Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
TPHA0M002006.10ON63458325100.0
Kpol_1045.776.10ON65061320240.0
TBLA0G011106.10ON63859019620.0
SAKL0E00880g6.10ON63658619500.0
TDEL0G046106.10ON63358319310.0
ZYRO0F00484g6.10ON64360018820.0
Kwal_56.223506.10ON65858518820.0
NCAS0D021906.10ON64560918760.0
KLLA0D00836g6.10ON64059018490.0
ACR016W6.10ON64059718400.0
CAGL0A01067g6.10ON64159317840.0
KLTH0C11528g6.10ON64259017780.0
KAFR0B065006.10ON63660317170.0
NDAI0I027506.10ON66362516560.0
KNAG0E027806.10ON65057314780.0
YPL263C (KEL3)6.10ON65160313131e-173
Smik_6.4716.10ON65157713061e-172
Suva_16.426.10ON65458013061e-172
Skud_16.146.10ON65257813011e-172
Kpol_1050.695.88ON10842091556e-10
Skud_8.2225.88ON11692231342e-07
KAFR0B043205.88ON9862101342e-07
Suva_15.3575.88ON11722231342e-07
KNAG0K005605.88ON11041891333e-07
TDEL0G011205.88ON10092181324e-07
SAKL0H02618g5.88ON10852201324e-07
Smik_8.2425.88ON11682231324e-07
ZYRO0B08228g5.88ON12932051315e-07
NCAS0F005205.88ON10862191298e-07
YHR158C (KEL1)5.88ON11642231298e-07
TBLA0C065305.88ON11721941226e-06
KLLA0E15511g5.88ON9052081226e-06
CAGL0I02090g5.88ON11362161181e-05
CAGL0F07997g5.88ON9362171181e-05
Kpol_1010.625.88ON9731791172e-05
Kwal_14.10195.88ON9782181163e-05
KLTH0C01474g5.88ON10562131163e-05
NDAI0D026005.88ON11672151163e-05
TPHA0A051705.88ON10162031154e-05
Suva_7.5305.88ON8942221145e-05
YGR238C (KEL2)5.88ON8822041111e-04
TPHA0H010805.88ON8281821083e-04
Ecym_20615.88ON13622111083e-04
Smik_16.685.88ON8942041010.002
ADL149W5.88ON12112121010.002
Skud_7.5725.88ON883100990.003
Kwal_55.207568.157ON157563752.0
TBLA0A043207.9ON83891742.4
ZYRO0C00550g7.9ON848104733.1
Kpol_538.457.9ON848160725.1
Ecym_50077.9ON83870716.1
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= TPHA0M00200
         (634 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

TPHA0M00200 Chr13 complement(40103..42007) [1905 bp, 634 aa] {ON...   971   0.0  
Kpol_1045.77 s1045 (180708..182660) [1953 bp, 650 aa] {ON} (1807...   784   0.0  
TBLA0G01110 Chr7 complement(283630..285546) [1917 bp, 638 aa] {O...   760   0.0  
SAKL0E00880g Chr5 complement(66646..68556) [1911 bp, 636 aa] {ON...   755   0.0  
TDEL0G04610 Chr7 (840098..841999) [1902 bp, 633 aa] {ON} Anc_6.1...   748   0.0  
ZYRO0F00484g Chr6 complement(47424..49355) [1932 bp, 643 aa] {ON...   729   0.0  
Kwal_56.22350 s56 complement(60828..62804) [1977 bp, 658 aa] {ON...   729   0.0  
NCAS0D02190 Chr4 complement(408069..410006) [1938 bp, 645 aa] {O...   727   0.0  
KLLA0D00836g Chr4 complement(78202..80124) [1923 bp, 640 aa] {ON...   716   0.0  
ACR016W Chr3 (384967..386889) [1923 bp, 640 aa] {ON} Syntenic ho...   713   0.0  
CAGL0A01067g Chr1 (106866..108791) [1926 bp, 641 aa] {ON} simila...   691   0.0  
KLTH0C11528g Chr3 (946632..948560) [1929 bp, 642 aa] {ON} simila...   689   0.0  
KAFR0B06500 Chr2 (1347509..1349419) [1911 bp, 636 aa] {ON} Anc_6...   665   0.0  
NDAI0I02750 Chr9 complement(644137..646128) [1992 bp, 663 aa] {O...   642   0.0  
KNAG0E02780 Chr5 complement(559180..561132) [1953 bp, 650 aa] {O...   573   0.0  
YPL263C Chr16 complement(44551..46506) [1956 bp, 651 aa] {ON}  K...   510   e-173
Smik_6.471 Chr6 (774663..776618) [1956 bp, 651 aa] {ON} YPL263C ...   507   e-172
Suva_16.42 Chr16 complement(60142..62106) [1965 bp, 654 aa] {ON}...   507   e-172
Skud_16.14 Chr16 complement(23637..25595) [1959 bp, 652 aa] {ON}...   505   e-172
Kpol_1050.69 s1050 complement(150301..153555) [3255 bp, 1084 aa]...    64   6e-10
Skud_8.222 Chr8 complement(385114..388623) [3510 bp, 1169 aa] {O...    56   2e-07
KAFR0B04320 Chr2 complement(893930..896890) [2961 bp, 986 aa] {O...    56   2e-07
Suva_15.357 Chr15 complement(617637..618952,619001..621203) [351...    56   2e-07
KNAG0K00560 Chr11 complement(96678..99992) [3315 bp, 1104 aa] {O...    56   3e-07
TDEL0G01120 Chr7 (229805..232834) [3030 bp, 1009 aa] {ON} Anc_5....    55   4e-07
SAKL0H02618g Chr8 (259684..262941) [3258 bp, 1085 aa] {ON} simil...    55   4e-07
Smik_8.242 Chr8 complement(390631..394137) [3507 bp, 1168 aa] {O...    55   4e-07
ZYRO0B08228g Chr2 (641988..645869) [3882 bp, 1293 aa] {ON} simil...    55   5e-07
NCAS0F00520 Chr6 (100048..103308) [3261 bp, 1086 aa] {ON} Anc_5....    54   8e-07
YHR158C Chr8 complement(413685..417179) [3495 bp, 1164 aa] {ON} ...    54   8e-07
TBLA0C06530 Chr3 complement(1577728..1581246) [3519 bp, 1172 aa]...    52   6e-06
KLLA0E15511g Chr5 (1388626..1391343) [2718 bp, 905 aa] {ON} simi...    52   6e-06
CAGL0I02090g Chr9 complement(177324..180734) [3411 bp, 1136 aa] ...    50   1e-05
CAGL0F07997g Chr6 complement(785803..788613) [2811 bp, 936 aa] {...    50   1e-05
Kpol_1010.62 s1010 complement(151895..154816) [2922 bp, 973 aa] ...    50   2e-05
Kwal_14.1019 s14 (159934..162870) [2937 bp, 978 aa] {ON} YHR158C...    49   3e-05
KLTH0C01474g Chr3 (131243..134413) [3171 bp, 1056 aa] {ON} simil...    49   3e-05
NDAI0D02600 Chr4 complement(600880..604383) [3504 bp, 1167 aa] {...    49   3e-05
TPHA0A05170 Chr1 complement(1161610..1164660) [3051 bp, 1016 aa]...    49   4e-05
Suva_7.530 Chr7 complement(920446..923130) [2685 bp, 894 aa] {ON...    49   5e-05
YGR238C Chr7 complement(966039..968687) [2649 bp, 882 aa] {ON}  ...    47   1e-04
TPHA0H01080 Chr8 complement(232804..235290) [2487 bp, 828 aa] {O...    46   3e-04
Ecym_2061 Chr2 (99788..103876) [4089 bp, 1362 aa] {ON} similar t...    46   3e-04
Smik_16.68 Chr16 (128068..130752) [2685 bp, 894 aa] {ON} YGR238C...    44   0.002
ADL149W Chr4 (427096..430731) [3636 bp, 1211 aa] {ON} Syntenic h...    44   0.002
Skud_7.572 Chr7 complement(940820..943471) [2652 bp, 883 aa] {ON...    43   0.003
Kwal_55.20756 s55 (545793..550520) [4728 bp, 1575 aa] {ON} YGL19...    33   2.0  
TBLA0A04320 Chr1 (1068199..1070715) [2517 bp, 838 aa] {ON} Anc_7...    33   2.4  
ZYRO0C00550g Chr3 (39312..41858) [2547 bp, 848 aa] {ON} similar ...    33   3.1  
Kpol_538.45 s538 complement(101351..103897) [2547 bp, 848 aa] {O...    32   5.1  
Ecym_5007 Chr5 (13107..15623) [2517 bp, 838 aa] {ON} similar to ...    32   6.1  

>TPHA0M00200 Chr13 complement(40103..42007) [1905 bp, 634 aa] {ON}
           Anc_6.10 YPL263C
          Length = 634

 Score =  971 bits (2510), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 480/583 (82%), Positives = 480/583 (82%)

Query: 52  VLANFKKEQEQFEQINVESVDKPTRRINSCMIANPNHGKKELLLFGGENTSQEQGVTHFY 111
           VLANFKKEQEQFEQINVESVDKPTRRINSCMIANPNHGKKELLLFGGENTSQEQGVTHFY
Sbjct: 52  VLANFKKEQEQFEQINVESVDKPTRRINSCMIANPNHGKKELLLFGGENTSQEQGVTHFY 111

Query: 112 NDLYTFTPDNDLWKKITSQNXXXXXXXXXXXXXXXGIALLHGGEFSSPKQNTFYHYSDTW 171
           NDLYTFTPDNDLWKKITSQN               GIALLHGGEFSSPKQNTFYHYSDTW
Sbjct: 112 NDLYTFTPDNDLWKKITSQNSPMPRSSAAMAAHPSGIALLHGGEFSSPKQNTFYHYSDTW 171

Query: 172 LLDCTTREWTKVEQKNGPSARSGHRITVWKNYFILHGGFRDLGSTTSYLNDSWLFDITSY 231
           LLDCTTREWTKVEQKNGPSARSGHRITVWKNYFILHGGFRDLGSTTSYLNDSWLFDITSY
Sbjct: 172 LLDCTTREWTKVEQKNGPSARSGHRITVWKNYFILHGGFRDLGSTTSYLNDSWLFDITSY 231

Query: 232 KWRQIEFPPNHPVPDARSGHSLIPTQEGAVLWGGYCKVKAGKGLQKGKILGDCWYLKMKA 291
           KWRQIEFPPNHPVPDARSGHSLIPTQEGAVLWGGYCKVKAGKGLQKGKILGDCWYLKMKA
Sbjct: 232 KWRQIEFPPNHPVPDARSGHSLIPTQEGAVLWGGYCKVKAGKGLQKGKILGDCWYLKMKA 291

Query: 292 DPSAVRWERRKKQGFQPSPRVGCSMVHHKGRGILFGGVYDFEETEESLDSIFYNDLFSYQ 351
           DPSAVRWERRKKQGFQPSPRVGCSMVHHKGRGILFGGVYDFEETEESLDSIFYNDLFSYQ
Sbjct: 292 DPSAVRWERRKKQGFQPSPRVGCSMVHHKGRGILFGGVYDFEETEESLDSIFYNDLFSYQ 351

Query: 352 IESNRWYALQLRSQRKKVVRLNNKSSXXXXXXXXXXXXXXXXXANLKDDDEDANELSNGL 411
           IESNRWYALQLRSQRKKVVRLNNKSS                 ANLKDDDEDANELSNGL
Sbjct: 352 IESNRWYALQLRSQRKKVVRLNNKSSKEKELELQNILNEILEKANLKDDDEDANELSNGL 411

Query: 412 GXXXXXXXXXXXXXXXXYIVRNQLPHHRFNASTTVVDDTLFIYGGVWELGEKDYSIDSMY 471
           G                YIVRNQLPHHRFNASTTVVDDTLFIYGGVWELGEKDYSIDSMY
Sbjct: 412 GSDSDSDDESEKVSKKEYIVRNQLPHHRFNASTTVVDDTLFIYGGVWELGEKDYSIDSMY 471

Query: 472 SIDLNKLDGVTVYWENLHDIEKAKELGAINSXXXXXXXXXXXXXXXXXTVDQKLVXXXXX 531
           SIDLNKLDGVTVYWENLHDIEKAKELGAINS                 TVDQKLV     
Sbjct: 472 SIDLNKLDGVTVYWENLHDIEKAKELGAINSDEEDEEDEDDEDDDEEETVDQKLVAEEEE 531

Query: 532 XXXXXXXXXXXXXXXXRPWLPHPKAFESLRNFYVRTGASFLEWAISNNKHTRGKHLKTKS 591
                           RPWLPHPKAFESLRNFYVRTGASFLEWAISNNKHTRGKHLKTKS
Sbjct: 532 EEEEIEDADDMEIPDPRPWLPHPKAFESLRNFYVRTGASFLEWAISNNKHTRGKHLKTKS 591

Query: 592 FELCQDRWWERRDQVRIXXXXXXXXXXXXXXXXXDTTKSTKRR 634
           FELCQDRWWERRDQVRI                 DTTKSTKRR
Sbjct: 592 FELCQDRWWERRDQVRIEEDKLEELGGVGEVIEKDTTKSTKRR 634

>Kpol_1045.77 s1045 (180708..182660) [1953 bp, 650 aa] {ON}
           (180710..182662) [1953 nt, 651 aa]
          Length = 650

 Score =  784 bits (2024), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 387/613 (63%), Positives = 438/613 (71%), Gaps = 43/613 (7%)

Query: 52  VLANFKKEQEQFEQINVESVDKPTRRINSCMIANPNHGKKELLLFGGENTSQEQGVTHFY 111
           VLANFKKEQE FEQIN+ESV++P+RRIN CMI NPNHGK EL+LFGGE+T+++   T F+
Sbjct: 51  VLANFKKEQELFEQINIESVERPSRRINPCMIENPNHGKSELILFGGESTNKDTSTTQFF 110

Query: 112 NDLYTFTPDNDLWKKITSQNXXXXXXXXXXXXXXXGIALLHGGEFSSPKQNTFYHYSDTW 171
           NDLY++TP+ND W++ TS+N               G+AL+HGGEFSSPKQNTFYHYSDTW
Sbjct: 111 NDLYSYTPENDQWRRYTSKNSPMPRSSAAMAAHPSGVALIHGGEFSSPKQNTFYHYSDTW 170

Query: 172 LLDCTTREWTKVEQKNGPSARSGHRITVWKNYFILHGGFRDLGSTTSYLNDSWLFDITSY 231
           LLDC+T+EWTKVEQKNGPSARSGHRI++WKNYF+LHGGFRDLG++T+YLND WLFDIT+Y
Sbjct: 171 LLDCSTKEWTKVEQKNGPSARSGHRISIWKNYFMLHGGFRDLGTSTTYLNDCWLFDITNY 230

Query: 232 KWRQIEFPPNHPVPDARSGHSLIPTQEGAVLWGGYCKVKAGKGLQKGKILGDCWYLKMKA 291
           KW+QIEFPPNHP+PDARSGHS IPTQEGAVLWGGYCKVKAGKGLQKGKIL DCWYLKMKA
Sbjct: 231 KWKQIEFPPNHPIPDARSGHSFIPTQEGAVLWGGYCKVKAGKGLQKGKILTDCWYLKMKA 290

Query: 292 DPSAVRWERRKKQGFQPSPRVGCSMVHHKGRGILFGGVYDFEETEESLDSIFYNDLFSYQ 351
           DP+A+RWERRKKQGFQPSPRVGCSMVHHKGRGILFGGVYDFEETEESLDS+FYNDLFSYQ
Sbjct: 291 DPTAIRWERRKKQGFQPSPRVGCSMVHHKGRGILFGGVYDFEETEESLDSMFYNDLFSYQ 350

Query: 352 IESNRWYALQLRSQRKKVVRLNNKSSXXXXXXXXXXXXXXXXXANLKD------------ 399
           IE NRW+ALQLR QRKKVVRLNNKSS                 ANL D            
Sbjct: 351 IEINRWFALQLRPQRKKVVRLNNKSSKDKEKELQDLLNQILEKANLNDKDDKDQEDEDAK 410

Query: 400 -------------DDEDANELSNGLGXXXXXXXXXXXXXXXXYIVRNQLPHHRFNASTTV 446
                         D DA+++ +                   Y V  QLPH RFNA+ TV
Sbjct: 411 AIETELDRADHDTSDSDADDVEDA-------------KEKKEYKVLTQLPHPRFNATMTV 457

Query: 447 VDDTLFIYGGVWELGEKDYSIDSMYSIDLNKLDGVTVYWENLHDIEKAKELGAI--NSXX 504
           V+DTLFIYGGVWELGEKDY+IDS YSIDLN+ DGVTV WE+L +IE AKE G +  +   
Sbjct: 458 VNDTLFIYGGVWELGEKDYTIDSFYSIDLNRTDGVTVLWEDLSEIEAAKEAGIVDSDEED 517

Query: 505 XXXXXXXXXXXXXXXTVDQKLVXXXXXXXXXXXXXXXXXXXXXR---PWLPHPKAFESLR 561
                           +DQKLV                         PWLPHPK FESLR
Sbjct: 518 DEFGDSDDEDDGEEEIMDQKLVAEEEEEEEEEEEEEQVDEMEIPDPCPWLPHPKPFESLR 577

Query: 562 NFYVRTGASFLEWAISNNKHTRGKHLKTKSFELCQDRWWERRDQVRIXXXXXXXXXXXXX 621
            FYVRTGA+FLEWAISNN+  RGKHLK KSF+LCQDRWW+RRDQVRI             
Sbjct: 578 VFYVRTGATFLEWAISNNRDARGKHLKKKSFDLCQDRWWQRRDQVRIEEDKMEELGGIGE 637

Query: 622 XXXXDTTKSTKRR 634
               DT+KSTKRR
Sbjct: 638 VIEKDTSKSTKRR 650

>TBLA0G01110 Chr7 complement(283630..285546) [1917 bp, 638 aa] {ON}
           Anc_6.10 YPL263C
          Length = 638

 Score =  760 bits (1962), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 372/590 (63%), Positives = 424/590 (71%), Gaps = 10/590 (1%)

Query: 52  VLANFKKEQEQFEQINVESVDKPTRRINSCMIANPNHGKKELLLFGGENTSQEQGVTHFY 111
           +L NFKK+QEQFE+IN+E+V KPT+RINSCMI+NP HGK EL+LFGGENTS     T FY
Sbjct: 52  ILENFKKQQEQFEKINIETVSKPTKRINSCMISNPIHGKNELILFGGENTST---TTTFY 108

Query: 112 NDLYTFTPDNDLWKKITSQNXXXXXXXXXXXXXXXGIALLHGGEFSSPKQNTFYHYSDTW 171
           NDL+T+ P+ND WKK TSQN               GIALLHGGEFSSPKQNTFYHYSDTW
Sbjct: 109 NDLFTYNPENDQWKKYTSQNSPMPRSSSAMISHPTGIALLHGGEFSSPKQNTFYHYSDTW 168

Query: 172 LLDCTTREWTKVEQKNGPSARSGHRITVWKNYFILHGGFRDLGSTTSYLNDSWLFDITSY 231
           LLDC T+EW+KVE KNGPSARSGHR+TVWKN+ ILHGGFRDLG++T+YL D WLFD+T Y
Sbjct: 169 LLDCATKEWSKVENKNGPSARSGHRMTVWKNFIILHGGFRDLGTSTTYLKDLWLFDVTKY 228

Query: 232 KWRQIEFPPNHPVPDARSGHSLIPTQEGAVLWGGYCKVKAGKGLQKGKILGDCWYLKMKA 291
           KW Q+EFPPNH +PDARSGHSLIPTQ+GA+LWGGYCKVKAGKGLQKGKIL DCWYLKMK+
Sbjct: 229 KWTQVEFPPNHAIPDARSGHSLIPTQDGALLWGGYCKVKAGKGLQKGKILSDCWYLKMKS 288

Query: 292 DPSAVRWERRKKQGFQPSPRVGCSMVHHKGRGILFGGVYDFEETEESLDSIFYNDLFSYQ 351
           D S +RWERRKKQGFQPSPRVGCSMVHHKGRGILFGGV+DFEETEESLDS+FYNDLF+YQ
Sbjct: 289 DVSGIRWERRKKQGFQPSPRVGCSMVHHKGRGILFGGVFDFEETEESLDSLFYNDLFTYQ 348

Query: 352 IESNRWYALQLRSQRKKVVRLNNKSSXXXXXXXXXXXXXXXXXANLKDDD-EDANELSNG 410
           IE NRW++L +RSQRKK +++  K++                  NL DDD ED N +   
Sbjct: 349 IEINRWFSLSMRSQRKKTIKIGPKTTKDKEKELQDILNSILKKNNLTDDDSEDPNAIEEE 408

Query: 411 L----GXXXXXXXXXXXXXXXXYIVRNQLPHHRFNASTTVVDDTLFIYGGVWELGEKDYS 466
           L                     Y V NQLPH RFNA+T VV+DTL+I+GG WELGEKDYS
Sbjct: 409 LKINDDESNSEDESKDGQVTKQYEVMNQLPHVRFNATTAVVNDTLYIFGGSWELGEKDYS 468

Query: 467 IDSMYSIDLNKLDGVTVYWENLHDIEKAKELGA-INSXXXXXXXXXXXXXXXXXTVDQKL 525
           IDS YSIDLNKLDGVTVYWE++ +IE AKELG   +                   VDQKL
Sbjct: 469 IDSFYSIDLNKLDGVTVYWEDMEEIEAAKELGEQFSDEEDEDDEEEDEDDGEEEIVDQKL 528

Query: 526 VXXXXXXXXXXXXXXXXXXX-XXRPWLPHPKAFESLRNFYVRTGASFLEWAISNNKHTRG 584
           V                      RPWLPHPK FE+LR FYVRTGA+FLEWAISNN+ ++G
Sbjct: 529 VAEEDEEEEEIEADEDEMEIPDPRPWLPHPKPFETLRAFYVRTGATFLEWAISNNRDSKG 588

Query: 585 KHLKTKSFELCQDRWWERRDQVRIXXXXXXXXXXXXXXXXXDTTKSTKRR 634
           KHLK KSFEL +DRWWERRDQVRI                 DTT+  KRR
Sbjct: 589 KHLKKKSFELTEDRWWERRDQVRIEEDKMEELGGIENIVERDTTQVNKRR 638

>SAKL0E00880g Chr5 complement(66646..68556) [1911 bp, 636 aa] {ON}
           similar to uniprot|Q08979 Saccharomyces cerevisiae
           YPL263C KEL3 Cytoplasmic protein of unknown function
          Length = 636

 Score =  755 bits (1950), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 362/586 (61%), Positives = 422/586 (72%), Gaps = 5/586 (0%)

Query: 53  LANFKKEQEQFEQINVESVDKPTRRINSCMIANPNHGKKELLLFGGENTSQEQGVTHFYN 112
           LANFK+EQE+FE++ V +VD+PTRRINS M+ANP HGK+ELLLFGGENT+     T FYN
Sbjct: 52  LANFKREQEKFEEVVVSTVDRPTRRINSSMVANPLHGKRELLLFGGENTNSTNSTTAFYN 111

Query: 113 DLYTFTPDNDLWKKITSQNXXXXXXXXXXXXXXXGIALLHGGEFSSPKQNTFYHYSDTWL 172
           DL+T++ D D W+KI+SQN               G+ L+HGGEFSSPKQNTFYHYSDTWL
Sbjct: 112 DLFTYSLDGDQWRKISSQNSPMPRSSAAIAAHPSGVVLIHGGEFSSPKQNTFYHYSDTWL 171

Query: 173 LDCTTREWTKVEQKNGPSARSGHRITVWKNYFILHGGFRDLGSTTSYLNDSWLFDITSYK 232
           LDC T+EWTK+EQKNGP+ARSGHR+TVWKNYFILHGGFRDLG+ T+YL+D WLFDIT+YK
Sbjct: 172 LDCNTKEWTKIEQKNGPTARSGHRLTVWKNYFILHGGFRDLGTMTTYLSDCWLFDITTYK 231

Query: 233 WRQIEFPPNHPVPDARSGHSLIPTQEGAVLWGGYCKVKAGKGLQKGKILGDCWYLKMKAD 292
           W+Q++FPPNHP+PDARSGHSL+PT +GAVLWGGYCKVKAGKGLQKGKIL DCWYLKMK+D
Sbjct: 232 WKQVDFPPNHPIPDARSGHSLVPTPDGAVLWGGYCKVKAGKGLQKGKILTDCWYLKMKSD 291

Query: 293 PSAVRWERRKKQGFQPSPRVGCSMVHHKGRGILFGGVYDFEETEESLDSIFYNDLFSYQI 352
             A+RWERRKKQGFQPSPRVGCSMVHHKGRGILFGGV+DFEETEESL+S+FYNDLF++QI
Sbjct: 292 IGAIRWERRKKQGFQPSPRVGCSMVHHKGRGILFGGVFDFEETEESLESMFYNDLFTFQI 351

Query: 353 ESNRWYALQLRSQRKKVVRLNNKSSXXXXXXXXXXXXXXXXXANLKDDD---EDANELSN 409
           E+NRWY+  LR QR K  +  +K++                 ANL DD+   E   ++  
Sbjct: 352 ETNRWYSASLRPQR-KAAKATSKNNRNKDKELEDILNQILEKANLNDDENEKETIGDVLK 410

Query: 410 GLGXXXXXXXXXXXXXXXXYIVRNQLPHHRFNASTTVVDDTLFIYGGVWELGEKDYSIDS 469
            L                 Y +R QLPH RFNAST VVDDTLFI+GGVWE+GEKDYSIDS
Sbjct: 411 ELDEEDSDSAEELNSEKKEYPIRIQLPHPRFNASTAVVDDTLFIFGGVWEIGEKDYSIDS 470

Query: 470 MYSIDLNKLDGVTVYWENLHDIEKAKELGAINSXXXXXXXXXXXXXXXXXTV-DQKLVXX 528
            Y+IDLN+LDG+ +YWE+L DIE AKELG                      + DQKLV  
Sbjct: 471 FYAIDLNRLDGIKIYWEDLRDIEMAKELGDEEEDFEDNEEDDEEDDDDEEEITDQKLVAE 530

Query: 529 XXXXXXXXXXXXXXXXXXXRPWLPHPKAFESLRNFYVRTGASFLEWAISNNKHTRGKHLK 588
                              RPWLPHPK FE+LR FYVRTGA FLEWAIS+N+  RGKHLK
Sbjct: 531 DDDEEEEEEDEYEPEIPDPRPWLPHPKPFETLRGFYVRTGADFLEWAISSNRDARGKHLK 590

Query: 589 TKSFELCQDRWWERRDQVRIXXXXXXXXXXXXXXXXXDTTKSTKRR 634
            KSF+LCQDRWWERRDQVRI                 DT+KS KRR
Sbjct: 591 KKSFDLCQDRWWERRDQVRIEEDKLEELGGIGEVVEKDTSKSKKRR 636

>TDEL0G04610 Chr7 (840098..841999) [1902 bp, 633 aa] {ON} Anc_6.10
           YPL263C
          Length = 633

 Score =  748 bits (1931), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 358/583 (61%), Positives = 419/583 (71%), Gaps = 1/583 (0%)

Query: 52  VLANFKKEQEQFEQINVESVDKPTRRINSCMIANPNHGKKELLLFGGENTSQEQGVTHFY 111
           VLANFKKEQEQFE++ VE++++P+RRIN  MIANP HGK EL++FGGE+T Q    THF+
Sbjct: 52  VLANFKKEQEQFEKVVVENIERPSRRINPSMIANPIHGKSELIMFGGEHTIQSTSTTHFF 111

Query: 112 NDLYTFTPDNDLWKKITSQNXXXXXXXXXXXXXXXGIALLHGGEFSSPKQNTFYHYSDTW 171
           NDL  F+PDN+ WK+I+SQN               G+ALLHGGEFSSPKQNTFYHYSDTW
Sbjct: 112 NDLVVFSPDNEQWKRISSQNSPMPRSSAAMVGHPSGVALLHGGEFSSPKQNTFYHYSDTW 171

Query: 172 LLDCTTREWTKVEQKNGPSARSGHRITVWKNYFILHGGFRDLGSTTSYLNDSWLFDITSY 231
           LLDC T+EWTK+EQKNGPSARSGHR+ VWKN+ ILHGGFRDLG++T+YLND WLFDIT+Y
Sbjct: 172 LLDCATKEWTKIEQKNGPSARSGHRMAVWKNFIILHGGFRDLGTSTTYLNDCWLFDITTY 231

Query: 232 KWRQIEFPPNHPVPDARSGHSLIPTQEGAVLWGGYCKVKAGKGLQKGKILGDCWYLKMKA 291
           KW+Q+EFP NHPVPDARSGHSLI  QEGA+LWGGYCKVKAGKGLQKGKIL DCWYLKM +
Sbjct: 232 KWKQVEFPQNHPVPDARSGHSLIADQEGAILWGGYCKVKAGKGLQKGKILTDCWYLKMSS 291

Query: 292 DPSAVRWERRKKQGFQPSPRVGCSMVHHKGRGILFGGVYDFEETEESLDSIFYNDLFSYQ 351
           + SA+RW+R+K+QGFQPSPRVGCSMV HKGRG+LFGGVYDFEETEESL+S FYND+F+YQ
Sbjct: 292 NTSAIRWDRKKRQGFQPSPRVGCSMVPHKGRGVLFGGVYDFEETEESLESNFYNDVFTYQ 351

Query: 352 IESNRWYALQLRSQRKKVVRLNNKSSXXXXXXXXXXXXXXXXXANLKDDDEDANELSNGL 411
           I  NRWY+L LR QRKK V+LNN+S+                 A L D  E+    +   
Sbjct: 352 INMNRWYSLSLRPQRKKQVKLNNRSTKDQEKELEDLLNKILRNAQLDDQGEEEEIDAAEE 411

Query: 412 GXXXXXXXXXXXXXXXXYIVRNQLPHHRFNASTTVVDDTLFIYGGVWELGEKDYSIDSMY 471
                            +++ N+LPH RFNA+T VVDDTLFI+GGVWE GEKDYSIDS Y
Sbjct: 412 STAVEEDSDESESLDKEHVIMNELPHPRFNAATAVVDDTLFIFGGVWEFGEKDYSIDSFY 471

Query: 472 SIDLNKLDGVTVYWENLHDIEKAKELGAINSXXXXXXXXXXXXXXXXXTVDQKLVXXXXX 531
            IDLNK DGVTVYWE+L  +E AK+    +                   VDQKLV     
Sbjct: 472 GIDLNKADGVTVYWEDLTALENAKDE-DDSDEDEGEEDDDDEEDSEEEQVDQKLVAEDED 530

Query: 532 XXXXXXXXXXXXXXXXRPWLPHPKAFESLRNFYVRTGASFLEWAISNNKHTRGKHLKTKS 591
                           RPWLPHPKAFESLR+FYVRTGA+FLEWAISNN+H +GKHLKTKS
Sbjct: 531 EEEEEFEEEEMEIPDPRPWLPHPKAFESLRSFYVRTGATFLEWAISNNRHVKGKHLKTKS 590

Query: 592 FELCQDRWWERRDQVRIXXXXXXXXXXXXXXXXXDTTKSTKRR 634
           FE+C+ RWWERRDQVR+                 DTTK+ KRR
Sbjct: 591 FEICESRWWERRDQVRLEEDKLEELGGVGEIIERDTTKTKKRR 633

>ZYRO0F00484g Chr6 complement(47424..49355) [1932 bp, 643 aa] {ON}
           similar to uniprot|Q08979 Saccharomyces cerevisiae
           YPL263C KEL3 Cytoplasmic protein of unknown function
          Length = 643

 Score =  729 bits (1882), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 359/600 (59%), Positives = 419/600 (69%), Gaps = 26/600 (4%)

Query: 52  VLANFKKEQEQFEQINVESVDKPTRRINSCMIANPNHGKKELLLFGGENTSQEQGVTHFY 111
           VLA+FKKEQEQFE++ VESVDKP+ RIN C+++NP HGKKEL+LFGGE T+Q    THFY
Sbjct: 53  VLASFKKEQEQFEKVVVESVDKPSARINPCLVSNPAHGKKELILFGGEYTNQSNSTTHFY 112

Query: 112 NDLYTFTPDNDLWKKITSQNXXXXXXXXXXXXXXXGIALLHGGEFSSPKQNTFYHYSDTW 171
           N+L+TFTPDND W+KI+SQN               GIALLHGGEFSSPKQNTFYHYSDTW
Sbjct: 113 NELFTFTPDNDQWRKISSQNAPMPRSSAAMAAHPSGIALLHGGEFSSPKQNTFYHYSDTW 172

Query: 172 LLDCTTREWTKVEQKNGPSARSGHRITVWKNYFILHGGFRDLGSTTSYLNDSWLFDITSY 231
           LLDCTT+EWTK++QKNGP++RSGHR+TVWKN+FI++GGFRDLG++T+YLND WLFDIT++
Sbjct: 173 LLDCTTKEWTKLDQKNGPASRSGHRMTVWKNFFIMYGGFRDLGTSTTYLNDCWLFDITTH 232

Query: 232 KWRQIEFPPNHPVPDARSGHSLIPTQEGAVLWGGYCKVKAGKGLQKGKILGDCWYLKMKA 291
           KW Q+EFP NH +PDARSGHS IP QEGA+LWGGYCKVKAGKGLQKGKIL DCWYLKM +
Sbjct: 233 KWTQVEFPRNHLIPDARSGHSFIPDQEGAILWGGYCKVKAGKGLQKGKILTDCWYLKMNS 292

Query: 292 DPSAVRWERRKKQGFQPSPRVGCSMVHHKGRGILFGGVYDFEETEESLDSIFYNDLFSYQ 351
            PSA+RWERRKKQGFQPSPRVGCSMV HKGRG+LFGGVYDFEETEESLDS FYNDLF++Q
Sbjct: 293 TPSAIRWERRKKQGFQPSPRVGCSMVPHKGRGVLFGGVYDFEETEESLDSNFYNDLFTFQ 352

Query: 352 IESNRWYALQLRSQRKKVVRLNNKSSXXXXXXXXXXXXXXXXXANL-------------K 398
           I++NRWY+L LR QRKK V+++  S+                 A L             +
Sbjct: 353 IKTNRWYSLSLRPQRKKQVKISKSSTKDQEKELQDHLNRILQQAQLYDQDEDKEDDKAIR 412

Query: 399 DDDEDANELSNGLGXXXXXXXXXXXXXXXXYIVRNQLPHHRFNASTTVVDDTLFIYGGVW 458
           +  ED N+  +                   + +  QLPH RFN S  VV+DTLFIYGG+W
Sbjct: 413 EQFEDENQSGD---------EDEEESTKKQHTISTQLPHPRFNTSLAVVNDTLFIYGGLW 463

Query: 459 ELGEKDYSIDSMYSIDLNKLDGVTVYWENLHDIEKAKEL---GAINSXXXXXXXXXXXXX 515
           ELG+KDY+IDS Y IDLNK+DGVTVYWENL +IEKAK+L   G+                
Sbjct: 464 ELGDKDYNIDSFYGIDLNKVDGVTVYWENLAEIEKAKKLAEQGSDEDEDDEDEEDEDEDD 523

Query: 516 XXXXTVDQKLVXXXXXXXXXXXXXXXXXXX-XXRPWLPHPKAFESLRNFYVRTGASFLEW 574
                 DQ LV                      RPWLPHPKAFESLR FYVR G  FLEW
Sbjct: 524 DEEEVRDQVLVAEEEDAEEDEEVEEEEMEIPDPRPWLPHPKAFESLRAFYVRAGPQFLEW 583

Query: 575 AISNNKHTRGKHLKTKSFELCQDRWWERRDQVRIXXXXXXXXXXXXXXXXXDTTKSTKRR 634
           AISNN+  RGKHLK KSF+LCQDRWWERRDQVRI                 +  + TKRR
Sbjct: 584 AISNNRDARGKHLKQKSFDLCQDRWWERRDQVRIEEDKMEELGGVGDIVERNPAQKTKRR 643

>Kwal_56.22350 s56 complement(60828..62804) [1977 bp, 658 aa] {ON}
           YPL263C (KEL3) - Kelch-repeat protein, similar to Kel1
           and Kel2 [contig 186] FULL
          Length = 658

 Score =  729 bits (1882), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 353/585 (60%), Positives = 426/585 (72%), Gaps = 5/585 (0%)

Query: 52  VLANFKKEQEQFEQINVESVDKPTRRINSCMIANPNHGKKELLLFGGENTSQEQGVTHFY 111
           VLANFKKEQE F+++ V  V++P++RINSCM+ANP HGK+ELL+FGGE+T+    +T FY
Sbjct: 77  VLANFKKEQELFQEVLVTPVERPSQRINSCMVANPIHGKRELLIFGGEHTNSTNSLTAFY 136

Query: 112 NDLYTFTPDNDLWKKITSQNXXXXXXXXXXXXXXXGIALLHGGEFSSPKQNTFYHYSDTW 171
           N+L+T++ D+D W+KITS+N               G+AL+HGGEFSSPKQNTFYHYSDTW
Sbjct: 137 NELFTYSLDSDQWRKITSRNSPMPRSSAAAAAHSSGVALIHGGEFSSPKQNTFYHYSDTW 196

Query: 172 LLDCTTREWTKVEQKNGPSARSGHRITVWKNYFILHGGFRDLGSTTSYLNDSWLFDITSY 231
           LLDCTT+EWTK+EQKNGPSARSGHR+T+WKN+FILHGGFRDLG++T+YLND W+FDIT+Y
Sbjct: 197 LLDCTTKEWTKMEQKNGPSARSGHRMTIWKNFFILHGGFRDLGTSTTYLNDLWIFDITTY 256

Query: 232 KWRQIEFPPNHPVPDARSGHSLIPTQEGAVLWGGYCKVKAGKGLQKGKILGDCWYLKMKA 291
           KW+Q+EFPPNHP+PDARSGHS+IPTQ+GAVLWGGYCKVKAGKGLQKGK L DCWYLKMK+
Sbjct: 257 KWKQVEFPPNHPIPDARSGHSIIPTQDGAVLWGGYCKVKAGKGLQKGKTLTDCWYLKMKS 316

Query: 292 DPSAVRWERRKKQGFQPSPRVGCSMVHHKGRGILFGGVYDFEETEESLDSIFYNDLFSYQ 351
           D SA+RWERRKKQGFQPSPRVGCSMVHHKGRG+LFGGVYDFEETEE L S F+NDLFSYQ
Sbjct: 317 DVSAIRWERRKKQGFQPSPRVGCSMVHHKGRGMLFGGVYDFEETEEGLASEFFNDLFSYQ 376

Query: 352 IESNRWYALQLRSQRKKVVRLNNKSSXXXXXXXXXXXXXXXXXANL-KDDDEDANELSNG 410
           +E+NRWY++++R Q+KK V + ++++                 ANL  D D+D NE+   
Sbjct: 377 VEANRWYSVKMRPQKKKTVAI-SRNNRNKDEELENILNDILQQANLADDTDDDDNEIKRE 435

Query: 411 LGXXXXXXXXXXXXXXXXYIVRNQLPHHRFNASTTVVDDTLFIYGGVWELGEKDYSIDSM 470
           L                 Y V  QLPH RFNA+T VVDD LFI+GGVWE GE+D+SIDS 
Sbjct: 436 L--QRIDEEEALENSRKQYEVVGQLPHPRFNATTAVVDDFLFIFGGVWEFGERDFSIDSF 493

Query: 471 YSIDLNKLDGVTVYWENLHDIEKAKELGAINSXXXXXXXXXXXXXXXXXTVDQKLVXXXX 530
           YSIDLNKLDGV VYWENL ++EKAK LG  +                  T DQKLV    
Sbjct: 494 YSIDLNKLDGVKVYWENLSELEKAKALGEDDEEEFDDDEDDDDDDEEEETADQKLVAEDE 553

Query: 531 XXXXXXXXXXXXXXX-XXRPWLPHPKAFESLRNFYVRTGASFLEWAISNNKHTRGKHLKT 589
                             RPWLPHPK FE+LR FY+RTGA FL+WAISNN+  +GKHLK 
Sbjct: 554 EEEEEEEEEEDEPEIPDLRPWLPHPKPFETLRAFYIRTGAEFLKWAISNNRDAKGKHLKK 613

Query: 590 KSFELCQDRWWERRDQVRIXXXXXXXXXXXXXXXXXDTTKSTKRR 634
           +SF+LCQDRWWERR+Q+RI                 D  ++ KRR
Sbjct: 614 QSFDLCQDRWWERREQIRIEEDKLEELGGVENVVERDPAQTMKRR 658

>NCAS0D02190 Chr4 complement(408069..410006) [1938 bp, 645 aa] {ON}
           Anc_6.10
          Length = 645

 Score =  727 bits (1876), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 365/609 (59%), Positives = 415/609 (68%), Gaps = 42/609 (6%)

Query: 52  VLANFKKEQEQFEQINVESVDKPTRRINSCMIANPNHGKKELLLFGGENTSQEQGVTHFY 111
           VLANFK +QEQFE +NVES+ KP +R+NSCMI  PNH KKELL+FGGE T+ E  +THFY
Sbjct: 52  VLANFKLQQEQFEHVNVESISKPAQRLNSCMITTPNHSKKELLIFGGEFTNPETSMTHFY 111

Query: 112 NDLYTFTPDNDLWKKITSQNXXXXXXXXXXXXXXXGIALLHGGEFSSPKQNTFYHYSDTW 171
           N+L T++PDN  W+KITSQN               GIALLHGGEFSSPKQNTFYHYSDTW
Sbjct: 112 NELITYSPDNGQWRKITSQNSPMPRSSAAMCAHPSGIALLHGGEFSSPKQNTFYHYSDTW 171

Query: 172 LLDCTTREWTKVEQKNGPSARSGHRITVWKNYFILHGGFRDLGSTTSYLNDSWLFDITSY 231
           LLD  T+EWTK++   GP  RSGHRIT+WKNYFIL GGF+DLG +TSY ND W FDIT+Y
Sbjct: 172 LLDTHTKEWTKMDSAKGPPGRSGHRITIWKNYFILSGGFKDLGHSTSYFNDCWCFDITTY 231

Query: 232 KWRQIEFPPNHPVPDARSGHSLIPTQEGAVLWGGYCKVKAGKGLQKGKILGDCWYLKMKA 291
           KW+QIEFPPNHP+PDARSGHS IPT+EG +LWGGYCKVKAGKGLQKGKIL DCWYLKMK+
Sbjct: 232 KWKQIEFPPNHPIPDARSGHSWIPTEEGCILWGGYCKVKAGKGLQKGKILNDCWYLKMKS 291

Query: 292 DPSAVRWERRKKQGFQPSPRVGCSMVHHKGRGILFGGVYDFEETEESLDSIFYNDLFSYQ 351
           D S VRWERRKKQGFQPSPRVGCSM +HKGRGILFGGVYDFEETEESL+SIFYNDLFSY 
Sbjct: 292 DLSQVRWERRKKQGFQPSPRVGCSMAYHKGRGILFGGVYDFEETEESLESIFYNDLFSYN 351

Query: 352 IESNRWYALQLRSQR--KKVVR-LNNKSSXXXXXXXXXXXXXXXXXANLK---------- 398
           +ESNRW++L LR  +  KKV +  NNKSS                  NLK          
Sbjct: 352 VESNRWFSLSLRKAQKFKKVAKSSNNKSSKEKEKELQDLLNQILEKNNLKDDDDDDEIST 411

Query: 399 -----------DDDEDANELSNGLGXXXXXXXXXXXXXXXXYIVRNQLPHHRFNASTTVV 447
                       DDED  E S                      V +QLPH RFNA+TTVV
Sbjct: 412 GTETETETAANSDDEDNKEHSKS----------------AQVTVMSQLPHPRFNAATTVV 455

Query: 448 DDTLFIYGGVWELGEKDYSIDSMYSIDLNKLDGVTVYWENLHDIEKAKELGAINSXXXXX 507
           DD+LFIYGG+WE+GEKDY+IDS+YSIDLNKLDGV+ YWE+L +IEKAKE+G  +S     
Sbjct: 456 DDSLFIYGGIWEMGEKDYAIDSLYSIDLNKLDGVSCYWEDLQEIEKAKEIGEQDSDEDEE 515

Query: 508 XXXXXXXXXXXXTVDQKLVXXXXXXXXXXXXXXXXXXXX--XRPWLPHPKAFESLRNFYV 565
                         D+KLV                       RPWLPHPK FESLR FY+
Sbjct: 516 EEDDEEDDDEEEIEDKKLVAEEDDEEEEEEEEEFEEMEIPDLRPWLPHPKPFESLRAFYI 575

Query: 566 RTGASFLEWAISNNKHTRGKHLKTKSFELCQDRWWERRDQVRIXXXXXXXXXXXXXXXXX 625
           R GA+FLEWAISNNKH RGKHLK KSF+LC+DRWWERRDQVRI                 
Sbjct: 576 REGAAFLEWAISNNKHVRGKHLKKKSFDLCEDRWWERRDQVRIEEDKLEELGVVGNVIEK 635

Query: 626 DTTKSTKRR 634
           DT+  T +R
Sbjct: 636 DTSVPTSKR 644

>KLLA0D00836g Chr4 complement(78202..80124) [1923 bp, 640 aa] {ON}
           similar to uniprot|Q08979 Saccharomyces cerevisiae
           YPL263C KEL3 Cytoplasmic protein of unknown function
          Length = 640

 Score =  716 bits (1849), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 345/590 (58%), Positives = 415/590 (70%), Gaps = 8/590 (1%)

Query: 53  LANFKKEQEQFEQINVESVDKPTRRINSCMIANPNHGKKELLLFGGENTSQEQGVTHFYN 112
           LANFK+EQE FE+INVE+VD+P +RIN CM  NP HGK+EL++FGGE+T+QE G THFYN
Sbjct: 51  LANFKREQENFEKINVENVDRPDQRINPCMFVNPAHGKRELMMFGGESTTQETGTTHFYN 110

Query: 113 DLYTFTPDNDLWKKITSQNXXXXXXXXXXXXXXXGIALLHGGEFSSPKQNTFYHYSDTWL 172
           DL+ ++ D D WK+ TSQN               G+AL+HGGEFSSPKQNTFYHYSD+WL
Sbjct: 111 DLFVYSLDTDTWKRYTSQNSPMPRSSAAVASHPTGVALIHGGEFSSPKQNTFYHYSDSWL 170

Query: 173 LDCTTREWTKVEQKNGPSARSGHRITVWKNYFILHGGFRDLGSTTSYLNDSWLFDITSYK 232
            DC+++EWTKVEQKNGPSARSGHR+ +WKN+ ILHGGFRDLG++T+YLND W+FDIT+YK
Sbjct: 171 FDCSSKEWTKVEQKNGPSARSGHRMAIWKNFIILHGGFRDLGTSTTYLNDLWVFDITNYK 230

Query: 233 WRQIEFPPNHPVPDARSGHSLIPTQEGAVLWGGYCKVKAGKGLQKGKILGDCWYLKMKAD 292
           W+Q+E P NHP+PDARSGHSLI T EGAVL+GGY KVKAGKGLQKGKIL DCWYLKMK+D
Sbjct: 231 WKQVELPANHPIPDARSGHSLISTAEGAVLYGGYTKVKAGKGLQKGKILSDCWYLKMKSD 290

Query: 293 PSAVRWERRKKQGFQPSPRVGCSMVHHKGRGILFGGVYDFEETEESLDSIFYNDLFSYQI 352
             ++RWERRKKQG QPSPRVGCSMVHHKGRG+LFGGVYDFEETEESL SIFYN+L++YQI
Sbjct: 291 LGSIRWERRKKQGSQPSPRVGCSMVHHKGRGVLFGGVYDFEETEESLRSIFYNELYTYQI 350

Query: 353 ESNRWYALQLRSQRKKVVRLNNKSSXXXXXXXXXXXXXXXXXANLKDDDED------ANE 406
           E+NRWYA+ LR QRKK   + +KS+                 ANL+D ++D        +
Sbjct: 351 ENNRWYAMSLRPQRKKKNFVQSKSNRNKDKELEDILNQILDKANLRDAEDDDESKVIEEQ 410

Query: 407 LSNGLGXXXXXXXXXXXXXXXXYIVRNQLPHHRFNASTTVVDDTLFIYGGVWELGEKDYS 466
           L+                    Y   + LPH RFNA+T VVDDTLFI+GG  E+GEKDY 
Sbjct: 411 LNQLDLIDFDDDDESDKKSAKSYETMSTLPHARFNAATAVVDDTLFIFGGTVEIGEKDYP 470

Query: 467 IDSMYSIDLNKLDGVTVYWENLHDIEKAKELGA-INSXXXXXXXXXXXXXXXXXTVDQKL 525
           IDS YSID+NKLDGV VYWE L ++E+A++LG   +                   VD KL
Sbjct: 471 IDSFYSIDMNKLDGVKVYWEELKEVERAEKLGEQDSDDEFGDEDDDDEDDGEEEIVDSKL 530

Query: 526 VXXXXXXXXXXXXXXXXXXX-XXRPWLPHPKAFESLRNFYVRTGASFLEWAISNNKHTRG 584
                                  RPWLPHPKAFE+LR FYVRTG +FLE AIS+N+ ++G
Sbjct: 531 EAEDEEEEEEEEEVEEEYEIPDLRPWLPHPKAFETLRAFYVRTGPTFLELAISSNRDSKG 590

Query: 585 KHLKTKSFELCQDRWWERRDQVRIXXXXXXXXXXXXXXXXXDTTKSTKRR 634
           KHLKTKSFELCQDRWWERR+QVRI                 DT+K+ +RR
Sbjct: 591 KHLKTKSFELCQDRWWERREQVRIEEDKLEELGGVEDVIEKDTSKTQRRR 640

>ACR016W Chr3 (384967..386889) [1923 bp, 640 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YPL263C (KEL3)
          Length = 640

 Score =  713 bits (1840), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 349/597 (58%), Positives = 414/597 (69%), Gaps = 21/597 (3%)

Query: 52  VLANFKKEQEQFEQINVESVDKPTRRINSCMIANPNHGKKELLLFGGENTSQEQGVTHFY 111
           VLANFK++Q +FE +NVE+V++P +R +S ++ANP H K+EL+LFGGE T+Q  G+THFY
Sbjct: 51  VLANFKRQQAEFEAVNVETVERPHQRSSSSLVANPLHNKRELILFGGEYTNQSTGMTHFY 110

Query: 112 NDLYTFTPDNDLWKKITSQNXXXXXXXXXXXXXXXGIALLHGGEFSSPKQNTFYHYSDTW 171
           NDL+ ++ D D WKK TSQN               G+ L+HGGEFSSPKQNTFYHYSDTW
Sbjct: 111 NDLFIYSLDTDQWKKYTSQNSPMPRSSAAIAAHPSGVVLIHGGEFSSPKQNTFYHYSDTW 170

Query: 172 LLDCTTREWTKVEQKNGPSARSGHRITVWKNYFILHGGFRDLGSTTSYLNDSWLFDITSY 231
           L DC T EWTK+EQKNGPS+RSGHR+TVWKNY ILHGGFRDLG++T+YLND WLFDIT+Y
Sbjct: 171 LFDCATHEWTKIEQKNGPSSRSGHRMTVWKNYIILHGGFRDLGTSTTYLNDCWLFDITTY 230

Query: 232 KWRQIEFPPNHPVPDARSGHSLIPTQEGAVLWGGYCKVKAGKGLQKGKILGDCWYLKMKA 291
           KW+Q++FP NHP+PDARSGHSL+PT EGA+LWGGYCKVKAGKGLQKGKIL DCWYLKMK+
Sbjct: 231 KWQQLQFPANHPIPDARSGHSLLPTPEGAILWGGYCKVKAGKGLQKGKILTDCWYLKMKS 290

Query: 292 DPSAVRWERRKKQGFQPSPRVGCSMVHHKGRGILFGGVYDFEETEESLDSIFYNDLFSYQ 351
           D +A+RWERRKKQGFQPS R GCSMVHHKGRGILFGGVYD+EETEE LDS+FYNDLF+Y 
Sbjct: 291 DVTAIRWERRKKQGFQPSSRAGCSMVHHKGRGILFGGVYDYEETEEGLDSLFYNDLFTYH 350

Query: 352 IESNRWYALQLRSQRKKVVRLNNKSSXXXXXXXXXXXXXXXXXANL---------KDDDE 402
           IE+NRWY++ LR+QR   V+   KS+                 ANL         K  +E
Sbjct: 351 IETNRWYSVSLRAQRHSKVKSAPKSNRDKDKELEDMLNAILKKANLDDDDGDEDGKTIEE 410

Query: 403 DANELSNGLGXXXXXXXXXXXXXXXXYIVRNQLPHHRFNASTTVVDDTLFIYGGVWELGE 462
           + N+L N                   Y +  +LPH RFNAST +VDDTLFI+GGVWE GE
Sbjct: 411 ELNKLEN-------DGITETEETKKSYPIVMKLPHPRFNASTAIVDDTLFIFGGVWEQGE 463

Query: 463 KDYSIDSMYSIDLNKLDGVTVYWENLHDIEKAKELGAINSXXXXXXXXXXXXXXXXXT-V 521
           KDY IDS YSID+NK+DGV VYWE++  +E+AKELG  +                     
Sbjct: 464 KDYMIDSFYSIDMNKVDGVKVYWEDMAAVERAKELGEEDEDDAEDDEDDDSEDDDEEEHS 523

Query: 522 DQKLVXXXXXXXXXXXXXXXXXXXXXRPWLPHPKAFESLRNFYVRTGASFLEWAISNNKH 581
           D+KLV                     RPWLPHPKAFESLR FYVRTGASFLEWAI+N  +
Sbjct: 524 DRKLVAEEEEEEEEEDNEILPEIPDPRPWLPHPKAFESLRAFYVRTGASFLEWAITNKHN 583

Query: 582 TR----GKHLKTKSFELCQDRWWERRDQVRIXXXXXXXXXXXXXXXXXDTTKSTKRR 634
           TR    GKHLK  SF+LCQ+RWWERR+QVRI                 D TK TKRR
Sbjct: 584 TRSDAKGKHLKKHSFDLCQERWWERREQVRIEEDKLEELGGVGEVIEKDFTKPTKRR 640

>CAGL0A01067g Chr1 (106866..108791) [1926 bp, 641 aa] {ON} similar
           to uniprot|Q08979 Saccharomyces cerevisiae YPL263c KEL3
          Length = 641

 Score =  691 bits (1784), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 343/593 (57%), Positives = 413/593 (69%), Gaps = 10/593 (1%)

Query: 52  VLANFKKEQEQFEQINVESVDKPTRRINSCMIANPN--HGKKELLLFGGENTSQEQGVTH 109
           VLANFKKEQEQFE++ V+SVDK  +R+N CM+ NP+    KKEL++FGGE T+ +   T 
Sbjct: 49  VLANFKKEQEQFEKVAVDSVDKVNKRLNPCMVGNPSASSSKKELIVFGGEFTNPQTSTTT 108

Query: 110 FYNDLYTFTPDNDLWKKITSQNXXXXXXXXXXXXXXXGIALLHGGEFSSPKQNTFYHYSD 169
           FYNDL+TFTP+N+ WK+ TSQN               GIALLHGGEFSSPKQNTFYHYSD
Sbjct: 109 FYNDLHTFTPENNQWKRYTSQNAPMPRSSAAMAAHPSGIALLHGGEFSSPKQNTFYHYSD 168

Query: 170 TWLLDCTTREWTKVEQKNGPSARSGHRITVWKNYFILHGGFRDLGSTTSYLNDSWLFDIT 229
           TW+LDC T+EW KV+ K GPSARSGHRITVWKN+FILHGGFRDLG++T+YL+D WLFDIT
Sbjct: 169 TWILDCNTKEWAKVDAKVGPSARSGHRITVWKNFFILHGGFRDLGTSTTYLSDCWLFDIT 228

Query: 230 SYKWRQIEFPPNHPVPDARSGHSLIPTQEGAVLWGGYCKVKAG-KGLQKGKILGDCWYLK 288
           +YKW+Q+EFP NH VPDARSGHS IPT EGA+LWGGYCKVKA  KG QKGKIL DCWYLK
Sbjct: 229 TYKWKQVEFPSNHQVPDARSGHSFIPTAEGAILWGGYCKVKANKKGYQKGKILSDCWYLK 288

Query: 289 MKADPSAVRWERRKKQGFQPSPRVGCSMVHHKGRGILFGGVYDFEETEESLDSIFYNDLF 348
           MK+D S +RWERR+KQGFQPSPRVGCSM +HKGRGILFGGVYDFEETEESL+S F+NDLF
Sbjct: 289 MKSDISGIRWERRRKQGFQPSPRVGCSMAYHKGRGILFGGVYDFEETEESLESNFFNDLF 348

Query: 349 SYQIESNRWYALQLRSQRK---KVVRLNNKSSXXXXXXXXXXXXXXXXXANLKDDDEDAN 405
           SY IESNRWY+L +RS++     V + + K+S                 ANL+D  +D  
Sbjct: 349 SYHIESNRWYSLSIRSRKSNNNAVAKKSGKNSKEQEKELKMLLDSILEKANLQDKSDDDE 408

Query: 406 ELS--NGLGXXXXXXXXXXXXXXXXYIVRNQLPHHRFNASTTVVDDTLFIYGGVWELGEK 463
           +    N                   + +  QLPH RFNA+TTV+DDTLFI+GG+WELG+K
Sbjct: 409 DDEEINTALAKVDLEDEEEEQLAVQHTILTQLPHPRFNATTTVIDDTLFIFGGIWELGDK 468

Query: 464 DYSIDSMYSIDLNKLDGVTVYWENLHDIEKAKELGAINSXXXXXXXXXXXXXXXXXTVDQ 523
           ++ IDS+YSIDLNKLDGVT+YWE+L +IE+AKELG  +S                   ++
Sbjct: 469 EFMIDSLYSIDLNKLDGVTMYWEDLKEIERAKELGVEDSDFEDDDEDDDDEDDDEEDDNE 528

Query: 524 KLVXXXXXXXXXXXXXXXXXXX--XXRPWLPHPKAFESLRNFYVRTGASFLEWAISNNKH 581
           K                         RPWLPHPK FE+LR FY+R GA+FLEWAISNNK+
Sbjct: 529 KDEGDDEESEEEEEEEIEEELEYPDPRPWLPHPKPFETLRAFYIREGAAFLEWAISNNKN 588

Query: 582 TRGKHLKTKSFELCQDRWWERRDQVRIXXXXXXXXXXXXXXXXXDTTKSTKRR 634
            +GKHLK  SF+LCQ+RWWERRDQ+RI                 D + S+KRR
Sbjct: 589 AKGKHLKKHSFDLCQERWWERRDQLRIEEDKLEEIGGVGDIIERDKSASSKRR 641

>KLTH0C11528g Chr3 (946632..948560) [1929 bp, 642 aa] {ON} similar
           to uniprot|Q08979 Saccharomyces cerevisiae YPL263C KEL3
           Cytoplasmic protein of unknown function
          Length = 642

 Score =  689 bits (1778), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 334/590 (56%), Positives = 415/590 (70%), Gaps = 11/590 (1%)

Query: 55  NFKKEQEQFEQINVESVDKPTRRINSCMIANPNHGKKELLLFGGENTSQEQGVTHFYNDL 114
           NF+KEQE F+++ V  V +P+ R N CM+ NP+HGK+ELL+FGGE T+Q    T FYN+L
Sbjct: 54  NFRKEQELFQEVVVTPVKRPSPRSNVCMVPNPSHGKRELLIFGGEYTNQTSSTTTFYNEL 113

Query: 115 YTFTPDNDLWKKITSQNXXXXXXXXXXXXXXXGIALLHGGEFSSPKQNTFYHYSDTWLLD 174
           +T++ D D WKKITS+N               G+ L+HGGEFSSPKQNTFYHYSD+WLLD
Sbjct: 114 FTYSLDTDQWKKITSRNAPMPRSSAAAAGHPSGVVLIHGGEFSSPKQNTFYHYSDSWLLD 173

Query: 175 CTTREWTKVEQKNGPSARSGHRITVWKNYFILHGGFRDLGSTTSYLNDSWLFDITSYKWR 234
           C+++EWTK++QKNGPSARSGHR+TVWKN+F++HGGFRDLG++T+YLND WLFDIT+YKW+
Sbjct: 174 CSSKEWTKIDQKNGPSARSGHRMTVWKNFFVMHGGFRDLGTSTTYLNDCWLFDITTYKWK 233

Query: 235 QIEFPPNHPVPDARSGHSLIPTQEGAVLWGGYCKVKAGKGLQKGKILGDCWYLKMKADPS 294
           Q+EFPPNHPVPDARSGHSLIPTQEGA++WGGYCK+KA KGLQKGKIL DCWYL+MK+D +
Sbjct: 234 QVEFPPNHPVPDARSGHSLIPTQEGAIVWGGYCKIKAKKGLQKGKILTDCWYLRMKSDIT 293

Query: 295 AVRWERRKKQGFQPSPRVGCSMVHHKGRGILFGGVYDFEETEESLDSIFYNDLFSYQIES 354
            +RWERRKKQGFQPSPRVGCSM HHKGRGILFGGVYD+EETEE L S F+NDL SYQ+E+
Sbjct: 294 GIRWERRKKQGFQPSPRVGCSMAHHKGRGILFGGVYDYEETEEGLSSEFFNDLLSYQVEA 353

Query: 355 NRWYALQLRSQRKKVVRLNNKSSXXXXXXXXXXXXXXXXXANLKDDDEDANELSNGLGXX 414
           NRWY++++R Q+KK+V   +KS+                 ANL D++ + NE  + +   
Sbjct: 354 NRWYSIKMRPQKKKIV-AASKSAKSKDDELVGILNDILQKANLADEENEENESDSEIEKE 412

Query: 415 XXXXXXXXXX--XXXXYIVRNQLPHHRFNASTTVVDDTLFIYGGVWELGEKDYSIDSMYS 472
                           Y V  QLPH RFNA+TTVVDDTLFI+GG WE GE+D+SIDS YS
Sbjct: 413 LHRLDEEELLGHQQKQYPVVAQLPHSRFNAATTVVDDTLFIFGGSWEYGERDFSIDSFYS 472

Query: 473 IDLNKLDGVTVYWENLHDIEKAKELGAINSXXXXXXXXXXXXXXXXXTVDQKLVXXXXXX 532
           IDLN+ DGV V+WE+L +IEKAK+ G                     T+D++L+      
Sbjct: 473 IDLNRTDGVRVFWEDLEEIEKAKDQGLEEDEEEEEEEDDDDEDDEEETLDEELIAEMEDD 532

Query: 533 XXXXXXXXXXXXXXX--------RPWLPHPKAFESLRNFYVRTGASFLEWAISNNKHTRG 584
                                  RPWLPHPKAFE+LR FY+RTGA FL+WAISNN+  +G
Sbjct: 533 KQEEEEQEEEEEEEEAGPEIPDPRPWLPHPKAFETLRAFYIRTGAEFLQWAISNNRSAKG 592

Query: 585 KHLKTKSFELCQDRWWERRDQVRIXXXXXXXXXXXXXXXXXDTTKSTKRR 634
           KHLK +SF+L QDRWWERR+QVRI                 D++ STKRR
Sbjct: 593 KHLKKQSFDLSQDRWWERREQVRIEEDKLEEMGGVENIIERDSSHSTKRR 642

>KAFR0B06500 Chr2 (1347509..1349419) [1911 bp, 636 aa] {ON} Anc_6.10
           YPL263C
          Length = 636

 Score =  665 bits (1717), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 341/603 (56%), Positives = 399/603 (66%), Gaps = 38/603 (6%)

Query: 52  VLANFKKEQEQFEQINVESVDKPTRRINSCMIANPNHGKKELLLFGGENTSQEQGVTHFY 111
           +L NFKKEQE +E+IN+ESV+KP+ R N  +I++    KKELLLFGGE+TS+E   T FY
Sbjct: 51  ILENFKKEQENYEKINIESVEKPSIRNNGSIISSTT--KKELLLFGGEHTSKELQTTKFY 108

Query: 112 NDLYTFTPDNDLWKKITSQNXXXXXXXXXXXXXXXGIALLHGGEFSSPKQNTFYHYSDTW 171
           NDLYTF+PDN+ WK+ITSQN               GIALL+GGEFSSPKQ+TFYHYSDTW
Sbjct: 109 NDLYTFSPDNNQWKRITSQNSPMPRSSAAMAAHPSGIALLNGGEFSSPKQSTFYHYSDTW 168

Query: 172 LLDCTTREWTKVEQKNGPSARSGHRITVWKNYFILHGGFRDLGSTTSYLNDSWLFDITSY 231
           +LD TT+EWTK+E K  P  RSGHRIT WKNYFIL GGF+DLG +T+Y ND WLFDIT+Y
Sbjct: 169 ILDLTTKEWTKIEGKVKPVGRSGHRITTWKNYFILFGGFKDLGHSTTYYNDVWLFDITTY 228

Query: 232 KWRQIEFPPNHPVPDARSGHSLIPTQEGAVLWGGYCKVKAGKGLQKGKILGDCWYLKMKA 291
           KW+Q+EFP NH +PDARSGHSLIPT EG +++GGYCK+KA KGLQKGK+L  CW LKMKA
Sbjct: 229 KWKQVEFPKNHTLPDARSGHSLIPTSEGCIVYGGYCKIKAKKGLQKGKLLSGCWNLKMKA 288

Query: 292 DPSAVRWERRKKQGFQPSPRVGCSMVHHKGRGILFGGVYDFEETEESLDSIFYNDLFSYQ 351
           D  A+RWERR+KQGFQPSPRVGCSM +HKGRGILFGGVYDF+ETEESL+SIFYNDLF+Y 
Sbjct: 289 DVEAIRWERRRKQGFQPSPRVGCSMAYHKGRGILFGGVYDFDETEESLESIFYNDLFTYN 348

Query: 352 IESNRWYALQLRSQR---KKVVRLNNKSSXXXXXXXXXXXXXXXXXANLK---------- 398
           IESNRW+ + L+ +    K +    NKSS                  NLK          
Sbjct: 349 IESNRWFNVTLKKRSNATKTISSTKNKSSKEKERELQDLLNQILEKNNLKPDDEEEEESS 408

Query: 399 ----DDDEDANELSNGLGXXXXXXXXXXXXXXXXYIVRNQLPHHRFNASTTVVDDTLFIY 454
                DDED  E  N +                      QLPH RFNA+TTV+DD L+IY
Sbjct: 409 DIFGSDDEDDEEQKNKIDIKTV----------------TQLPHPRFNATTTVIDDMLYIY 452

Query: 455 GGVWELGEKDYSIDSMYSIDLNKLDGVTVYWENLHDIEKAKELGAINSXXXXXXXXXXXX 514
           GG WE GE DYSIDS YSIDLNKLDGV VYWE+L++IE AKELG   S            
Sbjct: 453 GGAWEFGEIDYSIDSFYSIDLNKLDGVNVYWEDLNEIETAKELGEQGSEDEDEDDFEEDE 512

Query: 515 XXXXXTVDQ-KLVXXXXXXXXXXXXXXXXXXX--XXRPWLPHPKAFESLRNFYVRTGASF 571
                 V+  KL+                       RPWLPHPKAFESLR FY+R G +F
Sbjct: 513 EDGEEEVEDTKLIAEDVEDEKEEEEEEYPEMEIPDPRPWLPHPKAFESLRAFYLREGPAF 572

Query: 572 LEWAISNNKHTRGKHLKTKSFELCQDRWWERRDQVRIXXXXXXXXXXXXXXXXXDTTKST 631
           LEWAISNN+HTRGK LK KSFELCQDRWWERRDQ+ I                 DT+K+ 
Sbjct: 573 LEWAISNNRHTRGKLLKQKSFELCQDRWWERRDQISIEEDKLEEIGVVGDVVERDTSKAV 632

Query: 632 KRR 634
            +R
Sbjct: 633 SKR 635

>NDAI0I02750 Chr9 complement(644137..646128) [1992 bp, 663 aa] {ON}
           Anc_6.10 YPL263C
          Length = 663

 Score =  642 bits (1656), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 338/625 (54%), Positives = 393/625 (62%), Gaps = 57/625 (9%)

Query: 52  VLANFKKEQEQFEQINVESVDKP-----TRRINSCMI-ANPNHGKK--ELLLFGGENTSQ 103
           VLANFK EQE+FE+INVE + +      + R NS MI A   H KK  ELL+FGGE TS 
Sbjct: 53  VLANFKMEQEKFEKINVELLPQGQHNHISPRSNSSMITAASAHNKKGKELLMFGGEYTSP 112

Query: 104 EQGVTHFYNDLYTFTPDNDLWKKITSQNXXXXXXXXXXXXXXXGIALLHGGEFSSPKQNT 163
           E G+THFYNDL ++TPD   W+KITSQN               GIA+LHGGEFSSPKQNT
Sbjct: 113 ETGMTHFYNDLLSYTPDTQQWRKITSQNSPMPRSSAAMCYHPSGIAILHGGEFSSPKQNT 172

Query: 164 FYHYSDTWLLDCTTREWTKVEQKNGPSARSGHRITVWKNYFILHGGFRDLGST-TSYLND 222
           FYHYSDTW+LD +T+EWTKV+ K  P ARSGHRI  WKNYF+L GGF+D+G+  T+Y ND
Sbjct: 173 FYHYSDTWILDTSTKEWTKVDIKKSPVARSGHRIVHWKNYFVLFGGFKDIGNNQTNYFND 232

Query: 223 SWLFDITSYKWRQIEFPPNHPVPDARSGHSLIPTQEGAVLWGGYCKVKA--GKGLQKGKI 280
            W FDI +YKW Q+EFP NHP+PD RSGHS IP +EG +LWGGY KVK+    G QKGKI
Sbjct: 233 VWCFDILNYKWTQVEFPKNHPLPDPRSGHSWIPVEEGCILWGGYTKVKSKLKSGQQKGKI 292

Query: 281 LGDCWYLKMKADPSAVRWERRKKQGFQPSPRVGCSMVHHKGRGILFGGVYDFEETEESLD 340
           L DCWYLKMK+D S++RWERRKK GFQPSPRVGCSM +HKGRGILFGGVYDF+ETEESL+
Sbjct: 293 LNDCWYLKMKSDLSSIRWERRKKLGFQPSPRVGCSMAYHKGRGILFGGVYDFDETEESLE 352

Query: 341 SIFYNDLFSYQIESNRWYALQLRSQR---KKVVRLNNKSSXXXXXXXXXXXXXXXXXANL 397
           S+FYNDLFSY +E+NRW+AL LR  +   K + R NNK+S                  NL
Sbjct: 353 SLFYNDLFSYNVETNRWFALNLRKNQKGNKSLKRSNNKNSKEKEKELQDLLNQILEKNNL 412

Query: 398 K-------------------------DDDEDANELSNGLGXXXXXXXXXXXXXXXXYIVR 432
           K                          DDED    +                      + 
Sbjct: 413 KDEDDEDDEEVNENEDGSTTASTAATSDDEDTERTTQ---------------EAEGVTIM 457

Query: 433 NQLPHHRFNASTTVVDDTLFIYGGVWELGEKDYSIDSMYSIDLNKLDGVTVYWENLHDIE 492
           NQLPH R+N + TVVDD LFIYGG WELGEKDY I+S YSIDLN++DGVT YWE+L +IE
Sbjct: 458 NQLPHPRYNVAMTVVDDLLFIYGGSWELGEKDYFINSFYSIDLNRIDGVTCYWEDLKEIE 517

Query: 493 KAKELGAINSXXXXXXXXXXXXXXXXXTV---DQKLVXXXXXXXXXXXXXXXXXXXXXRP 549
           KAKELG  +S                      DQKLV                     RP
Sbjct: 518 KAKELGEQDSDEEDDEDDEEDDDEDDDEEEIKDQKLVADDEDEEEEEEDVQEMEIPDLRP 577

Query: 550 WLPHPKAFESLRNFYVRTGASFLEWAISNNKHTRGKHLKTKSFELCQDRWWERRDQVRIX 609
           WLPHPK FESLR FY+R G +FLEWAISNNKH RGKHLK KSFELC+DRWWERRDQ+RI 
Sbjct: 578 WLPHPKPFESLRAFYIREGPAFLEWAISNNKHVRGKHLKKKSFELCEDRWWERRDQIRIE 637

Query: 610 XXXXXXXXXXXXXXXXDTTKSTKRR 634
                           DT+K   +R
Sbjct: 638 EDKLEELGVVGDVIEKDTSKGASKR 662

>KNAG0E02780 Chr5 complement(559180..561132) [1953 bp, 650 aa] {ON}
           Anc_6.10 YPL263C
          Length = 650

 Score =  573 bits (1478), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 298/573 (52%), Positives = 356/573 (62%), Gaps = 19/573 (3%)

Query: 52  VLANFKKEQEQFEQINVESVDKPTRRINSCMIANPNHGKKELLLFGGENTSQEQGVTHFY 111
           +L NFK EQEQFE++ VE V  PT R N+C++ N    K ELLLFGGE T+ E  +T FY
Sbjct: 53  ILQNFKLEQEQFEKVVVELVPHPTPRNNACLVTNA--SKPELLLFGGERTNNETNMTKFY 110

Query: 112 NDLYTFTPDNDLWKKITSQNXXXXXXXXXXXXXXXGIALLHGGEFSSPKQNTFYHYSDTW 171
           NDL+ + P N+ WKK TSQN               G+ +L GGEFSSPKQNTFYHY+DTW
Sbjct: 111 NDLHVYNPQNNQWKKFTSQNSPMPRSSAAMCSHQSGVTILFGGEFSSPKQNTFYHYNDTW 170

Query: 172 LLDCTTREWTKVEQKNGPSARSGHRITVWKNYFILHGGFRDLGSTTSYLNDSWLFDITSY 231
           LLD TTREW+K++ KNGPSARSGHRIT WKNYFIL GGF+DL   TSY ND WLF++  +
Sbjct: 171 LLDNTTREWSKLDFKNGPSARSGHRITTWKNYFILFGGFKDLNQGTSYFNDVWLFNVVDF 230

Query: 232 KWRQIEFPPNHPVPDARSGHSLIPTQEGAVLWGGYCKVKA--GKGLQKGKILGDCWYLKM 289
           KW + E   N   PD RSGHS I + EG +++GGYCKVKA   K L KGK L DCW LKM
Sbjct: 231 KWTKWE-TTNKNQPDPRSGHSWIGSNEGPIVYGGYCKVKAKNNKSLHKGKTLTDCWILKM 289

Query: 290 KADPSAVRWERRKKQGFQPSPRVGCSM-VHHKGRGILFGGVYDFEETEESLDSIFYNDLF 348
             + + ++WERR K+G QPSPRVGCSM +H   RGILFGGVYD EETEE L SI+YNDL+
Sbjct: 290 SQNVNEIKWERRAKKGQQPSPRVGCSMALHRNNRGILFGGVYDLEETEEDLSSIYYNDLY 349

Query: 349 SYQIESNRWYALQLR-----SQRKKVVRLNNKSSXXXXXXXXXXXXXXXXXANLKDDDED 403
           SY IESNRWY L+LR     S   +    NN  S                  +LKD++ +
Sbjct: 350 SYNIESNRWYPLKLRKVTQNSNANRNKSSNNTVSKEQEKELQDLLNKILEQNDLKDEETN 409

Query: 404 ANELSNGLGXXXXXXXXXXXXXXXXYIVR-----NQLPHHRFNASTTVVDDTLFIYGGVW 458
           +   SN                    +       NQLPH RFNA TTV++DT +IYGG+W
Sbjct: 410 SYSGSNTPHEETTTDREQDDNEEEEKMRTNLPKLNQLPHERFNACTTVLNDTFYIYGGMW 469

Query: 459 ELGEKDYSIDSMYSIDLNKLDGVTVYWENLHDIEKAKELGAINSXXXXXXXXXXXXXXXX 518
           E  + DY+IDS YSIDLNKLDG+T Y+ENL +IE+ K LG + S                
Sbjct: 470 EFKDNDYTIDSFYSIDLNKLDGITQYYENLQEIEEVKRLGDVQSEDDFEYEDDDDEDDGE 529

Query: 519 ---XTVDQKLVXXXXXXXXXXXXXXXXXXXXXRPWLPHPKAFESLRNFYVRTGASFLEWA 575
                   +                       RPWLPHPKAFESLR FY+R G  FLEWA
Sbjct: 530 AEPTNERLEAEDDDEEENEEDEGIDEMEIPDPRPWLPHPKAFESLREFYIREGPKFLEWA 589

Query: 576 ISNNKHTRGKHLKTKSFELCQDRWWERRDQVRI 608
           ISNNKH +GKHLK KSFELCQDRWWERRDQ++I
Sbjct: 590 ISNNKHAKGKHLKQKSFELCQDRWWERRDQIQI 622

>YPL263C Chr16 complement(44551..46506) [1956 bp, 651 aa] {ON}
           KEL3Cytoplasmic protein of unknown function
          Length = 651

 Score =  510 bits (1313), Expect = e-173,   Method: Compositional matrix adjust.
 Identities = 282/603 (46%), Positives = 354/603 (58%), Gaps = 25/603 (4%)

Query: 52  VLANFKKEQEQFEQINVESVDKPTRRINSCMIANPNHGKKELLLFGGENTSQEQGVTHFY 111
           +L++F K+Q + E +++ SV+KP+ R +  M ANP H K EL +FGGE T  E  +THFY
Sbjct: 54  ILSSFSKKQIELEHVDITSVEKPSCRTHPLMFANPQHNKHELFIFGGEFTDPETKLTHFY 113

Query: 112 NDLYTFTPDNDLWKKITSQNXXXXXXXXXXXXXXXGIALLHGGEFSSPKQNTFYHYSDTW 171
           NDLY+++  N+ WKK  SQN               GIALLHGGEFSSPKQ+ FYHYSDTW
Sbjct: 114 NDLYSYSIKNNSWKKYVSQNAPLPRSSAAVAVHPSGIALLHGGEFSSPKQSKFYHYSDTW 173

Query: 172 LLDCTTREWTKVE---QKNGPSARSGHRITVWKNYFILHGGFRDLGS-TTSYLNDSWLFD 227
           L DC  R++TK+E   + + PSARSGHRI  WKNYFIL GGFRDLG+  TSYLND W FD
Sbjct: 174 LFDCVERKFTKLEFGGRDSSPSARSGHRIIAWKNYFILFGGFRDLGNGQTSYLNDLWCFD 233

Query: 228 ITSYKWRQIEFPPNHPVPDARSGHSLIPTQEGAVLWGGYCKV--KAGKGLQKGKILGDCW 285
           I++YKW ++E    +  PDARSGH  IPT   A+L GGYCK+  K  K L KGKIL D W
Sbjct: 234 ISTYKWTKLE---TNSKPDARSGHCFIPTDNSAILMGGYCKIIAKNNKNLMKGKILNDAW 290

Query: 286 YLKMKADPSAVRWERRKKQGFQPSPRVGCSM-VHHKGRGILFGGVYDFEETEESLDSIFY 344
            L +  DP   +WE+ K    QPSPRVG S  +  + + + FGGVYD +ETEESL+S+FY
Sbjct: 291 KLNLTPDPKKWQWEKLKNFKNQPSPRVGYSFNLWKQNKSVAFGGVYDLQETEESLESVFY 350

Query: 345 NDLFSYQIESNRWYALQLRSQRK-----KVVRLNNKSSXXXXXXXXXXXXXXXXXANLKD 399
           NDL+ + +E N+W  L+++ QR+            KS+                 +NL D
Sbjct: 351 NDLYMFHLELNKWSKLRIKPQRQTNSKNSPATSKRKSNKDQEKELQDLLNSILAKSNLND 410

Query: 400 DDEDANELS----NGLGXXXXXXXXXXXXXXXXYIVRNQLPHHRFNASTTVVDDTLFIYG 455
           DD+D ++ S    N +                   + NQLPH RFNA+T VV D+LFIY 
Sbjct: 411 DDDDNDDNSTTGPNSIDDDEDNEDDSDLDNQEDITISNQLPHPRFNAATCVVGDSLFIYS 470

Query: 456 GVWELGEKDYSIDSMYSIDLNKLDGVTVYWENLHDIEKAKELG----AINSXXXXXXXXX 511
           GVWELGEKDY I+S YSIDLNKLDGV VYWE+L  IE+AK LG      +          
Sbjct: 471 GVWELGEKDYPINSFYSIDLNKLDGVKVYWEDLSAIEEAKRLGDRDSDEDEFEYEDDEED 530

Query: 512 XXXXXXXXTVDQKLVXXXXXXXXXXXXXXXXXXXXXRPWLPHPKAFESLRNFYVRTGASF 571
                                               R WLPHPK FE+LR FY+R GA+F
Sbjct: 531 EDDGEEEQDAGPLEGDEDEESESDDDKQAQMEIPDERSWLPHPKPFETLRAFYLREGANF 590

Query: 572 LEWAISNNKHTRGKHLKTKSFELCQDRWWERRDQVRIXXXXXXXXXXXXXXXXXDTTKST 631
           L W+ISNN++ +GK LKTKSFELC+DRWWERRDQV +                  TTK +
Sbjct: 591 LTWSISNNRNLKGKQLKTKSFELCEDRWWERRDQVTLEEERLEDTGGIIERDT--TTKPS 648

Query: 632 KRR 634
           KRR
Sbjct: 649 KRR 651

>Smik_6.471 Chr6 (774663..776618) [1956 bp, 651 aa] {ON} YPL263C
           (REAL)
          Length = 651

 Score =  507 bits (1306), Expect = e-172,   Method: Compositional matrix adjust.
 Identities = 270/577 (46%), Positives = 341/577 (59%), Gaps = 23/577 (3%)

Query: 52  VLANFKKEQEQFEQINVESVDKPTRRINSCMIANPNHGKKELLLFGGENTSQEQGVTHFY 111
           +L++F K+Q + E +++ +V++P+ R +  M ANP H K EL +FGGE T  E  +THFY
Sbjct: 54  ILSSFTKKQTELEHVDITAVERPSCRTHPLMFANPQHNKHELFIFGGEFTDSETKLTHFY 113

Query: 112 NDLYTFTPDNDLWKKITSQNXXXXXXXXXXXXXXXGIALLHGGEFSSPKQNTFYHYSDTW 171
           NDLY+++  N+ WKK  SQN               GIALLHGGEFSSPKQ+ FYHYSDTW
Sbjct: 114 NDLYSYSIKNNSWKKYVSQNAPLPRSSAAVAVHPSGIALLHGGEFSSPKQSKFYHYSDTW 173

Query: 172 LLDCTTREWTKVE---QKNGPSARSGHRITVWKNYFILHGGFRDLGS-TTSYLNDSWLFD 227
           L DC  R++ K+E   + + PSARSGHRI  WKNYFIL GGFRDLG+  TSYLND W FD
Sbjct: 174 LFDCVERKFNKLEFGGRDSSPSARSGHRIIAWKNYFILFGGFRDLGNGQTSYLNDLWCFD 233

Query: 228 ITSYKWRQIEFPPNHPVPDARSGHSLIPTQEGAVLWGGYCK--VKAGKGLQKGKILGDCW 285
           I++YKW +IE    +  PDARSGH  IPT   A+L GGYCK   K  K L KGKIL D W
Sbjct: 234 ISNYKWSKIE---TNSKPDARSGHCFIPTDNSAILMGGYCKTIAKNNKNLMKGKILNDAW 290

Query: 286 YLKMKADPSAVRWERRKKQGFQPSPRVGCSM-VHHKGRGILFGGVYDFEETEESLDSIFY 344
            L +  DP   +WE+ K    QPSPRVG S  +  + + + FGGVYD +ETEESL+S+FY
Sbjct: 291 KLNLTPDPKKWQWEKLKNFKNQPSPRVGYSFNLWKQNKSVAFGGVYDLQETEESLESVFY 350

Query: 345 NDLFSYQIESNRWYALQLRSQRKKVVRLNNKSSXXXXXXXXXXXXXXXXXANLKDDDEDA 404
           NDL+ + +E N+W  L+++SQR+   R +  +S                 + L   + + 
Sbjct: 351 NDLYMFHLELNKWSKLRIKSQRQTSNRNSPATSKRKSNKDQEKELQDLLNSILAKSNLND 410

Query: 405 NEL---------SNGLGXXXXXXXXXXXXXXXXYIVRNQLPHHRFNASTTVVDDTLFIYG 455
           ++          SN +                   + NQLPH RFNA+T VV D+LFIY 
Sbjct: 411 DDDENDDYTATGSNSIDGDEDEEDDSDLDNQEDITISNQLPHPRFNAATCVVGDSLFIYS 470

Query: 456 GVWELGEKDYSIDSMYSIDLNKLDGVTVYWENLHDIEKAKELG----AINSXXXXXXXXX 511
           GVWELGEKDY I+S YSIDLNKLDGV VYWE L  IE+AK LG                 
Sbjct: 471 GVWELGEKDYPINSFYSIDLNKLDGVKVYWEELSAIEEAKRLGDRDSDEEEFEYEDEEDD 530

Query: 512 XXXXXXXXTVDQKLVXXXXXXXXXXXXXXXXXXXXXRPWLPHPKAFESLRNFYVRTGASF 571
                                               R WLPHPK FE+LR FY+R GA+F
Sbjct: 531 EDQSEEEQDAGLLESDEDEESDDEDDGQAQMEIPDERSWLPHPKPFETLRAFYLREGANF 590

Query: 572 LEWAISNNKHTRGKHLKTKSFELCQDRWWERRDQVRI 608
           L W+ISNN++ +GK LKTKSFELC+DRWWERRDQV +
Sbjct: 591 LTWSISNNRNLKGKQLKTKSFELCEDRWWERRDQVTL 627

>Suva_16.42 Chr16 complement(60142..62106) [1965 bp, 654 aa] {ON}
           YPL263C (REAL)
          Length = 654

 Score =  507 bits (1306), Expect = e-172,   Method: Compositional matrix adjust.
 Identities = 275/580 (47%), Positives = 351/580 (60%), Gaps = 26/580 (4%)

Query: 52  VLANFKKEQEQFEQINVESVDKPTRRINSCMIANPNHGKKELLLFGGENTSQEQGVTHFY 111
           +L++F K+Q + E +++ +V++P+ R++  M ANP H K EL +FGGE T  E  +THFY
Sbjct: 54  ILSSFTKKQTELEHVDITAVERPSCRVHPLMFANPQHNKHELFIFGGEFTDPETKLTHFY 113

Query: 112 NDLYTFTPDNDLWKKITSQNXXXXXXXXXXXXXXXGIALLHGGEFSSPKQNTFYHYSDTW 171
           NDLY+++  N+ WKK  SQN               GIALLHGGEFSSPKQ+ FYHYSDTW
Sbjct: 114 NDLYSYSIKNNSWKKYVSQNAPLPRSSGAVAVHSSGIALLHGGEFSSPKQSKFYHYSDTW 173

Query: 172 LLDCTTREWTKVE---QKNGPSARSGHRITVWKNYFILHGGFRDLGS-TTSYLNDSWLFD 227
           L DC  +++TK+E   + + PSARSGHRI  WKNYFIL GGFRDLGS  TSYLND W FD
Sbjct: 174 LFDCHEKKFTKLEFGGRDSSPSARSGHRIIAWKNYFILFGGFRDLGSGQTSYLNDLWCFD 233

Query: 228 ITSYKWRQIEFPPNHPVPDARSGHSLIPTQEGAVLWGGYCK--VKAGKGLQKGKILGDCW 285
           I++YKW ++E    +  PDARSGH  +PT   A+L GGYCK   K  K L KGKIL D W
Sbjct: 234 ISNYKWTKLE---TNTKPDARSGHCFVPTDNSAILMGGYCKTIAKNNKNLMKGKILNDSW 290

Query: 286 YLKMKADPSAVRWERRKKQGFQPSPRVGCSM-VHHKGRGILFGGVYDFEETEESLDSIFY 344
            L +  DP   +WE+ K    QPSPRVG S  +  + + + FGGVYD +ETEESLDSIFY
Sbjct: 291 KLTLTPDPKKWQWEKLKNFKNQPSPRVGYSFNLWKQNKSVAFGGVYDLQETEESLDSIFY 350

Query: 345 NDLFSYQIESNRWYALQLRSQRKKVVR-----LNNKSSXXXXXXXXXXXXXXXXXANLKD 399
           NDL+ + +E N+W  L+++ QR    R        KS+                 +NL D
Sbjct: 351 NDLYMFHLELNKWSKLRIKPQRHTNNRNAPATSKRKSNKDQEKELQDLLNSILAKSNLND 410

Query: 400 DDEDANEL------SNGLGXXXXXXXXXXXXXXXXYIVRNQLPHHRFNASTTVVDDTLFI 453
           +++D ++       +N                     + NQLPH RFNA+T VVDD+LFI
Sbjct: 411 EEDDNDDSTATTTGANSSNDEGDDEDDSDFENQENITISNQLPHPRFNAATCVVDDSLFI 470

Query: 454 YGGVWELGEKDYSIDSMYSIDLNKLDGVTVYWENLHDIEKAKELG---AINSXXXXXXXX 510
           Y GVWELGEKDY I+S YSIDLNKLDGV VYWE+L  +E+AK LG   +           
Sbjct: 471 YSGVWELGEKDYPINSFYSIDLNKLDGVKVYWEDLSTVEEAKRLGDRDSDEEEFEYEDED 530

Query: 511 XXXXXXXXXTVDQKLVXXXXXXXXXXXX--XXXXXXXXXRPWLPHPKAFESLRNFYVRTG 568
                      D +L+                       R WLPHPK FE+LR FY+R G
Sbjct: 531 DDEDDDEEEPQDTRLLEDDDDEESEEEDDGQAQMEIPDERSWLPHPKPFETLRAFYLREG 590

Query: 569 ASFLEWAISNNKHTRGKHLKTKSFELCQDRWWERRDQVRI 608
           A+FL W+ISNN++ +GK LKTKSFELC+DRWWERRDQV +
Sbjct: 591 ANFLTWSISNNRNLKGKQLKTKSFELCEDRWWERRDQVTL 630

>Skud_16.14 Chr16 complement(23637..25595) [1959 bp, 652 aa] {ON}
           YPL263C (REAL)
          Length = 652

 Score =  505 bits (1301), Expect = e-172,   Method: Compositional matrix adjust.
 Identities = 276/578 (47%), Positives = 349/578 (60%), Gaps = 24/578 (4%)

Query: 52  VLANFKKEQEQFEQINVESVDKPTRRINSCMIANPNHGKKELLLFGGENTSQEQGVTHFY 111
           +L++F K+Q + E +++ +V++ + R +  M ANP H K+EL +FGGE T  E  +THFY
Sbjct: 54  ILSSFTKKQTELEHVDITAVERLSCRTHPLMFANPQHNKRELFIFGGEFTDPETKLTHFY 113

Query: 112 NDLYTFTPDNDLWKKITSQNXXXXXXXXXXXXXXXGIALLHGGEFSSPKQNTFYHYSDTW 171
           NDLY+++  N+ WKK  S+N               GIALLHGGEFSSPKQ+ FYHYSDTW
Sbjct: 114 NDLYSYSIKNNSWKKYVSKNAPLPRSSAAVAVHPSGIALLHGGEFSSPKQSKFYHYSDTW 173

Query: 172 LLDCTTREWTKVE---QKNGPSARSGHRITVWKNYFILHGGFRDLGS-TTSYLNDSWLFD 227
           L DC  R++TK+E   + + PSARSGHRI  WKNYFIL GGFRDLG+  TSYLND W FD
Sbjct: 174 LFDCAERKFTKLEFGGRDSSPSARSGHRIIAWKNYFILFGGFRDLGNGQTSYLNDLWCFD 233

Query: 228 ITSYKWRQIEFPPNHPVPDARSGHSLIPTQEGAVLWGGYCKV--KAGKGLQKGKILGDCW 285
           I++YKW ++E    +  P+ARSGH  IPT   A+L GGYCK+  K  K L KGKIL D W
Sbjct: 234 ISNYKWTKLE---TNTKPEARSGHCFIPTDNSAILMGGYCKIIAKNNKNLMKGKILNDAW 290

Query: 286 YLKMKADPSAVRWERRKKQGFQPSPRVGCSM-VHHKGRGILFGGVYDFEETEESLDSIFY 344
            L +  DP   +WE+ K    QPSPRVG S  +  + + + FGGVYD +ETEESL+S+FY
Sbjct: 291 KLNLTPDPKKWQWEKLKNFKNQPSPRVGYSFNLWKQNKSVAFGGVYDLQETEESLESVFY 350

Query: 345 NDLFSYQIESNRWYALQLRSQRK-----KVVRLNNKSSXXXXXXXXXXXXXXXXXANLKD 399
           NDL+ + +E N+W  L+++ QR+       +    KS+                 +NL D
Sbjct: 351 NDLYMFHLELNKWSKLRIKPQRQTNNKNAPLTSKRKSNKDQEKELQDLLNSILAKSNLND 410

Query: 400 DDEDANEL--SNGLGXXXXXXXXXXXXXXXXYI-VRNQLPHHRFNASTTVVDDTLFIYGG 456
           DD+D N    SN +                  I + NQLPH RFNA+T VVDD+LFIY G
Sbjct: 411 DDDDDNTTTGSNSIDGDDEGEDDDSDLDNPENITISNQLPHPRFNAATCVVDDSLFIYSG 470

Query: 457 VWELGEKDYSIDSMYSIDLNKLDGVTVYWENLHDIEKAKELG------AINSXXXXXXXX 510
           VWELGEKDY I+S YSIDLNKLDGV VYWE+L  IE+AK LG                  
Sbjct: 471 VWELGEKDYPINSFYSIDLNKLDGVNVYWEDLSTIEEAKRLGDRDSDEDDFEYEDDDDDD 530

Query: 511 XXXXXXXXXTVDQKLVXXXXXXXXXXXXXXXXXXXXXRPWLPHPKAFESLRNFYVRTGAS 570
                     V                          R WLPHPK FE+LR FY+R GA+
Sbjct: 531 GEDNDEEEQDVALLEGDEDEEGENEDNGQAQMEIPDERSWLPHPKPFETLRAFYLREGAN 590

Query: 571 FLEWAISNNKHTRGKHLKTKSFELCQDRWWERRDQVRI 608
           FL W+ISNNK  +GKHLKTKSFE+C+DRWWERRDQV +
Sbjct: 591 FLTWSISNNKDLKGKHLKTKSFEICEDRWWERRDQVTL 628

>Kpol_1050.69 s1050 complement(150301..153555) [3255 bp, 1084 aa]
           {ON} complement(150301..153555) [3255 nt, 1085 aa]
          Length = 1084

 Score = 64.3 bits (155), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 59/209 (28%), Positives = 89/209 (42%), Gaps = 36/209 (17%)

Query: 167 YSDTWLLDCTTREWTKVEQK------NGPSARSGHRITVWKNYFILHGGFRDLGSTTSYL 220
           Y DTW++ C   + T+   K      N P  R GH  T+  N FI+ GG     +    +
Sbjct: 178 YGDTWIISCNP-DATQFSSKSVDIGENTPPPRVGHAATLCGNAFIVFGGDTHKVNKEGLM 236

Query: 221 NDS-WLFDITSYKWRQIEFP-PNHPVPDARSGHSLIPTQEGAVLWGGYCKVKAGKGLQKG 278
           +D  +LF+I SYKW     P P  P P  R GH +       +L     K K       G
Sbjct: 237 DDDIYLFNINSYKWT---IPNPIGPRPLGRYGHKI------CILATSTVKTKL---YLFG 284

Query: 279 KILGDCWYLKMKA-DPSAVR-----WERRKKQGFQPSPRVGCSMVHHKGRGILFGGVYDF 332
               D ++  +   D S+ R     WE  K +GF P P    +MV +     ++GG    
Sbjct: 285 GQFDDTYFNDLAVFDLSSFRRQDSHWEFIKSKGFMPPPLTNHTMVTYGSDLWIYGG---- 340

Query: 333 EETEESLDSIFYNDLFSYQIESNRWYALQ 361
            +T++ L     ND+F +   +N W  ++
Sbjct: 341 -DTQQGL----INDIFKFSPNTNTWTKVE 364

 Score = 38.9 bits (89), Expect = 0.042,   Method: Compositional matrix adjust.
 Identities = 50/192 (26%), Positives = 77/192 (40%), Gaps = 24/192 (12%)

Query: 81  CMIANPNHGKKELLLFGGENTSQEQGVTHFYN----DLYTFTPDNDLWKKITSQNXXXXX 136
           C++A  +  K +L LFGG+        T+F +    DL +F   +  W+ I S+      
Sbjct: 269 CILAT-STVKTKLYLFGGQFDD-----TYFNDLAVFDLSSFRRQDSHWEFIKSKGFMPPP 322

Query: 137 XXXXXXXXXXGIALLHGGEFSSPKQNTFYHYSDTWLLDCTTREWTKVEQK-NGPSARSGH 195
                         ++GG+      N  + +S        T  WTKVE     P     H
Sbjct: 323 LTNHTMVTYGSDLWIYGGDTQQGLINDIFKFS------PNTNTWTKVETTGTKPPPMQEH 376

Query: 196 RITVWKNYFILHGGFRDLGSTTSYLNDSWLFDITSYKWRQIEFPP-NHPVPDARSGHSL- 253
              V+KN   + GG  +      YLN  +LF+  S KW    FP     +   RSGHS+ 
Sbjct: 377 AAVVYKNIMCVVGGKDE---NDMYLNSVYLFNFDSSKW--YTFPDFKSGIIQGRSGHSVT 431

Query: 254 IPTQEGAVLWGG 265
           +   +  ++ GG
Sbjct: 432 LLNNDKLLIMGG 443

 Score = 32.3 bits (72), Expect = 5.1,   Method: Compositional matrix adjust.
 Identities = 38/160 (23%), Positives = 73/160 (45%), Gaps = 19/160 (11%)

Query: 53  LANFKKEQEQFEQINVESVDKPTRRINSCMIANPNHGKKELLLFGGENTSQEQGVTHFYN 112
           L++F+++   +E I  +    P    N  M+    +G  +L ++GG+    +QG+    N
Sbjct: 300 LSSFRRQDSHWEFIKSKGF-MPPPLTNHTMVT---YGS-DLWIYGGDT---QQGL---IN 348

Query: 113 DLYTFTPDNDLWKKITSQNXXXXXXXXXXXXXXXGIALLHGGEFSSPKQNTFYHYSDTWL 172
           D++ F+P+ + W K+ +                  I  + GG+     +N  Y  S  +L
Sbjct: 349 DIFKFSPNTNTWTKVETTGTKPPPMQEHAAVVYKNIMCVVGGK----DENDMYLNS-VYL 403

Query: 173 LDCTTREW-TKVEQKNG-PSARSGHRITVWKN-YFILHGG 209
            +  + +W T  + K+G    RSGH +T+  N   ++ GG
Sbjct: 404 FNFDSSKWYTFPDFKSGIIQGRSGHSVTLLNNDKLLIMGG 443

>Skud_8.222 Chr8 complement(385114..388623) [3510 bp, 1169 aa] {ON}
           YHR158C (REAL)
          Length = 1169

 Score = 56.2 bits (134), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 56/223 (25%), Positives = 93/223 (41%), Gaps = 44/223 (19%)

Query: 167 YSDTWLL----DCTTREWTKVE-QKNGPSARSGHRITVWKNYFILHGGFRDLGSTTSYLN 221
           Y DTW+L    + T    T ++  +  P  R GH   +  N F++ GG     +    ++
Sbjct: 152 YGDTWILTALDNATKFSTTTIDISEATPPPRVGHAAVLCGNAFVVFGGDTHKVNKEGLMD 211

Query: 222 DS-WLFDITSYKWRQIEFP-PNHPVPDARSGH--SLIPTQEGAV---LWGGYCKVKAGKG 274
           D  +L +I SYKW     P P  P P  R GH  S+I T +      ++GG         
Sbjct: 212 DDIYLLNINSYKWT---VPAPVGPRPLGRYGHKISIIATTQMKTKLYVFGGQ-------- 260

Query: 275 LQKGKILGDCWYLKMKA-DPSAVR-----WERRKKQGFQPSPRVGCSMVHHKGRGILFGG 328
                   D ++  +   D S+ R     WE  K + F P P    +M+ +  +  +FGG
Sbjct: 261 ------FDDTYFNDLAVYDLSSFRRPDSHWEFLKPKAFTPPPITNFTMISYDSKLWVFGG 314

Query: 329 VYDFEETEESLDSIFYNDLFSYQIESNRWYALQLRSQRKKVVR 371
                   ++L  +  ND+F Y    N W+ ++   ++   V+
Sbjct: 315 --------DTLQGLI-NDVFMYDPAINDWFIIETTGEKPPPVQ 348

 Score = 37.0 bits (84), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 30/125 (24%), Positives = 54/125 (43%), Gaps = 16/125 (12%)

Query: 169 DTWLLDCTTREWTKVEQK-NGPSARSGHRITVWKNYFILHGGFRDLGSTTSYLNDSWLFD 227
           D ++ D    +W  +E     P     H   V+ +   + GG  +     +YLN  +  +
Sbjct: 323 DVFMYDPAINDWFIIETTGEKPPPVQEHASVVYNDLMCVVGGKDE---HDAYLNSVYFLN 379

Query: 228 ITSYKWRQIEFPPNHPVPDARSGHSLIPTQEGAVLWGG-----YCKVK------AGKGLQ 276
           + S+KW ++       +P  RSGHSL   ++  +L  G     Y +V+      +   LQ
Sbjct: 380 LKSHKWFKLPVF-TAGIPQGRSGHSLTLLKDDKILIMGGDKFDYARVEEFDLHTSDIDLQ 438

Query: 277 KGKIL 281
           +G I+
Sbjct: 439 RGTIV 443

>KAFR0B04320 Chr2 complement(893930..896890) [2961 bp, 986 aa] {ON}
           Anc_5.88 YGR238C
          Length = 986

 Score = 56.2 bits (134), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 60/210 (28%), Positives = 86/210 (40%), Gaps = 32/210 (15%)

Query: 167 YSDTWLLDCTTREWTKVEQK-----NGPSARSGHRITVWKNYFILHGGFRDLGSTTSYLN 221
           Y DTW+L         + Q      N P  R GH  T+  N FI+ GG     +    ++
Sbjct: 173 YGDTWILTSENNASRFISQTVDISDNTPPPRVGHAATLCGNAFIIFGGDTHKVNKDGLMD 232

Query: 222 DS-WLFDITSYKWRQIEFP-PNHPVPDARSGH--SLIPTQEGAV---LWGGYCKVKAGKG 274
           D  +LF+I S+KW     P P  P P  R GH  S+I T        L+GG         
Sbjct: 233 DDLYLFNINSHKWT---IPNPVGPRPLGRYGHKISIIATANSKTRLYLFGGQFDDAYFND 289

Query: 275 LQKGKILGDCWYLKMKADPSAVRWERRKKQGFQPSPRVGCSMVHHKGRGILFGGVYDFEE 334
           L    ++ D    +    P + RWE  K + F P P    +MV +  +  +FGG     +
Sbjct: 290 L----VVFDLSSFRR---PDS-RWEFVKPKSFVPPPLTNHTMVSYDNKLWVFGG-----D 336

Query: 335 TEESLDSIFYNDLFSYQIESNRWYALQLRS 364
           T + L     N +F Y    N W  ++  S
Sbjct: 337 TLQGL----TNRVFMYDPMINDWTTIETSS 362

>Suva_15.357 Chr15 complement(617637..618952,619001..621203) [3519
           bp, 1172 aa] {ON} YHR158C (REAL)
          Length = 1172

 Score = 56.2 bits (134), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 55/223 (24%), Positives = 92/223 (41%), Gaps = 44/223 (19%)

Query: 167 YSDTWLL----DCTTREWTKVE-QKNGPSARSGHRITVWKNYFILHGGFRDLGSTTSYLN 221
           Y DTW+L    D T    T ++  +  P  R GH   +  N F++ GG     +    ++
Sbjct: 152 YGDTWILSAFDDATKFSTTTIDISEATPPPRVGHAAVLCGNAFVVFGGDTHKVNREGLMD 211

Query: 222 DS-WLFDITSYKWRQIEFP-PNHPVPDARSGH--SLIPTQEGAV---LWGGYCKVKAGKG 274
           D  +L ++ SYKW     P P  P P  R GH  S+I T +      ++GG         
Sbjct: 212 DDIYLLNVNSYKWT---VPAPVGPRPLGRYGHKISIIATTQMKTKLYVFGGQ-------- 260

Query: 275 LQKGKILGDCWYLKMKA-DPSAVR-----WERRKKQGFQPSPRVGCSMVHHKGRGILFGG 328
                   D ++  +   D S+ R     W+  K   F P P    +M+ +  +  +FGG
Sbjct: 261 ------FDDTYFNDLAVYDLSSFRRPDSHWDFLKPMTFTPPPMTNFTMISYDSKLWVFGG 314

Query: 329 VYDFEETEESLDSIFYNDLFSYQIESNRWYALQLRSQRKKVVR 371
                   ++L  +  ND+F Y    N W+ ++   ++   V+
Sbjct: 315 --------DTLQGLI-NDVFMYDPAKNDWFTIETSGEKPPPVQ 348

 Score = 35.8 bits (81), Expect = 0.46,   Method: Compositional matrix adjust.
 Identities = 25/99 (25%), Positives = 43/99 (43%), Gaps = 7/99 (7%)

Query: 169 DTWLLDCTTREWTKVEQK-NGPSARSGHRITVWKNYFILHGGFRDLGSTTSYLNDSWLFD 227
           D ++ D    +W  +E     P     H   V+ +   + GG  +  +   YLN  +  +
Sbjct: 323 DVFMYDPAKNDWFTIETSGEKPPPVQEHATVVYNDLMCVVGGKDEHDA---YLNTVYFLN 379

Query: 228 ITSYKWRQIE-FPPNHPVPDARSGHSLIPTQEGAVLWGG 265
           + ++KW ++  F     +P  RSGHSL   +   VL  G
Sbjct: 380 LKTHKWFKLPIFAAG--IPQGRSGHSLTLLKNDKVLIMG 416

>KNAG0K00560 Chr11 complement(96678..99992) [3315 bp, 1104 aa] {ON}
           Anc_5.88 YGR238C
          Length = 1104

 Score = 55.8 bits (133), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 51/189 (26%), Positives = 78/189 (41%), Gaps = 39/189 (20%)

Query: 186 KNGPSARSGHRITVWKNYFILHGGFRDLGSTTSYLNDS-WLFDITSYKWRQIEFP-PNHP 243
           +N P  R GH  T+  N F++ GG     +    ++D  +LF+I SYKW     P P  P
Sbjct: 260 ENTPPPRVGHAATLCGNAFVVFGGDTHKVNKDGLMDDDLYLFNINSYKWT---IPNPIGP 316

Query: 244 VPDARSGHSL-----IPTQEGAVLWGGYCKVKAGKGLQKGKILGDCWYLKMKA-DPSAVR 297
            P  R GH +      P +    L+GG                 D ++  +   D S  R
Sbjct: 317 RPLGRYGHKVSIIATTPMKTKLYLFGGQ--------------FDDTYFNNLAVFDLSQFR 362

Query: 298 -----WERRKKQGFQPSPRVGCSMVHHKGRGILFGGVYDFEETEESLDSIFYNDLFSYQI 352
                WE  K + F P P    +MV ++ +  +FGG        ++L  +  N +F Y  
Sbjct: 363 RPDSHWEFLKPKSFMPPPLTNHTMVSYQNKLWIFGG--------DTLQGLI-NKIFMYDP 413

Query: 353 ESNRWYALQ 361
           E N W  ++
Sbjct: 414 EVNDWTVVE 422

>TDEL0G01120 Chr7 (229805..232834) [3030 bp, 1009 aa] {ON} Anc_5.88
           YGR238C
          Length = 1009

 Score = 55.5 bits (132), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 61/218 (27%), Positives = 93/218 (42%), Gaps = 44/218 (20%)

Query: 167 YSDTWLL---DCTTREWTKVEQKN--GPSARSGHRITVWKNYFILHGGFRDLGSTTSYLN 221
           Y DTW++   D  T+  +K    +   P  R GH  T+  N F++ GG     ++   ++
Sbjct: 133 YGDTWIINVDDSGTQFSSKTVDISEFTPPPRVGHAATLCGNAFVIFGGDTHKVNSEGLMD 192

Query: 222 DS-WLFDITSYKWRQIEFP-PNHPVPDARSGH--SLIPTQEGAV---LWGGYCKVKAGKG 274
           D  +LF+I S+KW     P P  P P  R GH  S+I T +      L+GG         
Sbjct: 193 DDLYLFNINSFKWT---IPHPVGPRPLGRYGHKISIIATNQMKTKLYLFGGQ-------- 241

Query: 275 LQKGKILGDCWYLKMKA-DPSAVR-----WERRKKQGFQPSPRVGCSMVHHKGRGILFGG 328
                   D ++  +   D S+ R     WE  K + F P P    +MV +  +  +FGG
Sbjct: 242 ------FDDTFFNDLAVYDLSSFRRSDSHWEFLKPKTFVPPPLANHTMVSYDHKLWIFGG 295

Query: 329 VYDFEETEESLDSIFYNDLFSYQIESNRWYALQLRSQR 366
                +T + L     N +F Y I SN W  ++    R
Sbjct: 296 -----DTMQGL----INKVFVYDIMSNDWSLVETTGAR 324

 Score = 35.0 bits (79), Expect = 0.63,   Method: Compositional matrix adjust.
 Identities = 24/98 (24%), Positives = 43/98 (43%), Gaps = 7/98 (7%)

Query: 170 TWLLDCTTREWTKVEQKNG-PSARSGHRITVWKNYFILHGGFRDLGSTTSYLNDSWLFDI 228
            ++ D  + +W+ VE     P     H   ++K+   + GG  +      YLN  +  ++
Sbjct: 305 VFVYDIMSNDWSLVETTGARPPPLQEHAALIYKDLMCVVGGKDE---QDIYLNSIYFLNL 361

Query: 229 TSYKWRQIEFPP-NHPVPDARSGHSLIPTQEGAVLWGG 265
            S +W   +FP     +P  RSGHS+   +   +L  G
Sbjct: 362 KSCRW--FKFPVFKAGIPQGRSGHSITLLKNNKILIMG 397

>SAKL0H02618g Chr8 (259684..262941) [3258 bp, 1085 aa] {ON} similar
           to uniprot|P38853 Saccharomyces cerevisiae YHR158C KEL1
           Protein required for proper cell fusion and cell
           morphology functions in a complex with Kel2p to
           negatively regulate mitotic exit interacts with Tem1p
           and Lte1p localizes to regions of polarized growth
           potential Cdc28p substrate
          Length = 1085

 Score = 55.5 bits (132), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 60/220 (27%), Positives = 87/220 (39%), Gaps = 38/220 (17%)

Query: 167 YSDTWLLDC---TTREWTKVE--QKNGPSARSGHRITVWKNYFILHGGFRDLGSTTSYLN 221
           Y DTW+L      TR  +K        P  R GH  T+  N F++ GG     +    ++
Sbjct: 112 YGDTWILTAHANNTRFTSKTVDISDTTPPPRVGHASTLCGNAFVIFGGDTHKVNNEGLMD 171

Query: 222 DS-WLFDITSYKWRQIEFP-PNHPVPDARSGHSLIPTQEGAVLWGGYCKVKA---GKGLQ 276
           D  +LF+I SYKW     P P  P P  R GH +      +V+     K K    G    
Sbjct: 172 DDVYLFNINSYKWT---IPHPVGPRPLGRYGHKI------SVIATSQMKTKLYVFGGQFD 222

Query: 277 KGKILGDCWYLKMKADPSAVR-----WERRKKQGFQPSPRVGCSMVHHKGRGILFGGVYD 331
                  C Y     D S+ R     WE  K Q F P P    +MV +  +  +FGG   
Sbjct: 223 DTYFNDLCVY-----DLSSFRRPDSHWEFLKPQSFVPPPLTNHTMVSYDYKLWIFGG--- 274

Query: 332 FEETEESLDSIFYNDLFSYQIESNRWYALQLRSQRKKVVR 371
             +T + L     N++F Y    N W  ++    +   ++
Sbjct: 275 --DTAQGL----INEVFMYDPTVNDWTVVETTGSKPPAIQ 308

 Score = 46.6 bits (109), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 28/84 (33%), Positives = 42/84 (50%), Gaps = 5/84 (5%)

Query: 169 DTWLLDCTTREWTKVEQKNG-PSARSGHRITVWKNYFILHGGFRDLGSTTSYLNDSWLFD 227
           + ++ D T  +WT VE     P A   H   V+K+   + GG  +     SY ND +  +
Sbjct: 283 EVFMYDPTVNDWTVVETTGSKPPAIQEHAAVVYKDLMCVTGGKDE---QDSYSNDVYFLN 339

Query: 228 ITSYKWRQIEFPPNHPVPDARSGH 251
           + S+KW ++ F  N  VP  RSGH
Sbjct: 340 LKSFKWFKLPFFKNG-VPQGRSGH 362

>Smik_8.242 Chr8 complement(390631..394137) [3507 bp, 1168 aa] {ON}
           YHR158C (REAL)
          Length = 1168

 Score = 55.5 bits (132), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 56/223 (25%), Positives = 93/223 (41%), Gaps = 44/223 (19%)

Query: 167 YSDTWLL----DCTTREWTKVE-QKNGPSARSGHRITVWKNYFILHGGFRDLGSTTSYLN 221
           Y DTW+L    + T    T ++  +  P  R GH   +  N F++ GG     +    ++
Sbjct: 152 YGDTWILTAFDNATKFSTTTIDISEATPPPRVGHAAVLCGNAFVVFGGDTHKVNKEGLMD 211

Query: 222 DS-WLFDITSYKWRQIEFP-PNHPVPDARSGH--SLIPTQEGAV---LWGGYCKVKAGKG 274
           D  +L +I SYKW     P P  P P  R GH  S+I T +      ++GG         
Sbjct: 212 DDIYLLNINSYKWT---VPAPVGPRPLGRYGHKISIIATNQMKTKLYVFGGQ-------- 260

Query: 275 LQKGKILGDCWYLKMKA-DPSAVR-----WERRKKQGFQPSPRVGCSMVHHKGRGILFGG 328
                   D ++  +   D S+ R     WE  K + F P P    +M+ +  +  +FGG
Sbjct: 261 ------FDDTYFNDLAVYDLSSFRRPDSHWEFLKPKTFSPPPITNFTMISYDSKLWVFGG 314

Query: 329 VYDFEETEESLDSIFYNDLFSYQIESNRWYALQLRSQRKKVVR 371
                   ++L  +  ND+F Y    N W+ ++   ++   V+
Sbjct: 315 --------DTLQGLV-NDVFMYDPALNDWFIIETTGEKPPPVQ 348

 Score = 35.8 bits (81), Expect = 0.42,   Method: Compositional matrix adjust.
 Identities = 30/125 (24%), Positives = 51/125 (40%), Gaps = 16/125 (12%)

Query: 169 DTWLLDCTTREWTKVEQK-NGPSARSGHRITVWKNYFILHGGFRDLGSTTSYLNDSWLFD 227
           D ++ D    +W  +E     P     H   V+ +   + GG  +  +   YLN  +  +
Sbjct: 323 DVFMYDPALNDWFIIETTGEKPPPVQEHATVVYNDLMCVVGGKDEHDA---YLNSVYFLN 379

Query: 228 ITSYKWRQIEFPPNHPVPDARSGHSLIPTQEGAVLWGG-----YCKVKAGK------GLQ 276
           + S KW ++       +P  RSGHSL   +   +L  G     Y +V+          +Q
Sbjct: 380 LKSNKWFKLPVF-TAGIPQGRSGHSLTLLKNDKILIMGGDKFDYARVEESDLHTSDIDMQ 438

Query: 277 KGKIL 281
           KG I+
Sbjct: 439 KGTIV 443

>ZYRO0B08228g Chr2 (641988..645869) [3882 bp, 1293 aa] {ON} similar
           to uniprot|Q75AR9 Ashbya gossypii ADL149W ADL149Wp and
           some similarites with YHR158C uniprot|P38853
           Saccharomyces cerevisiae YHR158C KEL1 Protein required
           for proper cell fusion and cell morphology functions in
           a complex with Kel2p to negatively regulate mitotic exit
           interacts with Tem1p and Lte1p localizes to regions of
           polarized growth potential Cdc28p substrate
          Length = 1293

 Score = 55.1 bits (131), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 54/205 (26%), Positives = 85/205 (41%), Gaps = 36/205 (17%)

Query: 167 YSDTWLLDCTTREWTKVEQKN------GPSARSGHRITVWKNYFILHGGFRDLGSTTSYL 220
           Y DTW++  T    T+ + K        P  R GH  T+  N F+L GG     ++   +
Sbjct: 180 YGDTWII-STNDNGTQFQSKTVEISETTPPPRVGHAATLCGNAFVLFGGDTHKVNSEGLM 238

Query: 221 NDS-WLFDITSYKWRQIEFP-PNHPVPDARSGHSLIPTQEGAVLWGGYCKVKAGKGLQKG 278
           +D  +LF++ SYKW     P P  P P  R GH +      +++     K K       G
Sbjct: 239 DDDLYLFNVNSYKWT---IPHPIGPRPLGRYGHKI------SIMAANQMKTKL---YLFG 286

Query: 279 KILGDCWYLKMKA-DPSAVR-----WERRKKQGFQPSPRVGCSMVHHKGRGILFGGVYDF 332
               D ++  +   D S+ R     WE  K   F P P    +M+ +     +FGG    
Sbjct: 287 GQFDDTYFNDLAVFDLSSFRRPDSHWEFLKPTTFSPPPLTNHTMISYDNHLWVFGG---- 342

Query: 333 EETEESLDSIFYNDLFSYQIESNRW 357
               ++L  +  N +F Y + +N W
Sbjct: 343 ----DTLQGLI-NQVFKYDVANNDW 362

>NCAS0F00520 Chr6 (100048..103308) [3261 bp, 1086 aa] {ON} Anc_5.88
           YGR238C
          Length = 1086

 Score = 54.3 bits (129), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 58/219 (26%), Positives = 89/219 (40%), Gaps = 46/219 (21%)

Query: 167 YSDTWLLDCTTREWTKV-------EQKNGPSARSGHRITVWKNYFILHGGFRDLGSTTSY 219
           Y DTW+L C   + + +         +  P  R GH  T+  N F++ GG     +    
Sbjct: 170 YGDTWVLTCEDPQTSTMFSSRTVDITETTPPPRVGHASTLCGNAFVIFGGDTHKKNEMGE 229

Query: 220 LNDS-WLFDITSYKWRQIEFP-PNHPVPDARSGH--SLIP---TQEGAVLWGGYCKVKAG 272
           ++D  +LF+I SYKW     P P  P P  R GH  S+I     Q    L+GG       
Sbjct: 230 MDDDIYLFNINSYKWT---IPHPIGPRPKGRYGHKISIIARKQMQTKLYLFGGQ------ 280

Query: 273 KGLQKGKILGDCWYLKMKA-DPSAVR-----WERRKKQGFQPSPRVGCSMVHHKGRGILF 326
                     D ++  +   D S+ R     WE  K + F P P    +MV +  +  +F
Sbjct: 281 --------FDDNYFNDLVVFDLSSFRRDDSHWEFIKPRSFIPPPITNHTMVSYDFKLWVF 332

Query: 327 GGVYDFEETEESLDSIFYNDLFSYQIESNRWYALQLRSQ 365
           GG        ++L+ +  N +F Y    N W  ++   Q
Sbjct: 333 GG--------DTLEGLL-NQVFMYDPAVNDWCVVETTCQ 362

 Score = 35.0 bits (79), Expect = 0.66,   Method: Compositional matrix adjust.
 Identities = 27/103 (26%), Positives = 42/103 (40%), Gaps = 13/103 (12%)

Query: 171 WLLDCTTREWTKVEQ-------KNGPSARSGHRITVWKNYFILHGGFRDLGSTTSYLNDS 223
           ++ D    +W  VE        +N P     H   ++K    + GG  +      YLND 
Sbjct: 345 FMYDPAVNDWCVVETTCQDDDLENMPPPMQEHATLIYKGLMCIVGGKDE---QDHYLNDV 401

Query: 224 WLFDITSYKW-RQIEFPPNHPVPDARSGHSLIPTQEGAVLWGG 265
           +  ++ S KW R   F     +P  RSGHS+   +   +L  G
Sbjct: 402 YFLNLKSLKWFRLPRF--MDGIPQGRSGHSVTLLKNDKLLIMG 442

>YHR158C Chr8 complement(413685..417179) [3495 bp, 1164 aa] {ON}
           KEL1Protein required for proper cell fusion and cell
           morphology; functions in a complex with Kel2p to
           negatively regulate mitotic exit, interacts with Tem1p
           and Lte1p; localizes to regions of polarized growth;
           potential Cdc28p substrate
          Length = 1164

 Score = 54.3 bits (129), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 58/223 (26%), Positives = 93/223 (41%), Gaps = 44/223 (19%)

Query: 167 YSDTWLL---DCTTR-EWTKVE-QKNGPSARSGHRITVWKNYFILHGGFRDLGSTTSYLN 221
           Y DTW+L   D  TR   T ++  +  P  R GH   +  N F++ GG     +    ++
Sbjct: 152 YGDTWILTAFDNATRFSTTTIDISEATPPPRVGHAAVLCGNAFVVFGGDTHKVNKEGLMD 211

Query: 222 DS-WLFDITSYKWRQIEFP-PNHPVPDARSGH--SLIPTQEGAV---LWGGYCKVKAGKG 274
           D  +L +I SYKW     P P  P P  R GH  S+I T +      ++GG         
Sbjct: 212 DDIYLLNINSYKWT---VPAPVGPRPLGRYGHKISIIATTQMKTKLYVFGGQ-------- 260

Query: 275 LQKGKILGDCWYLKMKA-DPSAVR-----WERRKKQGFQPSPRVGCSMVHHKGRGILFGG 328
                   D ++  +   D S+ R     WE  K + F P P    +M+ +  +  +FGG
Sbjct: 261 ------FDDTYFNDLAVYDLSSFRRPDSHWEFLKPRTFTPPPITNFTMISYDSKLWVFGG 314

Query: 329 VYDFEETEESLDSIFYNDLFSYQIESNRWYALQLRSQRKKVVR 371
                   ++L  +  ND+F Y    N W+ +    ++   V+
Sbjct: 315 --------DTLQGLV-NDVFMYDPAINDWFIIDTTGEKPPPVQ 348

>TBLA0C06530 Chr3 complement(1577728..1581246) [3519 bp, 1172 aa]
           {ON} Anc_5.88 YGR238C
          Length = 1172

 Score = 51.6 bits (122), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 53/194 (27%), Positives = 81/194 (41%), Gaps = 35/194 (18%)

Query: 189 PSARSGHRITVWKNYFILHGGFRDLGSTTSYLNDS-WLFDITSYKWRQIEFPPNHPVPDA 247
           P  R GH  T+  N F++ GG     +    ++D  +LF+I SYKW   +  P  P P  
Sbjct: 140 PPPRVGHASTLCGNAFVIFGGDTHKTNKDGLMDDDIYLFNINSYKWTIPQ--PVGPRPLG 197

Query: 248 RSGH--SLIPTQEGAV---LWGGYCKVKAGKGLQKGKILGDCWYLKMKADPSAVR----- 297
           R GH  S+I T +      ++GG         L        C Y     D S+ R     
Sbjct: 198 RYGHKISIIATSQMKTKLYVFGGQFDDSYFNDL--------CVY-----DLSSFRKPESH 244

Query: 298 WERRKKQGFQPSPRVGCSMVHHKGRGILFGGVYDFEETEESLDSIFYNDLFSYQIESNRW 357
           WE  K + F P P    +MV +  +  +FGG     +T++ L     N LF +    N W
Sbjct: 245 WEFLKPKSFIPPPLTNHTMVSYDYKLWVFGG-----DTQQGL----INQLFMFDPVINDW 295

Query: 358 YALQLRSQRKKVVR 371
             ++   ++   V+
Sbjct: 296 RVVETTGEKPPPVQ 309

 Score = 31.6 bits (70), Expect = 8.2,   Method: Compositional matrix adjust.
 Identities = 29/121 (23%), Positives = 50/121 (41%), Gaps = 14/121 (11%)

Query: 92  ELLLFGGENTSQEQGVTHFYNDLYTFTPDNDLWKKITSQNXXXXXXXXXXXXXXXGIALL 151
           +L +FGG+    +QG     N L+ F P  + W+ + +                  +  +
Sbjct: 269 KLWVFGGD---TQQG---LINQLFMFDPVINDWRVVETTGEKPPPVQEHAAVMFNDLMCI 322

Query: 152 HGGEFSSPKQNTFYHYSDTWLLDCTTREWTKVE--QKNGPSARSGHRITVWK-NYFILHG 208
            GG     K     + +  + L+  + +W K    + N P  RSGH IT+ K N  ++ G
Sbjct: 323 MGG-----KDEQDVYLNSVYFLNLKSLKWFKFNDYKLNIPQGRSGHSITLLKNNRLLIMG 377

Query: 209 G 209
           G
Sbjct: 378 G 378

>KLLA0E15511g Chr5 (1388626..1391343) [2718 bp, 905 aa] {ON} similar
           to uniprot|P50090 Saccharomyces cerevisiae YGR238C KEL2
           Protein that functions in a complex with Kel1p to
           negatively regulate mitotic exit interacts with Tem1p
           and Lte1p localizes to regions of polarized growth
           potential Cdc28p substrate AND similar to YHR158C
           uniprot|P38853 Saccharomyces cerevisiae YHR158C KEL1
           Protein required for proper cell fusion and cell
           morphology functions in a complex with Kel2p to
           negatively regulate mitotic exit interacts with Tem1p
           and Lte1p localizes to regions of polarized growth
           potential Cdc28p substrate
          Length = 905

 Score = 51.6 bits (122), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 55/208 (26%), Positives = 85/208 (40%), Gaps = 34/208 (16%)

Query: 167 YSDTWL---LDCTT--REWTKVEQKNGPSARSGHRITVWKNYFILHGGFRDLGSTTSYLN 221
           Y DTW+   LD  T  +  T       P  R GH  T+  N F++ GG     +    ++
Sbjct: 132 YGDTWIIKSLDNATSFKSITVPIADATPPPRVGHASTLCGNAFVIFGGDTHKVNDAGLMD 191

Query: 222 DS-WLFDITSYKWRQIEFP-PNHPVPDARSGHSLIPTQEGAVLWGGYCKVKAGKGLQKGK 279
           D  +LF+I S+KW     P P  P P  R GH +      +++     K K       G 
Sbjct: 192 DDIYLFNINSHKWT---IPTPQGPRPLGRYGHKI------SIIAANQMKTKL---YVFGG 239

Query: 280 ILGDCWYLKMKA-DPSAVR-----WERRKKQGFQPSPRVGCSMVHHKGRGILFGGVYDFE 333
              D ++  +   D S+ R     WE  K   F P P    +M+    +  +FGG     
Sbjct: 240 QFDDTYFNDLAEFDLSSFRRSDSHWEFIKPATFMPPPLANHTMISFDHKLWVFGG----- 294

Query: 334 ETEESLDSIFYNDLFSYQIESNRWYALQ 361
           +T + L     N++F +   +N W  +Q
Sbjct: 295 DTPQGL----TNEVFMFDPAANDWCVVQ 318

 Score = 36.2 bits (82), Expect = 0.33,   Method: Compositional matrix adjust.
 Identities = 26/99 (26%), Positives = 45/99 (45%), Gaps = 7/99 (7%)

Query: 169 DTWLLDCTTREWTKVEQK-NGPSARSGHRITVWKNYFILHGGFRDLGSTTSYLNDSWLFD 227
           + ++ D    +W  V+   N P     H   ++++   + GG +D  +  +Y N  +  +
Sbjct: 303 EVFMFDPAANDWCVVQTTGNIPPPLQEHAAIIYRDLMCVFGG-KD--AQDNYSNAVYFLN 359

Query: 228 ITSYKWRQIEFPP-NHPVPDARSGHSLIPTQEGAVLWGG 265
             S KW   + P  N+ +P ARSGHSL       +L  G
Sbjct: 360 FRSLKW--FKLPTFNNMIPRARSGHSLTLLSNNKLLIMG 396

>CAGL0I02090g Chr9 complement(177324..180734) [3411 bp, 1136 aa]
           {ON} some similarities with uniprot|P38853 Saccharomyces
           cerevisiae YHR158c KEL1 involved in cell fusion and
           morphology
          Length = 1136

 Score = 50.1 bits (118), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 53/216 (24%), Positives = 89/216 (41%), Gaps = 46/216 (21%)

Query: 167 YSDTWLLDCT---------TREWTKVE-QKNGPSARSGHRITVWKNYFILHGGFRDLGST 216
           Y DTW+L  +         + + T +E  ++ P  R GH  T+  N F++ GG     ++
Sbjct: 186 YGDTWILTASDIDKTGAINSFKSTTIEITESTPPPRVGHASTLCGNAFVVFGGDTHKVNS 245

Query: 217 TSYLNDS-WLFDITSYKWRQIEFP-PNHPVPDARSGHSLI---PTQEGAVLWGGYCKVKA 271
              ++D  +L +I SYKW     P P    P  R GH ++     Q    L+GG      
Sbjct: 246 DGLMDDDLYLLNINSYKWT---IPKPVGQRPLGRYGHKIVTISAEQTKLYLFGGQ----- 297

Query: 272 GKGLQKGKILGDCWYLKMKA-DPSAVR-----WERRKKQGFQPSPRVGCSMVHHKGRGIL 325
                      D ++  +   D S+ R     W   K  GF P P    +MV ++ +  +
Sbjct: 298 ---------FDDTYFGDLAVFDLSSFRRPDSHWVFLKPSGFNPPPLTNHTMVTYQDKIWV 348

Query: 326 FGGVYDFEETEESLDSIFYNDLFSYQIESNRWYALQ 361
           FGG        ++L+    N ++ Y   +N W  ++
Sbjct: 349 FGG--------DTLEEGLINRVYLYSPTNNSWEIVE 376

 Score = 40.0 bits (92), Expect = 0.022,   Method: Compositional matrix adjust.
 Identities = 28/97 (28%), Positives = 45/97 (46%), Gaps = 5/97 (5%)

Query: 170 TWLLDCTTREWTKVEQKNG-PSARSGHRITVWKNYFILHGGFRDLGSTTSYLNDSWLFDI 228
            +L   T   W  VE     P     H   V+K+   + GG +D  +  +YLN  +  ++
Sbjct: 362 VYLYSPTNNSWEIVETTGDIPPPMQEHAAIVYKDLMCVVGG-KD--AEDNYLNTLYFLNL 418

Query: 229 TSYKWRQIEFPPNHPVPDARSGHSLIPTQEGAVLWGG 265
            S KW ++ F  N+ +P  RSGHS+   +   +L  G
Sbjct: 419 QSLKWFKLPFYKNN-IPQGRSGHSVTLLKNDQILIMG 454

>CAGL0F07997g Chr6 complement(785803..788613) [2811 bp, 936 aa] {ON}
           weakly similar to uniprot|P50090 Saccharomyces
           cerevisiae YGR238c KEL2 or uniprot|P38853 Saccharomyces
           cerevisiae YHR158c KEL1
          Length = 936

 Score = 50.1 bits (118), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 53/217 (24%), Positives = 83/217 (38%), Gaps = 32/217 (14%)

Query: 167 YSDTWLLDCTTREWTKVEQK-----NGPSARSGHRITVWKNYFILHGG-FRDLGSTTSYL 220
           Y DTW+L   +       Q      N P  R GH  T+  N  ++ GG    L S     
Sbjct: 201 YGDTWMLTANSDSTNFTTQVIDLTVNTPPPRVGHAATLCGNALVIFGGDTHKLNSEGLLD 260

Query: 221 NDSWLFDITSYKWRQIEFP-PNHPVPDARSGHSL-----IPTQEGAVLWGGYCKVKAGKG 274
           +D +LF++ S++W     P P    P  R GH +      P +    L+GG         
Sbjct: 261 DDLYLFNVDSHRW---TIPTPIGTRPLGRYGHQVSVIATTPKKAKLYLFGGQLDDNYFND 317

Query: 275 LQKGKILGDCWYLKMKADPSAVRWERRKKQGFQPSPRVGCSMVHHKGRGILFGGVYDFEE 334
           L         + L    +P + RW+  K + F P P    +MV +  +  +FGG    E 
Sbjct: 318 LA-------MYDLSDFRNPHS-RWQFLKSKAFTPPPLTNHTMVAYDYKLWVFGGSSRGE- 368

Query: 335 TEESLDSIFYNDLFSYQIESNRWYALQLRSQRKKVVR 371
                     N L+ Y  + N W  L+    + + ++
Sbjct: 369 --------LQNQLYVYIPDLNEWRCLETEGDKPQPIQ 397

 Score = 33.9 bits (76), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 36/144 (25%), Positives = 61/144 (42%), Gaps = 20/144 (13%)

Query: 92  ELLLFGGENTSQEQGVTHFYNDLYTFTPDNDLWKKITSQNXXXXXXXXXXXXXXXGIALL 151
           +L +FGG +  + Q      N LY + PD + W+ + ++                 +  +
Sbjct: 357 KLWVFGGSSRGELQ------NQLYVYIPDLNEWRCLETEGDKPQPIQEHSATIYKNLMCV 410

Query: 152 HGGEFSSPK-QNTFYHYSDTWLLDCTTREWTKVEQK--NGPSARSGHRITVWKNYFILHG 208
            GG+    + QNT Y       L+  T +W +++    N P  RSG  +++ +N  IL  
Sbjct: 411 FGGKNKDDEYQNTMY------FLNLQTLKWYRLDTSHCNEPLPRSGQSMSLMQNDKILIM 464

Query: 209 GFRDLGSTTSY-LNDSWLFDITSY 231
           G    G    Y +N + L DI  Y
Sbjct: 465 G----GDKNDYCVNGANLNDIDEY 484

>Kpol_1010.62 s1010 complement(151895..154816) [2922 bp, 973 aa]
           {ON} complement(151895..154816) [2922 nt, 974 aa]
          Length = 973

 Score = 49.7 bits (117), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 51/179 (28%), Positives = 75/179 (41%), Gaps = 25/179 (13%)

Query: 189 PSARSGHRITVWKNYFILHGGFRDLGSTTSYLNDS-WLFDITSYKWRQIEFPPNHPVPDA 247
           P  R GH  T+  N  IL GG     +    ++D  +LF++ SYKW   E  P    P  
Sbjct: 102 PPPRVGHASTICGNALILFGGDTHKVNEDGLMDDDLYLFNLNSYKWTIPE--PIGLRPLG 159

Query: 248 RSGH--SLI---PTQEGAVLWGGYCKVKAGKGLQKGKILGDCWYLKMKADPSAVRWERRK 302
           R GH  S+I   PT+    L+GG         L         + L     P A +WE  K
Sbjct: 160 RYGHKISIIATQPTKTKLFLFGGQFDDTYFNDLS-------MFDLSTFRKPDA-QWEFIK 211

Query: 303 KQGFQPSPRVGCSMVHHKGRGILFGGVYDFEETEESLDSIFYNDLFSYQIESNRWYALQ 361
            + F P P    +M+ +  +  +FGG        E+L  +  N++F Y    N W  ++
Sbjct: 212 PKSFFPPPVSNHTMISYDNKLWVFGG--------ETLQGLI-NEVFVYDPIVNDWSVIE 261

 Score = 35.0 bits (79), Expect = 0.71,   Method: Compositional matrix adjust.
 Identities = 25/84 (29%), Positives = 38/84 (45%), Gaps = 5/84 (5%)

Query: 274 GLQKGKILGDCWYLKMKADPSAVRWERRKKQGFQPSPRVGCSMVHHKGRGILFGGVYDFE 333
           GL++  + GD W +  K D S       +     P PRVG +        ILFGG  D  
Sbjct: 69  GLREQSVYGDVWSINHKDDKS-FSASSIEITPTTPPPRVGHASTICGNALILFGG--DTH 125

Query: 334 ETEESLDSIFYNDLFSYQIESNRW 357
           +  E  D +  +DL+ + + S +W
Sbjct: 126 KVNE--DGLMDDDLYLFNLNSYKW 147

>Kwal_14.1019 s14 (159934..162870) [2937 bp, 978 aa] {ON} YHR158C
           (KEL1) - involved in cell fusion and morphology;
           contains six Kelch repeats [contig 244] FULL
          Length = 978

 Score = 49.3 bits (116), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 56/218 (25%), Positives = 91/218 (41%), Gaps = 44/218 (20%)

Query: 167 YSDTWLL---DCTTREWTK-VEQKNG-PSARSGHRITVWKNYFILHGG-FRDLGSTTSYL 220
           Y DTW++   +   R  +K VE  +  P  R GH  T+  N F++ GG    + S     
Sbjct: 115 YGDTWIVTSHENGARFTSKTVEISDATPPPRVGHASTLCGNAFVIFGGDTHKVNSDGLMD 174

Query: 221 NDSWLFDITSYKWRQIEFP-PNHPVPDARSGH-----SLIPTQEGAVLWGGYCKVKAGKG 274
           +D +LF+I SYKW     P P  P P  R GH     ++ P +    ++GG         
Sbjct: 175 DDVYLFNINSYKWT---IPNPVGPRPLGRYGHKISIIAMSPMKTKLYVFGGQ-------- 223

Query: 275 LQKGKILGDCWYLKMKA-DPSAVR-----WERRKKQGFQPSPRVGCSMVHHKGRGILFGG 328
                   D ++  +   D S+ R     W+      F P P    +M+ +  +  +FGG
Sbjct: 224 ------FDDTYFNDLAVFDLSSFRRPDSSWQFITPNSFTPPPLTNHAMISYDYKLWVFGG 277

Query: 329 VYDFEETEESLDSIFYNDLFSYQIESNRWYALQLRSQR 366
                +T + L     +D+F +  + N W  +Q   Q+
Sbjct: 278 -----DTPQGL----IDDVFVFDPQVNDWKFIQTTGQK 306

>KLTH0C01474g Chr3 (131243..134413) [3171 bp, 1056 aa] {ON} similar
           to uniprot|P38853 Saccharomyces cerevisiae YHR158C KEL1
           Protein required for proper cell fusion and cell
           morphology functions in a complex with Kel2p to
           negatively regulate mitotic exit interacts with Tem1p
           and Lte1p localizes to regions of polarized growth
           potential Cdc28p substrate
          Length = 1056

 Score = 49.3 bits (116), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 57/213 (26%), Positives = 89/213 (41%), Gaps = 44/213 (20%)

Query: 167 YSDTWLL---DCTTREWTKVEQ--KNGPSARSGHRITVWKNYFILHGG-FRDLGSTTSYL 220
           Y DTW++   D  ++  +K        P  R GH  T+  N F++ GG    + S     
Sbjct: 117 YGDTWIISAHDNGSKFSSKTVDITDTTPPPRVGHASTLCGNAFVIFGGDTHKVNSDGLMD 176

Query: 221 NDSWLFDITSYKWRQIEFP-PNHPVPDARSGH--SLIPTQEGAV---LWGGYCKVKAGKG 274
           +D +LF+I SYKW     P P  P P  R GH  S+I T +      ++GG         
Sbjct: 177 DDVYLFNINSYKWT---IPRPVGPRPLGRYGHKISIIATSQMRTKLYVFGGQ-------- 225

Query: 275 LQKGKILGDCWYLKMKA-DPSAVR-----WERRKKQGFQPSPRVGCSMVHHKGRGILFGG 328
                   D ++  +   D S+ R     W+  K   F P P    +M+ +  +  +FGG
Sbjct: 226 ------FDDTYFNDLTVFDLSSFRRPDSHWQFIKPNTFTPPPLTNHTMISYDYKLWVFGG 279

Query: 329 VYDFEETEESLDSIFYNDLFSYQIESNRWYALQ 361
                +T + L     ND+F +  + N W  +Q
Sbjct: 280 -----DTPQGL----INDVFMFDPQINDWKVMQ 303

 Score = 39.7 bits (91), Expect = 0.029,   Method: Compositional matrix adjust.
 Identities = 46/205 (22%), Positives = 88/205 (42%), Gaps = 42/205 (20%)

Query: 169 DTWLLDCTTREWTKVEQKNGPS--ARSGHRITVWKN------YFILHGGFRDLGSTTSYL 220
           D +L +  + +WT + +  GP    R GH+I++          ++  G F D     +Y 
Sbjct: 178 DVYLFNINSYKWT-IPRPVGPRPLGRYGHKISIIATSQMRTKLYVFGGQFDD-----TYF 231

Query: 221 NDSWLFDITSYK-----WRQIEFPPNHPVPDARSGHSLIPTQEGAVLWGGYCKVKAGKGL 275
           ND  +FD++S++     W+ I+  PN   P   + H++I       ++GG       +GL
Sbjct: 232 NDLTVFDLSSFRRPDSHWQFIK--PNTFTPPPLTNHTMISYDYKLWVFGG----DTPQGL 285

Query: 276 QKGKILGDCWYLKMKADPSAVRWERRKKQGFQPSPRVGCSMVHHKGRGILFGGVYDFEET 335
                + D +      DP    W+  +  G +P P     +  H    +L+G +      
Sbjct: 286 -----INDVFMF----DPQINDWKVMQTTGDKPPP-----LQEHA--AVLYGDLMCVVGG 329

Query: 336 EESLDSIFYNDLFSYQIESNRWYAL 360
           ++  D ++ N +F   + S +W+ L
Sbjct: 330 KDEQD-VYSNSVFFLNLISLKWFKL 353

>NDAI0D02600 Chr4 complement(600880..604383) [3504 bp, 1167 aa] {ON}
           Anc_5.88 YGR238C
          Length = 1167

 Score = 49.3 bits (116), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 59/215 (27%), Positives = 87/215 (40%), Gaps = 46/215 (21%)

Query: 167 YSDTWLLD------CTTREWTKVE-QKNGPSARSGHRITVWKNYFILHGG-FRDLGSTTS 218
           Y DTW+L        TT     V+  +N P  R GH  T+  N F++ GG    +    S
Sbjct: 199 YGDTWILSYENNGLSTTITSKTVDISENTPPPRVGHAATLCGNAFVIFGGDTHKVNKDGS 258

Query: 219 YLNDSWLFDITSYKWRQIEFP-PNHPVPDARSGH--SLIPTQEGAV---LWGGYCKVKAG 272
             +D +LF+I SYKW     P P    P  R GH  S+I T +      L+GG       
Sbjct: 259 MDDDIYLFNINSYKWT---IPKPVGQRPLGRYGHKISIIATSQMKTKLYLFGGQ------ 309

Query: 273 KGLQKGKILGDCWYLKMKA-DPSAVR-----WERRKKQGFQPSPRVGCSMVHHKGRGILF 326
                     D ++  +   D S+ R     WE  + + F P P    +M  +  +  +F
Sbjct: 310 --------FDDTYFNDLVVFDLSSFRRPDSHWEFIRPKSFIPPPLTNHTMCSYDHKLWVF 361

Query: 327 GGVYDFEETEESLDSIFYNDLFSYQIESNRWYALQ 361
           GG     +T + L     N +F Y    N W  ++
Sbjct: 362 GG-----DTLQGL----TNQVFMYDPVDNDWCVVE 387

 Score = 38.5 bits (88), Expect = 0.068,   Method: Compositional matrix adjust.
 Identities = 26/102 (25%), Positives = 45/102 (44%), Gaps = 11/102 (10%)

Query: 171 WLLDCTTREWTKVEQ-------KNGPSARSGHRITVWKNYFILHGGFRDLGSTTSYLNDS 223
           ++ D    +W  VE         N P     H   ++K+   + GG  +   + +YLND 
Sbjct: 374 FMYDPVDNDWCVVETFANNNDVSNIPPPIQEHAAVLYKDLMCVIGGKDE---SDNYLNDV 430

Query: 224 WLFDITSYKWRQIEFPPNHPVPDARSGHSLIPTQEGAVLWGG 265
           +  ++ + KW ++ F     VP  RSGHS+   +   +L  G
Sbjct: 431 YFLNLKTLKWFKLPF-YKEGVPQGRSGHSVTLLKNDKILIMG 471

>TPHA0A05170 Chr1 complement(1161610..1164660) [3051 bp, 1016 aa]
           {ON} Anc_5.88 YGR238C
          Length = 1016

 Score = 48.9 bits (115), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 55/203 (27%), Positives = 85/203 (41%), Gaps = 46/203 (22%)

Query: 167 YSDTWLLDCTTREWTKVEQKN------GPSARSGHRITVWKNYFILHGGFRDLGSTTSYL 220
           Y DTW +  +T   T+   K        P  R GH  T+  N F++ GG     +    +
Sbjct: 181 YGDTWSI-TSTNNGTQFISKALEILDLSPPPRVGHASTLCGNAFVVFGGDTHKVNKDGLM 239

Query: 221 NDS-WLFDITSYKWRQIEFP-PNHPVPDARSGH--SLIPTQEGAV---LWGGYCKVKAGK 273
           +D  +LF+I S+KW     P P  P P  R GH  S+I T        L+GG        
Sbjct: 240 DDDIYLFNINSHKWT---IPSPVGPRPLGRYGHKISIIATSSSKTKLYLFGGQ------- 289

Query: 274 GLQKGKILGDCWYLKMKA-DPSAVR-----WERRKKQGFQPSPRVGCSMVHHKGRGILFG 327
                    D ++  +   D S+ R     WE  K +G  P P    +MV +  +  +FG
Sbjct: 290 -------FDDTYFNDIAVFDLSSFRRADSHWEFIKPKGLIPPPMTNHTMVTYDNKLWVFG 342

Query: 328 GVYDFEETEESLDSIFYNDLFSY 350
           G     +T++ L     ND++++
Sbjct: 343 G-----DTKDGL----INDIYAF 356

>Suva_7.530 Chr7 complement(920446..923130) [2685 bp, 894 aa] {ON}
           YGR238C (REAL)
          Length = 894

 Score = 48.5 bits (114), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 59/222 (26%), Positives = 89/222 (40%), Gaps = 42/222 (18%)

Query: 167 YSDTWL----LDCTTREWTKVE-QKNGPSARSGHRITVWKNYFILHGGFRDLGSTTSYLN 221
           Y DTW     LD T+     ++  +N P  R GH  T+  N +++ GG     +    L+
Sbjct: 112 YGDTWQITGNLDGTSFVSKTIQIGQNTPPPRVGHASTICGNAYVVFGGDTHKLNMNRLLD 171

Query: 222 DS-WLFDITSYKWRQIEFPPNHPVPDARSGH--SLI---PTQEGAVLWGGYCKVKAGKGL 275
           D  +LF+I SYKW   +  P    P  R GH  S+I   P Q    L+GG          
Sbjct: 172 DDLYLFNINSYKWTIPQ--PVGTRPLGRYGHKISIIANNPMQTKLFLFGGQ--------- 220

Query: 276 QKGKILGDCWYLKMKA-DPSAVR-----WERRKKQGFQPSPRVGCSMVHHKGRGILFGGV 329
                + + ++  +   D S+ R     W   K     P P    +MV    +  +FGG 
Sbjct: 221 -----IDETYFNDLAMFDLSSFRRPNSHWVFLKPVSIVPPPLTNHTMVTFDNKLWVFGG- 274

Query: 330 YDFEETEESLDSIFYNDLFSYQIESNRWYALQLRSQRKKVVR 371
               +T  +L     N+ F Y    N W  +Q   +R   V+
Sbjct: 275 ----KTPNTLS----NETFCYDPVQNDWSKIQTTGERPPAVQ 308

 Score = 41.6 bits (96), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 29/101 (28%), Positives = 53/101 (52%), Gaps = 8/101 (7%)

Query: 168 SDTWLLDCTTREWTKVEQKNG--PSARSGHRITVWKNYFILHGGFRDLGSTTSYLNDSWL 225
           ++T+  D    +W+K+ Q  G  P A   H   V+K+   + GG +D+ +  +Y ND + 
Sbjct: 282 NETFCYDPVQNDWSKI-QTTGERPPAVQEHASVVYKHLMCIFGG-KDIQN--AYSNDVYF 337

Query: 226 FDITSYKWRQIEFPPNHPVPDARSGHSL-IPTQEGAVLWGG 265
            ++ ++KW ++       +P  RSGHSL +   +  V+ GG
Sbjct: 338 LNLITFKWYKLPR-IKEGLPKERSGHSLTLIKNDKLVIMGG 377

>YGR238C Chr7 complement(966039..968687) [2649 bp, 882 aa] {ON}
           KEL2Protein that functions in a complex with Kel1p to
           negatively regulate mitotic exit, interacts with Tem1p
           and Lte1p; localizes to regions of polarized growth;
           potential Cdc28p substrate
          Length = 882

 Score = 47.4 bits (111), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 47/204 (23%), Positives = 87/204 (42%), Gaps = 40/204 (19%)

Query: 169 DTWLLDCTTREWTKVEQKNG--PSARSGHRITV-----WKNYFILHGGFRDLGSTTSYLN 221
           D +L +  + +WT + Q  G  P  R GH+I++      +    L GG  D     +Y N
Sbjct: 173 DLYLFNINSYKWT-IPQPIGRRPLGRYGHKISIIASNPMQTKLYLFGGQVD----ETYFN 227

Query: 222 DSWLFDITSYK-----WRQIEFPPNHPVPDARSGHSLIPTQEGAVLWGGYCKVKAGKGLQ 276
           D  +FD++S++     W  +E  P   +P   + H+++       ++GG          +
Sbjct: 228 DLVVFDLSSFRRPNSHWEFLE--PVGDLPPPLTNHTMVAYDNKLWVFGG----------E 275

Query: 277 KGKILGDCWYLKMKADPSAVRWERRKKQGFQPSPRVGCSMVHHKGRGILFGGVYDFEETE 336
             K + +  Y   + DP+   W + K  G +P P    + V +K    + GG        
Sbjct: 276 TPKTISNDTY---RYDPAQSEWSKVKTTGEKPPPIQEHASVVYKHLMCVLGG-------- 324

Query: 337 ESLDSIFYNDLFSYQIESNRWYAL 360
           +   + + ND++   + S +WY L
Sbjct: 325 KDTHNAYSNDVYFLNLLSLKWYKL 348

 Score = 46.2 bits (108), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 54/216 (25%), Positives = 92/216 (42%), Gaps = 30/216 (13%)

Query: 167 YSDTWLL----DCTTREWTKVE-QKNGPSARSGHRITVWKNYFILHGGFRDLGSTTSYLN 221
           Y D W +    D T+    +++  +N P  R GH  T+  N +++ GG     +    L+
Sbjct: 112 YGDVWQIAANADGTSFTSKRIDIDQNTPPPRVGHASTICGNAYVVFGGDTHKLNKNGLLD 171

Query: 222 DS-WLFDITSYKWRQIEFPPNHPVPDARSGH--SLI---PTQEGAVLWGGYCKVKAGKGL 275
           D  +LF+I SYKW   +  P    P  R GH  S+I   P Q    L+GG         L
Sbjct: 172 DDLYLFNINSYKWTIPQ--PIGRRPLGRYGHKISIIASNPMQTKLYLFGGQVDETYFNDL 229

Query: 276 QKGKILGDCWYLKMKADPSAVRWERRKKQGFQPSPRVGCSMVHHKGRGILFGGVYDFEET 335
               ++ D    +    P++  WE  +  G  P P    +MV +  +  +FGG     ET
Sbjct: 230 ----VVFDLSSFRR---PNS-HWEFLEPVGDLPPPLTNHTMVAYDNKLWVFGG-----ET 276

Query: 336 EESLDSIFYNDLFSYQIESNRWYALQLRSQRKKVVR 371
            +++     ND + Y    + W  ++   ++   ++
Sbjct: 277 PKTIS----NDTYRYDPAQSEWSKVKTTGEKPPPIQ 308

 Score = 43.5 bits (101), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 33/136 (24%), Positives = 56/136 (41%), Gaps = 13/136 (9%)

Query: 231 YKWRQIEFPPNHPVPDARSGHSLIPTQEGAVLWGGYCKVKAGKGLQKGKILGDCWYLKMK 290
           Y W +++   N P P  R   S I T +  +   G        GL    + GD W +   
Sbjct: 71  YIWNRVKLK-NSPFPRYRHSSSFIVTNDNRIFVTG--------GLHDQSVYGDVWQIAAN 121

Query: 291 ADPSAVRWERRKKQGFQPSPRVGCSMVHHKGRGILFGGVYDFEETEESLDSIFYNDLFSY 350
           AD ++   +R       P PRVG +        ++FGG    +  + + + +  +DL+ +
Sbjct: 122 ADGTSFTSKRIDIDQNTPPPRVGHASTICGNAYVVFGG----DTHKLNKNGLLDDDLYLF 177

Query: 351 QIESNRWYALQLRSQR 366
            I S +W   Q   +R
Sbjct: 178 NINSYKWTIPQPIGRR 193

>TPHA0H01080 Chr8 complement(232804..235290) [2487 bp, 828 aa] {ON}
           Anc_5.88 YGR238C
          Length = 828

 Score = 46.2 bits (108), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 46/182 (25%), Positives = 68/182 (37%), Gaps = 25/182 (13%)

Query: 189 PSARSGHRITVWKNYFILHGGFRDLGSTTSYL--NDSWLFDITSYKWRQIEFP-PNHPVP 245
           P  R GH  T+  N  I+ GG     + ++ L  +D +  ++ + KW     P P    P
Sbjct: 95  PPPRVGHAATLCGNALIVFGGDTHKVNVSNGLMDDDLYFLNLDTTKWT---IPSPKGIRP 151

Query: 246 DARSGHSLIPTQEGAVLWGGYCKVKAGKGLQKGKILGDCWYLKMKADPSAVRWERRKKQG 305
             R GH +        L+GG         L K  +L            +  +WE  K +G
Sbjct: 152 LGRYGHKISVINSNLYLFGGQFDETYFNDLVKFDLLN--------FKDANSQWEFIKPKG 203

Query: 306 FQPSPRVGCSMVHHKGRGILFGG-VYDFEETEESLDSIFYNDLFSYQIESNRWYALQLRS 364
           F P P    SM   + +  +FGG  Y           +  N+ F Y  E N W  L+   
Sbjct: 204 FIPPPLSNFSMCTFENKLYVFGGDTY----------QVLTNETFVYDPELNEWSILETFG 253

Query: 365 QR 366
           Q 
Sbjct: 254 QE 255

 Score = 33.5 bits (75), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 27/92 (29%), Positives = 45/92 (48%), Gaps = 11/92 (11%)

Query: 168 SDTWLLDCTTREWTKVE-----QKNGPSARSGHRITVWKNYFILHGGFRDLGSTTSYLND 222
           ++T++ D    EW+ +E       N P     H   ++K+   + GG +D  S  +YLN 
Sbjct: 234 NETFVYDPELNEWSILETFGQEDTNKPPPIQEHAGIIYKHLMCVVGG-KD--SNDNYLNS 290

Query: 223 SWLFDITSYKWRQI-EFPPNHPVPDARSGHSL 253
            +  ++ S KW ++ EF  N      RSGHS+
Sbjct: 291 VYFLNLISKKWFKLPEF--NDTAMLGRSGHSV 320

>Ecym_2061 Chr2 (99788..103876) [4089 bp, 1362 aa] {ON} similar to
           Ashbya gossypii ADL149W
          Length = 1362

 Score = 46.2 bits (108), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 54/211 (25%), Positives = 84/211 (39%), Gaps = 42/211 (19%)

Query: 167 YSDTWLLDC---------TTREWTKVEQKNGPSARSGHRITVWKNYFILHGGFRDLGSTT 217
           Y DTW++            T E T+      P  R GH  T+  N F++ GG     +  
Sbjct: 197 YGDTWIIKSHENGNKFTSKTVEITETT----PPPRVGHASTLCGNAFVIFGGDTHKTNAE 252

Query: 218 SYLNDS-WLFDITSYKWRQIEFP-PNHPVPDARSGHSLIPTQEGAVLWGGYCKVKAGKGL 275
             ++D  +L +I S+KW     P P  P P  R GH +      +++     K K     
Sbjct: 253 GLMDDDVYLLNINSHKWT---IPRPVGPRPLGRYGHKI------SIIATSQMKTKL---Y 300

Query: 276 QKGKILGDCWYLKMKA-DPSAVR-----WERRKKQGFQPSPRVGCSMVHHKGRGILFGGV 329
             G    D ++  +   D S+ R     W+  K   F P P    +MV +  +  +FGG 
Sbjct: 301 VFGGQFDDTYFNDLAVYDLSSFRRPDSHWQFLKPVSFVPPPLTNHTMVSYDYKLWVFGG- 359

Query: 330 YDFEETEESLDSIFYNDLFSYQIESNRWYAL 360
               +T + L     N+LF Y   +N W  +
Sbjct: 360 ----DTPQGL----INELFMYDPTTNDWSVV 382

>Smik_16.68 Chr16 (128068..130752) [2685 bp, 894 aa] {ON} YGR238C
           (REAL)
          Length = 894

 Score = 43.5 bits (101), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 45/204 (22%), Positives = 86/204 (42%), Gaps = 40/204 (19%)

Query: 169 DTWLLDCTTREWTKVEQKNG--PSARSGHRITVWKNY-----FILHGGFRDLGSTTSYLN 221
           D +L +  + +WT +    G  P  R GH+I++  +        L GG  D     +Y N
Sbjct: 173 DLYLFNINSYKWT-IPHPIGSRPLGRYGHKISIIASKQMHTELYLFGGQID----ETYFN 227

Query: 222 DSWLFDITSYK-----WRQIEFPPNHPVPDARSGHSLIPTQEGAVLWGGYCKVKAGKGLQ 276
           D  +FD++S++     W  +E  P   +P   + H+++       ++GG          +
Sbjct: 228 DLAVFDLSSFRRPNSHWEFLE--PISALPPPLTNHTMVTFDNKLWVFGG----------E 275

Query: 277 KGKILGDCWYLKMKADPSAVRWERRKKQGFQPSPRVGCSMVHHKGRGILFGGVYDFEETE 336
             K + +  Y     DP    W + +  G +P P    + V +K    +FGG        
Sbjct: 276 TPKTISNDTYC---YDPIQNAWSKVETTGEKPPPVQEHASVVYKHLMCVFGG-------- 324

Query: 337 ESLDSIFYNDLFSYQIESNRWYAL 360
           + + + + ND++   + S +W+ L
Sbjct: 325 KDIHNTYSNDVYFLNLLSLKWFKL 348

 Score = 42.7 bits (99), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 50/200 (25%), Positives = 82/200 (41%), Gaps = 43/200 (21%)

Query: 187 NGPSARSGHRITVWKNYFILHGG-FRDLGSTTSYLNDSWLFDITSYKWRQIEFPPNHPV- 244
           N P  R GH  T+  N +++ GG    L       +D +LF+I SYKW     P  HP+ 
Sbjct: 137 NTPPPRVGHASTMCGNAYVVFGGDTHKLNKNRLLDDDLYLFNINSYKWT---IP--HPIG 191

Query: 245 --PDARSGH--SLIPTQEGAV---LWGGYCKVKAGKGLQKGKILGDCWYLKMKA-DPSAV 296
             P  R GH  S+I +++      L+GG               + + ++  +   D S+ 
Sbjct: 192 SRPLGRYGHKISIIASKQMHTELYLFGGQ--------------IDETYFNDLAVFDLSSF 237

Query: 297 R-----WERRKKQGFQPSPRVGCSMVHHKGRGILFGGVYDFEETEESLDSIFYNDLFSYQ 351
           R     WE  +     P P    +MV    +  +FGG     ET +++     ND + Y 
Sbjct: 238 RRPNSHWEFLEPISALPPPLTNHTMVTFDNKLWVFGG-----ETPKTIS----NDTYCYD 288

Query: 352 IESNRWYALQLRSQRKKVVR 371
              N W  ++   ++   V+
Sbjct: 289 PIQNAWSKVETTGEKPPPVQ 308

 Score = 40.8 bits (94), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 30/127 (23%), Positives = 54/127 (42%), Gaps = 13/127 (10%)

Query: 231 YKWRQIEFPPNHPVPDARSGHSLIPTQEGAVLWGGYCKVKAGKGLQKGKILGDCWYLKMK 290
           Y W +I+   + P P  R   S I T +  +   G        GL    + GD W +   
Sbjct: 71  YIWNRIKLK-DSPFPRYRHSSSFITTNDNRIFVTG--------GLYDQSVYGDVWEITAN 121

Query: 291 ADPSAVRWERRKKQGFQPSPRVGCSMVHHKGRGILFGGVYDFEETEESLDSIFYNDLFSY 350
           A+ ++   +R +     P PRVG +        ++FGG    +  + + + +  +DL+ +
Sbjct: 122 ANGTSFTSKRIQIDHNTPPPRVGHASTMCGNAYVVFGG----DTHKLNKNRLLDDDLYLF 177

Query: 351 QIESNRW 357
            I S +W
Sbjct: 178 NINSYKW 184

 Score = 33.1 bits (74), Expect = 3.0,   Method: Compositional matrix adjust.
 Identities = 28/121 (23%), Positives = 50/121 (41%), Gaps = 14/121 (11%)

Query: 92  ELLLFGGENTSQEQGVTHFYNDLYTFTPDNDLWKKITSQNXXXXXXXXXXXXXXXGIALL 151
           +L +FGGE            ND Y + P  + W K+ +                  +  +
Sbjct: 268 KLWVFGGETPKT------ISNDTYCYDPIQNAWSKVETTGEKPPPVQEHASVVYKHLMCV 321

Query: 152 HGGEFSSPKQNTFYHYSDTWLLDCTTREWTKVE--QKNGPSARSGHRITVWKN-YFILHG 208
            GG+      NT+ +  D + L+  + +W K+   ++  P  RSGH +T+  N   ++ G
Sbjct: 322 FGGK---DIHNTYSN--DVYFLNLLSLKWFKLPCVKEGIPQERSGHSLTLMNNEKLVIMG 376

Query: 209 G 209
           G
Sbjct: 377 G 377

>ADL149W Chr4 (427096..430731) [3636 bp, 1211 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YHR158C (KEL1) and
           YGR238C (KEL2)
          Length = 1211

 Score = 43.5 bits (101), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 54/212 (25%), Positives = 83/212 (39%), Gaps = 42/212 (19%)

Query: 167 YSDTWLL---------DCTTREWTKVEQKNGPSARSGHRITVWKNYFILHGGFRDLGSTT 217
           Y DTW+L            T E T+      P  R GH  T+  N F++ GG     +  
Sbjct: 91  YGDTWILRAQDNGKQFSARTIEITETT----PPPRVGHAATLCGNAFVIFGGDTHKTNNE 146

Query: 218 SYLNDS-WLFDITSYKWRQIEFP-PNHPVPDARSGHSLIPTQEGAVLWGGYCKVKAGKGL 275
             ++D  +L ++ S+KW     P P  P P  R GH +      +++     K K     
Sbjct: 147 GLMDDDVYLLNVNSHKW---TIPHPVGPRPLGRYGHKI------SIIATSQMKTKL---Y 194

Query: 276 QKGKILGDCWYLKMKA-DPSAVR-----WERRKKQGFQPSPRVGCSMVHHKGRGILFGGV 329
             G    D ++  +   D S+ R     W   K   F P P    +MV +  +  +FGG 
Sbjct: 195 VFGGQFDDTYFNDLAVYDLSSFRRPDSHWVFVKPASFVPPPLTNHTMVSYDYKLWVFGG- 253

Query: 330 YDFEETEESLDSIFYNDLFSYQIESNRWYALQ 361
               +T + L     N+LF Y    N W  ++
Sbjct: 254 ----DTPQGL----INELFVYDPVVNDWSVVE 277

>Skud_7.572 Chr7 complement(940820..943471) [2652 bp, 883 aa] {ON}
           YGR238C (REAL)
          Length = 883

 Score = 42.7 bits (99), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 28/100 (28%), Positives = 48/100 (48%), Gaps = 6/100 (6%)

Query: 168 SDTWLLDCTTREWTKVEQKNG-PSARSGHRITVWKNYFILHGGFRDLGSTTSYLNDSWLF 226
           ++T+  D    +W+K+E     P     H   V+K+   + GG     +  +Y ND +  
Sbjct: 280 NETYCYDPIQNDWSKIETTGEIPPPVQEHASVVYKHIMCVFGGKY---THNAYSNDVYFL 336

Query: 227 DITSYKWRQIEFPPNHPVPDARSGHSL-IPTQEGAVLWGG 265
           D+ S+KW ++       +P  RSGHSL +   E  ++ GG
Sbjct: 337 DLLSFKWYKLPH-IKEGIPRERSGHSLTLMKNEKILIMGG 375

 Score = 40.8 bits (94), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 53/212 (25%), Positives = 85/212 (40%), Gaps = 42/212 (19%)

Query: 167 YSDTWLL----DCTTREWTKVE-QKNGPSARSGHRITVWKNYFILHGG-FRDLGSTTSYL 220
           Y D W +    D T+     ++  +N P  R GH  T+  N +++ GG    L       
Sbjct: 110 YGDVWQITANADGTSFTPKAIQIDRNTPPPRVGHASTLCGNAYVVFGGDTHKLNEDKLLD 169

Query: 221 NDSWLFDITSYKWRQIEFPPNHPVPDARSGH--SLI---PTQEGAVLWGGYCKVKAGKGL 275
           +D +LF++ SYKW   +  P    P  R GH  S+I   P Q    L+GG          
Sbjct: 170 DDIYLFNVNSYKWTIPQ--PIGSRPLGRYGHKISIIAYNPMQTKLYLFGGQ--------- 218

Query: 276 QKGKILGDCWYLKMKA-DPSAVR-----WERRKKQGFQPSPRVGCSMVHHKGRGILFGGV 329
                L   ++  +   D S+ R     WE  +     P P    +MV +  +  +FGG 
Sbjct: 219 -----LDKTYFNDLAMFDLSSFRRRNSHWEFLEPATTVPPPLANHTMVTYGNKLWVFGG- 272

Query: 330 YDFEETEESLDSIFYNDLFSYQIESNRWYALQ 361
               ET +++     N+ + Y    N W  ++
Sbjct: 273 ----ETPKTVS----NETYCYDPIQNDWSKIE 296

>Kwal_55.20756 s55 (545793..550520) [4728 bp, 1575 aa] {ON} YGL197W
           (MDS3) - 1:1 [contig 139] FULL
          Length = 1575

 Score = 33.5 bits (75), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 24/63 (38%), Positives = 32/63 (50%), Gaps = 4/63 (6%)

Query: 311 RVGCSMVHHKGRGILFGGVYDFEETEESLDSIFYNDLFSYQIESNRWYALQLRSQRKKVV 370
           RV  SM  H GR  LFGG+    +++  L  I  N+L+S  +E+  W  LQL S      
Sbjct: 138 RVFHSMCFHDGRLYLFGGLVVSPQSDYEL--IASNELWSLDLETKTW--LQLSSDPAITR 193

Query: 371 RLN 373
           R N
Sbjct: 194 RFN 196

>TBLA0A04320 Chr1 (1068199..1070715) [2517 bp, 838 aa] {ON} Anc_7.9
           YAL056W
          Length = 838

 Score = 33.1 bits (74), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 24/91 (26%), Positives = 37/91 (40%), Gaps = 10/91 (10%)

Query: 181 TKVEQKNGPSARSGHRITVWKNYFILHGGFRDLGSTTSYLNDSWLFDITSYKWRQIEFPP 240
           TK    +GP  +     T   +  ++HGG     + T   +D W FD  +  W QIE   
Sbjct: 636 TKSNGPSGPVLQLHINETSEGHTLVMHGG----SNATHIYSDMWWFDFETESWVQIETQA 691

Query: 241 NH------PVPDARSGHSLIPTQEGAVLWGG 265
                   P+  A +GHS+      ++  GG
Sbjct: 692 QTEDKGLVPIEMALAGHSMATVGSASIFVGG 722

>ZYRO0C00550g Chr3 (39312..41858) [2547 bp, 848 aa] {ON} similar to
           uniprot|Q08886 Saccharomyces cerevisiae YOR371C GPB1
           Proposed beta subunit of the heterotrimeric G protein
           that interacts with the receptor Grp1p has signaling
           role in response to nutrients involved in regulation of
           pseudohyphal growth through cAMP levels homolog of Gpb2p
          Length = 848

 Score = 32.7 bits (73), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 27/104 (25%), Positives = 37/104 (35%), Gaps = 10/104 (9%)

Query: 168 SDTWLLDCTTREWTKVEQKNGPSARSGHRITVWKNYFILHGGFRDLGSTTSYLNDSWLFD 227
           ++  L  C T   +          RS  +        I+HGG     + T    D W +D
Sbjct: 635 TNPLLKQCLTSSSSHSAPTKPLQPRSKTQPNFEHKVLIMHGG----SNKTDVCRDMWWYD 690

Query: 228 ITSYKWRQIEFPPNH------PVPDARSGHSLIPTQEGAVLWGG 265
           I +  W QI     H      P+     GHSL+     AV  GG
Sbjct: 691 IETETWSQITTHGKHEASKMIPIGVGLVGHSLVCVGGMAVFVGG 734

>Kpol_538.45 s538 complement(101351..103897) [2547 bp, 848 aa] {ON}
           complement(101351..103897) [2547 nt, 849 aa]
          Length = 848

 Score = 32.3 bits (72), Expect = 5.1,   Method: Compositional matrix adjust.
 Identities = 39/160 (24%), Positives = 57/160 (35%), Gaps = 39/160 (24%)

Query: 204 FILHGGFRDLGSTTSYLNDSWLFDITSYKWRQIEFPPNHPVPD-------ARSGHSLIPT 256
            I+HGG       T+ + D WLF+ T   W    F   +P  D          GH+L   
Sbjct: 666 LIIHGG----SDHTNVIGDMWLFNFTKETWEHEHFLIKNPQEDRYKAIDIPLVGHTLTFI 721

Query: 257 QEGAVLWGGYCK------------VKAGKGLQKGKILG--------------DCWYLKMK 290
              AV +GG  +             K G G  +G  LG              +   LK+ 
Sbjct: 722 GYSAVSFGGLTQDDINSVYNLGDEAKVG-GDHEGLALGSNLVNYINLKTFQLESKELKLV 780

Query: 291 ADPSAVRWERRKKQGFQPSP-RVGCSMVHHKGRGILFGGV 329
           A     +  R K    + +   +GC +  + G  +L GGV
Sbjct: 781 AGTDEYKLVRDKTVNARSTVLAIGCIVAMNNGSYLLIGGV 820

>Ecym_5007 Chr5 (13107..15623) [2517 bp, 838 aa] {ON} similar to
           Ashbya gossypii ADR414C
          Length = 838

 Score = 32.0 bits (71), Expect = 6.1,   Method: Compositional matrix adjust.
 Identities = 16/70 (22%), Positives = 35/70 (50%), Gaps = 10/70 (14%)

Query: 280 ILGDCWYLKMKAD-----PSAVRWERRKKQGFQPSPRVGCSMVHHKGRGILFGGVYDFEE 334
           + GD W+  + ++     P  ++ E  K++     P VG  +V H  R ++ GG++    
Sbjct: 666 VYGDMWWFDLDSEQWTEVPLLLKNEHTKQRDRTCIPVVGHELVQHNSRFLILGGIH---- 721

Query: 335 TEESLDSIFY 344
            ++ +D I++
Sbjct: 722 -QQDVDKIYF 730

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.317    0.134    0.423 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 56,563,546
Number of extensions: 2295287
Number of successful extensions: 5077
Number of sequences better than 10.0: 54
Number of HSP's gapped: 4830
Number of HSP's successfully gapped: 92
Length of query: 634
Length of database: 53,481,399
Length adjustment: 116
Effective length of query: 518
Effective length of database: 40,180,143
Effective search space: 20813314074
Effective search space used: 20813314074
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 69 (31.2 bits)