184
           + P L+VGRDSR SGP LL CL + A  L   KI DYGLLTTPQLHFLTN   T  + A 
Sbjct: 120 VRPQLIVGRDSRVSGPHLLSCLVASATSLFDAKITDYGLLTTPQLHFLTN--ETMITGAH 177

Query: 185 VTEDDYYSFFMDAWVSITALHGIKVLQSPRLYIDAANGIGGPKVSKLFEVWPQAGQFTLV 244
           V E  Y++ F+ AW  I AL  +K+   P + +D ANGIGGPK+S L   W  A Q +++
Sbjct: 178 VDEQAYFAHFLGAWDQIAALQPVKL---PNVVVDCANGIGGPKMSALLTQWGFAKQCSVI 234

Query: 245 NNHWQTPTLLNNDCGADYVKTNQRLPKNIDPAADSDPATLYCSFDGDADRIVFYYQDAQN 304
           N+    P LLN+ CGAD+VKT+QRLP  + P A+     LYCSFDGDADR+VFYY D   
Sbjct: 235 NDKCDEPELLNHGCGADFVKTSQRLPNGVKPNAND----LYCSFDGDADRVVFYYLDQNL 290

Query: 305 SFHLLDGDKISTLFALFISKQLKKAGLTEKISMGVVQTAYANGNSTNYLENVLNIPVSCA 364
            FHLLDGDKISTLFA F++K LK+  L   +SMGVVQTAYANG+ST YL++ L +PVSC 
Sbjct: 291 GFHLLDGDKISTLFAYFVAKLLKQCKLDSILSMGVVQTAYANGSSTKYLQDNLQVPVSCT 350

Query: 365 KTGVKHLHHEAITNYDVGIYFEANGHGTIMFSNKFFETCXXXXXXXXXXXXVKTLLSFAH 424
           KTGVKHLHHEA+ NYD+GIYFEANGHGT+MFSNKF ET             +K L   A 
Sbjct: 351 KTGVKHLHHEAVNNYDIGIYFEANGHGTVMFSNKFHETV---TNHADQTPELKILKYLAK 407

Query: 425 LINQTVGDAISDMLGVLAVLSIMKLTPSAWDKEYTDLPNLLTKVVVPDRSLFTTTDQERK 484
           LINQTVGDAISDM+ VLAVLSI++ +PS WD+E+TDLPN LTKVVV DRS FTTTDQER+
Sbjct: 408 LINQTVGDAISDMMAVLAVLSILQWSPSRWDREFTDLPNKLTKVVVSDRSAFTTTDQERR 467

Query: 485 LLTPEGAQTKIDAIVAKYKNGRSFVRASGTEDAVRVYAEASTPQDAAALNEEVSKAV 541
           L++P G Q KID  VA+ K+GRSFVRASGTEDAVRVYAEA+T  +   L+  V   V
Sbjct: 468 LVSPAGLQDKIDEAVARIKSGRSFVRASGTEDAVRVYAEAATQSEKDQLSSIVGDLV 524

>ZYRO0F00506g Chr6 complement(49579..51231) [1653 bp, 550 aa] {ON}
           similar to uniprot|P38628 Saccharomyces cerevisiae
           YEL058W PCM1 Essential N-acetylglucosamine-phosphate
           mutase a hexosephosphate mutase involved in the
           biosynthesis of chitin
          Length = 550

 Score =  620 bits (1598), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 316/554 (57%), Positives = 380/554 (68%), Gaps = 22/554 (3%)

Query: 4   NVLESVFESCCTTRNHRYVYGTAGFRDDATVLDTVMVTTGLLACLRSIALDGKAVGVMIT 63
           + L  + +  C+  +  YVYGTAGFR  A  LDTV+  TG+LACLRS+AL G  +GVM+T
Sbjct: 5   DTLTKLIDQYCSNSDRHYVYGTAGFRGPAATLDTVLFATGILACLRSLALKGDVIGVMVT 64

Query: 64  ASHNQPCDNGVKIVEPDGSMLDQSWEPFATELAN----------KASFCHSTQEFKLYLQ 113
           ASHN P DNGVK+VEPDGSM+ +SWEP ATELAN          +A   HS  + +L  Q
Sbjct: 65  ASHNPPVDNGVKVVEPDGSMMPESWEPLATELANTLAIKGSSHERAQATHSWLQRELKGQ 124

Query: 114 EKFAQYKVDSGITPVLVVGRDSRDSGPRLLQCLNSLAVPLMKPKIIDYGLLTTPQLHFLT 173
            + A    + GI P LVVGRDSR+SGP+LL CL + A  L   KI D GLLTTPQLHFLT
Sbjct: 125 LQSANNSYNEGIVPTLVVGRDSRESGPKLLSCLVASAKELFHAKIHDQGLLTTPQLHFLT 184

Query: 174 NAINTTKSRAPVTEDDYYSFFMDAWVSITALHGI--KVLQSPRLYIDAANGIGGPKVSKL 231
           +   T K  A VTE  YY  F+ AW  +  LHGI   +     L IDAANGIG PKV +L
Sbjct: 185 S--ETAKGVANVTESRYYEHFLQAWDYVAQLHGIGESLPTISSLTIDAANGIGAPKVQEL 242

Query: 232 FEVWPQAGQFTLVNNHWQTPTLLNNDCGADYVKTNQRLPKNIDPAADSDPATLYCSFDGD 291
              W   GQ   +N+ W  P LLN++CGAD+VK+NQR P   +     D   L CS+DGD
Sbjct: 243 LSQWACRGQVHFINDKWTNPELLNHECGADFVKSNQRCPLGFN-----DSTGLGCSYDGD 297

Query: 292 ADRIVFYYQDAQNSFHLLDGDKISTLFALFISKQLKKAGLTEKISMGVVQTAYANGNSTN 351
           ADR+VFYY +  N F LLDGD+IS LFA F +  LK+AGL  ++S+GVVQTAYANGNST 
Sbjct: 298 ADRVVFYYINEANEFCLLDGDRISGLFAHFFAGILKQAGLQSELSLGVVQTAYANGNSTE 357

Query: 352 YLENVLNIPVSCAKTGVKHLHHEAITNYDVGIYFEANGHGTIMFSNKFFETCXXXXXXXX 411
           YL+  L +PVSCAKTGVKHLHHEA+T YD+GIYFEANGHGTI+FS KF++          
Sbjct: 358 YLQKTLQVPVSCAKTGVKHLHHEAVTKYDIGIYFEANGHGTIIFSPKFYKVI---KEQKE 414

Query: 412 XXXXVKTLLSFAHLINQTVGDAISDMLGVLAVLSIMKLTPSAWDKEYTDLPNLLTKVVVP 471
               V+TL +F+ LINQTVGDAISDMLGVLA LSI K TP  W +E+TDLPN L KVVVP
Sbjct: 415 RSVAVETLEAFSRLINQTVGDAISDMLGVLAALSISKWTPEHWGQEFTDLPNRLAKVVVP 474

Query: 472 DRSLFTTTDQERKLLTPEGAQTKIDAIVAKYKNGRSFVRASGTEDAVRVYAEASTPQDAA 531
           DRS+F TTDQER+L  PEG Q KID  V  ++ GRSFVRASGTEDAVRVYAEA++ +D  
Sbjct: 475 DRSVFITTDQERRLTKPEGLQQKIDEAVKCFQQGRSFVRASGTEDAVRVYAEAASLEDVE 534

Query: 532 ALNEEVSKAVLASV 545
            L+  V + V+ SV
Sbjct: 535 KLSNTVKELVVKSV 548

>Suva_5.10 Chr5 (19280..20941) [1662 bp, 553 aa] {ON} YEL058W (REAL)
          Length = 553

 Score =  615 bits (1587), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 315/554 (56%), Positives = 387/554 (69%), Gaps = 12/554 (2%)

Query: 1   MHWNVLESVFESCCTTRNHRYVYGTAGFRDDATVLDTVMVTTGLLACLRSIALDGKAVGV 60
           + ++ L  ++E  C T+N +Y YGTAGFR  A  LDTVM TTG+LA LRS+ L G+ VGV
Sbjct: 3   IDYDQLRKLYEETCCTKNLQYSYGTAGFRTLAKDLDTVMFTTGILAVLRSLKLQGQYVGV 62

Query: 61  MITASHNQPCDNGVKIVEPDGSMLDQSWEPFATELANKASFCHSTQEFKLYLQEKFAQYK 120
           MITASHN   DNGVKIVEPDGSML  +WEP+A +LAN ASF  +  EF   L +     K
Sbjct: 63  MITASHNPYQDNGVKIVEPDGSMLLAAWEPYAMQLANAASFAATFDEFYAELVKLIEHEK 122

Query: 121 VDSGITPVLVVGRDSRDSGPRLLQCLNSLAVPLMKPKIIDYGLLTTPQLHFLTNAINTTK 180
           +D    P +VVGRDSR+S P LL+CL S    +    ++D G +TTPQLH++TN  N  +
Sbjct: 123 IDLDAAPHVVVGRDSRESSPFLLRCLTSTMASVFHAHVVDLGCVTTPQLHYVTNLSNKRQ 182

Query: 181 ----SRAPVTEDDYYSFFMDAWVSI-TALHGIKVLQSPRLYIDAANGIGGPKVSKLF--E 233
               S    TE DYYSFF++A+  + T     K L  P+L++D ANGIGGP++ KL   +
Sbjct: 183 REGGSAQVATEQDYYSFFINAFNELFTTCQIEKRLSVPKLFVDTANGIGGPQLKKLLASK 242

Query: 234 VWP-QAGQFTLVNNHWQTPTLLNNDCGADYVKTNQRLPKNIDPAADSDPATLYCSFDGDA 292
            W   + +  +VN+    P LLN +CGADYVKTNQRLPK + P   S P +LYCSFDGDA
Sbjct: 243 DWAVPSDEIEIVNDKSDVPKLLNFECGADYVKTNQRLPKGLSP---SSPDSLYCSFDGDA 299

Query: 293 DRIVFYYQDAQNSFHLLDGDKISTLFALFISKQLKKAGLTEKISMGVVQTAYANGNSTNY 352
           DR+VFYY D ++ FHLLDGDKISTLFA F+SKQL+ A LT+ + +GVVQTAYANG+ST+Y
Sbjct: 300 DRVVFYYVDPESKFHLLDGDKISTLFAKFLSKQLELANLTDSLKIGVVQTAYANGSSTSY 359

Query: 353 LENVLNIPVSCAKTGVKHLHHEAITNYDVGIYFEANGHGTIMFSNKFFETCXXXXXXXX- 411
           +++ L+ PVSC KTGVKHLHHEA T YD+GIYFEANGHGTI+FS KF +T          
Sbjct: 360 IKDTLHCPVSCTKTGVKHLHHEAATQYDIGIYFEANGHGTIIFSKKFHQTIESELSRAQG 419

Query: 412 XXXXVKTLLSFAHLINQTVGDAISDMLGVLAVLSIMKLTPSAWDKEYTDLPNLLTKVVVP 471
               + TL  FA+LINQTVGDAISDML VLA LSI+ + P+ WDKEYTDLPN L K +VP
Sbjct: 420 SLLALNTLRCFANLINQTVGDAISDMLAVLATLSILHMAPTDWDKEYTDLPNKLVKCIVP 479

Query: 472 DRSLFTTTDQERKLLTPEGAQTKIDAIVAKYKNGRSFVRASGTEDAVRVYAEASTPQDAA 531
           DRS+F TTDQERKL  P G QTKID+++ KY  GRSFVRASGTEDAVRVYAE   P    
Sbjct: 480 DRSIFQTTDQERKLQNPAGLQTKIDSVIGKYAMGRSFVRASGTEDAVRVYAECQDPTKLD 539

Query: 532 ALNEEVSKAVLASV 545
               EV + V +SV
Sbjct: 540 QFCNEVVEYVKSSV 553

>Smik_5.29 Chr5 (45538..47205) [1668 bp, 555 aa] {ON} YEL058W (REAL)
          Length = 555

 Score =  612 bits (1578), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 317/559 (56%), Positives = 392/559 (70%), Gaps = 22/559 (3%)

Query: 1   MHWNVLESVFESCCTTRNHRYVYGTAGFRDDATVLDTVMVTTGLLACLRSIALDGKAVGV 60
           + +  L  +++  C T+N +Y YGTAGFR  A  LDTVM TTG+LA LRS+ L G+ VGV
Sbjct: 3   IDYEQLSELYDKTCRTKNVQYSYGTAGFRTLAKNLDTVMFTTGILAILRSLKLQGQYVGV 62

Query: 61  MITASHNQPCDNGVKIVEPDGSMLDQSWEPFATELANKASFCHSTQEFKLYLQEKFAQYK 120
           MITASHN   DNGVKIVEPDGSML  +WEP+A +LAN ASF  + +EF+  L       K
Sbjct: 63  MITASHNPYQDNGVKIVEPDGSMLLATWEPYAMQLANTASFASNFEEFRAELTRLIEHEK 122

Query: 121 V--DSGITPVLVVGRDSRDSGPRLLQCLNSLAVPLMKPKIIDYGLLTTPQLHFLTNAINT 178
           +  D+ I P +VVGRDSR+S P LL+CL S  V +   +++D G +TTPQLH++T+  N 
Sbjct: 123 IGLDTSIVPHIVVGRDSRESSPYLLRCLTSTMVSVFHAQVLDLGCVTTPQLHYITDLSNK 182

Query: 179 TK----SRAPVTEDDYYSFFMDAWVSITALHGI-KVLQSPRLYIDAANGIGGPKVSKLFE 233
            +    S    TE DYYSFF+ A+  + + + I K L  PRL+IDAANGIGGP++ KL  
Sbjct: 183 REREGGSAEVATEQDYYSFFIGAFNELFSTYEIEKRLSVPRLFIDAANGIGGPQLKKLLT 242

Query: 234 ----VWPQAGQFTLVNNHWQTPTLLNNDCGADYVKTNQRLPKNIDPAADSDPATLYCSFD 289
               V P   Q  ++N+    P LLN +CGADYVKTNQRLPK + P++     +LYCSFD
Sbjct: 243 SKDWVVP-PDQIEVINDKSDVPELLNFECGADYVKTNQRLPKGLSPSSHD---SLYCSFD 298

Query: 290 GDADRIVFYYQDAQNSFHLLDGDKISTLFALFISKQLKKAGLTEKISMGVVQTAYANGNS 349
           GDADR+VFYY D+++ FHLLDGDKISTLFA F+SKQL+ A L   + +GVVQTAYANG+S
Sbjct: 299 GDADRVVFYYVDSESQFHLLDGDKISTLFAKFLSKQLELAHLENSLRIGVVQTAYANGSS 358

Query: 350 TNYLENVLNIPVSCAKTGVKHLHHEAITNYDVGIYFEANGHGTIMFSNKFFETCXXXXXX 409
           TNY+EN L  PVSC KTGVKHLHHEA T YD+GIYFEANGHGTI+FS KF +        
Sbjct: 359 TNYIENTLRCPVSCTKTGVKHLHHEAATQYDIGIYFEANGHGTIIFSEKFHQVIKSELSR 418

Query: 410 XX-XXXXVKTLLSFAHLINQTVGDAISDMLGVLAVLSIMKLTPSAWDKEYTDLPNLLTKV 468
                  +KTL  F+ LINQTVGDA+SDML VLA L+IMK+ P  WDKEYTDLPN L K 
Sbjct: 419 ARGDMLALKTLDCFSKLINQTVGDALSDMLAVLATLAIMKMAPMDWDKEYTDLPNKLVKC 478

Query: 469 VVPDRSLFTTTDQERKLLTPEGAQTKIDAIVAKYKNGRSFVRASGTEDAVRVYAEASTPQ 528
           +VPDRS+F T DQERKL  P G Q KID ++AKY  GRSFVRASGTEDAVR+YAE    Q
Sbjct: 479 IVPDRSIFQTIDQERKLQNPVGLQAKIDLVIAKYPMGRSFVRASGTEDAVRIYAEC---Q 535

Query: 529 DAAALNE---EVSKAVLAS 544
           D++ L++   E+ + V AS
Sbjct: 536 DSSQLDQFCNEIVELVKAS 554

>NCAS0F00200 Chr6 complement(30474..32123) [1650 bp, 549 aa] {ON}
           Anc_6.11 YEL058W
          Length = 549

 Score =  607 bits (1565), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 305/549 (55%), Positives = 387/549 (70%), Gaps = 16/549 (2%)

Query: 5   VLESVFESCCTTRNHRYVYGTAGFRDDATVLDTVMVTTGLLACLRSIALDGKAVGVMITA 64
           VL+ V+ S CTTR+++Y YGTAGFRD A+ LDTVM  TG++AC RS+ L G  VGVM+TA
Sbjct: 7   VLQQVYNSTCTTRDYKYTYGTAGFRDKASKLDTVMFATGIIACWRSMVLCGTPVGVMVTA 66

Query: 65  SHNQPCDNGVKIVEPDGSMLDQSWEPFATELANKASFCHSTQEFKLYLQ-EKFAQYKVDS 123
           SHN P DNGVK+VEP G+ML Q WEP  T+LAN A+     + +   L+  K  ++    
Sbjct: 67  SHNPPLDNGVKVVEPTGAMLIQEWEPLTTKLANIAANESFEKVYDFILEVSKDPKFPFQE 126

Query: 124 GITPVLVVGRDSRDSGPRLLQCLNSLAVPLMKPKIIDYGLLTTPQLHFLT---NAINTTK 180
              P L++G DSR+S PRL + L + AV +    I +YGL+TTPQLHF+T   NA     
Sbjct: 127 N-KPSLIIGHDSRESSPRLTKLLVNTAVEIYNADIHNYGLVTTPQLHFITSLWNAKYNKN 185

Query: 181 SRAPVTEDDYYSFFMDAWVSITALHGIKVLQS-PRLYIDAANGIGGPKVSKLFEVWPQA- 238
           +   ++ D+YY++F  +W     L+     +S   L ID+ANGIGGPKV+ L   WP   
Sbjct: 186 TNDVISVDNYYNYFNASWSKFQELYDFNSFKSFENLIIDSANGIGGPKVTDLISTWPSTL 245

Query: 239 -GQFTLVNNHWQTPTLLNNDCGADYVKTNQRLPKNIDPAADSDPATLYCSFDGDADRIVF 297
            G  +++NN W+ P LLNNDCGADYVKTNQ+LPK I   ++ +   L+CSFDGDADRIVF
Sbjct: 246 RGNVSIINNSWENPNLLNNDCGADYVKTNQKLPKGIQNPSNLN---LHCSFDGDADRIVF 302

Query: 298 YY-QDAQNSFHLLDGDKISTLFALFISKQLKKAGLTEKISMGVVQTAYANGNSTNYLENV 356
           YY  +    FHLLDGDKI+TLFA F+S  LK+  LT+K+ +GVVQTAYANG+STNYL NV
Sbjct: 303 YYISEVDQKFHLLDGDKIATLFAKFLSNLLKETNLTDKLKLGVVQTAYANGSSTNYLTNV 362

Query: 357 LNIPVSCAKTGVKHLHHEAITNYDVGIYFEANGHGTIMFSNKFFETCXXXXXXXXXXXXV 416
           L +PVSC KTGVKHLHHEA T YD+GIYFEANGHGT++FS +F +               
Sbjct: 363 LKVPVSCTKTGVKHLHHEASTKYDIGIYFEANGHGTVLFSERFQQVLQNEPKTTA----T 418

Query: 417 KTLLSFAHLINQTVGDAISDMLGVLAVLSIMKLTPSAWDKEYTDLPNLLTKVVVPDRSLF 476
           +TLL F  +INQTVGDA++DMLGV+ VLS+ K+TPS WD+ Y DLPN L KV+VPDRS+F
Sbjct: 419 QTLLLFQKIINQTVGDAMADMLGVITVLSVSKITPSQWDQGYKDLPNKLAKVIVPDRSVF 478

Query: 477 TTTDQERKLLTPEGAQTKIDAIVAKYKNGRSFVRASGTEDAVRVYAEASTPQDAAALNEE 536
            TT+QER+L +P G Q KID  V+K  NGRSFVRASGTEDAVRVYAEA+T ++   L++E
Sbjct: 479 ITTNQERQLTSPVGLQEKIDVAVSKVTNGRSFVRASGTEDAVRVYAEAATQEETEKLSQE 538

Query: 537 VSKAVLASV 545
           V K VL+SV
Sbjct: 539 VCKFVLSSV 547

>YEL058W Chr5 (43252..44925) [1674 bp, 557 aa] {ON}  PCM1Essential
           N-acetylglucosamine-phosphate mutase; converts
           GlcNAc-6-P to GlcNAc-1-P, which is a precursor for the
           biosynthesis of chitin and for the formation of
           N-glycosylated mannoproteins and
           glycosylphosphatidylinositol anchors
          Length = 557

 Score =  606 bits (1563), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 315/555 (56%), Positives = 389/555 (70%), Gaps = 16/555 (2%)

Query: 3   WNVLESVFESCCTTRNHRYVYGTAGFRDDATVLDTVMVTTGLLACLRSIALDGKAVGVMI 62
           +  L  +++  C T+N ++ YGTAGFR  A  LDTVM +TG+LA LRS+ L G+ VGVMI
Sbjct: 5   YEQLCKLYDDTCRTKNVQFSYGTAGFRTLAKNLDTVMFSTGILAVLRSLKLQGQYVGVMI 64

Query: 63  TASHNQPCDNGVKIVEPDGSMLDQSWEPFATELANKASFCHSTQEFKLYLQEKFAQYKVD 122
           TASHN   DNGVKIVEPDGSML  +WEP+A +LAN ASF  + +EF++ L +     K+D
Sbjct: 65  TASHNPYQDNGVKIVEPDGSMLLATWEPYAMQLANAASFATNFEEFRVELAKLIEHEKID 124

Query: 123 --SGITPVLVVGRDSRDSGPRLLQCLNSLAVPLMKPKIIDYGLLTTPQLHFLTNAINTTK 180
             + + P +VVGRDSR+S P LL+CL S    +   +++D G +TTPQLH++T+  N  K
Sbjct: 125 LNTTVVPHIVVGRDSRESSPYLLRCLTSSMASVFHAQVLDLGCVTTPQLHYITDLSNRRK 184

Query: 181 ---SRAPV-TEDDYYSFFMDAWVSITALHGI-KVLQSPRLYIDAANGIGGPKVSKLF--E 233
                APV TE DYYSFF+ A+  + A + + K L  P+L+ID ANGIGGP++ KL   E
Sbjct: 185 LEGDTAPVATEQDYYSFFIGAFNELFATYQLEKRLSVPKLFIDTANGIGGPQLKKLLASE 244

Query: 234 VWP-QAGQFTLVNNHWQTPTLLNNDCGADYVKTNQRLPKNIDPAADSDPATLYCSFDGDA 292
            W   A Q  ++N+    P LLN +CGADYVKTNQRLPK + P   S   +LYCSFDGDA
Sbjct: 245 DWDVPAEQVEVINDRSDVPELLNFECGADYVKTNQRLPKGLSP---SSFDSLYCSFDGDA 301

Query: 293 DRIVFYYQDAQNSFHLLDGDKISTLFALFISKQLKKAGLTEKISMGVVQTAYANGNSTNY 352
           DR+VFYY D+ + FHLLDGDKISTLFA F+SKQL+ A L   + +GVVQTAYANG+ST Y
Sbjct: 302 DRVVFYYVDSGSKFHLLDGDKISTLFAKFLSKQLELAHLEHSLKIGVVQTAYANGSSTAY 361

Query: 353 LENVLNIPVSCAKTGVKHLHHEAITNYDVGIYFEANGHGTIMFSNKFFETCXXXXXXXXX 412
           ++N L+ PVSC KTGVKHLHHEA T YD+GIYFEANGHGTI+FS KF  T          
Sbjct: 362 IKNTLHCPVSCTKTGVKHLHHEAATQYDIGIYFEANGHGTIIFSEKFHRTIKSELSKSKL 421

Query: 413 ---XXXVKTLLSFAHLINQTVGDAISDMLGVLAVLSIMKLTPSAWDKEYTDLPNLLTKVV 469
                 ++TL  F+ LINQTVGDAISDML VLA L+I+K++P  WD+EYTDLPN L K +
Sbjct: 422 NGDTLALRTLKCFSELINQTVGDAISDMLAVLATLAILKMSPMDWDEEYTDLPNKLVKCI 481

Query: 470 VPDRSLFTTTDQERKLLTPEGAQTKIDAIVAKYKNGRSFVRASGTEDAVRVYAEASTPQD 529
           VPDRS+F TTDQERKLL P G Q KID +VAKY  GRSFVRASGTEDAVRVYAE      
Sbjct: 482 VPDRSIFQTTDQERKLLNPVGLQDKIDLVVAKYPMGRSFVRASGTEDAVRVYAECKDSSK 541

Query: 530 AAALNEEVSKAVLAS 544
                +EV + V AS
Sbjct: 542 LGQFCDEVVEHVKAS 556

>Skud_5.31 Chr5 (42262..43935) [1674 bp, 557 aa] {ON} YEL058W (REAL)
          Length = 557

 Score =  602 bits (1553), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 314/560 (56%), Positives = 389/560 (69%), Gaps = 24/560 (4%)

Query: 3   WNVLESVFESCCTTRNHRYVYGTAGFRDDATVLDTVMVTTGLLACLRSIALDGKAVGVMI 62
           +  L  +++  C T+N +Y YGTAGFR  A  LDTVM TTG+LA LRS+ L G+ VGVMI
Sbjct: 5   YEQLRKLYDETCRTKNVQYSYGTAGFRTLAKDLDTVMFTTGILAVLRSLKLQGQYVGVMI 64

Query: 63  TASHNQPCDNGVKIVEPDGSMLDQSWEPFATELANKASFCHSTQEFKLYLQEKFAQYKVD 122
           TASHN   DNGVKIVEPDGSML  SWEP+A +LAN ASF    +EF   L +     K+D
Sbjct: 65  TASHNPYQDNGVKIVEPDGSMLLASWEPYAMQLANAASFATHFEEFYAELVKLIELEKID 124

Query: 123 SG---ITPVLVVGRDSRDSGPRLLQCLNSLAVPLMKPKIIDYGLLTTPQLHFLTNAINTT 179
            G   + P +VVGRDSR+S P LL+CL S    +   +++D G +TTPQLH++T+  N  
Sbjct: 125 LGASNVAPHIVVGRDSRESSPYLLRCLTSTMASVFHARVLDLGCVTTPQLHYITDLSNRR 184

Query: 180 KSR-----APVTEDDYYSFFMDAWVSITALHGI-KVLQSPRLYIDAANGIGGPKVSKLFE 233
           +       A  TE DYYSFF+ A+  +   + + K L  P+L+ID ANGIGGP++ KL  
Sbjct: 185 EREGDSALAAATEQDYYSFFIGAFNELFTTYDMEKRLSVPKLFIDTANGIGGPQLKKLLA 244

Query: 234 ----VWPQAGQFTLVNNHWQTPTLLNNDCGADYVKTNQRLPKNIDPAADSDPATLYCSFD 289
               V P + Q  ++N+    P LLN++CGADYVKTNQRLPK + P   S   +LYCSFD
Sbjct: 245 SKDWVVP-SDQIEIINDKSDVPKLLNSECGADYVKTNQRLPKGLSP---SSFESLYCSFD 300

Query: 290 GDADRIVFYYQDAQNSFHLLDGDKISTLFALFISKQLKKAGLTEKISMGVVQTAYANGNS 349
           GDADR+VFYY D++  FHLLDGDKISTLFA F+SKQL+ A L   + +GVVQTAYANG+S
Sbjct: 301 GDADRVVFYYVDSELKFHLLDGDKISTLFAKFLSKQLEMANLERSLKIGVVQTAYANGSS 360

Query: 350 TNYLENVLNIPVSCAKTGVKHLHHEAITNYDVGIYFEANGHGTIMFSNKFFETCXXXXXX 409
           T Y+++ L+ PVSC KTGVKHLHHEA T YD+GIYFEANGHGTI+FS KF +T       
Sbjct: 361 TAYIKDTLHCPVSCTKTGVKHLHHEAATQYDIGIYFEANGHGTIIFSEKFHQTIESELSK 420

Query: 410 -XXXXXXVKTLLSFAHLINQTVGDAISDMLGVLAVLSIMKLTPSAWDKEYTDLPNLLTKV 468
                  +KTL  FA LINQTVGDA+SDML VLA L+I+K+ P  WD+EY DLPN L K 
Sbjct: 421 PNGHTLALKTLSCFAKLINQTVGDAMSDMLAVLATLAILKMAPMNWDEEYKDLPNKLVKC 480

Query: 469 VVPDRSLFTTTDQERKLLTPEGAQTKIDAIVAKYKNGRSFVRASGTEDAVRVYAEASTPQ 528
           +VPDRS+F TTDQERKL  P G Q+KID+++AKY  GRSFVRASGTEDAVRVYAE    Q
Sbjct: 481 IVPDRSIFQTTDQERKLQNPVGLQSKIDSVIAKYPMGRSFVRASGTEDAVRVYAEC---Q 537

Query: 529 DAAALNE---EVSKAVLASV 545
           D + L++   E+   V ASV
Sbjct: 538 DMSKLDQFCNEIVGYVKASV 557

>SAKL0E00902g Chr5 complement(68682..70316) [1635 bp, 544 aa] {ON}
           similar to uniprot|P38628 Saccharomyces cerevisiae
           YEL058W PCM1 Essential N-acetylglucosamine-phosphate
           mutase a hexosephosphate mutase involved in the
           biosynthesis of chitin
          Length = 544

 Score =  596 bits (1536), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 308/545 (56%), Positives = 380/545 (69%), Gaps = 11/545 (2%)

Query: 5   VLESVFESCCTTRNHRYVYGTAGFRDDATVLDTVMVTTGLLACLRSIALDGKAVGVMITA 64
           +LE +++  C T    Y YGTAGFR  A VLDTVM TTG+LA +RSI L G+ VGVMITA
Sbjct: 6   LLEELYDKHCKT-GFTYTYGTAGFRYKADVLDTVMFTTGILAAIRSIYLKGQYVGVMITA 64

Query: 65  SHNQPCDNGVKIVEPDGSMLDQSWEPFATELANKASFCHSTQEFKLYLQEKFAQYKVDSG 124
           SHN P DNGVKIV+P G MLDQ+WEPFATELAN AS     QE    L +   +  +D  
Sbjct: 65  SHNPPQDNGVKIVDPKGEMLDQAWEPFATELANSAS--KGKQELIKALDKLITKLGIDDT 122

Query: 125 ITPVLVVGRDSRDSGPRLLQCLNSLAVPLMKPKIIDYGLLTTPQLHFLTNAINTTKSRAP 184
            +  + + RDSR+SGPRLLQ +      L   +++D+ LLTTPQLHFLT   N   S + 
Sbjct: 123 ESAKITISRDSRESGPRLLQAVIDGTKVLKNVQVVDFNLLTTPQLHFLTYQYNQGSS-SK 181

Query: 185 VTEDDYYSFFMDAWVSITALHGIKVLQSPRLYIDAANGIGGPKVSK-LFEVWPQAGQFTL 243
           V E  YYS F  AW  I  LH I  L   R+ IDAANGIGGPKVS+ L +    +   ++
Sbjct: 182 VEESTYYSAFSSAWTKICGLHDINSLPY-RVIIDAANGIGGPKVSEMLLKNKFFSSTVSV 240

Query: 244 VNNHWQTPTLLNNDCGADYVKTNQRLPKNIDPAADSDPATLYCSFDGDADRIVFYYQDAQ 303
           +NN WQ+P LLN  CGADYVKTNQ  PK +  + +S+   +YCSFDGDADRIVFYY D +
Sbjct: 241 INNQWQSPELLNESCGADYVKTNQHFPKGV--SGNSENECIYCSFDGDADRIVFYYHDEK 298

Query: 304 NSFHLLDGDKISTLFALFISKQLKKAGLTEKISMGVVQTAYANGNSTNYLENVLNIPVSC 363
           + F+LLDGDKISTLFA F  + L  AG   ++ +GVVQTAYANG+ST YL ++L +PVSC
Sbjct: 299 SKFNLLDGDKISTLFAKFFKELLVAAGAENELKLGVVQTAYANGSSTEYLSSILEVPVSC 358

Query: 364 AKTGVKHLHHEAITNYDVGIYFEANGHGTIMFSNKFFETCXXXXXX---XXXXXXVKTLL 420
             TGVKHLHHEAI NYD+GIYFEANGHGT++FS++F +T                +KTL 
Sbjct: 359 TATGVKHLHHEAIHNYDIGIYFEANGHGTVIFSDEFHKTIDKKLKEPQDEKTAKALKTLY 418

Query: 421 SFAHLINQTVGDAISDMLGVLAVLSIMKLTPSAWDKEYTDLPNLLTKVVVPDRSLFTTTD 480
            F +LINQTVGDAISDML VLAVL I+K +P  WD+EYTDLPN L KV+VPDRS+F T++
Sbjct: 419 LFTNLINQTVGDAISDMLAVLAVLCILKWSPQKWDQEYTDLPNKLVKVIVPDRSVFKTSN 478

Query: 481 QERKLLTPEGAQTKIDAIVAKYKNGRSFVRASGTEDAVRVYAEASTPQDAAALNEEVSKA 540
            ER+L++P+G Q KID+ V ++++GRSFVRASGTEDAVRVYAEA+T + A  L   VS  
Sbjct: 479 AERQLVSPKGLQEKIDSTVQEFEHGRSFVRASGTEDAVRVYAEAATKEKADRLAASVSDL 538

Query: 541 VLASV 545
           V  SV
Sbjct: 539 VSRSV 543

>KLTH0C11506g Chr3 (944869..946503) [1635 bp, 544 aa] {ON} similar
           to uniprot|P38628 Saccharomyces cerevisiae YEL058W PCM1
           Essential N-acetylglucosamine- phosphate mutase a
           hexosephosphate mutase involved in the biosynthesis of
           chitin
          Length = 544

 Score =  587 bits (1514), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 310/541 (57%), Positives = 383/541 (70%), Gaps = 12/541 (2%)

Query: 6   LESVFESCCTTRNHRYVYGTAGFRDDATVLDTVMVTTGLLACLRSIALDGKAVGVMITAS 65
           LE+++E+ C +    Y YGTAGFR  A VLDTVM TTG+LA LRSI L+G+ VGVMITAS
Sbjct: 7   LETLYETHCKS-GFTYAYGTAGFRYKADVLDTVMFTTGVLAGLRSIYLEGRTVGVMITAS 65

Query: 66  HNQPCDNGVKIVEPDGSMLDQSWEPFATELANKASFCHSTQEFKLYLQEKFAQYKVDSGI 125
           HN P DNGVKIV+P G ML+QSWE +AT+LAN A+   S   F  YLQ   ++  +D+  
Sbjct: 66  HNPPEDNGVKIVDPKGEMLEQSWESYATDLANSAT--QSFTAFLAYLQNLVSELGLDTDA 123

Query: 126 TPVLVVGRDSRDSGPRLLQCLNSLAVPLMKPKIIDYGLLTTPQLHFLTNAINTTKSRAPV 185
              L V RDSR+SGPRLL  L + +  L   +I DYGLLTTPQLHFLT+  N   +   +
Sbjct: 124 LGSLAVARDSRESGPRLLHALLNGSRVLPNIRITDYGLLTTPQLHFLTSKRNELPNDTAI 183

Query: 186 TEDDYYSFFMDAWVSITALHGIKVLQSPRLYIDAANGIGGPKVSKLFEVWPQ-AGQFTLV 244
               YY  F+ AW  ITAL GI+ L   +L IDAANGIG P+V ++        G F +V
Sbjct: 184 DRFFYYKEFLSAWDDITALCGIQSLPY-KLEIDAANGIGAPRVKEMLSTHKFFDGVFRVV 242

Query: 245 NNHWQTPTLLNNDCGADYVKTNQRLPKNIDPAADSDPATLYCSFDGDADRIVFYYQDAQN 304
           N+ W+TP  LN+ CGADYVKTNQRLP  I   A++D   + CSFDGDADRIVFY+ D++ 
Sbjct: 243 NDDWETPASLNHLCGADYVKTNQRLPYGIQ--ANNDCQRICCSFDGDADRIVFYFCDSEG 300

Query: 305 SFHLLDGDKISTLFALFISKQLKKAGLTEKISMGVVQTAYANGNSTNYLENVLNIPVSCA 364
            F LLDGDK++TLFA F    L  A L E++S+GVVQTAYANG+ST+Y+E VL IPV+C 
Sbjct: 301 QFRLLDGDKMATLFAKFFQDILSSANLQERLSLGVVQTAYANGSSTHYIERVLGIPVTCT 360

Query: 365 KTGVKHLHHEAITNYDVGIYFEANGHGTIMFSNKFFETCXX----XXXXXXXXXXVKTLL 420
            TGVKHLHHEAI NYD+G+YFEANGHGT++FS KF E                  ++ L 
Sbjct: 361 PTGVKHLHHEAI-NYDIGVYFEANGHGTVVFSKKFDEVVNSGLSNKHQSDSSLQSLEVLS 419

Query: 421 SFAHLINQTVGDAISDMLGVLAVLSIMKLTPSAWDKEYTDLPNLLTKVVVPDRSLFTTTD 480
            FA+LINQTVGDAISDM+GVLAVLSI+K TP  W++EYTDLPN L KV+VPDR++F TT+
Sbjct: 420 KFANLINQTVGDAISDMMGVLAVLSILKWTPQKWNQEYTDLPNKLVKVLVPDRTVFKTTN 479

Query: 481 QERKLLTPEGAQTKIDAIVAKYKNGRSFVRASGTEDAVRVYAEASTPQDAAALNEEVSKA 540
            ER+LL+P G Q KI+A+VA+Y   RSFVRASGTEDAVRVYAEAST ++A +L   VS+ 
Sbjct: 480 AERQLLSPLGLQPKINALVAEYHQARSFVRASGTEDAVRVYAEASTREEADSLASRVSQV 539

Query: 541 V 541
           V
Sbjct: 540 V 540

>Kwal_56.22355 s56 complement(62955..64580) [1626 bp, 541 aa] {ON}
           YEL058W (PCM1) - Phosphoacetylglucosamine Mutase [contig
           186] FULL
          Length = 541

 Score =  578 bits (1489), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 301/539 (55%), Positives = 374/539 (69%), Gaps = 12/539 (2%)

Query: 6   LESVFESCCTTRNHRYVYGTAGFRDDATVLDTVMVTTGLLACLRSIALDGKAVGVMITAS 65
           L+S++E+ C+T  H Y YGTAGFR  A VLDTVM TTG++A LRSI L+GK VGVMITAS
Sbjct: 7   LKSLYEAHCSTGFH-YAYGTAGFRYKADVLDTVMFTTGVVAGLRSIFLEGKTVGVMITAS 65

Query: 66  HNQPCDNGVKIVEPDGSMLDQSWEPFATELANKASFCHSTQEFKLYLQEKFAQYKVDSGI 125
           HN P DNGVKIV+P G ML+QSWE +AT+LAN AS      EF   ++    + +V S  
Sbjct: 66  HNPPEDNGVKIVDPKGEMLEQSWEVYATDLANSAS--QGFSEFVASVERLMTKLEVGSND 123

Query: 126 TPVLVVGRDSRDSGPRLLQCLNSLAVPLMKPKIIDYGLLTTPQLHFLTNAINTTKSRAPV 185
              +VV RDSR+SGPRLL    S    L   K+ D+GLLTTPQLHFLT+  N       +
Sbjct: 124 HGSIVVARDSRESGPRLLGAFLSGVKVLANVKVTDHGLLTTPQLHFLTSKSNELPKGTEI 183

Query: 186 TEDDYYSFFMDAWVSITALHGIKVLQSPRLYIDAANGIGGPKVSKLFEVWPQ-AGQFTLV 244
            +  YY  F+ AWV I  L  I  L   +L IDAANGIG P V+++        G F +V
Sbjct: 184 GKSLYYDNFLSAWVEIAELCKIDSLPY-KLEIDAANGIGAPVVTEMLSQHKFFKGAFAVV 242

Query: 245 NNHWQTPTLLNNDCGADYVKTNQRLPKNIDPAADSDPATLYCSFDGDADRIVFYYQDAQN 304
           N+ W+TP  LN+ CGAD+VKTNQ+LP  I P  + +   + CSFDGDADRIVFYY     
Sbjct: 243 NDEWETPDSLNHLCGADFVKTNQKLPHGIAPGGERN--RICCSFDGDADRIVFYYCGKNG 300

Query: 305 SFHLLDGDKISTLFALFISKQLKKAGLTEKISMGVVQTAYANGNSTNYLENVLNIPVSCA 364
            FHLLDGDK++TLFA F  + L+ AGL +++ +GVVQTAYANG+ST Y+E VL I V+C 
Sbjct: 301 DFHLLDGDKMATLFAKFFQELLRDAGLQDELELGVVQTAYANGSSTAYIEQVLGISVTCT 360

Query: 365 KTGVKHLHHEAITNYDVGIYFEANGHGTIMFSNKFFETC----XXXXXXXXXXXXVKTLL 420
            TGVKHLHHEA+  YD+G+YFEANGHGT++FS+KF +                  +K L 
Sbjct: 361 PTGVKHLHHEAV-KYDIGVYFEANGHGTVVFSSKFLDVIDRKLSEKLESDAAQKSLKVLH 419

Query: 421 SFAHLINQTVGDAISDMLGVLAVLSIMKLTPSAWDKEYTDLPNLLTKVVVPDRSLFTTTD 480
            FA LINQTVGDAISDML VLAVLSI+K +P  WD+EYTDLPN L KV+VPDR++F T +
Sbjct: 420 LFAKLINQTVGDAISDMLAVLAVLSILKWSPEKWDEEYTDLPNKLIKVLVPDRTVFKTKN 479

Query: 481 QERKLLTPEGAQTKIDAIVAKYKNGRSFVRASGTEDAVRVYAEASTPQDAAALNEEVSK 539
            ER+L++P G Q KIDA+VA +  GRSFVRASGTEDAVRVYAEA+TPQ+  AL+++V K
Sbjct: 480 AERQLVSPAGVQEKIDALVATFSKGRSFVRASGTEDAVRVYAEAATPQETEALSQQVEK 538

>CAGL0B03597g Chr2 complement(359018..360640) [1623 bp, 540 aa] {ON}
           similar to uniprot|P38628 Saccharomyces cerevisiae
           YEL058w PCM1 phosphoacetylglucosamine mutase
          Length = 540

 Score =  572 bits (1474), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 296/548 (54%), Positives = 370/548 (67%), Gaps = 25/548 (4%)

Query: 9   VFESCCTTRNHRYVYGTAGFRDDATVLDTVMVTTGLLACLRSIALDGKAVGVMITASHNQ 68
           ++   C TR+  Y YGTAGFR DA +LD+VM TTG++A LRSI+     VGVMITASHN 
Sbjct: 5   LYNKNCITRDQHYTYGTAGFRADARILDSVMFTTGVIAALRSISCQCAPVGVMITASHNP 64

Query: 69  PCDNGVKIVEPDGSMLDQSWEPFATELANKASFCHSTQEFKLYLQEKFAQYKVDSGITPV 128
           P DNGVKIVE DGSML Q WEP AT LAN  +  H+   F+  L     +  +  G  P 
Sbjct: 65  PRDNGVKIVESDGSMLLQDWEPLATRLANSVADYHT---FESTLNAIMQELNISPGHAPQ 121

Query: 129 LVVGRDSRDSGPRLL-QCLNSLAVPLMKPKIIDYGLLTTPQLHFLTNAINTTKSRAPVTE 187
           +VVG DSR+S PRLL   L+ +       +I ++GLLTTPQLHFLT       +     E
Sbjct: 122 IVVGHDSRESSPRLLANLLDGIKAVSPDARITNHGLLTTPQLHFLT-------ANPAHFE 174

Query: 188 DDYYSFFMDAWVSITALHGIKVLQS-PRLYIDAANGIGGPKVSKLFEVWP---------Q 237
           D YY +F+DAW  +  L+GI+  +S  +L ID ANGIGGP+  K+              +
Sbjct: 175 DYYYRYFLDAWNQLFELYGIEGFKSFDKLVIDTANGIGGPQFLKMLSYSQTDLPHLQKIR 234

Query: 238 AGQFTLVNNHWQTPTLLNNDCGADYVKTNQRLPKNIDPAADSDPATLYCSFDGDADRIVF 297
             Q  + NN W  P++LN+ CGAD+VKTNQRLP+ I+    +DP  LYCSFDGDADR+VF
Sbjct: 235 LHQIDITNNSWLNPSMLNSGCGADFVKTNQRLPEGIN----ADPRNLYCSFDGDADRVVF 290

Query: 298 YYQDAQNSFHLLDGDKISTLFALFISKQLKKAGLTEKISMGVVQTAYANGNSTNYLENVL 357
           YY D   +FHLLDGDKISTL A FI+  LK+AGL E++ +GVVQTAYANG+ST Y+   L
Sbjct: 291 YYVDDSLTFHLLDGDKISTLLAYFINALLKEAGLAEELKLGVVQTAYANGSSTTYVTKKL 350

Query: 358 NIPVSCAKTGVKHLHHEAITNYDVGIYFEANGHGTIMFSNKFFETCXXXXXXXXXXXXVK 417
            +PVS AKTGVKHLHHEA+TNYD+G+YFEANGHGT++FS  F+E                
Sbjct: 351 QVPVSIAKTGVKHLHHEAVTNYDIGVYFEANGHGTVIFSQHFYEVIEDRLAKNAHDKSTL 410

Query: 418 TLLSFAHLINQTVGDAISDMLGVLAVLSIMKLTPSAWDKEYTDLPNLLTKVVVPDRSLFT 477
           TL   + LINQT+GDAISDML ++ VL I+  +P+ WD EYTDLPN LTKVVVPDRS+F 
Sbjct: 411 TLRLLSRLINQTIGDAISDMLAIITVLGILGWSPATWDHEYTDLPNKLTKVVVPDRSIFI 470

Query: 478 TTDQERKLLTPEGAQTKIDAIVAKYKNGRSFVRASGTEDAVRVYAEASTPQDAAALNEEV 537
           TTDQER+L++P G Q KID +VA    GRSF+RASGTEDAVRVYAEA T +    L+ EV
Sbjct: 471 TTDQERRLVSPAGLQDKIDMLVADAPCGRSFIRASGTEDAVRVYAEAQTVEATEKLSTEV 530

Query: 538 SKAVLASV 545
           + A++ +V
Sbjct: 531 TDALIETV 538

>KAFR0L00340 Chr12 complement(62157..63779) [1623 bp, 540 aa] {ON}
           Anc_6.11 YEL058W
          Length = 540

 Score =  568 bits (1463), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 288/541 (53%), Positives = 369/541 (68%), Gaps = 15/541 (2%)

Query: 6   LESVFESCCTTRNHRYVYGTAGFRDDATVLDTVMVTTGLLACLRSIALDGKAVGVMITAS 65
           LE  F   CTTRNH Y YGTAGFR +A+ LDTVM TTG++A LRS+ L GK +GVMITAS
Sbjct: 7   LEPAFIKYCTTRNHSYTYGTAGFRANASTLDTVMFTTGIVAILRSLVLQGKYIGVMITAS 66

Query: 66  HNQPCDNGVKIVEPDGSMLDQSWEPFATELANKASFCHSTQEFKLYLQEKFAQYKVDSGI 125
           HN P DNGVKIVEP G+ML +SWE  AT+LAN AS  + T  F ++L +  A+  +D   
Sbjct: 67  HNPPQDNGVKIVEPSGAMLIESWEQIATDLANIASHGNFTA-FVMHLSQVIAKLNIDETT 125

Query: 126 TPVLVVGRDSRDSGPRLLQCLNSLAVPLMKPKIIDYGLLTTPQLHFLTNAINTTKSRAPV 185
           TP L+VG DSR+S P L++CL + A P+    +I++ L+TTPQLH+LT   N       V
Sbjct: 126 TPRLIVGHDSRESSPYLMECLQA-AAPVFDTIVINHTLITTPQLHYLTMLQNDV-----V 179

Query: 186 TEDDYYSFFMDAWVSITALHGIKVLQSPRLYIDAANGIGGPKVSKLFEVWPQAGQFT-LV 244
           TE DYY FF  +W ++ +L+    L    L +D ANG+G  + SK     PQ    T ++
Sbjct: 180 TEVDYYKFFSTSWNNLFSLYPDLNLTFNNLIVDGANGVGSVQFSKFLPYLPQLATLTTII 239

Query: 245 NNHWQTPTLLNNDCGADYVKTNQRLPKNIDPAADSDPATLYCSFDGDADRIVFYYQDAQN 304
           N+    P +LN DCGAD+VKTNQ+LP  I    + +P+ LY SFDGDADRIVFYY D   
Sbjct: 240 NDKHNVPQMLNVDCGADFVKTNQKLPNGI---VNPNPSDLYASFDGDADRIVFYYVDNNK 296

Query: 305 SFHLLDGDKISTLFALFISKQLKKAGLTEKISMGVVQTAYANGNSTNYLENVLNIPVSCA 364
            FHLLDGDKIST+    +   L+++ L   I++GVVQTAYANG+ST Y+   L +PV C 
Sbjct: 297 KFHLLDGDKISTILTKCLISMLRESELLNDINLGVVQTAYANGSSTKYITKSLKVPVECT 356

Query: 365 KTGVKHLHHEAITNYDVGIYFEANGHGTIMFSNKFFETCXXXXXXXXXXXXVK----TLL 420
           KTGVKHLHH A + +D+GIYFEANGHGT++FSNKF+E              +     +L 
Sbjct: 357 KTGVKHLHHIAESKFDIGIYFEANGHGTVLFSNKFYEVLQKAIDNGSSSEKIHKARLSLF 416

Query: 421 SFAHLINQTVGDAISDMLGVLAVLSIMKLTPSAWDKEYTDLPNLLTKVVVPDRSLFTTTD 480
            F+ LINQTVGD+++D+L V+A LSI++L+PS WD EY DLPNLLTK  V +R +F TTD
Sbjct: 417 YFSKLINQTVGDSMADLLAVIATLSILQLSPSDWDTEYQDLPNLLTKCTVLNRFVFKTTD 476

Query: 481 QERKLLTPEGAQTKIDAIVAKYKNGRSFVRASGTEDAVRVYAEASTPQDAAALNEEVSKA 540
            ERKL +P G Q KIDA V+KY +GRSFVRASGTEDAVR+YAEA T  +  AL++EV++ 
Sbjct: 477 MERKLTSPSGLQEKIDAAVSKYDSGRSFVRASGTEDAVRIYAEAKTKAEVEALSKEVTQL 536

Query: 541 V 541
           V
Sbjct: 537 V 537

>Ecym_3014 Chr3 complement(28261..29916) [1656 bp, 551 aa] {ON}
           similar to Ashbya gossypii ACR015W
          Length = 551

 Score =  558 bits (1439), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 293/544 (53%), Positives = 364/544 (66%), Gaps = 23/544 (4%)

Query: 13  CCTTRNHRYVYGTAGFRDDATVLDTVMVTTGLLACLRSIALDGKAVGVMITASHNQPCDN 72
           CC+    +Y+YGTAGFR  A +LDTV+ TTG+LACLRS+ L G+ VG MITASHN P DN
Sbjct: 15  CCS--RFKYIYGTAGFRYKAEILDTVLFTTGVLACLRSMHLKGQYVGAMITASHNPPQDN 72

Query: 73  GVKIVEPDGSMLDQSWEPFATELANKASFCHSTQEFKLYLQEKFAQYKVDSGITPVLVVG 132
           GVK+V+P G ML Q WE +ATELAN AS      +F   LQE   Q+ + +     +VV 
Sbjct: 73  GVKLVDPKGEMLKQEWEVYATELANCAS--DGKHQFLHRLQELMNQFGIKADSEARIVVA 130

Query: 133 RDSRDSGPRLLQCLNSLAVPLMKPKIIDYGLLTTPQLHFLTNAINTTKSRAPVTEDD--- 189
           RDSR+SG RLL+ L           I+DY +LTTPQLHFLT  +N       V E +   
Sbjct: 131 RDSRESGSRLLKALVDGTSVFTNVDIVDYDMLTTPQLHFLTYHLNRQMESERVIEVNEAF 190

Query: 190 YYSFFMDAWVSITALHGIKVLQSPRLYIDAANGIGGPKVSKLFEVWPQAGQF-----TLV 244
           YYS F+ A   +T L  I  L  P L IDAANG+GG K  +LF        F     T++
Sbjct: 191 YYSHFLSALKELTELFNIPGLPYP-LVIDAANGVGGAKAEELF----MKNTFFKDSTTII 245

Query: 245 NNHWQTPTLLNNDCGADYVKTNQRLPKNIDPAADSDPATLYCSFDGDADRIVFYYQDAQN 304
           N +W    LLN+ CGADYVKTNQ LP+ I  A D +  +L+CSFDGDADR++FYY+D   
Sbjct: 246 NGNWSQHDLLNSFCGADYVKTNQCLPQGISAATDIN--SLHCSFDGDADRVIFYYRDVDG 303

Query: 305 SFHLLDGDKISTLFALFISKQLKKAGLTEKISMGVVQTAYANGNSTNYLENVLNIPVSCA 364
            FHLLDGDKISTLFA F    L  AG+ + + +GVVQTAYANG+ST YL  VL +PVSC 
Sbjct: 304 MFHLLDGDKISTLFAKFFQSMLPVAGIQDNVKLGVVQTAYANGSSTRYLSEVLIVPVSCT 363

Query: 365 KTGVKHLHHEAITNYDVGIYFEANGHGTIMFSNKFFETCXXX----XXXXXXXXXVKTLL 420
            TGVK+LH +A+ NYDVGIYFEANGHGT++FS  F  T                 +KTL 
Sbjct: 364 PTGVKYLHRKAVENYDVGIYFEANGHGTVIFSENFNNTVSKRLKEGSLSAESKMALKTLQ 423

Query: 421 SFAHLINQTVGDAISDMLGVLAVLSIMKLTPSAWDKEYTDLPNLLTKVVVPDRSLFTTTD 480
           SF+ LINQTVGDA+SDM+ VLAVL I+K TP  WD EYTDLPN L KVVVPDRSLF TT+
Sbjct: 424 SFSKLINQTVGDAMSDMMAVLAVLCILKWTPQQWDGEYTDLPNTLMKVVVPDRSLFKTTN 483

Query: 481 QERKLLTPEGAQTKIDAIVAKYKNGRSFVRASGTEDAVRVYAEASTPQDAAALNEEVSKA 540
            ER+L++P+G Q +ID ++  Y N RSFVRASGTEDAVR+YAEA+T + A  L+ ++S+ 
Sbjct: 484 AERQLVSPKGLQAQIDKVIKSYDNARSFVRASGTEDAVRIYAEAATKEQADDLSIKISQL 543

Query: 541 VLAS 544
           V+++
Sbjct: 544 VISA 547

>NDAI0K02890 Chr11 (655311..656996) [1686 bp, 561 aa] {ON} Anc_6.11
           YEL058W
          Length = 561

 Score =  551 bits (1420), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 299/553 (54%), Positives = 373/553 (67%), Gaps = 19/553 (3%)

Query: 6   LESVFESCCTTRNHRYVYGTAGFRDDATVLDTVMVTTGLLACLRSIALDGK----AVGVM 61
           L+S F   C T+N+ Y YGTAGFRD+A  LDTVM TTG++ACLRS+ L       A+GVM
Sbjct: 12  LKSCFNEICQTKNYHYTYGTAGFRDNAKRLDTVMFTTGIVACLRSLTLQTSNKHSAIGVM 71

Query: 62  ITASHNQPCDNGVKIVEPDGSMLDQSWEPFATELANKASFCHSTQEFKLYLQEKFAQYKV 121
           +TASHN P DNGVKI+EP+GSML Q WEP AT+ AN A+   S  EF   L +     + 
Sbjct: 72  VTASHNPPEDNGVKIIEPNGSMLLQEWEPKATQFANIAA-NESFDEFYQLLIDSIVTLEN 130

Query: 122 DSGIT--PVLVVGRDSRDSGPRLLQCLNSLAVPLMKPKIIDYGLLTTPQLHFLTNAINTT 179
           D  I   P L++G DSRDS P L+  +   A  +   KII+Y  +TTPQLHFLTN    T
Sbjct: 131 DLNIKQPPTLILGHDSRDSSPTLMNHIIKSATLIFNAKIINYNYVTTPQLHFLTNL---T 187

Query: 180 KSRAPVTEDDYYSFFMDAWVSITALHGIKVLQSPRLYIDAANGIGGPKVSKL------FE 233
            +     E +YY  F      + +L+    L    L IDAANGIG P+V KL      F 
Sbjct: 188 NTTGTAEEINYYDHFNKYLSQLQSLYPPFNLPFDNLIIDAANGIGAPQVEKLLFTKNKFP 247

Query: 234 VWPQAGQFTLVNNHWQTPTLLNNDCGADYVKTNQRLPKNIDPAADSDPATLYCSFDGDAD 293
                    ++NN  + P LLN +CGADYVKTNQ+LP+ I    D++ +TL+CS+DGDAD
Sbjct: 248 PLNIKNPIKIINNDSKNPNLLNMNCGADYVKTNQKLPQGIPKDIDAN-STLFCSYDGDAD 306

Query: 294 RIVFYYQDAQ-NSFHLLDGDKISTLFALFISKQLKKAGLTEKISMGVVQTAYANGNSTNY 352
           RIVFYY D   N+F+LLDGDKI+TLFA F S  L  A L   + +GVVQTAYANG+STNY
Sbjct: 307 RIVFYYIDPMTNNFNLLDGDKIATLFAKFFSNLLTIAKLNHILKLGVVQTAYANGSSTNY 366

Query: 353 LENVLNIPVSCAKTGVKHLHHEAITNYDVGIYFEANGHGTIMFSNKFFETCXXXXXXXXX 412
           + + L +PVSC KTGVKHLHHEAIT YD+GIYFEANGHGT++FS+KF  +          
Sbjct: 367 ISSKLKVPVSCTKTGVKHLHHEAITKYDIGIYFEANGHGTVIFSDKF-HSELTKLKESGS 425

Query: 413 XXXVKTLLSFAHLINQTVGDAISDMLGVLAVLSIMKLTPSAWDKEYTDLPNLLTKVVVPD 472
              +KTLL F+ LINQTVGDA+SDML V+AVLSI++L+P++WDKEY DLPN L KV+VPD
Sbjct: 426 SREIKTLLLFSELINQTVGDAMSDMLAVIAVLSILQLSPNSWDKEYKDLPNKLAKVIVPD 485

Query: 473 RSLFTTTDQERKLLTPEGAQTKIDAIVAKYKNGRSFVRASGTEDAVRVYAEASTPQDAAA 532
           RS F TTDQERKL+ P+G Q  ++  VA    GRSFVRASGTEDAVRVYAEA T ++   
Sbjct: 486 RSKFITTDQERKLVEPKGLQPLLEEAVASVSLGRSFVRASGTEDAVRVYAEAKTQEETEW 545

Query: 533 LNEEVSKAVLASV 545
           L+++V + V+ SV
Sbjct: 546 LSKKVCQLVIESV 558

>KLLA0D00858g Chr4 complement(80327..81952) [1626 bp, 541 aa] {ON}
           similar to uniprot|P38628 Saccharomyces cerevisiae
           YEL058W PCM1 Essential N-acetylglucosamine-phosphate
           mutase a hexosephosphate mutase involved in the
           biosynthesis of chitin
          Length = 541

 Score =  545 bits (1405), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 294/544 (54%), Positives = 361/544 (66%), Gaps = 23/544 (4%)

Query: 9   VFESCCTTRNHRYVYGTAGFRDDATVLDTVMVTTGLLACLRSIALDGKAVGVMITASHNQ 68
           ++E  C  + H Y YGTAGFR   +VLDTVM TTG++A LRSI L  K VGVMITASHN 
Sbjct: 6   LYEQYCK-QGHAYTYGTAGFRAHNSVLDTVMFTTGIVAVLRSIYLKSKFVGVMITASHNP 64

Query: 69  PCDNGVKIVEPDGSMLDQSWEPFATELANKASFCHSTQEFKLYLQEKFAQYKVDSGITPV 128
           P DNGVK+VEP G ML Q+WEP AT+LAN AS   S  + +  LQ   A+  +D+     
Sbjct: 65  PEDNGVKVVEPYGEMLVQNWEPIATKLANAAS--SSFTQLESTLQSIIAELNIDTTQLAN 122

Query: 129 LVVGRDSRDSGPRLLQCLNSLAVPLMKPKIIDYGLLTTPQLHFLTNAINTTKSRAPVTED 188
           + V RDSR+SGPRLL  L +        KIID+ LLTTPQLHFL  ++NT+   + V + 
Sbjct: 123 ITVARDSRESGPRLLAALKAGISVFPAVKIIDFELLTTPQLHFLVYSLNTSSQPSQVRDS 182

Query: 189 DYYSFFMDAWVSITALHGIKVLQSP-RLYIDAANGIGGPKVSKLFEVWPQAGQ-----FT 242
            YY  F+  W  +T L+  +V + P  L ID ANGIG  KV +L     QAG       T
Sbjct: 183 TYYDHFVSIWNQLTQLY--EVTELPFHLTIDCANGIGADKVKQLIS---QAGHMLENSLT 237

Query: 243 LVNNHWQTPTLLNNDCGADYVKTNQRLPKNIDPAADSDPATLYCSFDGDADRIVFYYQDA 302
            VN   +T  LLN  CGAD+VKTNQ  P N +P     P+ LYCSFDGDADR+VFYY D 
Sbjct: 238 AVNGETKTFQLLNESCGADFVKTNQTFPANCNPK----PSQLYCSFDGDADRVVFYYVDG 293

Query: 303 -QNSFHLLDGDKISTLFALFISKQLKKAGLTEKISMGVVQTAYANGNSTNYLENVLNIPV 361
            +N FHLLDGDKI+TL A  I+  L+  GL++ + +GVVQTAYANG+ST Y+ + L IPV
Sbjct: 294 KENKFHLLDGDKIATLLAKLIADLLRDCGLSDTLKLGVVQTAYANGSSTKYITDKLKIPV 353

Query: 362 SCAKTGVKHLHHEAITNYDVGIYFEANGHGTIMFSNKFFETCXXXXXXXX----XXXXVK 417
           SC KTGVKHLHHEA++ YD+GIYFEANGHGT++FS +F ET                 + 
Sbjct: 354 SCTKTGVKHLHHEAVSRYDIGIYFEANGHGTVIFSREFLETVDSRLQETSGNEQQYKSLL 413

Query: 418 TLLSFAHLINQTVGDAISDMLGVLAVLSIMKLTPSAWDKEYTDLPNLLTKVVVPDRSLFT 477
           +L   + LINQTVGDAISDML V+A LSI  L P  WD  Y DLPN LTKV+VPDRS+F 
Sbjct: 414 SLKLLSQLINQTVGDAISDMLAVIATLSIFNLKPEDWDGCYQDLPNRLTKVIVPDRSVFV 473

Query: 478 TTDQERKLLTPEGAQTKIDAIVAKYKNGRSFVRASGTEDAVRVYAEASTPQDAAALNEEV 537
           +T+ ER+LL+PEG Q KID +V ++ N RSFVRASGTEDAVRVYAEA T + A  L  +V
Sbjct: 474 STNAERQLLSPEGLQAKIDLLVTQFPNSRSFVRASGTEDAVRVYAEAETTESAIELATKV 533

Query: 538 SKAV 541
            + V
Sbjct: 534 GELV 537

>ACR015W Chr3 (383130..384788) [1659 bp, 552 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YEL058W (PCM1)
          Length = 552

 Score =  538 bits (1385), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 284/529 (53%), Positives = 352/529 (66%), Gaps = 10/529 (1%)

Query: 21  YVYGTAGFRDDATVLDTVMVTTGLLACLRSIALDGKAVGVMITASHNQPCDNGVKIVEPD 80
           Y YGTAGFR  A VL  V+  TGLLACLRS+ L G  VGVM+TASHN P DNGVK+V+P 
Sbjct: 21  YAYGTAGFRSRAEVLAPVVFATGLLACLRSLYLGGAYVGVMLTASHNPPEDNGVKLVDPH 80

Query: 81  GSMLDQSWEPFATELANKASFCHSTQEFKLYLQEKFAQYKVDSGITPVLVVGRDSRDSGP 140
           G ML   WE  AT LAN AS     QE    L     +  +D  +   +VV RDSR SGP
Sbjct: 81  GEMLAAEWEKHATALANCAS--QGQQELLDALHMLVDRLGLDLALRARVVVARDSRASGP 138

Query: 141 RLLQCLNSLAVPLMKPKIIDYGLLTTPQLHFLTNAINTTKSRAPVTEDDYYSFFMDAWVS 200
           +LL  L      L   +++D G+LTTPQLHFLT A N   S A V ED YY+ F+ A   
Sbjct: 139 QLLDALLDGTRMLEDVEVVDCGMLTTPQLHFLTCACNERGSAAGVREDLYYAHFVAALEE 198

Query: 201 ITALHGIKVLQSPRLYIDAANGIGGPKVSKLFEVWPQ-AGQFTLVNNHWQTPTLLNNDCG 259
           + ALHG++ L  P L +D ANG+G  K  +LF   P    + +++N++W    LLN+ CG
Sbjct: 199 LAALHGLETLPFP-LVVDTANGVGALKARELFRRSPLFKNRVSIINDNWSQHELLNSGCG 257

Query: 260 ADYVKTNQRLPKNIDPAADSDPATLYCSFDGDADRIVFYYQDAQNSFHLLDGDKISTLFA 319
           ADYVKT Q LP+ I  +AD    +L+CS+DGDADR++FYY D Q  FHLLDGDKISTL A
Sbjct: 258 ADYVKTKQCLPQGI--SADLLRESLFCSYDGDADRVIFYYIDGQERFHLLDGDKISTLIA 315

Query: 320 LFISKQLKKAGLTEKISMGVVQTAYANGNSTNYLENVLNIPVSCAKTGVKHLHHEAITNY 379
            F+   L  AG+ + + +GVVQTAYANG+ST YL  VL +PVSC  TGVKHLH EA+  Y
Sbjct: 316 KFLQSALLTAGINDDVCLGVVQTAYANGSSTRYLSEVLEVPVSCTPTGVKHLHREAVQKY 375

Query: 380 DVGIYFEANGHGTIMFSNKFFETCXXX----XXXXXXXXXVKTLLSFAHLINQTVGDAIS 435
           DVGIYFEANGHGT++FS  F  T                 ++TL +FA+LINQT+GDAI+
Sbjct: 376 DVGIYFEANGHGTVIFSEHFTLTVERALENPALSAKARLSLQTLKTFANLINQTIGDAIA 435

Query: 436 DMLGVLAVLSIMKLTPSAWDKEYTDLPNLLTKVVVPDRSLFTTTDQERKLLTPEGAQTKI 495
           DML V+A+LSI+  +P  WDK+YTDLPN L KVVVPDRS+F TT+ E++L +P G Q  I
Sbjct: 436 DMLAVIAILSILHWSPEDWDKQYTDLPNNLVKVVVPDRSMFKTTNAEQQLTSPAGLQELI 495

Query: 496 DAIVAKYKNGRSFVRASGTEDAVRVYAEASTPQDAAALNEEVSKAVLAS 544
           D IV  Y +GRSFVRASGTEDAVR+YAEA++ Q A  L  +VS  V+ S
Sbjct: 496 DDIVMVYDSGRSFVRASGTEDAVRIYAEAASQQQADELATKVSTLVVES 544

>KNAG0E00940 Chr5 (176887..178503) [1617 bp, 538 aa] {ON} Anc_6.11
           YEL058W
          Length = 538

 Score =  525 bits (1351), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 286/556 (51%), Positives = 360/556 (64%), Gaps = 29/556 (5%)

Query: 1   MHWNVLESVFESCCTTRNHRYVYGTAGFRDDATVLDTVMVTTGLLACLRSIALDGKAVGV 60
           M    + +VF++ CTT+ + Y YGTAGFRD A VLDTVM  TG +A LRS  L+G  VGV
Sbjct: 1   MSREAVRAVFDAVCTTKGYTYTYGTAGFRDKAAVLDTVMFATGCVAVLRSWRLNGAQVGV 60

Query: 61  MITASHNQPCDNGVKIVEPDGSMLDQSWEPFATELANKASFCHSTQEFKLYLQEKFAQYK 120
           M+TASHN P DNGVK+V+P+G ML + WEP AT LAN A+     Q ++ Y      +  
Sbjct: 61  MVTASHNPPEDNGVKVVDPEGGMLPEQWEPLATRLANLAANGTFDQWWE-YWTSLVEEGN 119

Query: 121 VDSGITPVLVVGRDSRDSGPRLLQCLNSLA-------VPLMKPKIIDYGLLTTPQLHFLT 173
              G    L VG D+R+S PRLL+ L   A       + + KP I ++     PQLH+LT
Sbjct: 120 YTGGAR--LCVGHDTRESSPRLLKNLMDAALAVSGGSITISKPWITNH-----PQLHYLT 172

Query: 174 NAINTTKSRAPVTEDDYYS-FFMDAWVSITALHGIKVLQSPRLYIDAANGIGGPKVSKLF 232
           +       R  VT+   Y+  F   W  +    G+      RL+ID ANG+G  ++ + F
Sbjct: 173 SL-----QRDGVTDAAAYNDHFQGCWQKLFP-DGVVAWPFDRLFIDTANGVGAVQLQQFF 226

Query: 233 EVWP-QAGQFTLVNNHWQTPTLLNNDCGADYVKTNQRLPKNIDPAADSDPA--TLYCSFD 289
           + W     +F L+N  + TP  LN  CGAD+VKTN RLP  +     +  A   LYCSFD
Sbjct: 227 KGWAVDQNKFRLLNTDYGTPENLNVKCGADFVKTNHRLPSEVPDQRGTSGALPDLYCSFD 286

Query: 290 GDADRIVFYYQDAQNSFHLLDGDKISTLFALFISKQLKKAGLTEKISMGVVQTAYANGNS 349
           GDADRIVFY+      FHLLDGDKISTLFA FI +   +AG  +K+++GVVQTAYANGNS
Sbjct: 287 GDADRIVFYFVK-NKQFHLLDGDKISTLFAKFIGQLTARAGADDKLTVGVVQTAYANGNS 345

Query: 350 TNYLENVLNIPVSCAKTGVKHLHHEAITNYDVGIYFEANGHGTIMFSNKFFETCXXXXXX 409
           T Y+ + L IP +C KTGVKHLHH A T YD+GIYFEANGHGT++FS+KF E        
Sbjct: 346 TRYIASELGIPSACTKTGVKHLHHVAKTQYDIGIYFEANGHGTVVFSDKFNEVVAGVAST 405

Query: 410 XXXXXXVKTLLSFAHLINQTVGDAISDMLGVLAVLSIMKLTPSAWDKEYTDLPNLLTKVV 469
                   TL  F+ LINQTVGDAI+DMLGVLAVL  ++ TP  W  EYTDLPNLLTKVV
Sbjct: 406 NDA---ASTLYHFSKLINQTVGDAIADMLGVLAVLIKLQWTPEVWGAEYTDLPNLLTKVV 462

Query: 470 VPDRSLFTTTDQERKLLTPEGAQTKIDAIVAKYKNGRSFVRASGTEDAVRVYAEASTPQD 529
           VPDRS+F TTDQER+L++PEG Q KIDA V ++K  RSFVRASGTE+AVR+Y EA  PQ+
Sbjct: 463 VPDRSIFETTDQERRLVSPEGLQEKIDACVGRFKRARSFVRASGTENAVRIYCEAEDPQE 522

Query: 530 AAALNEEVSKAVLASV 545
              L+++V++AVL SV
Sbjct: 523 VQELSKQVTEAVLNSV 538

>NDAI0K00410 Chr11 complement(91807..93687) [1881 bp, 626 aa] {ON}
           Anc_8.840 YMR278W
          Length = 626

 Score = 40.8 bits (94), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 28/93 (30%), Positives = 49/93 (52%), Gaps = 14/93 (15%)

Query: 57  AVGVMITASHNQPCDNGVKIVEPDG------------SMLDQSWEPFATELANKASFCHS 104
           ++GVMITASHN   DNG K+   +G            + +D++ EP++++    ++F  +
Sbjct: 153 SIGVMITASHNPKMDNGYKVYYSNGCQIIPPHDKNIAATIDENLEPWSSDWNWDSTFEKN 212

Query: 105 TQEFKL-YLQEKFAQYKVDSGITPVLVVGRDSR 136
            +E KL Y++E+    K    +  +LV    SR
Sbjct: 213 LKEKKLVYVREEMTN-KYLQAMKDILVSSSISR 244

>YMR278W Chr13 (822763..824631) [1869 bp, 622 aa] {ON}
           PGM3Phosphoglucomutase, catalyzes interconversion of
           glucose-1-phosphate and glucose-6-phospate;
           transcription induced in response to stress; green
           fluorescent protein (GFP)-fusion protein localizes to
           the cytoplasm and nucleus; non-essential
          Length = 622

 Score = 38.1 bits (87), Expect = 0.065,   Method: Compositional matrix adjust.
 Identities = 29/80 (36%), Positives = 40/80 (50%), Gaps = 22/80 (27%)

Query: 57  AVGVMITASHNQPCDNGVKIVEPDGSM------------LDQSWEPFAT-----ELANKA 99
           +VGVMITASHN   DNG K+   +G              +D + EP+A      ++ NKA
Sbjct: 150 SVGVMITASHNPKMDNGYKVYYSNGCQIIPPHDHAISDSIDANLEPWANVWDFDDVLNKA 209

Query: 100 ----SFCHSTQE-FKLYLQE 114
                  +S +E  KLYL+E
Sbjct: 210 LKQGKLMYSREEMLKLYLEE 229

>NCAS0C00410 Chr3 complement(62893..64770) [1878 bp, 625 aa] {ON}
           Anc_8.840 YMR278W
          Length = 625

 Score = 37.0 bits (84), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 32/101 (31%), Positives = 46/101 (45%), Gaps = 14/101 (13%)

Query: 22  VYGTAGFRDDATVLDTVMVTTGLLACLRSIALDGKAVGVMITASHNQPCDNGVK------ 75
           ++  AGF+      D   V T L+    S+     +VGVMITASHN   DNG K      
Sbjct: 119 IFLRAGFKVFYLTPDDQFVHTPLVPF--SVLNLKASVGVMITASHNPKMDNGYKVYYDNA 176

Query: 76  --IVEPD----GSMLDQSWEPFATELANKASFCHSTQEFKL 110
             I+ P       M+ ++ EP++T     A+F    +  KL
Sbjct: 177 CQIIPPHDKNIAEMIQKNLEPWSTSWDWDATFKKGLETNKL 217

>TDEL0B00570 Chr2 complement(109270..111162) [1893 bp, 630 aa] {ON}
           Anc_8.840 YMR278W
          Length = 630

 Score = 36.6 bits (83), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 16/30 (53%), Positives = 20/30 (66%)

Query: 55  GKAVGVMITASHNQPCDNGVKIVEPDGSML 84
           G +VGVMITASHN   DNG K+   +G  +
Sbjct: 156 GASVGVMITASHNPKMDNGYKVYYSNGCQI 185

>Kpol_1068.8 s1068 complement(13542..15440) [1899 bp, 632 aa] {ON}
           complement(13542..15440) [1899 nt, 633 aa]
          Length = 632

 Score = 36.2 bits (82), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 16/30 (53%), Positives = 20/30 (66%)

Query: 55  GKAVGVMITASHNQPCDNGVKIVEPDGSML 84
           G +VGVMITASHN   DNG K+   +G  +
Sbjct: 154 GASVGVMITASHNPKMDNGYKVYYSNGCQI 183

>KLLA0D01573g Chr4 complement(139183..141006) [1824 bp, 607 aa] {ON}
           similar to uniprot|Q03262 Saccharomyces cerevisiae
           YMR278W Hypothetical ORF
          Length = 607

 Score = 35.8 bits (81), Expect = 0.29,   Method: Compositional matrix adjust.
 Identities = 15/30 (50%), Positives = 20/30 (66%)

Query: 55  GKAVGVMITASHNQPCDNGVKIVEPDGSML 84
           G +VG+MITASHN   DNG K+   +G  +
Sbjct: 151 GASVGIMITASHNPKMDNGYKVYYTNGCQI 180

>KLTH0C03872g Chr3 complement(337765..339630) [1866 bp, 621 aa] {ON}
           similar to uniprot|Q03262 Saccharomyces cerevisiae
           YMR278W Hypothetical ORF
          Length = 621

 Score = 35.4 bits (80), Expect = 0.40,   Method: Compositional matrix adjust.
 Identities = 24/61 (39%), Positives = 34/61 (55%), Gaps = 10/61 (16%)

Query: 27  GFRDDAT---VLDTVMVTTGLLACLRSIALDGKAVGVMITASHNQPCDNGVKIVEPDGSM 83
           GF +DA+   V+ T MV  G+   LR+      + G+MITASHN   DNG K+   +G  
Sbjct: 129 GFTEDASQDVVVHTPMVPFGI-DHLRA------SGGIMITASHNPKMDNGYKVYYSNGCQ 181

Query: 84  L 84
           +
Sbjct: 182 I 182

>TPHA0I00250 Chr9 (46554..48443) [1890 bp, 629 aa] {ON} Anc_8.840
           YMR278W
          Length = 629

 Score = 35.4 bits (80), Expect = 0.41,   Method: Compositional matrix adjust.
 Identities = 31/98 (31%), Positives = 43/98 (43%), Gaps = 26/98 (26%)

Query: 6   LESVFESCCTT---RNHRY-----------VYGTAGFR-----DDATVLDTVMVTTGLLA 46
           ++S F S  T     +HRY           V+  AGF+      +   + T MV  G   
Sbjct: 93  IKSQFPSNLTAVVGHDHRYHSKEFAQITAAVFLNAGFKVYYLNPNDEFVHTPMVPFG--- 149

Query: 47  CLRSIALDGKAVGVMITASHNQPCDNGVKIVEPDGSML 84
               I L   ++GVMITASHN   DNG K+   +G  +
Sbjct: 150 ----INLYSASIGVMITASHNPEMDNGYKVYYNNGCQI 183

>KLLA0D06809g Chr4 complement(587709..588275) [567 bp, 188 aa] {ON}
           similar to uniprot|Q75C19 Ashbya gossypii ACR098C
           ACR098Cp and some similarites with YPL129W
           uniprot|P35189 Saccharomyces cerevisiae YPL129W TAF14
           Subunit (30 kDa) of TFIID TFIIF and SWI/SNF complexes
           involved in RNA polymerase II transcription initiation
           and in chromatin modification contains a YEATS domain
          Length = 188

 Score = 34.3 bits (77), Expect = 0.51,   Method: Compositional matrix adjust.
 Identities = 32/124 (25%), Positives = 48/124 (38%), Gaps = 17/124 (13%)

Query: 75  KIVEPDGSMLDQSWEPFATELANKASFCHSTQEFKLYLQEKFAQYKVDSGITPVLVVGRD 134
           K+ EP  ++ +Q W  F  ++  K  FC +T  F   L      Y VD         GR 
Sbjct: 35  KLTEPPFTLDEQGWGEFELKIIAKVKFCSTTYTFHHELSFDNNAYNVDYE-------GRF 87

Query: 135 SRDSGPRLLQCLNSLAVPLMKPKIIDYGLLTTPQ----------LHFLTNAINTTKSRAP 184
                    + LNS +VP+     I  G +T  Q          +  +   INT  +  P
Sbjct: 88  PYHQTKLREELLNSGSVPIYNEDEISLGQVTNLQRAINLISVSDVDTIQKVINTIVTFPP 147

Query: 185 VTED 188
           V+E+
Sbjct: 148 VSEE 151

>Kwal_27.10258 s27 complement(265612..267474) [1863 bp, 620 aa] {ON}
           YMR278W - Hypothetical ORF [contig 37] FULL
          Length = 620

 Score = 35.0 bits (79), Expect = 0.56,   Method: Compositional matrix adjust.
 Identities = 15/30 (50%), Positives = 19/30 (63%)

Query: 55  GKAVGVMITASHNQPCDNGVKIVEPDGSML 84
           G + GVMITASHN   DNG K+   +G  +
Sbjct: 152 GASAGVMITASHNPKMDNGYKVYYSNGCQI 181

>Skud_13.450 Chr13 (796030..797898) [1869 bp, 622 aa] {ON} YMR278W
           (REAL)
          Length = 622

 Score = 34.7 bits (78), Expect = 0.70,   Method: Compositional matrix adjust.
 Identities = 25/80 (31%), Positives = 39/80 (48%), Gaps = 22/80 (27%)

Query: 57  AVGVMITASHNQPCDNGVKIVEPDG------------SMLDQSWEPFA---------TEL 95
           +VGVMITASHN   DNG K+   +G            + +D + EP+A         ++ 
Sbjct: 150 SVGVMITASHNPKMDNGYKVYYSNGCQIIPPHDQAISNAIDMNLEPWANAWNFDDILSKN 209

Query: 96  ANKASFCHSTQE-FKLYLQE 114
             +    +S +E  KLYL++
Sbjct: 210 LKQGKLMYSREEMLKLYLEK 229

>Smik_13.491 Chr13 (805767..807635) [1869 bp, 622 aa] {ON} YMR278W
           (REAL)
          Length = 622

 Score = 34.3 bits (77), Expect = 0.80,   Method: Compositional matrix adjust.
 Identities = 27/80 (33%), Positives = 38/80 (47%), Gaps = 22/80 (27%)

Query: 57  AVGVMITASHNQPCDNGVKIVEPDGSM------------LDQSWEPFAT-----ELANK- 98
           +VGVM+TASHN   DNG K+   +G              +D + EP+A      ++ NK 
Sbjct: 150 SVGVMVTASHNPKMDNGYKVYYSNGCQIIPPHDHAISDSIDMNLEPWANVWNFDDVLNKG 209

Query: 99  ---ASFCHSTQE-FKLYLQE 114
                  +S +E  KLYL E
Sbjct: 210 LKQGKLMYSREEILKLYLGE 229

>CAGL0M02981g Chr13 (335863..337716) [1854 bp, 617 aa] {ON} similar
           to uniprot|Q03262 Saccharomyces cerevisiae YMR278w
          Length = 617

 Score = 34.3 bits (77), Expect = 0.83,   Method: Compositional matrix adjust.
 Identities = 15/28 (53%), Positives = 19/28 (67%)

Query: 57  AVGVMITASHNQPCDNGVKIVEPDGSML 84
           +VGVMITASHN   DNG K+   +G  +
Sbjct: 147 SVGVMITASHNPKMDNGYKVYYTNGCQI 174

>ABL126W Chr2 (159207..161081) [1875 bp, 624 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YMR278W
          Length = 624

 Score = 34.3 bits (77), Expect = 0.86,   Method: Compositional matrix adjust.
 Identities = 28/86 (32%), Positives = 38/86 (44%), Gaps = 12/86 (13%)

Query: 57  AVGVMITASHNQPCDNGVK--------IVEPD----GSMLDQSWEPFATELANKASFCHS 104
           + GVMITASHN   DNG K        I+ P     G  +D + EP+     +KA    +
Sbjct: 158 SCGVMITASHNPKMDNGYKVYYANGCQIIPPHDELIGRHIDANLEPWTRAWDSKALIEEA 217

Query: 105 TQEFKLYLQEKFAQYKVDSGITPVLV 130
            +  KL+   K    K    I  +LV
Sbjct: 218 IKSGKLHDVRKEMLQKYKDSIQTMLV 243

>ZYRO0G14190g Chr7 (1131206..1133038) [1833 bp, 610 aa] {ON} similar
           to uniprot|Q03262 Saccharomyces cerevisiae YMR278W
           Hypothetical ORF
          Length = 610

 Score = 34.3 bits (77), Expect = 0.86,   Method: Compositional matrix adjust.
 Identities = 15/28 (53%), Positives = 19/28 (67%)

Query: 57  AVGVMITASHNQPCDNGVKIVEPDGSML 84
           +VGVMITASHN   DNG K+   +G  +
Sbjct: 146 SVGVMITASHNPKLDNGYKVYYANGCQI 173

>Suva_13.466 Chr13 (805414..807282) [1869 bp, 622 aa] {ON} YMR278W
           (REAL)
          Length = 622

 Score = 34.3 bits (77), Expect = 0.91,   Method: Compositional matrix adjust.
 Identities = 15/28 (53%), Positives = 19/28 (67%)

Query: 57  AVGVMITASHNQPCDNGVKIVEPDGSML 84
           +VGVMITASHN   DNG K+   +G  +
Sbjct: 150 SVGVMITASHNPKMDNGYKVYYSNGCQI 177

>Kpol_1037.41 s1037 (100357..101667) [1311 bp, 436 aa] {ON}
           (100357..101667) [1311 nt, 437 aa]
          Length = 436

 Score = 33.9 bits (76), Expect = 1.00,   Method: Compositional matrix adjust.
 Identities = 39/146 (26%), Positives = 57/146 (39%), Gaps = 37/146 (25%)

Query: 246 NHWQTPTLLNNDCGADYVKTNQRLPKNIDPAADSDPATLYCSFDGDADRIVFYYQDAQNS 305
           N W    L N D G       Q+L + IDP    D A L C           +++D QN 
Sbjct: 174 NDWIYKNLANQDSGV----MGQKLKQRIDPTCTKDDAILDC---------CLFFKDEQNC 220

Query: 306 F-HLLDGDKISTLFALFISKQLKKAGLTEKISMGVVQTAYANGNSTNYLENVLNIPVSCA 364
           F  LL  DK   L AL  ++++      + ++  ++        S  Y EN+L       
Sbjct: 221 FVILLSNDKNLCLKAL--TEEIPTVSYRQDMTAELIA-------SKAYEENLL------- 264

Query: 365 KTGVKHLHHEAITNYDVGIYFEANGH 390
           + G +H+       YD G    A GH
Sbjct: 265 RFGQQHI-------YDQGSSTSAQGH 283

>Ecym_4611 Chr4 (1191367..1193259) [1893 bp, 630 aa] {ON} similar to
           Ashbya gossypii ABL126W
          Length = 630

 Score = 34.3 bits (77), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 14/30 (46%), Positives = 19/30 (63%)

Query: 55  GKAVGVMITASHNQPCDNGVKIVEPDGSML 84
           G + G+MITASHN   DNG K+   +G  +
Sbjct: 160 GASCGIMITASHNPKMDNGYKVYYSNGCQI 189

>KAFR0C05550 Chr3 complement(1108145..1108708) [564 bp, 187 aa] {ON}
           Anc_5.557 YDR441C
          Length = 187

 Score = 33.1 bits (74), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 24/70 (34%), Positives = 32/70 (45%), Gaps = 8/70 (11%)

Query: 88  WEPFATELANKASFCHSTQEFKLYLQEKFAQYKVDSGITPVLVVGRDSRD--SGPRLLQC 145
           +E F     N   F    + FKL+L EKF   K+D       ++G +SR    GP L   
Sbjct: 27  FEDFLPIFQNPQLFNKLVESFKLHLAEKFPNTKIDY------IIGLESRGFLFGPALALA 80

Query: 146 LNSLAVPLMK 155
           LN   VP+ K
Sbjct: 81  LNVGFVPVRK 90

>KNAG0J00270 Chr10 complement(39750..41627) [1878 bp, 625 aa] {ON}
           Anc_8.840 YMR278W
          Length = 625

 Score = 33.9 bits (76), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 19/47 (40%), Positives = 25/47 (53%), Gaps = 12/47 (25%)

Query: 57  AVGVMITASHNQPCDNGVKIVEPDGSM------------LDQSWEPF 91
           +VGVMITASHN   DNG K+   +G              +DQ+ EP+
Sbjct: 153 SVGVMITASHNPKMDNGYKVYFANGCQIIPPHDLNIARSIDQNLEPW 199

>TBLA0B03250 Chr2 (757928..759859) [1932 bp, 643 aa] {ON} Anc_8.840
           YMR278W
          Length = 643

 Score = 33.9 bits (76), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 14/28 (50%), Positives = 19/28 (67%)

Query: 57  AVGVMITASHNQPCDNGVKIVEPDGSML 84
           +VGVM+TASHN   DNG K+   +G  +
Sbjct: 165 SVGVMVTASHNPKMDNGYKVYYSNGCQI 192

>KLLA0B01309g Chr2 complement(103734..104297) [564 bp, 187 aa] {ON}
           similar to uniprot|P49435 YML022W Saccharomyces
           cerevisiae APT1 Adenine phosphoribosyltransferase
          Length = 187

 Score = 32.3 bits (72), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 23/70 (32%), Positives = 34/70 (48%), Gaps = 8/70 (11%)

Query: 88  WEPFATELANKASFCHSTQEFKLYLQEKFAQYKVDSGITPVLVVGRDSRD--SGPRLLQC 145
           +E F     +   F    + FKL+LQEKF   K+D       V+G ++R    GP L   
Sbjct: 27  FEDFLPIFRDPQLFKKLIESFKLHLQEKFTGKKID------YVIGLEARGFLFGPALALA 80

Query: 146 LNSLAVPLMK 155
           L++  VP+ K
Sbjct: 81  LDAGFVPVRK 90

>KAFR0B03920 Chr2 (814394..816268) [1875 bp, 624 aa] {ON} Anc_8.840
           YMR278W
          Length = 624

 Score = 33.1 bits (74), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 29/99 (29%), Positives = 44/99 (44%), Gaps = 24/99 (24%)

Query: 57  AVGVMITASHNQPCDNGVKIVEPDGSML---------------------DQSWEP-FATE 94
           A GVMITASHN   DNG K+   +G  +                     D +W+  F+TE
Sbjct: 156 ACGVMITASHNPKDDNGYKVYYSNGCQIIPPHDKNIALTIEKNLTPWSKDWNWKDLFSTE 215

Query: 95  LANKASFCHSTQEFKLYLQEKFAQYKVDSGITPVLVVGR 133
             N     +  + F  Y+Q+   +Y   +G +P+L  G+
Sbjct: 216 ERNGNLEFNGNKMFLAYVQD-ITRYVFTNG-SPMLKTGK 252

>NCAS0H02720 Chr8 complement(535363..535929) [567 bp, 188 aa] {ON}
           Anc_5.557 YDR441C
          Length = 188

 Score = 32.0 bits (71), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 22/70 (31%), Positives = 32/70 (45%), Gaps = 8/70 (11%)

Query: 88  WEPFATELANKASFCHSTQEFKLYLQEKFAQYKVDSGITPVLVVGRDSRD--SGPRLLQC 145
           +E F     N   F      FK++L+EKF   K+D       ++G +SR    GP L   
Sbjct: 27  FEDFLPIFQNPVLFKKLVDAFKMHLEEKFKGTKID------YIIGLESRGFLFGPSLALA 80

Query: 146 LNSLAVPLMK 155
           +N   VP+ K
Sbjct: 81  MNVGFVPVRK 90

>SAKL0D01474g Chr4 complement(117178..119052) [1875 bp, 624 aa] {ON}
           similar to uniprot|Q03262 Saccharomyces cerevisiae
           YMR278W Hypothetical ORF
          Length = 624

 Score = 32.7 bits (73), Expect = 3.0,   Method: Compositional matrix adjust.
 Identities = 13/28 (46%), Positives = 18/28 (64%)

Query: 57  AVGVMITASHNQPCDNGVKIVEPDGSML 84
           + G+MITASHN   DNG K+   +G  +
Sbjct: 154 SAGIMITASHNPKMDNGYKVYYSNGCQI 181

>NDAI0C05790 Chr3 (1331269..1333380) [2112 bp, 703 aa] {ON}
           Anc_8.587 YBR172C
          Length = 703

 Score = 31.2 bits (69), Expect = 9.5,   Method: Compositional matrix adjust.
 Identities = 24/93 (25%), Positives = 40/93 (43%), Gaps = 7/93 (7%)

Query: 152 PLMKPKIIDYGLLTTPQLHFLTNAINTTKSRAPVTEDDYYSFFMDAWVSITALHGIKVLQ 211
           PL    I+D G + +P +H  T   +T++ ++ +     Y+      + I       VL+
Sbjct: 165 PLSSQFIVDTGYVDSPLIHSATPLTSTSQQQSNLFAPQLYTPSSSNVMPI-------VLE 217

Query: 212 SPRLYIDAANGIGGPKVSKLFEVWPQAGQFTLV 244
           S   YID+   + GP  +     W Q G F  V
Sbjct: 218 SKWKYIDSTGTVQGPFSTSEMASWNQQGYFQPV 250

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.318    0.133    0.395 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 56,212,100
Number of extensions: 2420739
Number of successful extensions: 5797
Number of sequences better than 10.0: 50
Number of HSP's gapped: 5845
Number of HSP's successfully gapped: 50
Length of query: 545
Length of database: 53,481,399
Length adjustment: 115
Effective length of query: 430
Effective length of database: 40,294,809
Effective search space: 17326767870
Effective search space used: 17326767870
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 68 (30.8 bits)