Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
TPHA0M001906.9ON39139120000.0
Kpol_1045.786.9ON39239313330.0
TDEL0G046206.9ON39239012401e-170
ZYRO0F00462g6.9ON39338712331e-169
NDAI0K029006.9ON43840212141e-165
NCAS0F001906.9ON41140811921e-162
CAGL0B03575g6.9ON41939511661e-158
KNAG0E009806.9ON41439111101e-150
Ecym_30126.9ON39738111001e-149
SAKL0E00814g6.9ON39840110861e-146
Suva_5.126.9ON40140110701e-144
KLLA0D00814g6.9ON40841010691e-144
YEL056W (HAT2)6.9ON40140010551e-142
Smik_5.316.9ON42740010521e-141
Skud_5.336.9ON40140010451e-140
KLTH0C11550g6.9ON39838010391e-139
ACR017W6.9ON42338310301e-137
Kwal_56.223456.9ON39638510201e-136
KAFR0L003206.9ON39138210191e-136
TBLA0A071206.9ON4073899591e-127
YBR195C (MSI1)8.548ON4224173317e-34
TBLA0H036508.548ON4194203282e-33
KLLA0E23541g8.548ON4174023272e-33
Skud_2.3218.548ON4224103193e-32
NDAI0C055108.548ON4194303167e-32
Smik_2.3358.548ON4224233142e-31
Kpol_1024.398.548ON4174123132e-31
CAGL0M05291g8.548ON4194203105e-31
KAFR0I008408.548ON4134203105e-31
Suva_4.4498.548ON4244172948e-29
AEL250C8.548ON4174092931e-28
KLTH0E12694g8.548ON4184042886e-28
NCAS0B021708.548ON4144232886e-28
ZYRO0A13068g8.548ON3974162868e-28
Ecym_70428.548ON4144062842e-27
SAKL0H09900g8.548ON4254102843e-27
TPHA0L017208.548ON4194132823e-27
TDEL0B029808.548ON4124062807e-27
Kwal_27.120708.548ON4184242674e-25
KNAG0A036708.548ON4264242641e-24
Suva_3.936.325ON9202501633e-11
Suva_13.3112.401ON5104001603e-11
Smik_3.1576.325ON9242061589e-11
Skud_3.1336.325ON9162061571e-10
YCR057C (PWP2)6.325ON9232061552e-10
Skud_13.2912.401ON5093991542e-10
AAR057W6.325ON9222221525e-10
KNAG0I025406.325ON9182211509e-10
KLLA0C08976g6.325ON9112011501e-09
TDEL0A068906.276ON4472221481e-09
Smik_13.3292.401ON5093991481e-09
Ecym_20936.325ON9232061482e-09
CAGL0K03861g2.401ON5133791462e-09
NCAS0D046106.340ON5151781462e-09
KAFR0H024508.672ON4172161452e-09
KNAG0I028406.340ON5192001444e-09
TBLA0I022806.325ON9271801454e-09
NCAS0F019702.401ON5114051435e-09
NDAI0I004606.325ON9172231445e-09
KLLA0F15598g5.201ON4782521426e-09
YMR131C (RRB1)2.401ON5114001427e-09
TPHA0G026502.401ON5164011418e-09
KAFR0J025506.325ON9061791429e-09
NCAS0D044806.325ON9151801411e-08
Kpol_1060.246.276ON4862361401e-08
NCAS0G011206.276ON4941771391e-08
ZYRO0A08690g2.401ON5164021392e-08
TPHA0D038306.325ON9122061402e-08
NCAS0F033405.429ON4481791382e-08
SAKL0A01738g6.325ON9091801392e-08
KAFR0A003802.401ON5163841372e-08
Kpol_1028.546.325ON9052181383e-08
AAR078W7.356ON5621821364e-08
NDAI0I003506.340ON5151781355e-08
NDAI0H027502.401ON5123841355e-08
CAGL0K09284g6.325ON9112061357e-08
KNAG0E021802.401ON5174031338e-08
KAFR0L015207.356ON5841811331e-07
TDEL0A075506.340ON5153001321e-07
KNAG0B025807.356ON5801691321e-07
TBLA0C050107.356ON5721721321e-07
CAGL0L03201g1.247ON5792221321e-07
Kwal_33.151365.201ON4731671302e-07
AGL234W6.363ON6292071312e-07
Ecym_25236.363ON6462071312e-07
YKR036C (CAF4)1.247ON6432301302e-07
Smik_10.1261.247ON7122361302e-07
Kwal_14.17106.135ON5742331302e-07
NCAS0D047806.363ON6212231302e-07
KLTH0A06754g6.340ON5142061292e-07
KLLA0E19515g7.356ON5721731292e-07
TPHA0E030805.201ON4881761293e-07
CAGL0A04037g7.356ON5831781293e-07
ZYRO0D08206g6.340ON5152001293e-07
Kpol_1041.202.401ON5153991293e-07
TDEL0D013101.247ON7091771284e-07
ZYRO0E08184g6.276ON5062421274e-07
TDEL0G033402.401ON5144001275e-07
NDAI0B056305.429ON4352161275e-07
Suva_16.1598.672ON4511601275e-07
Skud_10.1021.247ON7081771275e-07
KNAG0I010508.288ON11591271275e-07
ZYRO0D08558g6.325ON9122181276e-07
Suva_16.606.276ON5261711266e-07
Suva_6.1871.247ON7142301266e-07
KLTH0A06380g6.325ON9151791277e-07
Sklu_YGOB_Anc_2.4012.401ON5203841267e-07
NDAI0F012406.276ON5241701257e-07
YJL112W (MDV1)1.247ON7141771268e-07
Skud_16.1318.672ON4511761258e-07
Skud_11.2711.247ON6462311259e-07
TPHA0L016908.544ON8322151259e-07
NCAS0A042702.431ON3181871239e-07
Kwal_23.62406.325ON9131791251e-06
KLTH0B03410g5.201ON4771681241e-06
NDAI0G038303.25ON5101511241e-06
KNAG0E023102.431ON3192441221e-06
KNAG0J016808.672ON3981971231e-06
TDEL0A074006.325ON9011801241e-06
NCAS0F018502.431ON3181871211e-06
NCAS0B036908.288ON11451191241e-06
CAGL0J03476g6.340ON5172061232e-06
ZYRO0G20152g2.431ON3192441212e-06
TBLA0D055601.247ON5892091222e-06
Suva_11.2681.247ON6452291232e-06
KAFR0B003707.534ON4611661222e-06
Kwal_26.87768.672ON4332151222e-06
NCAS0D027305.201ON4751741222e-06
CAGL0H00781g6.276ON5132301222e-06
SAKL0D04796g1.247ON7691781222e-06
CAGL0M02563g8.651ON4571971212e-06
Smik_6.3488.672ON4511611212e-06
TPHA0E017905.429ON4412001212e-06
KLTH0A07282g6.363ON7251661222e-06
NCAS0A055206.363ON6712151213e-06
SAKL0G12892g5.201ON4762531213e-06
Suva_3.1096.340ON5151561213e-06
Kpol_2002.995.201ON4871421203e-06
Kwal_56.243326.276ON4181791203e-06
Skud_12.5214.309ON6451761213e-06
SAKL0F11506g7.356ON5681721203e-06
YPL151C (PRP46)8.672ON4511621203e-06
AAL157C5.201ON4791591203e-06
KLLA0C08547g6.340ON5152071203e-06
CAGL0C03608g6.363ON6432301203e-06
KLLA0F17237g2.401ON5234001204e-06
ACR137W8.672ON4251601194e-06
Ecym_24986.340ON5422061204e-06
NDAI0J011808.288ON11341181204e-06
Kwal_56.236858.288ON11021551204e-06
TBLA0B087303.25ON4611951194e-06
SAKL0A00660g6.363ON6601761194e-06
Kpol_530.257.356ON5741711194e-06
TBLA0B091002.431ON3172541175e-06
TPHA0M018306.340ON5152981195e-06
Kwal_23.63246.340ON5142011185e-06
ZYRO0B02486g7.356ON5751781185e-06
KLLA0F11231g8.672ON4342041186e-06
KAFR0F025901.247ON7001871196e-06
ADL184W3.25ON4491981186e-06
SAKL0A01276g6.340ON5152031186e-06
CAGL0D02090g2.431ON2771791166e-06
NDAI0H027102.431ON3181871167e-06
KLLA0E07085g3.25ON4521831177e-06
SAKL0F08404g7.231ON6431771187e-06
Smik_6.4516.276ON5231691177e-06
Ecym_24018.672ON4261741177e-06
SAKL0H06666g8.672ON4411751177e-06
NCAS0E037507.310ON12761531188e-06
YPL247C6.276ON5231691178e-06
Skud_12.2617.356ON5801731178e-06
Kwal_23.64296.363ON7501661178e-06
KLTH0G13068g8.288ON11011181188e-06
CAGL0G09845g7.534ON5002131179e-06
Suva_4.537.310ON12712191179e-06
KAFR0A005102.431ON3192441159e-06
TBLA0A023106.276ON5311931169e-06
ADL186C3.22ON13612011171e-05
Skud_16.326.276ON5221691161e-05
Ecym_47177.356ON6031811161e-05
TDEL0E042805.201ON4811801161e-05
Smik_16.4427.534ON4702031151e-05
KNAG0D007406.276ON5042291161e-05
AEL246C8.544ON8152161161e-05
Smik_12.2567.356ON5761721161e-05
Skud_16.4827.534ON4652171151e-05
TBLA0F041306.340ON5142971151e-05
YLR429W (CRN1)4.309ON6511761161e-05
CAGL0E00561g6.363ON8362131161e-05
ZYRO0D03828g1.247ON7261811151e-05
Kpol_1019.307.310ON12522311161e-05
ZYRO0D16742g7.231ON6081771151e-05
NDAI0D022505.139ON7952521151e-05
TBLA0C018408.672ON4232121141e-05
ZYRO0A09636g8.435ON8081611151e-05
AER263C6.340ON5132981152e-05
KNAG0B016101.247ON6742071152e-05
KLTH0D11132g8.672ON4371761142e-05
Smik_3.1726.340ON5152071142e-05
NCAS0E028407.356ON6071861142e-05
Suva_10.2927.356ON5801721142e-05
Suva_13.2952.431ON3192421122e-05
Skud_13.2752.431ON3192421122e-05
Smik_13.3052.431ON3192421122e-05
YMR116C (ASC1)2.431ON3192421122e-05
Kpol_1028.236.363ON7442121142e-05
NDAI0E024008.672ON4341971132e-05
Kpol_1028.416.340ON5122001132e-05
KLTH0E09394g2.401ON5224001132e-05
TPHA0B005904.309ON5881771132e-05
Kpol_1072.178.672ON4331761132e-05
KLLA0E08449g2.283ON4221971122e-05
NDAI0E044407.356ON5811781133e-05
CAGL0M02277g8.672ON4271871123e-05
AGL196C8.324ON9352211133e-05
KAFR0J009805.201ON4802521123e-05
Skud_4.637.310ON12732191133e-05
KLTH0H02508gna 1ON3091481113e-05
CAGL0D05588g5.201ON4772351123e-05
TBLA0D041307.231ON5741731123e-05
KAFR0I028403.25ON4561291114e-05
ZYRO0F06776g8.651ON4322141114e-05
SAKL0G16962g4.309ON6171881124e-05
TDEL0A077806.363ON6571661124e-05
Kwal_27.126671.247ON7211741124e-05
TPHA0G023802.431ON3182521104e-05
KNAG0M017505.201ON4852601114e-05
TDEL0A004403.25ON4511991114e-05
KLTH0H02772g6.276ON4202541114e-05
Kwal_47.178272.401ON5234001114e-05
KLLA0D02530g4.309ON7071741114e-05
KAFR0F010606.276ON5531651114e-05
KNAG0A012303.22ON13211981124e-05
Smik_14.143.25ON4662151114e-05
KNAG0A030808.651ON4461971104e-05
AFR199C2.431ON3341941105e-05
TPHA0P014903.25ON4591711105e-05
Kpol_1031.361.247ON7061791115e-05
KAFR0B057008.316ON3722351105e-05
ZYRO0C03124g3.25ON4452001105e-05
KLTH0H06160g6.135ON5742331115e-05
ZYRO0F07282g8.672ON4272131105e-05
TBLA0F042406.363ON7271801115e-05
Suva_10.5454.309ON6421761115e-05
TDEL0A004103.22ON12622131115e-05
CAGL0M05335g8.544ON8062251115e-05
TPHA0G016108.672ON4141471096e-05
KLLA0E21187g5.429ON4292141106e-05
Skud_3.1456.340ON5152061106e-05
TDEL0A020702.431ON3191881096e-05
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= TPHA0M00190
         (391 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

TPHA0M00190 Chr13 complement(38571..39746) [1176 bp, 391 aa] {ON...   775   0.0  
Kpol_1045.78 s1045 (183044..184222) [1179 bp, 392 aa] {ON} (1830...   518   0.0  
TDEL0G04620 Chr7 (842202..843380) [1179 bp, 392 aa] {ON} Anc_6.9...   482   e-170
ZYRO0F00462g Chr6 complement(46021..47202) [1182 bp, 393 aa] {ON...   479   e-169
NDAI0K02900 Chr11 (657436..658752) [1317 bp, 438 aa] {ON} Anc_6.9     472   e-165
NCAS0F00190 Chr6 complement(29012..30247) [1236 bp, 411 aa] {ON}...   463   e-162
CAGL0B03575g Chr2 complement(357525..358784) [1260 bp, 419 aa] {...   453   e-158
KNAG0E00980 Chr5 complement(186207..187451) [1245 bp, 414 aa] {O...   432   e-150
Ecym_3012 Chr3 complement(24573..25766) [1194 bp, 397 aa] {ON} s...   428   e-149
SAKL0E00814g Chr5 complement(59724..60920) [1197 bp, 398 aa] {ON...   422   e-146
Suva_5.12 Chr5 (23273..24478) [1206 bp, 401 aa] {ON} YEL056W (REAL)   416   e-144
KLLA0D00814g Chr4 complement(76687..77913) [1227 bp, 408 aa] {ON...   416   e-144
YEL056W Chr5 (47168..48373) [1206 bp, 401 aa] {ON}  HAT2Subunit ...   410   e-142
Smik_5.31 Chr5 (49406..50689) [1284 bp, 427 aa] {ON} YEL056W (REAL)   409   e-141
Skud_5.33 Chr5 (46184..47389) [1206 bp, 401 aa] {ON} YEL056W (REAL)   407   e-140
KLTH0C11550g Chr3 (949063..950259) [1197 bp, 398 aa] {ON} simila...   404   e-139
ACR017W Chr3 (387122..388393) [1272 bp, 423 aa] {ON} Syntenic ho...   401   e-137
Kwal_56.22345 s56 complement(58523..59713) [1191 bp, 396 aa] {ON...   397   e-136
KAFR0L00320 Chr12 (56449..57624) [1176 bp, 391 aa] {ON} Anc_6.9 ...   397   e-136
TBLA0A07120 Chr1 complement(1765718..1766941) [1224 bp, 407 aa] ...   374   e-127
YBR195C Chr2 complement(610614..611882) [1269 bp, 422 aa] {ON}  ...   132   7e-34
TBLA0H03650 Chr8 (888840..890099) [1260 bp, 419 aa] {ON} Anc_8.5...   130   2e-33
KLLA0E23541g Chr5 (2095246..2096499) [1254 bp, 417 aa] {ON} simi...   130   2e-33
Skud_2.321 Chr2 complement(577912..579180) [1269 bp, 422 aa] {ON...   127   3e-32
NDAI0C05510 Chr3 (1281190..1282449) [1260 bp, 419 aa] {ON} Anc_8...   126   7e-32
Smik_2.335 Chr2 complement(596903..598171) [1269 bp, 422 aa] {ON...   125   2e-31
Kpol_1024.39 s1024 complement(104336..105589) [1254 bp, 417 aa] ...   125   2e-31
CAGL0M05291g Chr13 complement(566250..567509) [1260 bp, 419 aa] ...   124   5e-31
KAFR0I00840 Chr9 complement(162878..164119) [1242 bp, 413 aa] {O...   124   5e-31
Suva_4.449 Chr4 complement(780822..782096) [1275 bp, 424 aa] {ON...   117   8e-29
AEL250C Chr5 complement(168010..169263) [1254 bp, 417 aa] {ON} S...   117   1e-28
KLTH0E12694g Chr5 (1126940..1128196) [1257 bp, 418 aa] {ON} simi...   115   6e-28
NCAS0B02170 Chr2 complement(354274..355518) [1245 bp, 414 aa] {O...   115   6e-28
ZYRO0A13068g Chr1 (1032695..1033888) [1194 bp, 397 aa] {ON} simi...   114   8e-28
Ecym_7042 Chr7 (86859..88103) [1245 bp, 414 aa] {ON} similar to ...   114   2e-27
SAKL0H09900g Chr8 complement(847975..849252) [1278 bp, 425 aa] {...   114   3e-27
TPHA0L01720 Chr12 (362572..363831) [1260 bp, 419 aa] {ON} Anc_8....   113   3e-27
TDEL0B02980 Chr2 complement(529584..530822) [1239 bp, 412 aa] {O...   112   7e-27
Kwal_27.12070 s27 (1071472..1072728) [1257 bp, 418 aa] {ON} YBR1...   107   4e-25
KNAG0A03670 Chr1 complement(472849..474129) [1281 bp, 426 aa] {O...   106   1e-24
Suva_3.93 Chr3 complement(133524..136286) [2763 bp, 920 aa] {ON}...    67   3e-11
Suva_13.311 Chr13 complement(511812..513344) [1533 bp, 510 aa] {...    66   3e-11
Smik_3.157 Chr3 complement(218522..221296) [2775 bp, 924 aa] {ON...    65   9e-11
Skud_3.133 Chr3 complement(204741..207488) [2748 bp, 916 aa] {ON...    65   1e-10
YCR057C Chr3 complement(220457..223228) [2772 bp, 923 aa] {ON}  ...    64   2e-10
Skud_13.291 Chr13 complement(506764..508293) [1530 bp, 509 aa] {...    64   2e-10
AAR057W Chr1 (442821..445589) [2769 bp, 922 aa] {ON} Syntenic ho...    63   5e-10
KNAG0I02540 Chr9 (489509..492265) [2757 bp, 918 aa] {ON} Anc_6.3...    62   9e-10
KLLA0C08976g Chr3 (784536..787271) [2736 bp, 911 aa] {ON} highly...    62   1e-09
TDEL0A06890 Chr1 (1202790..1204133) [1344 bp, 447 aa] {ON} Anc_6...    62   1e-09
Smik_13.329 Chr13 complement(515612..517141) [1530 bp, 509 aa] {...    62   1e-09
Ecym_2093 Chr2 (165578..168349) [2772 bp, 923 aa] {ON} similar t...    62   2e-09
CAGL0K03861g Chr11 complement(360277..361818) [1542 bp, 513 aa] ...    61   2e-09
NCAS0D04610 Chr4 (881005..882552) [1548 bp, 515 aa] {ON} Anc_6.340     61   2e-09
KAFR0H02450 Chr8 complement(468767..470020) [1254 bp, 417 aa] {O...    60   2e-09
KNAG0I02840 Chr9 (554645..556204) [1560 bp, 519 aa] {ON} Anc_6.3...    60   4e-09
TBLA0I02280 Chr9 complement(523331..526114) [2784 bp, 927 aa] {O...    60   4e-09
NCAS0F01970 Chr6 complement(396326..397861) [1536 bp, 511 aa] {O...    60   5e-09
NDAI0I00460 Chr9 (91809..94562) [2754 bp, 917 aa] {ON} Anc_6.325       60   5e-09
KLLA0F15598g Chr6 (1439610..1441046) [1437 bp, 478 aa] {ON} high...    59   6e-09
YMR131C Chr13 complement(533163..534698) [1536 bp, 511 aa] {ON} ...    59   7e-09
TPHA0G02650 Chr7 (558370..559920) [1551 bp, 516 aa] {ON} Anc_2.4...    59   8e-09
KAFR0J02550 Chr10 complement(484360..487080) [2721 bp, 906 aa] {...    59   9e-09
NCAS0D04480 Chr4 complement(851440..854187) [2748 bp, 915 aa] {O...    59   1e-08
Kpol_1060.24 s1060 complement(61507..62967) [1461 bp, 486 aa] {O...    59   1e-08
NCAS0G01120 Chr7 complement(199561..201045) [1485 bp, 494 aa] {O...    58   1e-08
ZYRO0A08690g Chr1 (691253..692803) [1551 bp, 516 aa] {ON} highly...    58   2e-08
TPHA0D03830 Chr4 complement(802754..805492) [2739 bp, 912 aa] {O...    59   2e-08
NCAS0F03340 Chr6 complement(675569..676915) [1347 bp, 448 aa] {O...    58   2e-08
SAKL0A01738g Chr1 (157360..160089) [2730 bp, 909 aa] {ON} highly...    58   2e-08
KAFR0A00380 Chr1 (70400..71950) [1551 bp, 516 aa] {ON} Anc_2.401...    57   2e-08
Kpol_1028.54 s1028 (125940..128657) [2718 bp, 905 aa] {ON} (1259...    58   3e-08
AAR078W Chr1 (483989..485677) [1689 bp, 562 aa] {ON} Syntenic ho...    57   4e-08
NDAI0I00350 Chr9 (71116..72663) [1548 bp, 515 aa] {ON} Anc_6.340       57   5e-08
NDAI0H02750 Chr8 (677299..678837) [1539 bp, 512 aa] {ON} Anc_2.4...    57   5e-08
CAGL0K09284g Chr11 (915766..918501) [2736 bp, 911 aa] {ON} highl...    57   7e-08
KNAG0E02180 Chr5 (440039..441592) [1554 bp, 517 aa] {ON} Anc_2.4...    56   8e-08
KAFR0L01520 Chr12 complement(278754..280508) [1755 bp, 584 aa] {...    56   1e-07
TDEL0A07550 Chr1 complement(1314676..1316223) [1548 bp, 515 aa] ...    55   1e-07
KNAG0B02580 Chr2 (501215..502957) [1743 bp, 580 aa] {ON} Anc_7.3...    55   1e-07
TBLA0C05010 Chr3 complement(1217846..1219564) [1719 bp, 572 aa] ...    55   1e-07
CAGL0L03201g Chr12 complement(368792..370531) [1740 bp, 579 aa] ...    55   1e-07
Kwal_33.15136 s33 (974095..975516) [1422 bp, 473 aa] {ON} YLL011...    55   2e-07
AGL234W Chr7 (257969..259858) [1890 bp, 629 aa] {ON} Syntenic ho...    55   2e-07
Ecym_2523 Chr2 complement(1021566..1023506) [1941 bp, 646 aa] {O...    55   2e-07
YKR036C Chr11 complement(508702..510633) [1932 bp, 643 aa] {ON} ...    55   2e-07
Smik_10.126 Chr10 (196821..198959) [2139 bp, 712 aa] {ON} YJL112...    55   2e-07
Kwal_14.1710 s14 (433526..435250) [1725 bp, 574 aa] {ON} YGL116W...    55   2e-07
NCAS0D04780 Chr4 (916321..918186) [1866 bp, 621 aa] {ON} Anc_6.363     55   2e-07
KLTH0A06754g Chr1 complement(560921..562465) [1545 bp, 514 aa] {...    54   2e-07
KLLA0E19515g Chr5 complement(1733708..1735426) [1719 bp, 572 aa]...    54   2e-07
TPHA0E03080 Chr5 complement(646691..648157) [1467 bp, 488 aa] {O...    54   3e-07
CAGL0A04037g Chr1 complement(404063..405814) [1752 bp, 583 aa] {...    54   3e-07
ZYRO0D08206g Chr4 (711937..713484) [1548 bp, 515 aa] {ON} highly...    54   3e-07
Kpol_1041.20 s1041 complement(56019..57566) [1548 bp, 515 aa] {O...    54   3e-07
TDEL0D01310 Chr4 complement(251119..253248) [2130 bp, 709 aa] {O...    54   4e-07
ZYRO0E08184g Chr5 (639823..641343) [1521 bp, 506 aa] {ON} simila...    54   4e-07
TDEL0G03340 Chr7 (618276..619820) [1545 bp, 514 aa] {ON} Anc_2.4...    54   5e-07
NDAI0B05630 Chr2 complement(1376242..1377549) [1308 bp, 435 aa] ...    54   5e-07
Suva_16.159 Chr16 complement(275378..276733) [1356 bp, 451 aa] {...    54   5e-07
Skud_10.102 Chr10 (173179..175305) [2127 bp, 708 aa] {ON} YJL112...    54   5e-07
KNAG0I01050 Chr9 complement(200338..203817) [3480 bp, 1159 aa] {...    54   5e-07
ZYRO0D08558g Chr4 (736975..739713) [2739 bp, 912 aa] {ON} highly...    54   6e-07
Suva_16.60 Chr16 complement(91552..93132) [1581 bp, 526 aa] {ON}...    53   6e-07
Suva_6.187 Chr6 complement(344709..346853) [2145 bp, 714 aa] {ON...    53   6e-07
KLTH0A06380g Chr1 complement(532367..535114) [2748 bp, 915 aa] {...    54   7e-07
Sklu_YGOB_Anc_2.401 Chr5 complement(385202..386764) [1563 bp, 52...    53   7e-07
NDAI0F01240 Chr6 complement(302631..304205) [1575 bp, 524 aa] {O...    53   7e-07
YJL112W Chr10 (205305..207449) [2145 bp, 714 aa] {ON}  MDV1Perip...    53   8e-07
Skud_16.131 Chr16 complement(237797..239152) [1356 bp, 451 aa] {...    53   8e-07
Skud_11.271 Chr11 complement(490869..492809) [1941 bp, 646 aa] {...    53   9e-07
TPHA0L01690 Chr12 (355859..358357) [2499 bp, 832 aa] {ON} Anc_8....    53   9e-07
NCAS0A04270 Chr1 (862892..863425,863734..864156) [957 bp, 318 aa...    52   9e-07
Kwal_23.6240 s23 complement(1503990..1506731) [2742 bp, 913 aa] ...    53   1e-06
KLTH0B03410g Chr2 complement(276115..277548) [1434 bp, 477 aa] {...    52   1e-06
NDAI0G03830 Chr7 (919944..921476) [1533 bp, 510 aa] {ON} Anc_3.25      52   1e-06
KNAG0E02310 Chr5 (463866..464402,464772..465194) [960 bp, 319 aa...    52   1e-06
KNAG0J01680 Chr10 (307280..308476) [1197 bp, 398 aa] {ON} Anc_8....    52   1e-06
TDEL0A07400 Chr1 complement(1292494..1295199) [2706 bp, 901 aa] ...    52   1e-06
NCAS0F01850 Chr6 complement(371372..371794,372104..372637) [957 ...    51   1e-06
NCAS0B03690 Chr2 complement(657488..660925) [3438 bp, 1145 aa] {...    52   1e-06
CAGL0J03476g Chr10 (334536..336089) [1554 bp, 517 aa] {ON} highl...    52   2e-06
ZYRO0G20152g Chr7 complement(1669233..1669655,1669872..1670408) ...    51   2e-06
TBLA0D05560 Chr4 complement(1366222..1367991) [1770 bp, 589 aa] ...    52   2e-06
Suva_11.268 Chr11 complement(492639..494576) [1938 bp, 645 aa] {...    52   2e-06
KAFR0B00370 Chr2 complement(83264..84649) [1386 bp, 461 aa] {ON}...    52   2e-06
Kwal_26.8776 s26 (938508..939809) [1302 bp, 433 aa] {ON} YPL151C...    52   2e-06
NCAS0D02730 Chr4 (523453..524880) [1428 bp, 475 aa] {ON} Anc_5.201     52   2e-06
CAGL0H00781g Chr8 complement(77292..78833) [1542 bp, 513 aa] {ON...    52   2e-06
SAKL0D04796g Chr4 (372598..374907) [2310 bp, 769 aa] {ON} simila...    52   2e-06
CAGL0M02563g Chr13 complement(295156..296529) [1374 bp, 457 aa] ...    51   2e-06
Smik_6.348 Chr6 (556719..558074) [1356 bp, 451 aa] {ON} YPL151C ...    51   2e-06
TPHA0E01790 Chr5 (359679..361004) [1326 bp, 441 aa] {ON} Anc_5.4...    51   2e-06
KLTH0A07282g Chr1 complement(604949..607126) [2178 bp, 725 aa] {...    52   2e-06
NCAS0A05520 Chr1 complement(1085200..1087215) [2016 bp, 671 aa] ...    51   3e-06
SAKL0G12892g Chr7 complement(1102157..1103587) [1431 bp, 476 aa]...    51   3e-06
Suva_3.109 Chr3 complement(158211..159758) [1548 bp, 515 aa] {ON...    51   3e-06
Kpol_2002.99 s2002 (237070..238533) [1464 bp, 487 aa] {ON} (2370...    51   3e-06
Kwal_56.24332 s56 (959476..960732) [1257 bp, 418 aa] {ON} YPL247...    51   3e-06
Skud_12.521 Chr12 (924571..926508) [1938 bp, 645 aa] {ON} YLR429...    51   3e-06
SAKL0F11506g Chr6 complement(894080..895786) [1707 bp, 568 aa] {...    51   3e-06
YPL151C Chr16 complement(266180..267535) [1356 bp, 451 aa] {ON} ...    51   3e-06
AAL157C Chr1 complement(70077..71516) [1440 bp, 479 aa] {ON} Syn...    51   3e-06
KLLA0C08547g Chr3 (749737..751284) [1548 bp, 515 aa] {ON} highly...    51   3e-06
CAGL0C03608g Chr3 (360681..362612) [1932 bp, 643 aa] {ON} simila...    51   3e-06
KLLA0F17237g Chr6 (1577197..1578768) [1572 bp, 523 aa] {ON} high...    51   4e-06
ACR137W Chr3 (590077..591354) [1278 bp, 425 aa] {ON} Syntenic ho...    50   4e-06
Ecym_2498 Chr2 complement(974601..976229) [1629 bp, 542 aa] {ON}...    51   4e-06
NDAI0J01180 Chr10 complement(273472..276876) [3405 bp, 1134 aa] ...    51   4e-06
Kwal_56.23685 s56 complement(656691..659999) [3309 bp, 1102 aa] ...    51   4e-06
TBLA0B08730 Chr2 complement(2077729..2079114) [1386 bp, 461 aa] ...    50   4e-06
SAKL0A00660g Chr1 (71855..73837) [1983 bp, 660 aa] {ON} some sim...    50   4e-06
Kpol_530.25 s530 (67445..69169) [1725 bp, 574 aa] {ON} (67445..6...    50   4e-06
TBLA0B09100 Chr2 complement(2156320..2156742,2157014..2157544) [...    50   5e-06
TPHA0M01830 Chr13 complement(378923..380470) [1548 bp, 515 aa] {...    50   5e-06
Kwal_23.6324 s23 complement(1531252..1532796) [1545 bp, 514 aa] ...    50   5e-06
ZYRO0B02486g Chr2 complement(199474..201201) [1728 bp, 575 aa] {...    50   5e-06
KLLA0F11231g Chr6 complement(1034708..1036012) [1305 bp, 434 aa]...    50   6e-06
KAFR0F02590 Chr6 complement(504740..506842) [2103 bp, 700 aa] {O...    50   6e-06
ADL184W Chr4 (375530..376879) [1350 bp, 449 aa] {ON} Syntenic ho...    50   6e-06
SAKL0A01276g Chr1 (124778..126325) [1548 bp, 515 aa] {ON} highly...    50   6e-06
CAGL0D02090g Chr4 (214357..214893,215564..215860) [834 bp, 277 a...    49   6e-06
NDAI0H02710 Chr8 complement(668900..669322,669678..670211) [957 ...    49   7e-06
KLLA0E07085g Chr5 (645766..647124) [1359 bp, 452 aa] {ON} simila...    50   7e-06
SAKL0F08404g Chr6 complement(640436..642367) [1932 bp, 643 aa] {...    50   7e-06
Smik_6.451 Chr6 (740074..741645) [1572 bp, 523 aa] {ON} YPL247C ...    50   7e-06
Ecym_2401 Chr2 complement(781043..782323) [1281 bp, 426 aa] {ON}...    50   7e-06
SAKL0H06666g Chr8 complement(586110..587435) [1326 bp, 441 aa] {...    50   7e-06
NCAS0E03750 Chr5 complement(736672..740502) [3831 bp, 1276 aa] {...    50   8e-06
YPL247C Chr16 complement(82625..84196) [1572 bp, 523 aa] {ON} Pu...    50   8e-06
Skud_12.261 Chr12 (490588..492330) [1743 bp, 580 aa] {ON} YLR196...    50   8e-06
Kwal_23.6429 s23 complement(1577398..1579650) [2253 bp, 750 aa] ...    50   8e-06
KLTH0G13068g Chr7 complement(1118964..1122269) [3306 bp, 1101 aa...    50   8e-06
CAGL0G09845g Chr7 (940598..942100) [1503 bp, 500 aa] {ON} simila...    50   9e-06
Suva_4.53 Chr4 (95619..99434) [3816 bp, 1271 aa] {ON} YDL195W (R...    50   9e-06
KAFR0A00510 Chr1 (93452..93988,94240..94662) [960 bp, 319 aa] {O...    49   9e-06
TBLA0A02310 Chr1 (557822..559417) [1596 bp, 531 aa] {ON} Anc_6.2...    49   9e-06
ADL186C Chr4 complement(369320..373405) [4086 bp, 1361 aa] {ON} ...    50   1e-05
Skud_16.32 Chr16 complement(56168..57736) [1569 bp, 522 aa] {ON}...    49   1e-05
Ecym_4717 Chr4 (1407391..1409202) [1812 bp, 603 aa] {ON} similar...    49   1e-05
TDEL0E04280 Chr5 complement(799966..801411) [1446 bp, 481 aa] {O...    49   1e-05
Smik_16.442 Chr16 (754983..756395) [1413 bp, 470 aa] {ON} YPR178...    49   1e-05
KNAG0D00740 Chr4 complement(115399..116913) [1515 bp, 504 aa] {O...    49   1e-05
AEL246C Chr5 complement(172849..175296) [2448 bp, 815 aa] {ON} S...    49   1e-05
Smik_12.256 Chr12 (490929..492659) [1731 bp, 576 aa] {ON} YLR196...    49   1e-05
Skud_16.482 Chr16 (834842..836239) [1398 bp, 465 aa] {ON} YPR178...    49   1e-05
TBLA0F04130 Chr6 complement(1021035..1022579) [1545 bp, 514 aa] ...    49   1e-05
YLR429W Chr12 (990777..992732) [1956 bp, 651 aa] {ON}  CRN1Coron...    49   1e-05
CAGL0E00561g Chr5 (49987..52497) [2511 bp, 836 aa] {ON} some sim...    49   1e-05
ZYRO0D03828g Chr4 (310049..312229) [2181 bp, 726 aa] {ON} simila...    49   1e-05
Kpol_1019.30 s1019 (56367..60125) [3759 bp, 1252 aa] {ON} (56367...    49   1e-05
ZYRO0D16742g Chr4 complement(1385330..1387156) [1827 bp, 608 aa]...    49   1e-05
NDAI0D02250 Chr4 complement(526907..529294) [2388 bp, 795 aa] {O...    49   1e-05
TBLA0C01840 Chr3 (435021..436292) [1272 bp, 423 aa] {ON} Anc_8.6...    49   1e-05
ZYRO0A09636g Chr1 (779501..781927) [2427 bp, 808 aa] {ON} highly...    49   1e-05
AER263C Chr5 complement(1118228..1119769) [1542 bp, 513 aa] {ON}...    49   2e-05
KNAG0B01610 Chr2 (294433..296457) [2025 bp, 674 aa] {ON} Anc_1.2...    49   2e-05
KLTH0D11132g Chr4 (910259..911572) [1314 bp, 437 aa] {ON} simila...    49   2e-05
Smik_3.172 Chr3 complement(240515..242062) [1548 bp, 515 aa] {ON...    49   2e-05
NCAS0E02840 Chr5 (558336..560159) [1824 bp, 607 aa] {ON} Anc_7.3...    49   2e-05
Suva_10.292 Chr10 (516694..518436) [1743 bp, 580 aa] {ON} YLR196...    49   2e-05
Suva_13.295 Chr13 complement(480518..480940,481217..481753) [960...    48   2e-05
Skud_13.275 Chr13 complement(474770..475192,475471..476007) [960...    48   2e-05
Smik_13.305 Chr13 complement(482912..483334,483612..484148) [960...    48   2e-05
YMR116C Chr13 complement(499456..499878,500152..500688) [960 bp,...    48   2e-05
Kpol_1028.23 s1028 (63032..65266) [2235 bp, 744 aa] {ON} (63032....    49   2e-05
NDAI0E02400 Chr5 (499223..500527) [1305 bp, 434 aa] {ON} Anc_8.672     48   2e-05
Kpol_1028.41 s1028 (100720..102258) [1539 bp, 512 aa] {ON} (1007...    48   2e-05
KLTH0E09394g Chr5 complement(853592..855160) [1569 bp, 522 aa] {...    48   2e-05
TPHA0B00590 Chr2 complement(134906..136672) [1767 bp, 588 aa] {O...    48   2e-05
Kpol_1072.17 s1072 complement(40550..41851) [1302 bp, 433 aa] {O...    48   2e-05
KLLA0E08449g Chr5 (759718..760986) [1269 bp, 422 aa] {ON} simila...    48   2e-05
NDAI0E04440 Chr5 (1002113..1003858) [1746 bp, 581 aa] {ON} Anc_7...    48   3e-05
CAGL0M02277g Chr13 complement(271836..273119) [1284 bp, 427 aa] ...    48   3e-05
AGL196C Chr7 complement(328838..331645) [2808 bp, 935 aa] {ON} S...    48   3e-05
KAFR0J00980 Chr10 (176984..178426) [1443 bp, 480 aa] {ON} Anc_5....    48   3e-05
Skud_4.63 Chr4 (104587..108408) [3822 bp, 1273 aa] {ON} YDL195W ...    48   3e-05
KLTH0H02508g Chr8 complement(225069..225998) [930 bp, 309 aa] {O...    47   3e-05
CAGL0D05588g Chr4 (533235..534668) [1434 bp, 477 aa] {ON} highly...    48   3e-05
TBLA0D04130 Chr4 (1027726..1029450) [1725 bp, 574 aa] {ON} Anc_7...    48   3e-05
KAFR0I02840 Chr9 complement(570039..571409) [1371 bp, 456 aa] {O...    47   4e-05
ZYRO0F06776g Chr6 (555965..557263) [1299 bp, 432 aa] {ON} simila...    47   4e-05
SAKL0G16962g Chr7 (1463359..1463363,1463442..1465290) [1854 bp, ...    48   4e-05
TDEL0A07780 Chr1 complement(1352017..1353990) [1974 bp, 657 aa] ...    48   4e-05
Kwal_27.12667 s27 complement(1325822..1327987) [2166 bp, 721 aa]...    48   4e-05
TPHA0G02380 Chr7 (484477..485010,485373..485795) [957 bp, 318 aa...    47   4e-05
KNAG0M01750 Chr13 complement(323446..324903) [1458 bp, 485 aa] {...    47   4e-05
TDEL0A00440 Chr1 (78820..80175) [1356 bp, 451 aa] {ON} Anc_3.25 ...    47   4e-05
KLTH0H02772g Chr8 complement(248747..250009) [1263 bp, 420 aa] {...    47   4e-05
Kwal_47.17827 s47 complement(570622..572193) [1572 bp, 523 aa] {...    47   4e-05
KLLA0D02530g Chr4 complement(212703..214826) [2124 bp, 707 aa] {...    47   4e-05
KAFR0F01060 Chr6 complement(201465..203126) [1662 bp, 553 aa] {O...    47   4e-05
KNAG0A01230 Chr1 complement(17341..21306) [3966 bp, 1321 aa] {ON...    48   4e-05
Smik_14.14 Chr14 (25114..26514) [1401 bp, 466 aa] {ON} YNL317W (...    47   4e-05
KNAG0A03080 Chr1 complement(380346..381686) [1341 bp, 446 aa] {O...    47   4e-05
AFR199C Chr6 complement(799873..800295,800490..801071) [1005 bp,...    47   5e-05
TPHA0P01490 Chr16 complement(302996..304375) [1380 bp, 459 aa] {...    47   5e-05
Kpol_1031.36 s1031 complement(87105..89225) [2121 bp, 706 aa] {O...    47   5e-05
KAFR0B05700 Chr2 complement(1176020..1177138) [1119 bp, 372 aa] ...    47   5e-05
ZYRO0C03124g Chr3 complement(240321..241658) [1338 bp, 445 aa] {...    47   5e-05
KLTH0H06160g Chr8 complement(538741..540465) [1725 bp, 574 aa] {...    47   5e-05
ZYRO0F07282g Chr6 (590095..591378) [1284 bp, 427 aa] {ON} simila...    47   5e-05
TBLA0F04240 Chr6 (1043577..1045760) [2184 bp, 727 aa] {ON} Anc_6...    47   5e-05
Suva_10.545 Chr10 (945641..947569) [1929 bp, 642 aa] {ON} YLR429...    47   5e-05
TDEL0A00410 Chr1 complement(70940..74728) [3789 bp, 1262 aa] {ON...    47   5e-05
CAGL0M05335g Chr13 complement(569132..571552) [2421 bp, 806 aa] ...    47   5e-05
TPHA0G01610 Chr7 complement(332529..333773) [1245 bp, 414 aa] {O...    47   6e-05
KLLA0E21187g Chr5 (1892524..1893813) [1290 bp, 429 aa] {ON} simi...    47   6e-05
Skud_3.145 Chr3 complement(225459..227006) [1548 bp, 515 aa] {ON...    47   6e-05
TDEL0A02070 Chr1 (372046..372582,372798..373220) [960 bp, 319 aa...    47   6e-05
TBLA0B09250 Chr2 (2194005..2195585) [1581 bp, 526 aa] {ON} Anc_2...    47   6e-05
KAFR0F04350 Chr6 (853842..855389) [1548 bp, 515 aa] {ON} Anc_6.3...    47   7e-05
SAKL0G02398g Chr7 complement(200123..201538) [1416 bp, 471 aa] {...    47   7e-05
YBR198C Chr2 complement(616127..618523) [2397 bp, 798 aa] {ON}  ...    47   7e-05
Kwal_55.22067 s55 complement(1094600..1095955) [1356 bp, 451 aa]...    47   7e-05
KLTH0E15576g Chr5 complement(1384027..1386198) [2172 bp, 723 aa]...    47   7e-05
Skud_12.56 Chr12 (118914..120383) [1470 bp, 489 aa] {ON} YLL011W...    47   7e-05
NCAS0C03990 Chr3 complement(804313..806505) [2193 bp, 730 aa] {O...    47   7e-05
AFL014C Chr6 complement(409496..411169) [1674 bp, 557 aa] {ON} S...    47   7e-05
NDAI0J02490 Chr10 complement(613859..615748) [1890 bp, 629 aa] {...    47   7e-05
Smik_16.106 Chr16 (194195..196564) [2370 bp, 789 aa] {ON} YGR200...    47   8e-05
ZYRO0D17292g Chr4 complement(1424965..1427121) [2157 bp, 718 aa]...    47   8e-05
NDAI0A02610 Chr1 (585697..588000) [2304 bp, 767 aa] {ON} Anc_7.231     47   8e-05
KLTH0F19294g Chr6 complement(1560167..1561522) [1356 bp, 451 aa]...    46   8e-05
YLR196W Chr12 (543968..545698) [1731 bp, 576 aa] {ON}  PWP1Prote...    47   8e-05
Smik_12.525 Chr12 (919777..921735) [1959 bp, 652 aa] {ON} YLR429...    47   8e-05
NCAS0C04450 Chr3 (912688..914073) [1386 bp, 461 aa] {ON} Anc_3.25      46   8e-05
Kwal_27.11550 s27 (845458..846681) [1224 bp, 407 aa] {ON} YNL035...    46   8e-05
Suva_3.121 Chr3 complement(177765..179864) [2100 bp, 700 aa] {ON...    47   9e-05
CAGL0M04081g Chr13 complement(450572..451939) [1368 bp, 455 aa] ...    46   9e-05
Kpol_1036.65 s1036 complement(180839..181954) [1116 bp, 371 aa] ...    46   9e-05
KLLA0F21406g Chr6 complement(1996260..1998377) [2118 bp, 705 aa]...    47   9e-05
YCR072C Chr3 complement(240805..242352) [1548 bp, 515 aa] {ON}  ...    46   9e-05
Skud_3.156 Chr3 complement(244873..247014) [2142 bp, 713 aa] {ON...    47   9e-05
YCR084C Chr3 complement(260311..262452) [2142 bp, 713 aa] {ON}  ...    47   9e-05
Ecym_8090 Chr8 (194643..196793) [2151 bp, 716 aa] {ON} similar t...    47   9e-05
KLLA0F10263g Chr6 (949926..951974) [2049 bp, 682 aa] {ON} unipro...    47   9e-05
NCAS0A13430 Chr1 complement(2641588..2643414) [1827 bp, 608 aa] ...    46   9e-05
Kpol_1016.11 s1016 (27192..29201) [2010 bp, 669 aa] {ON} (27192....    46   1e-04
Kpol_487.7 s487 complement(37021..37932) [912 bp, 303 aa] {ON} c...    46   1e-04
KLTH0A04114g Chr1 complement(344618..346594) [1977 bp, 658 aa] {...    46   1e-04
KNAG0B02800 Chr2 (537056..540979) [3924 bp, 1307 aa] {ON} Anc_7....    47   1e-04
Ecym_7038 Chr7 (80529..82931) [2403 bp, 800 aa] {ON} similar to ...    46   1e-04
ZYRO0B10450g Chr2 complement(825240..826688) [1449 bp, 482 aa] {...    46   1e-04
CAGL0J03960g Chr10 complement(375780..377087) [1308 bp, 435 aa] ...    46   1e-04
KAFR0A03380 Chr1 (690272..692272) [2001 bp, 666 aa] {ON} Anc_1.2...    46   1e-04
TDEL0E04900 Chr5 complement(913381..915738) [2358 bp, 785 aa] {O...    46   1e-04
Smik_2.338 Chr2 complement(602610..605012) [2403 bp, 800 aa] {ON...    46   1e-04
SAKL0H09988g Chr8 complement(853060..855309) [2250 bp, 749 aa] {...    46   1e-04
ADR242C Chr4 complement(1126441..1128006) [1566 bp, 521 aa] {ON}...    46   1e-04
KLLA0F10791g Chr6 complement(991642..993279) [1638 bp, 545 aa] {...    46   1e-04
SAKL0F15972g Chr6 (1291625..1293037) [1413 bp, 470 aa] {ON} simi...    46   1e-04
Skud_4.109 Chr4 complement(190191..193796) [3606 bp, 1201 aa] {O...    46   1e-04
TPHA0G01740 Chr7 complement(357600..358946) [1347 bp, 448 aa] {O...    46   1e-04
Skud_2.324 Chr2 complement(583774..586182) [2409 bp, 802 aa] {ON...    46   1e-04
Suva_4.99 Chr4 complement(182425..186030) [3606 bp, 1201 aa] {ON...    46   1e-04
KLTH0G12430g Chr7 (1057236..1058339) [1104 bp, 367 aa] {ON} simi...    45   2e-04
Smik_12.52 Chr12 (114649..116118) [1470 bp, 489 aa] {ON} YLL011W...    45   2e-04
Ecym_6067 Chr6 (124870..126438) [1569 bp, 522 aa] {ON} similar t...    45   2e-04
KNAG0C01410 Chr3 (277054..279015) [1962 bp, 653 aa] {ON} Anc_1.2...    45   2e-04
AEL314W Chr5 (52978..55125) [2148 bp, 715 aa] {ON} Syntenic homo...    45   2e-04
KNAG0G00800 Chr7 (147792..150164) [2373 bp, 790 aa] {ON} Anc_5.1...    46   2e-04
YLL011W Chr12 (127523..128992) [1470 bp, 489 aa] {ON}  SOF1Essen...    45   2e-04
TBLA0C01740 Chr3 (409315..410889) [1575 bp, 524 aa] {ON} Anc_8.6...    45   2e-04
NDAI0B05190 Chr2 complement(1269217..1271223) [2007 bp, 668 aa] ...    45   2e-04
KAFR0L01320 Chr12 complement(244228..247950) [3723 bp, 1240 aa] ...    45   2e-04
CAGL0A02772g Chr1 complement(293966..295291) [1326 bp, 441 aa] {...    45   2e-04
NDAI0I02180 Chr9 complement(499955..501394) [1440 bp, 479 aa] {O...    45   2e-04
SAKL0B02244g Chr2 (212226..214547) [2322 bp, 773 aa] {ON} simila...    45   2e-04
KNAG0H01690 Chr8 (301564..302475) [912 bp, 303 aa] {ON} Anc_1.39...    45   2e-04
AER114W Chr5 (850726..850730,850789..852685) [1902 bp, 633 aa] {...    45   2e-04
Kpol_1001.23 s1001 complement(63130..64962) [1833 bp, 610 aa] {O...    45   2e-04
Skud_14.22 Chr14 (34087..35490) [1404 bp, 467 aa] {ON} YNL317W (...    45   2e-04
NDAI0J00330 Chr10 (54580..55998) [1419 bp, 472 aa] {ON} Anc_7.534      45   2e-04
CAGL0E01485g Chr5 complement(139067..143077) [4011 bp, 1336 aa] ...    45   2e-04
Kwal_27.12053 s27 (1065073..1067340) [2268 bp, 755 aa] {ON} YBR1...    45   2e-04
Kpol_1014.19 s1014 complement(30466..31824) [1359 bp, 452 aa] {O...    45   2e-04
KLTH0H01122g Chr8 (113798..115537) [1740 bp, 579 aa] {ON} simila...    45   2e-04
TPHA0M02000 Chr13 complement(414262..416361) [2100 bp, 699 aa] {...    45   2e-04
Smik_4.90 Chr4 complement(171469..175074) [3606 bp, 1201 aa] {ON...    45   3e-04
Suva_16.510 Chr16 (874866..876263) [1398 bp, 465 aa] {ON} YPR178...    45   3e-04
YNL317W Chr14 (40619..42016) [1398 bp, 465 aa] {ON}  PFS2Integra...    45   3e-04
AER255C Chr5 complement(1107932..1109335) [1404 bp, 467 aa] {ON}...    45   3e-04
Smik_4.45 Chr4 (85422..89234) [3813 bp, 1270 aa] {ON} YDL195W (R...    45   3e-04
TDEL0H02130 Chr8 (362711..364465) [1755 bp, 584 aa] {ON} Anc_7.2...    45   3e-04
Suva_7.494 Chr7 complement(856266..858641) [2376 bp, 791 aa] {ON...    45   3e-04
TPHA0A04810 Chr1 complement(1090373..1092751) [2379 bp, 792 aa] ...    45   3e-04
Suva_10.64 Chr10 (132461..133933) [1473 bp, 490 aa] {ON} YLL011W...    45   3e-04
SAKL0E03960g Chr5 complement(319708..320130,320346..320885) [963...    44   3e-04
ZYRO0C14564g Chr3 (1135755..1137491) [1737 bp, 578 aa] {ON} simi...    45   3e-04
Suva_14.22 Chr14 (36853..38262) [1410 bp, 469 aa] {ON} YNL317W (...    45   3e-04
Kwal_23.5769 s23 complement(1311598..1313481) [1884 bp, 627 aa] ...    45   3e-04
SAKL0G14432g Chr7 complement(1245508..1247877) [2370 bp, 789 aa]...    45   3e-04
KLTH0D15840g Chr4 (1305121..1305125,1305195..1307283) [2094 bp, ...    45   3e-04
Suva_10.316 Chr10 complement(551612..554068) [2457 bp, 818 aa] {...    45   3e-04
KLTH0G12276g Chr7 complement(1042617..1045430) [2814 bp, 937 aa]...    45   3e-04
KAFR0E03900 Chr5 complement(771649..772968) [1320 bp, 439 aa] {O...    44   3e-04
KLTH0E12606g Chr5 (1120419..1122686) [2268 bp, 755 aa] {ON} simi...    45   4e-04
SAKL0A02970g Chr1 complement(275095..276342) [1248 bp, 415 aa] {...    44   4e-04
Ecym_7403 Chr7 (829923..831476) [1554 bp, 517 aa] {ON} similar t...    44   4e-04
TDEL0A06180 Chr1 (1082208..1083512) [1305 bp, 434 aa] {ON} Anc_8...    44   4e-04
KNAG0A01250 Chr1 (23559..24917) [1359 bp, 452 aa] {ON} Anc_3.25 ...    44   4e-04
Kpol_1062.32 s1062 (69674..71074) [1401 bp, 466 aa] {ON} (69674....    44   4e-04
SAKL0H15532g Chr8 complement(1351712..1354537) [2826 bp, 941 aa]...    44   4e-04
Skud_12.285 Chr12 complement(525831..528284) [2454 bp, 817 aa] {...    44   4e-04
TDEL0C01920 Chr3 (337685..339376) [1692 bp, 563 aa] {ON} Anc_7.3...    44   4e-04
NDAI0H02250 Chr8 (546983..548821) [1839 bp, 612 aa] {ON} Anc_2.4...    44   4e-04
TPHA0B01120 Chr2 (254017..256176) [2160 bp, 719 aa] {ON} Anc_1.2...    44   4e-04
KLTH0G10296g Chr7 complement(869990..871270) [1281 bp, 426 aa] {...    44   4e-04
Skud_7.536 Chr7 complement(874704..877070) [2367 bp, 788 aa] {ON...    44   4e-04
YLR222C Chr12 complement(579318..581771) [2454 bp, 817 aa] {ON} ...    44   5e-04
Kpol_1048.59 s1048 complement(166721..169273) [2553 bp, 850 aa] ...    44   5e-04
TDEL0D01090 Chr4 complement(204076..206004) [1929 bp, 642 aa] {O...    44   5e-04
SAKL0C13332g Chr3 (1177358..1181419) [4062 bp, 1353 aa] {ON} sim...    44   5e-04
Suva_4.452 Chr4 complement(786121..788523) [2403 bp, 800 aa] {ON...    44   6e-04
Ecym_2282 Chr2 complement(552170..553879) [1710 bp, 569 aa] {ON}...    44   6e-04
AFL157C Chr6 complement(140404..141720) [1317 bp, 438 aa] {ON} S...    44   6e-04
TDEL0C00940 Chr3 (150797..152719) [1923 bp, 640 aa] {ON} Anc_8.6...    44   6e-04
Ecym_7078 Chr7 complement(156495..157436) [942 bp, 313 aa] {ON} ...    44   6e-04
TBLA0A03950 Chr1 (986923..989733) [2811 bp, 936 aa] {ON} Anc_8.3...    44   6e-04
YNL035C Chr14 complement(568522..569691) [1170 bp, 389 aa] {ON} ...    44   6e-04
TBLA0A03750 Chr1 complement(937167..938510) [1344 bp, 447 aa] {O...    44   6e-04
TPHA0P00330 Chr16 (63488..65419) [1932 bp, 643 aa] {ON} Anc_8.67...    44   6e-04
SAKL0C13266g Chr3 complement(1171961..1173340) [1380 bp, 459 aa]...    44   6e-04
Smik_7.159 Chr7 (285146..286981) [1836 bp, 611 aa] {ON} YGL116W ...    44   7e-04
KNAG0G00130 Chr7 complement(8702..10888) [2187 bp, 728 aa] {ON} ...    44   7e-04
KLTH0A02750g Chr1 complement(239284..241545) [2262 bp, 753 aa] {...    44   7e-04
Smik_3.183 Chr3 complement(259959..262088) [2130 bp, 709 aa] {ON...    44   7e-04
KAFR0A06480 Chr1 complement(1312834..1314540) [1707 bp, 568 aa] ...    44   7e-04
KLTH0H01892g Chr8 complement(167262..170891) [3630 bp, 1209 aa] ...    44   7e-04
Smik_12.279 Chr12 complement(526367..528820) [2454 bp, 817 aa] {...    44   7e-04
NCAS0C01680 Chr3 (309670..310965) [1296 bp, 431 aa] {ON} Anc_8.672     44   7e-04
NDAI0J01850 Chr10 (461283..463010) [1728 bp, 575 aa] {ON} Anc_4....    44   7e-04
NDAI0K02350 Chr11 complement(524551..526932) [2382 bp, 793 aa] {...    44   7e-04
TDEL0A05970 Chr1 (1047306..1048733) [1428 bp, 475 aa] {ON} Anc_8...    44   7e-04
Smik_6.70 Chr6 (129582..131933) [2352 bp, 783 aa] {ON} YFL009W (...    44   7e-04
KNAG0I00920 Chr9 (173033..174178) [1146 bp, 381 aa] {ON} Anc_8.3...    43   7e-04
Smik_15.413 Chr15 (718053..719462) [1410 bp, 469 aa] {ON} YOR229...    44   8e-04
KNAG0B06450 Chr2 complement(1274888..1276792) [1905 bp, 634 aa] ...    44   8e-04
KLLA0E23453g Chr5 (2088516..2090996) [2481 bp, 826 aa] {ON} simi...    44   8e-04
AEL269C Chr5 complement(134760..136127) [1368 bp, 455 aa] {ON} S...    43   8e-04
KLLA0F27511g Chr6 (2546533..2548404) [1872 bp, 623 aa] {ON} simi...    44   8e-04
KAFR0E00180 Chr5 complement(35535..37721) [2187 bp, 728 aa] {ON}...    44   8e-04
NCAS0B02200 Chr2 complement(359080..361548) [2469 bp, 822 aa] {O...    44   8e-04
Kwal_56.24526 s56 (1036575..1040207) [3633 bp, 1210 aa] {ON} YDL...    44   9e-04
KLLA0E20967g Chr5 (1872227..1876192) [3966 bp, 1321 aa] {ON} sim...    44   9e-04
Suva_14.311 Chr14 complement(553987..555156) [1170 bp, 389 aa] {...    43   0.001
YGR200C Chr7 complement(899904..902270) [2367 bp, 788 aa] {ON}  ...    43   0.001
NCAS0B00480 Chr2 (69598..70968) [1371 bp, 456 aa] {ON} Anc_8.721       43   0.001
KLLA0F05159g Chr6 (506007..509702) [3696 bp, 1231 aa] {ON} simil...    43   0.001
Suva_2.291 Chr2 (504722..508177) [3456 bp, 1151 aa] {ON} YDR128W...    43   0.001
Skud_4.389 Chr4 (681326..684781) [3456 bp, 1151 aa] {ON} YDR128W...    43   0.001
YOR229W Chr15 (768409..769812) [1404 bp, 467 aa] {ON}  WTM2Trans...    43   0.001
KAFR0C04740 Chr3 complement(941929..943926) [1998 bp, 665 aa] {O...    43   0.001
ZYRO0A12980g Chr1 (1025863..1028337) [2475 bp, 824 aa] {ON} simi...    43   0.001
KNAG0G02450 Chr7 (557570..560398) [2829 bp, 942 aa] {ON} Anc_8.3...    43   0.001
Kwal_56.24661 s56 complement(1093040..1094725) [1686 bp, 561 aa]...    43   0.001
NDAI0E00910 Chr5 complement(182574..183968) [1395 bp, 464 aa] {O...    43   0.001
TBLA0H03060 Chr8 complement(748221..750413) [2193 bp, 730 aa] {O...    43   0.001
AGR180W Chr7 (1090641..1093061) [2421 bp, 806 aa] {ON} Syntenic ...    43   0.001
TPHA0L01080 Chr12 (226790..229297) [2508 bp, 835 aa] {ON} Anc_8....    43   0.001
TBLA0D02630 Chr4 (645439..648027) [2589 bp, 862 aa] {ON} Anc_8.6...    43   0.001
KAFR0G01900 Chr7 (403294..404574) [1281 bp, 426 aa] {ON}               42   0.001
Smik_11.10 Chr11 complement(16139..18292) [2154 bp, 717 aa] {ON}...    43   0.001
Smik_4.374 Chr4 (670748..674206) [3459 bp, 1152 aa] {ON} YDR128W...    43   0.001
AGL190W Chr7 (341382..342494) [1113 bp, 370 aa] {ON} Syntenic ho...    42   0.001
KAFR0C03190 Chr3 complement(639680..641698) [2019 bp, 672 aa] {O...    43   0.001
KLLA0E04093g Chr5 (371642..372760) [1119 bp, 372 aa] {ON} simila...    42   0.001
Kwal_55.22076 s55 (1098857..1102717) [3861 bp, 1286 aa] {ON} YOL...    43   0.001
KLLA0E07965g Chr5 (717476..718648) [1173 bp, 390 aa] {ON} simila...    42   0.002
Smik_15.16 Chr15 complement(29410..33390) [3981 bp, 1326 aa] {ON...    43   0.002
KAFR0A05610 Chr1 complement(1126349..1128211) [1863 bp, 620 aa] ...    42   0.002
YDR128W Chr4 (709549..712995) [3447 bp, 1148 aa] {ON}  MTC5Subun...    43   0.002
TBLA0H00230 Chr8 complement(31016..35017) [4002 bp, 1333 aa] {ON...    43   0.002
SAKL0H15708g Chr8 (1370148..1371254) [1107 bp, 368 aa] {ON} high...    42   0.002
Kwal_56.24399 s56 (981153..982262) [1110 bp, 369 aa] {ON} [conti...    42   0.002
SAKL0F10384g Chr6 complement(799553..803338) [3786 bp, 1261 aa] ...    43   0.002
Kpol_1064.35 s1064 (64223..65584) [1362 bp, 453 aa] {ON} (64223....    42   0.002
NDAI0C05770 Chr3 complement(1328677..1329684) [1008 bp, 335 aa] ...    42   0.002
NDAI0G03310 Chr7 complement(777538..780195) [2658 bp, 885 aa] {O...    42   0.002
Ecym_2139 Chr2 complement(262217..263524) [1308 bp, 435 aa] {ON}...    42   0.002
ZYRO0F09922g Chr6 complement(805666..807033) [1368 bp, 455 aa] {...    42   0.002
TPHA0F03030 Chr6 complement(661801..663549) [1749 bp, 582 aa] {O...    42   0.002
Ecym_4134 Chr4 complement(280146..282578) [2433 bp, 810 aa] {ON}...    42   0.002
Ecym_7105 Chr7 complement(205465..206919) [1455 bp, 484 aa] {ON}...    42   0.002
TDEL0A05770 Chr1 (1018340..1019641) [1302 bp, 433 aa] {ON} Anc_8...    42   0.002
SAKL0E07766g Chr5 (628373..629569) [1197 bp, 398 aa] {ON} simila...    42   0.002
Ecym_7028 Chr7 (52132..52136,52211..54083) [1878 bp, 625 aa] {ON...    42   0.002
TPHA0C03370 Chr3 complement(738736..739977) [1242 bp, 413 aa] {O...    42   0.002
TDEL0E01960 Chr5 (369744..371102) [1359 bp, 452 aa] {ON} Anc_5.4...    42   0.002
TPHA0I01880 Chr9 complement(418620..421724) [3105 bp, 1034 aa] {...    42   0.002
Ecym_5528 Chr5 complement(1070598..1072013) [1416 bp, 471 aa] {O...    42   0.002
NDAI0A00750 Chr1 complement(144773..151225) [6453 bp, 2150 aa] {...    42   0.002
KNAG0A03220 Chr1 complement(399879..401150) [1272 bp, 423 aa] {O...    42   0.002
YKL213C Chr11 complement(31960..34107) [2148 bp, 715 aa] {ON}  D...    42   0.002
NCAS0A15170 Chr1 (2984221..2985645) [1425 bp, 474 aa] {ON} Anc_7...    42   0.002
Suva_7.152 Chr7 (284623..286461) [1839 bp, 612 aa] {ON} YGL116W ...    42   0.002
KLLA0D16390g Chr4 (1378884..1381694) [2811 bp, 936 aa] {ON} simi...    42   0.002
Suva_2.537 Chr2 complement(959258..960625) [1368 bp, 455 aa] {ON...    42   0.002
TPHA0D03590 Chr4 (752790..754586) [1797 bp, 598 aa] {ON} Anc_6.2...    42   0.002
YDL195W Chr4 (107208..111029) [3822 bp, 1273 aa] {ON}  SEC31Comp...    42   0.002
NCAS0C02710 Chr3 complement(505852..508299) [2448 bp, 815 aa] {O...    42   0.002
KLTH0D04466g Chr4 (413024..413560,413816..414238) [960 bp, 319 a...    42   0.002
TBLA0D03580 Chr4 complement(885182..887353) [2172 bp, 723 aa] {O...    42   0.002
SAKL0H16390g Chr8 complement(1437966..1441388) [3423 bp, 1140 aa...    42   0.002
Smik_13.277 Chr13 (437902..439443) [1542 bp, 513 aa] {ON} YMR093...    42   0.002
TBLA0H03620 Chr8 (882587..885025) [2439 bp, 812 aa] {ON} Anc_8.5...    42   0.002
TBLA0F00520 Chr6 complement(134791..136782) [1992 bp, 663 aa] {O...    42   0.002
NCAS0A09610 Chr1 complement(1920171..1922258) [2088 bp, 695 aa] ...    42   0.003
Kpol_1024.42 s1024 complement(112044..114575) [2532 bp, 843 aa] ...    42   0.003
KLTH0F16192g Chr6 (1312331..1313719) [1389 bp, 462 aa] {ON} simi...    42   0.003
Smik_11.298 Chr11 complement(497968..499956) [1989 bp, 662 aa] {...    42   0.003
CAGL0M08646g Chr13 (861488..862501) [1014 bp, 337 aa] {ON} simil...    41   0.003
NDAI0G02580 Chr7 complement(590030..592906) [2877 bp, 958 aa] {O...    42   0.003
ZYRO0F11110g Chr6 (908737..912342) [3606 bp, 1201 aa] {ON} highl...    42   0.003
Skud_14.298 Chr14 complement(546083..547252) [1170 bp, 389 aa] {...    41   0.003
NDAI0C05490 Chr3 (1275046..1277625) [2580 bp, 859 aa] {ON}             42   0.003
Ecym_4343 Chr4 (733111..734862) [1752 bp, 583 aa] {ON} similar t...    42   0.003
NCAS0B01430 Chr2 (233965..235317) [1353 bp, 450 aa] {ON}               42   0.003
TBLA0G02090 Chr7 (545989..547911) [1923 bp, 640 aa] {ON} Anc_4.3...    42   0.003
Ecym_4280 Chr4 complement(600066..603464) [3399 bp, 1132 aa] {ON...    42   0.003
Suva_11.7 Chr11 complement(15456..17615) [2160 bp, 719 aa] {ON} ...    42   0.003
YPR178W Chr16 (892332..893729) [1398 bp, 465 aa] {ON}  PRP4Splic...    41   0.003
Skud_15.437 Chr15 (771566..772951) [1386 bp, 461 aa] {ON} YOR272...    41   0.003
AGR207C Chr7 complement(1146704..1147666) [963 bp, 320 aa] {ON} ...    41   0.003
NCAS0A07860 Chr1 (1563830..1565362) [1533 bp, 510 aa] {ON} Anc_2...    41   0.004
Smik_5.200 Chr5 (297829..299004) [1176 bp, 391 aa] {ON} YFL009W ...    41   0.004
TPHA0C01050 Chr3 complement(235500..238874) [3375 bp, 1124 aa] {...    42   0.004
CAGL0L02629g Chr12 complement(309320..311707) [2388 bp, 795 aa] ...    41   0.004
ABL044C Chr2 complement(312376..313932) [1557 bp, 518 aa] {ON} S...    41   0.004
KAFR0B05580 Chr2 (1142731..1146093) [3363 bp, 1120 aa] {ON} Anc_...    41   0.004
NCAS0A13940 Chr1 (2740150..2743767) [3618 bp, 1205 aa] {ON} Anc_...    41   0.004
KAFR0A04110 Chr1 (826618..828000) [1383 bp, 460 aa] {ON} Anc_8.7...    41   0.004
NDAI0E03440 Chr5 complement(735469..738042) [2574 bp, 857 aa] {O...    41   0.004
Kpol_1038.20 s1038 complement(43719..47660) [3942 bp, 1313 aa] {...    41   0.004
TBLA0B04390 Chr2 (1014987..1015997) [1011 bp, 336 aa] {ON} Anc_8...    41   0.004
ZYRO0D01122g Chr4 complement(86927..88327) [1401 bp, 466 aa] {ON...    41   0.004
ZYRO0F03784g Chr6 (314914..317247) [2334 bp, 777 aa] {ON} simila...    41   0.004
TDEL0A01730 Chr1 complement(310640..312433) [1794 bp, 597 aa] {O...    41   0.004
YGL116W Chr7 (289809..291641) [1833 bp, 610 aa] {ON}  CDC20Cell-...    41   0.004
TPHA0D00580 Chr4 (100671..102869) [2199 bp, 732 aa] {ON} Anc_8.6...    41   0.004
KLLA0E04819g Chr5 (428278..429657) [1380 bp, 459 aa] {ON} simila...    41   0.005
Smik_14.296 Chr14 complement(535060..536229) [1170 bp, 389 aa] {...    41   0.005
TDEL0A06650 Chr1 (1160677..1162032) [1356 bp, 451 aa] {ON} Anc_8...    41   0.005
TPHA0G00680 Chr7 complement(127929..129302) [1374 bp, 457 aa] {O...    41   0.005
Kpol_1070.11 s1070 (30012..32012) [2001 bp, 666 aa] {ON} (30012....    41   0.005
Ecym_3321 Chr3 complement(615730..616959) [1230 bp, 409 aa] {ON}...    40   0.005
ZYRO0F05808g Chr6 complement(479060..482908) [3849 bp, 1282 aa] ...    41   0.005
YFL009W Chr6 (116145..118484) [2340 bp, 779 aa] {ON}  CDC4F-box ...    41   0.006
KNAG0F03870 Chr6 complement(731884..733281) [1398 bp, 465 aa] {O...    40   0.006
SAKL0H05456g Chr8 complement(490546..491886) [1341 bp, 446 aa] {...    40   0.006
NCAS0B07840 Chr2 complement(1486900..1488669) [1770 bp, 589 aa] ...    41   0.006
KLLA0D12760g Chr4 complement(1090428..1091909) [1482 bp, 493 aa]...    40   0.006
KNAG0G01080 Chr7 (235280..237520) [2241 bp, 746 aa] {ON}  YER066W      41   0.006
Kwal_47.17567 s47 complement(459443..461215) [1773 bp, 590 aa] {...    40   0.006
Suva_8.321 Chr8 (572329..573711) [1383 bp, 460 aa] {ON} YOR272W ...    40   0.006
YOR272W Chr15 (832813..834195) [1383 bp, 460 aa] {ON}  YTM1Const...    40   0.006
Skud_15.395 Chr15 (707395..708789) [1395 bp, 464 aa] {ON} YOR229...    40   0.006
ADL082C Chr4 complement(538945..540654) [1710 bp, 569 aa] {ON} S...    40   0.006
Kwal_56.23920 s56 (776647..779460) [2814 bp, 937 aa] {ON} YLR129...    41   0.006
Kwal_56.24478 s56 complement(1010876..1014766) [3891 bp, 1296 aa...    41   0.006
TDEL0B03020 Chr2 complement(534847..537342) [2496 bp, 831 aa] {O...    40   0.006
Kpol_1011.6 s1011 complement(17489..19777) [2289 bp, 762 aa] {ON...    40   0.007
TPHA0G02840 Chr7 (604491..605033) [543 bp, 180 aa] {ON} Anc_2.43...    39   0.007
CAGL0G04345g Chr7 (408842..410977) [2136 bp, 711 aa] {ON} simila...    40   0.007
ADR090W Chr4 (868742..872443) [3702 bp, 1233 aa] {ON} Syntenic h...    40   0.007
Ecym_2026 Chr2 (42179..43534) [1356 bp, 451 aa] {ON} similar to ...    40   0.007
TDEL0F04150 Chr6 (765748..769152) [3405 bp, 1134 aa] {ON} Anc_8....    40   0.007
Kpol_2001.63 s2001 complement(171777..175607) [3831 bp, 1276 aa]...    40   0.007
CAGL0M06193g Chr13 (643917..644867) [951 bp, 316 aa] {ON} simila...    40   0.007
Ecym_2024 Chr2 complement(35886..39839) [3954 bp, 1317 aa] {ON} ...    40   0.007
KLTH0A00880g Chr1 complement(90125..91540) [1416 bp, 471 aa] {ON...    40   0.008
KAFR0E03180 Chr5 (637055..639499) [2445 bp, 814 aa] {ON} Anc_8.5...    40   0.008
NCAS0J01110 Chr10 (189535..191322) [1788 bp, 595 aa] {ON}              40   0.008
KLTH0B01628g Chr2 (129632..132004) [2373 bp, 790 aa] {ON} simila...    40   0.008
KNAG0D01690 Chr4 (286791..288755) [1965 bp, 654 aa] {ON} Anc_7.2...    40   0.008
TBLA0G03080 Chr7 complement(817595..818923) [1329 bp, 442 aa] {O...    40   0.008
Kpol_1058.31 s1058 (85899..87926) [2028 bp, 675 aa] {ON} (85899....    40   0.009
KNAG0D00250 Chr4 (32581..34548) [1968 bp, 655 aa] {ON} Anc_6.363...    40   0.009
YMR093W Chr13 (454015..455556) [1542 bp, 513 aa] {ON}  UTP15Nucl...    40   0.009
NCAS0C04430 Chr3 complement(905927..909862) [3936 bp, 1311 aa] {...    40   0.009
KAFR0I02860 Chr9 (573406..577503) [4098 bp, 1365 aa] {ON} Anc_3....    40   0.009
CAGL0A00605g Chr1 complement(67281..69203) [1923 bp, 640 aa] {ON...    40   0.009
TBLA0A03890 Chr1 complement(973249..974337) [1089 bp, 362 aa] {O...    40   0.010
Kwal_26.8975 s26 (1026741..1028078) [1338 bp, 445 aa] {ON} YOR27...    40   0.010
TBLA0F02400 Chr6 complement(590293..591189) [897 bp, 298 aa] {ON...    39   0.010
KNAG0C04950 Chr3 (955701..957023) [1323 bp, 440 aa] {ON} Anc_5.4...    40   0.010
Ecym_4249 Chr4 complement(516064..517188) [1125 bp, 374 aa] {ON}...    40   0.010
TBLA0A01870 Chr1 (455007..458021) [3015 bp, 1004 aa] {ON} Anc_6....    40   0.010
NDAI0E01320 Chr5 complement(262712..263995) [1284 bp, 427 aa] {O...    40   0.010
NCAS0B01910 Chr2 (312479..313456) [978 bp, 325 aa] {ON} Anc_8.585      39   0.011
SAKL0D03740g Chr4 (303240..304676) [1437 bp, 478 aa] {ON} simila...    40   0.011
KAFR0L01390 Chr12 (257344..260964) [3621 bp, 1206 aa] {ON} Anc_7...    40   0.011
SAKL0H08932g Chr8 (763703..764647) [945 bp, 314 aa] {ON} similar...    39   0.011
ZYRO0F09372g Chr6 (761606..762952) [1347 bp, 448 aa] {ON} highly...    40   0.011
KLTH0D10186g Chr4 (845352..846617) [1266 bp, 421 aa] {ON} simila...    40   0.012
KNAG0G02820 Chr7 (623677..625050) [1374 bp, 457 aa] {ON} Anc_8.7...    40   0.012
KAFR0I00500 Chr9 complement(104685..106268) [1584 bp, 527 aa] {O...    40   0.012
Skud_6.63 Chr6 (118478..120823) [2346 bp, 781 aa] {ON} YFL009W (...    40   0.012
Kpol_1036.69 s1036 (189457..192267) [2811 bp, 936 aa] {ON} (1894...    40   0.012
CAGL0M04279g Chr13 (469040..471862) [2823 bp, 940 aa] {ON} highl...    40   0.012
TBLA0H02000 Chr8 complement(474850..476271) [1422 bp, 473 aa] {O...    39   0.013
Ecym_8061 Chr8 complement(131761..135447) [3687 bp, 1228 aa] {ON...    40   0.013
KLLA0F19734g Chr6 (1826828..1830229) [3402 bp, 1133 aa] {ON} sim...    40   0.013
CAGL0L00781g Chr12 (97503..99524) [2022 bp, 673 aa] {ON} similar...    40   0.013
CAGL0G01628g Chr7 complement(151262..152392) [1131 bp, 376 aa] {...    39   0.013
ACR097W Chr3 (529784..531187) [1404 bp, 467 aa] {ON} Syntenic ho...    39   0.013
NCAS0B01440 Chr2 (236104..237390) [1287 bp, 428 aa] {ON}               39   0.015
Kwal_27.11585 s27 (859952..862423) [2472 bp, 823 aa] {ON} YLR222...    39   0.016
CAGL0K00957g Chr11 (95657..98038) [2382 bp, 793 aa] {ON} similar...    39   0.016
TBLA0H02380 Chr8 (568334..570721) [2388 bp, 795 aa] {ON} Anc_5.1...    39   0.016
TDEL0F04500 Chr6 (843307..846123) [2817 bp, 938 aa] {ON} Anc_8.3...    39   0.016
Kwal_23.5035 s23 (975572..977806) [2235 bp, 744 aa] {ON} YFL009W...    39   0.016
SAKL0H22396g Chr8 complement(1949474..1951141) [1668 bp, 555 aa]...    39   0.016
TBLA0B03570 Chr2 complement(828308..829684) [1377 bp, 458 aa] {O...    39   0.017
KLTH0F19338g Chr6 (1564555..1568427) [3873 bp, 1290 aa] {ON} sim...    39   0.017
TBLA0B05920 Chr2 complement(1390257..1391468) [1212 bp, 403 aa] ...    39   0.018
CAGL0J08998g Chr10 (884779..888624) [3846 bp, 1281 aa] {ON} high...    39   0.018
TDEL0B02010 Chr2 complement(355418..357835) [2418 bp, 805 aa] {O...    39   0.019
KAFR0D01020 Chr4 (210874..212490) [1617 bp, 538 aa] {ON} Anc_8.4...    39   0.019
Ecym_8044 Chr8 (97649..98584) [936 bp, 311 aa] {ON} similar to A...    39   0.019
TBLA0E00760 Chr5 (158338..159492) [1155 bp, 384 aa] {ON}               39   0.019
ZYRO0B13838g Chr2 (1121025..1123079) [2055 bp, 684 aa] {ON} some...    39   0.020
Suva_16.171 Chr16 complement(299070..300455) [1386 bp, 461 aa] {...    39   0.020
Smik_9.144 Chr9 (242718..244610) [1893 bp, 630 aa] {ON} YIL046W ...    39   0.020
TDEL0F04430 Chr6 complement(831678..832781) [1104 bp, 367 aa] {O...    39   0.020
CAGL0K00275g Chr11 complement(26129..28276) [2148 bp, 715 aa] {O...    39   0.021
KAFR0L01440 Chr12 complement(266463..267377) [915 bp, 304 aa] {O...    39   0.021
YIL046W Chr9 (268651..270573) [1923 bp, 640 aa] {ON}  MET30F-box...    39   0.021
Smik_15.398 Chr15 (692606..693883) [1278 bp, 425 aa] {ON} YOR212...    39   0.022
ACR116W Chr3 (555946..557307) [1362 bp, 453 aa] {ON} Syntenic ho...    39   0.022
Kwal_55.21450 s55 (842483..843994) [1512 bp, 503 aa] {ON} YDR364...    39   0.022
Skud_12.272 Chr12 (506157..507050) [894 bp, 297 aa] {ON} YLR208W...    38   0.023
KNAG0B05550 Chr2 (1080707..1082560) [1854 bp, 617 aa] {ON} Anc_4...    39   0.023
KNAG0F00620 Chr6 (105380..106768) [1389 bp, 462 aa] {ON} Anc_1.1...    39   0.023
Suva_15.22 Chr15 complement(39171..43181) [4011 bp, 1336 aa] {ON...    39   0.023
KNAG0A03070 Chr1 complement(378279..379604) [1326 bp, 441 aa] {O...    39   0.024
Smik_4.518 Chr4 complement(935380..936372) [993 bp, 330 aa] {ON}...    39   0.024
ZYRO0D05852g Chr4 (498219..499334) [1116 bp, 371 aa] {ON} simila...    39   0.025
Kpol_1033.19 s1033 (40266..43685) [3420 bp, 1139 aa] {ON} (40266...    39   0.025
YLR208W Chr12 (559551..560444) [894 bp, 297 aa] {ON}  SEC13Struc...    38   0.025
Suva_13.269 Chr13 complement(433166..435016) [1851 bp, 616 aa] {...    39   0.026
NCAS0D03330 Chr4 (623172..625046) [1875 bp, 624 aa] {ON} Anc_6.135     39   0.026
KLTH0E13552g Chr5 complement(1202406..1203356) [951 bp, 316 aa] ...    38   0.026
Ecym_7301 Chr7 (634995..637349) [2355 bp, 784 aa] {ON} similar t...    39   0.027
Suva_10.302 Chr10 (532343..533236) [894 bp, 297 aa] {ON} YLR208W...    38   0.027
SAKL0E03080g Chr5 (253338..254885) [1548 bp, 515 aa] {ON} highly...    39   0.027
Suva_6.51 Chr6 (88465..90756) [2292 bp, 763 aa] {ON} YFL009W (REAL)    39   0.028
TPHA0C00810 Chr3 complement(158582..161395) [2814 bp, 937 aa] {O...    39   0.028
Kwal_56.23895 s56 complement(763257..764360) [1104 bp, 367 aa] {...    38   0.028
Suva_5.178 Chr5 (266333..267301) [969 bp, 322 aa] {ON} YFL009W (...    38   0.028
Smik_12.266 Chr12 (506562..507455) [894 bp, 297 aa] {ON} YLR208W...    38   0.028
KAFR0H02550 Chr8 complement(487226..488521) [1296 bp, 431 aa] {O...    38   0.028
Suva_8.265 Chr8 (481783..483054) [1272 bp, 423 aa] {ON} YOR212W ...    38   0.028
TPHA0G03100 Chr7 complement(659503..661032) [1530 bp, 509 aa] {O...    39   0.029
NCAS0B03550 Chr2 complement(627953..629080) [1128 bp, 375 aa] {O...    38   0.029
KAFR0A00690 Chr1 complement(124349..125875) [1527 bp, 508 aa] {O...    39   0.029
Suva_9.154 Chr9 (257284..259200) [1917 bp, 638 aa] {ON} YIL046W ...    39   0.030
NCAS0A07270 Chr1 complement(1442956..1445355) [2400 bp, 799 aa] ...    39   0.031
Skud_4.634 Chr4 complement(1131614..1132978) [1365 bp, 454 aa] {...    38   0.031
TDEL0G02140 Chr7 complement(420388..421566) [1179 bp, 392 aa] {O...    38   0.032
KAFR0I01880 Chr9 (386694..388469) [1776 bp, 591 aa] {ON} Anc_7.2...    38   0.032
Skud_7.160 Chr7 (294214..296055) [1842 bp, 613 aa] {ON} YGL116W ...    38   0.032
NDAI0G05340 Chr7 (1301733..1303889) [2157 bp, 718 aa] {ON} Anc_1...    39   0.032
TBLA0I02570 Chr9 (597481..600027) [2547 bp, 848 aa] {ON} Anc_8.7...    39   0.033
Suva_8.280 Chr8 (507390..508796) [1407 bp, 468 aa] {ON} YOR229W ...    38   0.033
KAFR0I00640 Chr9 (128872..129819) [948 bp, 315 aa] {ON} Anc_8.58...    38   0.033
ZYRO0D06556g Chr4 complement(564778..568221) [3444 bp, 1147 aa] ...    39   0.033
Skud_9.123 Chr9 (237466..239385) [1920 bp, 639 aa] {ON} YIL046W ...    38   0.034
TBLA0B08930 Chr2 complement(2117704..2119536) [1833 bp, 610 aa] ...    38   0.035
NCAS0J01860 Chr10 (350125..352011) [1887 bp, 628 aa] {ON} Anc_4....    38   0.035
TDEL0F00270 Chr6 complement(40832..42949) [2118 bp, 705 aa] {ON}...    38   0.035
YDR364C Chr4 complement(1202843..1204210) [1368 bp, 455 aa] {ON}...    38   0.036
Kpol_1061.36 s1061 (100800..102569) [1770 bp, 589 aa] {ON} (1008...    38   0.037
Smik_2.243 Chr2 (432627..434252) [1626 bp, 541 aa] {ON} YBR103W ...    38   0.037
TBLA0B04070 Chr2 complement(930877..932130) [1254 bp, 417 aa] {O...    38   0.037
TBLA0F02140 Chr6 complement(526982..530884) [3903 bp, 1300 aa] {...    38   0.037
KAFR0A00700 Chr1 (126326..128149) [1824 bp, 607 aa] {ON} Anc_2.4...    38   0.038
Kpol_467.20 s467 complement(43262..43506,43751..45251) [1746 bp,...    38   0.039
KAFR0H02260 Chr8 complement(430272..433088) [2817 bp, 938 aa] {O...    38   0.040
NDAI0E01330 Chr5 complement(266071..267363) [1293 bp, 430 aa] {O...    38   0.040
Kwal_26.8628 s26 (871377..872645) [1269 bp, 422 aa] {ON} YOR212W...    38   0.041
NDAI0A02880 Chr1 (644069..647938) [3870 bp, 1289 aa] {ON} Anc_7....    38   0.041
NCAS0G03600 Chr7 complement(672904..673887) [984 bp, 327 aa] {ON...    38   0.042
Kpol_1003.34 s1003 complement(85833..86999) [1167 bp, 388 aa] {O...    38   0.043
Ecym_2808 Chr2 (1568103..1569500) [1398 bp, 465 aa] {ON} similar...    38   0.043
KLLA0E12277g Chr5 (1086778..1087329,1087730..1088158) [981 bp, 3...    37   0.044
NCAS0G03870 Chr7 (717809..718978) [1170 bp, 389 aa] {ON} Anc_2.283     38   0.044
TPHA0D04500 Chr4 (978756..982382) [3627 bp, 1208 aa] {ON} Anc_7....    38   0.044
KAFR0H01750 Chr8 complement(322707..325058) [2352 bp, 783 aa] {O...    38   0.047
KLLA0D07546g Chr4 complement(647984..649927) [1944 bp, 647 aa] {...    38   0.047
NDAI0G00150 Chr7 complement(18719..20887) [2169 bp, 722 aa] {ON}...    38   0.047
KLLA0F13244g Chr6 (1224178..1226622) [2445 bp, 814 aa] {ON} high...    38   0.049
TDEL0A05290 Chr1 complement(933493..934452) [960 bp, 319 aa] {ON...    37   0.049
KLTH0C07634g Chr3 (654087..655364) [1278 bp, 425 aa] {ON} weakly...    37   0.054
KLLA0D04840g Chr4 (413362..414273) [912 bp, 303 aa] {ON} highly ...    37   0.055
KLLA0B01958g Chr2 (170646..170663,170896..173550) [2673 bp, 890 ...    38   0.055
TBLA0E04570 Chr5 (1163562..1165349) [1788 bp, 595 aa] {ON} Anc_4...    37   0.056
Ecym_5635 Chr5 (1285780..1286937) [1158 bp, 385 aa] {ON} similar...    37   0.058
SAKL0F12782g Chr6 complement(999031..1000134) [1104 bp, 367 aa] ...    37   0.059
Smik_15.454 Chr15 (782403..783788) [1386 bp, 461 aa] {ON} YOR272...    37   0.060
Kpol_1054.60 s1054 (148854..151013) [2160 bp, 719 aa] {ON} (1488...    37   0.064
NDAI0H02240 Chr8 complement(545073..546617) [1545 bp, 514 aa] {O...    37   0.064
NDAI0G00630 Chr7 complement(137826..139019) [1194 bp, 397 aa] {O...    37   0.065
Suva_13.270 Chr13 (435573..437114) [1542 bp, 513 aa] {ON} YMR093...    37   0.065
Ecym_4255 Chr4 (529455..532268) [2814 bp, 937 aa] {ON} similar t...    37   0.066
KLTH0H01518g Chr8 (138469..139353) [885 bp, 294 aa] {ON} highly ...    37   0.067
NDAI0C02600 Chr3 complement(605643..606554) [912 bp, 303 aa] {ON}      37   0.068
Skud_15.379 Chr15 (681934..683211) [1278 bp, 425 aa] {ON} YOR212...    37   0.076
Kpol_1013.37 s1013 complement(88637..88936,88986..88994,89037..9...    37   0.076
TDEL0F02230 Chr6 (407699..409369) [1671 bp, 556 aa] {ON} Anc_4.1...    37   0.076
NDAI0J01040 Chr10 (238940..240136) [1197 bp, 398 aa] {ON} Anc_8....    37   0.077
TDEL0C02080 Chr3 (360056..360940) [885 bp, 294 aa] {ON} Anc_7.33...    37   0.079
KNAG0A03700 Chr1 complement(477870..480323) [2454 bp, 817 aa] {O...    37   0.084
TDEL0C02360 Chr3 (412482..416276) [3795 bp, 1264 aa] {ON} Anc_7....    37   0.084
NCAS0C03260 Chr3 complement(640108..643059) [2952 bp, 983 aa] {O...    37   0.086
KNAG0E02460 Chr5 complement(488247..490064) [1818 bp, 605 aa] {O...    37   0.089
Skud_15.16 Chr15 complement(26552..30550) [3999 bp, 1332 aa] {ON...    37   0.094
KLLA0E11177g Chr5 (983669..985150) [1482 bp, 493 aa] {ON} simila...    37   0.098
CAGL0B02013g Chr2 (184252..187614) [3363 bp, 1120 aa] {ON} highl...    37   0.100
NDAI0A02090 Chr1 complement(466744..470346) [3603 bp, 1200 aa] {...    37   0.10 
CAGL0I03718g Chr9 complement(317565..321170) [3606 bp, 1201 aa] ...    37   0.10 
KLTH0E08162g Chr5 complement(749584..751254) [1671 bp, 556 aa] {...    37   0.10 
Kwal_56.24596 s56 complement(1068314..1069198) [885 bp, 294 aa] ...    36   0.11 
TPHA0F03650 Chr6 (793481..795703) [2223 bp, 740 aa] {ON} Anc_1.5...    37   0.11 
AGL301C Chr7 complement(137221..138306) [1086 bp, 361 aa] {ON} S...    36   0.11 
YDR142C Chr4 complement(740473..741600) [1128 bp, 375 aa] {ON}  ...    36   0.11 
TPHA0C00860 Chr3 (180116..181252) [1137 bp, 378 aa] {ON} Anc_8.3...    36   0.11 
CAGL0L10890g Chr12 (1165380..1166753) [1374 bp, 457 aa] {ON} hig...    36   0.12 
Kwal_27.12239 s27 complement(1143763..1144713) [951 bp, 316 aa] ...    36   0.12 
CAGL0B01529g Chr2 (137174..138283) [1110 bp, 369 aa] {ON} highly...    36   0.12 
KLTH0D10648g Chr4 (875331..875337,875409..876751) [1350 bp, 449 ...    36   0.13 
Skud_13.249 Chr13 (427918..429459) [1542 bp, 513 aa] {ON} YMR093...    36   0.13 
KAFR0H03340 Chr8 (637913..639016) [1104 bp, 367 aa] {ON} Anc_2.2...    36   0.13 
Suva_10.222 Chr10 (408217..411048) [2832 bp, 943 aa] {ON} YLR129...    36   0.14 
Ecym_6228 Chr6 (425765..427102) [1338 bp, 445 aa] {ON} similar t...    36   0.14 
Kwal_26.7736 s26 complement(491687..493210) [1524 bp, 507 aa] {O...    36   0.14 
NCAS0B01660 Chr2 complement(270046..271320) [1275 bp, 424 aa] {O...    36   0.15 
ZYRO0F14960g Chr6 complement(1228479..1229438) [960 bp, 319 aa] ...    36   0.15 
TBLA0B09190 Chr2 (2171629..2172669) [1041 bp, 346 aa] {ON} Anc_2...    36   0.15 
CAGL0J04818g Chr10 (458449..460413) [1965 bp, 654 aa] {ON} highl...    36   0.16 
KNAG0A02510 Chr1 complement(253245..255794) [2550 bp, 849 aa] {O...    36   0.16 
Smik_4.386 Chr4 complement(701174..702304) [1131 bp, 376 aa] {ON...    36   0.16 
Kpol_2001.65 s2001 (178299..181919) [3621 bp, 1206 aa] {ON} (178...    36   0.16 
Suva_14.342 Chr14 (600032..600943) [912 bp, 303 aa] {ON} YNL006W...    36   0.17 
Kwal_14.884 s14 complement(95068..96255) [1188 bp, 395 aa] {ON} ...    36   0.17 
Ecym_6169 Chr6 complement(314473..316128) [1656 bp, 551 aa] {ON}...    36   0.17 
TBLA0A01540 Chr1 complement(355418..357592) [2175 bp, 724 aa] {O...    36   0.17 
SAKL0B01540g Chr2 (150043..151752) [1710 bp, 569 aa] {ON} simila...    36   0.17 
YDL156W Chr4 (174918..176486) [1569 bp, 522 aa] {ON}  CMR1DNA-bi...    36   0.18 
NDAI0D04730 Chr4 (1109256..1111241) [1986 bp, 661 aa] {ON} Anc_4...    36   0.18 
KLLA0F08811g Chr6 complement(819834..821744) [1911 bp, 636 aa] {...    36   0.19 
KLLA0C07425g Chr3 complement(647673..649007) [1335 bp, 444 aa] {...    36   0.19 
NCAS0H00700 Chr8 (125259..126152) [894 bp, 297 aa] {ON} Anc_7.33...    35   0.19 
Suva_2.303 Chr2 complement(535706..536839) [1134 bp, 377 aa] {ON...    35   0.19 
Kwal_33.15591 s33 (1174119..1176263) [2145 bp, 714 aa] {ON} YKL2...    36   0.19 
YOL138C Chr15 complement(61325..65350) [4026 bp, 1341 aa] {ON}  ...    36   0.19 
Kpol_530.39 s530 (90456..91340) [885 bp, 294 aa] {ON} (90456..91...    35   0.20 
KNAG0B02720 Chr2 complement(523885..527499) [3615 bp, 1204 aa] {...    36   0.20 
Ecym_7373 Chr7 complement(776909..779269) [2361 bp, 786 aa] {ON}...    36   0.20 
Kwal_14.1235 s14 complement(247700..249523) [1824 bp, 607 aa] {O...    36   0.20 
KAFR0I01050 Chr9 complement(205792..208320) [2529 bp, 842 aa] {O...    36   0.21 
ZYRO0A03234g Chr1 (258942..260183) [1242 bp, 413 aa] {ON} simila...    35   0.21 
Kpol_1045.33 s1045 (77282..78367) [1086 bp, 361 aa] {ON} (77284....    35   0.21 
Smik_4.265 Chr4 complement(483300..484820) [1521 bp, 506 aa] {ON...    35   0.21 
YDL145C Chr4 complement(194571..198176) [3606 bp, 1201 aa] {ON} ...    36   0.22 
TPHA0D01130 Chr4 (236199..237554) [1356 bp, 451 aa] {ON} Anc_8.6...    35   0.23 
Ecym_8072 Chr8 (157039..160644) [3606 bp, 1201 aa] {ON} similar ...    36   0.23 
TDEL0B07580 Chr2 (1329080..1330252) [1173 bp, 390 aa] {ON} Anc_2...    35   0.23 
TBLA0G01490 Chr7 (389958..392156) [2199 bp, 732 aa] {ON} Anc_4.1...    35   0.24 
Skud_12.198 Chr12 (382439..385270) [2832 bp, 943 aa] {ON} YLR129...    35   0.24 
KLTH0D12276g Chr4 (998921..1000258) [1338 bp, 445 aa] {ON} highl...    35   0.24 
AFL007C Chr6 complement(424004..425659) [1656 bp, 551 aa] {ON} S...    35   0.24 
TPHA0A05040 Chr1 (1137120..1138359,1138450..1139051) [1842 bp, 6...    35   0.24 
Smik_4.631 Chr4 complement(1128746..1130113) [1368 bp, 455 aa] {...    35   0.24 
Kwal_26.7570 s26 (423448..424104) [657 bp, 218 aa] {ON} YMR116C ...    35   0.25 
KLTH0E10120g Chr5 (916575..919055) [2481 bp, 826 aa] {ON} highly...    35   0.25 
Kpol_1072.41 s1072 complement(90370..91632) [1263 bp, 420 aa] {O...    35   0.25 
KLLA0E18899g Chr5 (1680775..1683747) [2973 bp, 990 aa] {ON} simi...    35   0.26 
KLTH0H02134g Chr8 (191540..195439) [3900 bp, 1299 aa] {ON} simil...    35   0.26 
Skud_14.321 Chr14 (586864..587775) [912 bp, 303 aa] {ON} YNL006W...    35   0.27 
TDEL0C00690 Chr3 (111718..113595) [1878 bp, 625 aa] {ON} Anc_8.4...    35   0.27 
KLLA0A08822g Chr1 (772565..774313) [1749 bp, 582 aa] {ON} simila...    35   0.27 
KAFR0A04550 Chr1 complement(901244..903100) [1857 bp, 618 aa] {O...    35   0.28 
KAFR0G01970 Chr7 complement(414143..415420) [1278 bp, 425 aa] {O...    35   0.28 
TPHA0K00780 Chr11 (163003..164088) [1086 bp, 361 aa] {ON} Anc_7....    35   0.29 
TDEL0A02460 Chr1 (439489..441321) [1833 bp, 610 aa] {ON} Anc_2.4...    35   0.29 
CAGL0J03806g Chr10 (363777..365039) [1263 bp, 420 aa] {ON} simil...    35   0.30 
Smik_12.192 Chr12 (380993..383824) [2832 bp, 943 aa] {ON} YLR129...    35   0.30 
Smik_14.322 Chr14 (578426..579337) [912 bp, 303 aa] {ON} YNL006W...    35   0.32 
YNL006W Chr14 (620067..620978) [912 bp, 303 aa] {ON}  LST8Protei...    35   0.32 
Suva_2.181 Chr2 complement(312873..314396) [1524 bp, 507 aa] {ON...    35   0.34 
ZYRO0F06314g Chr6 (526555..527850) [1296 bp, 431 aa] {ON} simila...    35   0.35 
YLR129W Chr12 (399657..402488) [2832 bp, 943 aa] {ON}  DIP2Nucle...    35   0.35 
ZYRO0G03146g Chr7 complement(238354..239886) [1533 bp, 510 aa] {...    35   0.35 
TPHA0A03100 Chr1 (679875..683672) [3798 bp, 1265 aa] {ON} Anc_7....    35   0.35 
AGR067W Chr7 (842176..845553) [3378 bp, 1125 aa] {ON} Syntenic h...    35   0.36 
CAGL0K12188g Chr11 (1192017..1193624) [1608 bp, 535 aa] {ON} sim...    35   0.37 
ZYRO0G10472g Chr7 complement(844939..846621) [1683 bp, 560 aa] {...    35   0.37 
TBLA0I00360 Chr9 (56206..57300) [1095 bp, 364 aa] {ON} Anc_7.405...    35   0.37 
KLTH0D05346g Chr4 complement(475917..477440) [1524 bp, 507 aa] {...    35   0.38 
Kwal_0.212 s0 (105364..106275) [912 bp, 303 aa] {ON} YNL006W (LS...    35   0.39 
TDEL0B05970 Chr2 (1055359..1056270) [912 bp, 303 aa] {ON} Anc_1....    35   0.39 
TPHA0A00380 Chr1 complement(55881..59813) [3933 bp, 1310 aa] {ON...    35   0.40 
Suva_4.427 Chr4 (751909..752856) [948 bp, 315 aa] {ON} YBR175W (...    34   0.41 
Skud_13.248 Chr13 complement(425542..427389) [1848 bp, 615 aa] {...    35   0.41 
TPHA0I03240 Chr9 (714446..715879) [1434 bp, 477 aa] {ON} Anc_7.5...    35   0.41 
CAGL0J01265g Chr10 complement(118375..119928) [1554 bp, 517 aa] ...    35   0.42 
TPHA0C01150 Chr3 (263944..266007) [2064 bp, 687 aa] {ON} Anc_7.2...    35   0.43 
KAFR0G01890 Chr7 (400922..402274) [1353 bp, 450 aa] {ON}               35   0.43 
KAFR0K01900 Chr11 complement(388463..389554) [1092 bp, 363 aa] {...    34   0.43 
SAKL0F11022g Chr6 (863614..864504) [891 bp, 296 aa] {ON} highly ...    34   0.43 
KAFR0H03140 Chr8 complement(600224..601135) [912 bp, 303 aa] {ON...    34   0.44 
ZYRO0F10406g Chr6 (843429..846245) [2817 bp, 938 aa] {ON} simila...    35   0.46 
KLLA0C16643g Chr3 complement(1457590..1458498) [909 bp, 302 aa] ...    34   0.48 
CAGL0C00737g Chr3 complement(75028..77478) [2451 bp, 816 aa] {ON...    35   0.49 
CAGL0H03729g Chr8 (342948..343859) [912 bp, 303 aa] {ON} highly ...    34   0.50 
Ecym_4218 Chr4 complement(455396..456721) [1326 bp, 441 aa] {ON}...    34   0.52 
AER337W Chr5 (1256750..1258087) [1338 bp, 445 aa] {ON} Syntenic ...    34   0.52 
KNAG0D02720 Chr4 complement(489642..494267) [4626 bp, 1541 aa] {...    35   0.53 
Skud_4.283 Chr4 complement(493677..495191) [1515 bp, 504 aa] {ON...    34   0.58 
SAKL0H12760g Chr8 complement(1089272..1091797) [2526 bp, 841 aa]...    34   0.58 
TPHA0J02160 Chr10 (484299..487313) [3015 bp, 1004 aa] {ON} Anc_6...    34   0.58 
KAFR0E01230 Chr5 complement(247314..248423) [1110 bp, 369 aa] {O...    34   0.59 
CAGL0H08932g Chr8 (871668..871685,872089..874779) [2709 bp, 902 ...    34   0.60 
KAFR0G01170 Chr7 (265249..267603) [2355 bp, 784 aa] {ON} Anc_5.1...    34   0.62 
KLTH0H01628g Chr8 (144953..146488) [1536 bp, 511 aa] {ON} simila...    34   0.65 
CAGL0F07337g Chr6 complement(714870..716735) [1866 bp, 621 aa] {...    34   0.65 
TBLA0D04870 Chr4 complement(1194448..1195431) [984 bp, 327 aa] {...    34   0.67 
KLLA0F13772g Chr6 (1276532..1278094) [1563 bp, 520 aa] {ON} high...    34   0.67 
Ecym_4644 Chr4 (1256560..1257447) [888 bp, 295 aa] {ON} similar ...    33   0.68 
TPHA0O00710 Chr15 (135136..136050) [915 bp, 304 aa] {ON} Anc_1.3...    33   0.71 
TBLA0I01220 Chr9 (261925..263460) [1536 bp, 511 aa] {ON} Anc_2.4...    34   0.73 
AGL024W Chr7 (667533..669803) [2271 bp, 756 aa] {ON} Syntenic ho...    34   0.74 
Skud_15.396 Chr15 (709746..711059) [1314 bp, 437 aa] {ON} YOR230...    34   0.76 
ACR199C Chr3 complement(698881..699768) [888 bp, 295 aa] {ON} Sy...    33   0.77 
TBLA0D04020 Chr4 complement(997081..1000617) [3537 bp, 1178 aa] ...    34   0.79 
KLLA0E24487g Chr5 complement(2175775..2176758) [984 bp, 327 aa] ...    33   0.81 
CAGL0M09845g Chr13 (975007..977817) [2811 bp, 936 aa] {ON} highl...    34   0.81 
AER448W Chr5 (1497416..1499560) [2145 bp, 714 aa] {ON} Syntenic ...    34   0.83 
Kwal_26.8700 s26 (902915..904060) [1146 bp, 381 aa] {ON} YOR229W...    33   0.88 
TBLA0A04150 Chr1 (1027635..1029005) [1371 bp, 456 aa] {ON} Anc_8...    33   0.90 
ZYRO0E07392g Chr5 complement(564166..566841,567011..567028) [269...    34   0.91 
Kwal_27.10785 s27 (495263..496366) [1104 bp, 367 aa] {ON} YER107...    33   0.92 
NCAS0A02800 Chr1 (533712..535517) [1806 bp, 601 aa] {ON} Anc_4.3...    33   0.93 
ZYRO0E04620g Chr5 (348647..349558) [912 bp, 303 aa] {ON} highly ...    33   0.98 
Kpol_1048.38 s1048 (104927..105949) [1023 bp, 340 aa] {ON} (1049...    33   0.98 
Ecym_1499 Chr1 complement(1025285..1027051) [1767 bp, 588 aa] {O...    33   0.99 
SAKL0F10010g Chr6 (767640..768644) [1005 bp, 334 aa] {ON} simila...    33   1.00 
Ecym_1293 Chr1 (595329..596240) [912 bp, 303 aa] {ON} similar to...    33   1.0  
TDEL0C02240 Chr3 complement(388060..391665) [3606 bp, 1201 aa] {...    33   1.0  
TPHA0D04480 Chr4 complement(970967..974989) [4023 bp, 1340 aa] {...    33   1.0  
SAKL0A03872g Chr1 (361507..361524,361720..364338) [2637 bp, 878 ...    33   1.1  
ZYRO0B03652g Chr2 complement(301728..302804) [1077 bp, 358 aa] {...    33   1.1  
NCAS0J00460 Chr10 (68054..69892) [1839 bp, 612 aa] {ON} Anc_8.43...    33   1.1  
NDAI0G03810 Chr7 complement(911595..915776) [4182 bp, 1393 aa] {...    33   1.1  
Skud_11.7 Chr11 complement(15413..17566) [2154 bp, 717 aa] {ON} ...    33   1.1  
Ecym_2274 Chr2 (539468..540592) [1125 bp, 374 aa] {ON} similar t...    33   1.1  
NDAI0A01990 Chr1 (442919..444508) [1590 bp, 529 aa] {ON} Anc_7.3...    33   1.1  
ZYRO0C11242g Chr3 complement(871160..872170) [1011 bp, 336 aa] {...    33   1.2  
AAL009C Chr1 complement(325785..326696) [912 bp, 303 aa] {ON} Sy...    33   1.2  
Kpol_1061.6 s1061 complement(19407..20762) [1356 bp, 451 aa] {ON...    33   1.2  
YHR186C Chr8 complement(475999..480672) [4674 bp, 1557 aa] {ON} ...    33   1.2  
KAFR0G01710 Chr7 (373483..375048) [1566 bp, 521 aa] {ON} Anc_3.3...    33   1.2  
CAGL0E02805g Chr5 complement(265374..267896) [2523 bp, 840 aa] {...    33   1.3  
Skud_4.401 Chr4 complement(712131..713261) [1131 bp, 376 aa] {ON...    33   1.3  
ZYRO0G02420g Chr7 (184509..186686) [2178 bp, 725 aa] {ON} simila...    33   1.3  
KLLA0F22000g Chr6 complement(2044973..2047354) [2382 bp, 793 aa]...    33   1.3  
Kpol_2001.68 s2001 complement(187786..188673) [888 bp, 295 aa] {...    33   1.3  
SAKL0A10406g Chr1 (910452..912587) [2136 bp, 711 aa] {ON} simila...    33   1.4  
KNAG0B01570 Chr2 (290085..290978) [894 bp, 297 aa] {ON} Anc_1.23...    33   1.4  
ADR077C Chr4 complement(843169..846783) [3615 bp, 1204 aa] {ON} ...    33   1.4  
YDR267C Chr4 complement(1002510..1003502) [993 bp, 330 aa] {ON} ...    33   1.4  
Skud_16.142 Chr16 complement(261333..262718) [1386 bp, 461 aa] {...    33   1.4  
Skud_4.530 Chr4 complement(945231..946247) [1017 bp, 338 aa] {ON...    33   1.4  
Kpol_1018.103 s1018 complement(268887..269966) [1080 bp, 359 aa]...    33   1.5  
Suva_16.126 Chr16 complement(209255..212296) [3042 bp, 1013 aa] ...    33   1.5  
ZYRO0D00748g Chr4 (56274..57251) [978 bp, 325 aa] {ON} highly si...    33   1.5  
Ecym_7229 Chr7 (475040..477529) [2490 bp, 829 aa] {ON} similar t...    33   1.5  
KNAG0C03490 Chr3 (684848..685936) [1089 bp, 362 aa] {ON} Anc_7.4...    33   1.5  
Smik_8.275 Chr8 complement(450898..455568) [4671 bp, 1556 aa] {O...    33   1.6  
TPHA0N01800 Chr14 complement(386979..387968) [990 bp, 329 aa] {O...    33   1.6  
TDEL0E05480 Chr5 complement(1002913..1005540,1005640..1005657) [...    33   1.6  
KLLA0E11331g Chr5 complement(994770..996308) [1539 bp, 512 aa] {...    33   1.6  
KNAG0E02470 Chr5 (490378..491907) [1530 bp, 509 aa] {ON} Anc_2.4...    33   1.6  
Smik_13.276 Chr13 complement(435512..437359) [1848 bp, 615 aa] {...    33   1.7  
ZYRO0A01804g Chr1 complement(150103..151233) [1131 bp, 376 aa] {...    33   1.7  
Kwal_47.17572 s47 complement(461322..462626) [1305 bp, 434 aa] {...    33   1.7  
KLTH0G18348g Chr7 (1581039..1582844) [1806 bp, 601 aa] {ON} simi...    33   1.7  
NCAS0A03470 Chr1 (684361..686811) [2451 bp, 816 aa] {ON} Anc_4.106     33   1.7  
NCAS0A07850 Chr1 complement(1561758..1563596) [1839 bp, 612 aa] ...    33   1.7  
Kpol_1031.49 s1031 (132811..133005,133055..133063,133288..133320...    33   1.7  
KNAG0C02890 Chr3 (571926..574418) [2493 bp, 830 aa] {ON} Anc_4.1...    33   1.8  
CAGL0B00748g Chr2 (65727..68165) [2439 bp, 812 aa] {ON} similar ...    33   1.8  
Smik_2.315 Chr2 (568572..569519) [948 bp, 315 aa] {ON} YBR175W (...    32   1.8  
Suva_15.389 Chr15 complement(680068..684735) [4668 bp, 1555 aa] ...    33   1.8  
KLTH0C00748g Chr3 (72171..73157) [987 bp, 328 aa] {ON} highly si...    32   1.8  
KLLA0B02827g Chr2 (254447..257275) [2829 bp, 942 aa] {ON} highly...    33   1.8  
YBR175W Chr2 (582408..583355) [948 bp, 315 aa] {ON}  SWD3Essenti...    32   1.8  
ZYRO0C03190g Chr3 (245542..249363) [3822 bp, 1273 aa] {ON} simil...    33   1.9  
ZYRO0G03168g Chr7 (241103..242923) [1821 bp, 606 aa] {ON} simila...    33   1.9  
KLLA0A09471g Chr1 complement(827264..831784) [4521 bp, 1506 aa] ...    33   1.9  
NDAI0A01560 Chr1 (352038..353129) [1092 bp, 363 aa] {ON} Anc_5.6...    32   1.9  
TPHA0I01690 Chr9 (377629..378651) [1023 bp, 340 aa] {ON} Anc_8.5...    32   2.0  
Ecym_5501 Chr5 (1021675..1022658) [984 bp, 327 aa] {ON} similar ...    32   2.0  
TBLA0D01190 Chr4 complement(301525..302820) [1296 bp, 431 aa] {O...    32   2.0  
KLTH0F16764g Chr6 complement(1358483..1359478) [996 bp, 331 aa] ...    32   2.0  
Kwal_56.24163 s56 complement(879667..881856) [2190 bp, 729 aa] {...    32   2.1  
Kwal_56.24577 s56 complement(1061240..1062766) [1527 bp, 508 aa]...    32   2.1  
Kwal_23.4118 s23 (579251..582070) [2820 bp, 939 aa] {ON} YLR409C...    32   2.2  
KLLA0E21781g Chr5 complement(1944865..1945866) [1002 bp, 333 aa]...    32   2.2  
SAKL0C03344g Chr3 (315639..317087) [1449 bp, 482 aa] {ON} weakly...    32   2.2  
TDEL0F01740 Chr6 complement(322088..325102) [3015 bp, 1004 aa] {...    32   2.2  
Kpol_526.37 s526 complement(88726..89769) [1044 bp, 347 aa] {ON}...    32   2.2  
TDEL0F02410 Chr6 complement(447058..449568) [2511 bp, 836 aa] {O...    32   2.2  
KNAG0F02420 Chr6 complement(453743..455668) [1926 bp, 641 aa] {O...    32   2.2  
SAKL0F10648g Chr6 (827399..831010) [3612 bp, 1203 aa] {ON} highl...    32   2.3  
KNAG0F01840 Chr6 (348492..351227) [2736 bp, 911 aa] {ON} Anc_6.2...    32   2.3  
Smik_15.414 Chr15 (720454..721767) [1314 bp, 437 aa] {ON} YOR230...    32   2.4  
TDEL0C02130 Chr3 (366855..368435) [1581 bp, 526 aa] {ON} Anc_7.3...    32   2.4  
CAGL0L09647g Chr12 (1034737..1036026) [1290 bp, 429 aa] {ON} hig...    32   2.4  
KNAG0H02040 Chr8 (366384..367583) [1200 bp, 399 aa] {ON} Anc_2.2...    32   2.4  
TBLA0F02230 Chr6 (551746..555396) [3651 bp, 1216 aa] {ON} Anc_7....    32   2.4  
KLLA0F04884g Chr6 complement(478044..481682) [3639 bp, 1212 aa] ...    32   2.5  
Suva_8.281 Chr8 (509873..511183) [1311 bp, 436 aa] {ON} YOR230W ...    32   2.6  
ZYRO0F11484g Chr6 complement(943018..943902) [885 bp, 294 aa] {O...    32   2.6  
NCAS0A14470 Chr1 complement(2848835..2849923) [1089 bp, 362 aa] ...    32   2.7  
Suva_10.139 Chr10 complement(252982..254748) [1767 bp, 588 aa] {...    32   2.7  
TBLA0B04000 Chr2 complement(913726..915084) [1359 bp, 452 aa] {O...    32   2.7  
TPHA0J02540 Chr10 complement(561110..563710) [2601 bp, 866 aa] {...    32   2.7  
Kpol_1012.5 s1012 (8531..8920,8923..9909) [1377 bp, 458 aa] {ON}...    32   2.8  
Ecym_3243 Chr3 (460611..463448) [2838 bp, 945 aa] {ON} similar t...    32   2.9  
KLLA0A04928g Chr1 (439349..441934) [2586 bp, 861 aa] {ON} simila...    32   2.9  
Smik_12.117 Chr12 complement(232159..233895) [1737 bp, 578 aa] {...    32   2.9  
ACR166W Chr3 (647933..649102) [1170 bp, 389 aa] {ON} Syntenic ho...    32   3.0  
SAKL0G19668g Chr7 (1695030..1696214) [1185 bp, 394 aa] {ON} simi...    32   3.0  
SAKL0A06534g Chr1 complement(584399..586162) [1764 bp, 587 aa] {...    32   3.1  
TPHA0A03700 Chr1 complement(808996..813273) [4278 bp, 1425 aa] {...    32   3.1  
YMR092C Chr13 complement(451632..453479) [1848 bp, 615 aa] {ON} ...    32   3.2  
NDAI0J02410 Chr10 complement(586395..589244) [2850 bp, 949 aa] {...    32   3.2  
Kpol_1002.101 s1002 complement(252330..254240) [1911 bp, 636 aa]...    32   3.3  
KNAG0G02790 Chr7 (617832..619247) [1416 bp, 471 aa] {ON} Anc_8.7...    32   3.3  
YOR230W Chr15 (770800..772113) [1314 bp, 437 aa] {ON}  WTM1Trans...    32   3.3  
NDAI0F02240 Chr6 (542551..545610) [3060 bp, 1019 aa] {ON} Anc_6....    32   3.4  
TPHA0G03110 Chr7 (661602..663428) [1827 bp, 608 aa] {ON} Anc_2.4...    32   3.5  
KNAG0B06260 Chr2 complement(1228060..1230876) [2817 bp, 938 aa] ...    32   3.5  
NDAI0E02310 Chr5 (477468..478811) [1344 bp, 447 aa] {ON}               32   3.6  
TBLA0C04110 Chr3 complement(994729..997278) [2550 bp, 849 aa] {O...    32   3.6  
Suva_4.348 Chr4 (616802..618448) [1647 bp, 548 aa] {ON} YBR103W ...    32   3.7  
NDAI0A00340 Chr1 (50320..53166) [2847 bp, 948 aa] {ON} Anc_1.34 ...    32   3.7  
TBLA0B08220 Chr2 complement(1962086..1963405) [1320 bp, 439 aa] ...    32   3.9  
Kwal_34.15917 s34 complement(113361..114713) [1353 bp, 450 aa] {...    32   4.0  
Skud_7.135 Chr7 (254246..254263,254479..257154) [2694 bp, 897 aa...    32   4.0  
NDAI0I01520 Chr9 complement(358776..360710) [1935 bp, 644 aa] {O...    32   4.0  
SAKL0H07150g Chr8 complement(626019..627341,627428..627430) [132...    32   4.0  
TPHA0F02890 Chr6 complement(640553..641440) [888 bp, 295 aa] {ON...    31   4.1  
NCAS0A14030 Chr1 complement(2760841..2762415) [1575 bp, 524 aa] ...    32   4.1  
TBLA0F02330 Chr6 complement(576335..577975) [1641 bp, 546 aa] {O...    32   4.1  
TDEL0A02450 Chr1 complement(437732..439264) [1533 bp, 510 aa] {O...    32   4.2  
SAKL0G15994g Chr7 complement(1374780..1377614) [2835 bp, 944 aa]...    32   4.2  
KLLA0E18877g Chr5 complement(1676876..1680310) [3435 bp, 1144 aa...    32   4.2  
KLLA0F13750g Chr6 complement(1274110..1275972) [1863 bp, 620 aa]...    32   4.5  
Ecym_2239 Chr2 complement(467139..470081) [2943 bp, 980 aa] {ON}...    32   4.5  
Skud_12.121 Chr12 complement(236234..238000) [1767 bp, 588 aa] {...    32   4.6  
KLTH0B00924g Chr2 complement(79302..81446) [2145 bp, 714 aa] {ON...    32   4.6  
YLR055C Chr12 complement(251272..253080) [1809 bp, 602 aa] {ON} ...    31   4.8  
Kpol_530.43 s530 (97335..98945) [1611 bp, 536 aa] {ON} (97335..9...    31   4.8  
TPHA0B04250 Chr2 complement(995664..997187) [1524 bp, 507 aa] {O...    31   4.9  
NCAS0I02490 Chr9 complement(465916..467796) [1881 bp, 626 aa] {O...    31   4.9  
Smik_7.135 Chr7 (244035..244445,244446..246698) [2664 bp, 887 aa...    31   4.9  
ACR091W Chr3 (520609..521595) [987 bp, 328 aa] {ON} Syntenic hom...    31   5.0  
YAR003W Chr1 (155005..156285) [1281 bp, 426 aa] {ON}  SWD1Subuni...    31   5.1  
Suva_2.435 Chr2 complement(769135..770127) [993 bp, 330 aa] {ON}...    31   5.1  
Ecym_3389 Chr3 (736712..737695) [984 bp, 327 aa] {ON} similar to...    31   5.2  
Suva_7.127 Chr7 (246249..246659,246660..248924) [2676 bp, 891 aa...    31   5.2  
AFL118W Chr6 (216252..216269,216423..218903) [2499 bp, 832 aa] {...    31   5.3  
Suva_14.89 Chr14 (164766..166034) [1269 bp, 422 aa] {ON} YNL253W...    31   5.4  
Kpol_1002.74 s1002 complement(195739..198756) [3018 bp, 1005 aa]...    31   5.5  
Kwal_56.23207 s56 (446947..449748) [2802 bp, 933 aa] {ON} YOL087...    31   5.6  
YGL137W Chr7 (249869..249886,250087..252738) [2670 bp, 889 aa] {...    31   5.6  
ZYRO0G19250g Chr7 (1595380..1596999) [1620 bp, 539 aa] {ON} high...    31   5.8  
Skud_4.99 Chr4 (170540..172108) [1569 bp, 522 aa] {ON} YDL156W (...    31   5.8  
Ecym_3481 Chr3 complement(897444..898958) [1515 bp, 504 aa] {ON}...    31   6.0  
KLLA0C06633g Chr3 (580349..582244) [1896 bp, 631 aa] {ON} simila...    31   6.4  
NDAI0C01330 Chr3 (272773..274755) [1983 bp, 660 aa] {ON} Anc_5.4...    31   6.5  
Kwal_27.12634 s27 complement(1312252..1314114) [1863 bp, 620 aa]...    31   6.6  
CAGL0J08778g Chr10 (868299..869195) [897 bp, 298 aa] {ON} highly...    30   6.6  
TPHA0F00550 Chr6 complement(127250..129736) [2487 bp, 828 aa] {O...    31   6.6  
KNAG0J02560 Chr10 (482741..484294) [1554 bp, 517 aa] {ON} Anc_3....    31   6.7  
Ecym_3619 Chr3 (1183531..1185666) [2136 bp, 711 aa] {ON} similar...    31   6.8  
KLTH0E07700g Chr5 (705358..707778) [2421 bp, 806 aa] {ON} simila...    31   6.8  
Skud_14.85 Chr14 (158809..160077) [1269 bp, 422 aa] {ON} YNL253W...    31   6.9  
KAFR0A06990 Chr1 complement(1405904..1408543,1408655..1408672) [...    31   6.9  
Skud_13.39 Chr13 (67722..69146) [1425 bp, 474 aa] {ON} YML102W (...    31   6.9  
CAGL0L09757g Chr12 complement(1048895..1049875) [981 bp, 326 aa]...    30   6.9  
KAFR0A04080 Chr1 (820402..821889) [1488 bp, 495 aa] {ON} Anc_8.7...    31   7.0  
KNAG0G01320 Chr7 (295446..296891) [1446 bp, 481 aa] {ON} Anc_8.1...    31   7.1  
TPHA0J01890 Chr10 (430218..432287) [2070 bp, 689 aa] {ON} Anc_6....    31   7.1  
ZYRO0G03586g Chr7 (285054..287969) [2916 bp, 971 aa] {ON} simila...    31   7.1  
KLLA0C16533g Chr3 complement(1448866..1450404) [1539 bp, 512 aa]...    31   7.2  
CAGL0C01441g Chr3 complement(156930..159947) [3018 bp, 1005 aa] ...    31   7.3  
NDAI0C06420 Chr3 complement(1486617..1488686) [2070 bp, 689 aa] ...    31   7.5  
ZYRO0F12364g Chr6 (1007637..1009175) [1539 bp, 512 aa] {ON} cons...    31   7.5  
TPHA0D00460 Chr4 (77764..79647) [1884 bp, 627 aa] {ON} Anc_8.43 ...    31   7.6  
TBLA0A09610 Chr1 (2369818..2370978) [1161 bp, 386 aa] {ON} Anc_5...    30   7.6  
KLLA0D07282g Chr4 (621115..622467) [1353 bp, 450 aa] {ON} simila...    30   7.6  
ZYRO0G11660g Chr7 (924314..926665) [2352 bp, 783 aa] {ON} simila...    31   7.6  
TPHA0N01850 Chr14 (393690..394910) [1221 bp, 406 aa] {ON} Anc_2....    30   7.6  
Ecym_5498 Chr5 (1016519..1019092) [2574 bp, 857 aa] {ON} similar...    31   7.6  
TDEL0C02650 Chr3 complement(460884..461978) [1095 bp, 364 aa] {O...    30   7.7  
SAKL0F11154g Chr6 (870446..871981) [1536 bp, 511 aa] {ON} simila...    30   7.9  
SAKL0E03058g Chr5 complement(251271..253112) [1842 bp, 613 aa] {...    31   7.9  
TPHA0A01250 Chr1 (240466..241863) [1398 bp, 465 aa] {ON} Anc_8.5...    30   8.1  
NCAS0G00690 Chr7 (116505..119162) [2658 bp, 885 aa] {ON} Anc_5.6...    31   8.2  
ACR088W Chr3 (515561..518113) [2553 bp, 850 aa] {ON} Syntenic ho...    31   8.3  
TPHA0E03760 Chr5 complement(791726..794116) [2391 bp, 796 aa] {O...    31   8.3  
Skud_13.307 Chr13 complement(530776..531819) [1044 bp, 347 aa] {...    30   8.4  
Kpol_1002.36 s1002 (110010..112229) [2220 bp, 739 aa] {ON} (1100...    30   8.8  
Ecym_7149 Chr7 (308042..309139) [1098 bp, 365 aa] {ON} similar t...    30   8.9  
KNAG0H01290 Chr8 (227947..229341) [1395 bp, 464 aa] {ON} Anc_3.2...    30   8.9  
Ecym_8336 Chr8 (677880..679250) [1371 bp, 456 aa] {ON} similar t...    30   9.0  
NDAI0I00880 Chr9 complement(203097..205763) [2667 bp, 888 aa] {O...    30   9.0  
KAFR0A05800 Chr1 (1177423..1180245) [2823 bp, 940 aa] {ON} Anc_4...    30   9.3  
Smik_13.344 Chr13 complement(540043..541086) [1044 bp, 347 aa] {...    30   9.6  

>TPHA0M00190 Chr13 complement(38571..39746) [1176 bp, 391 aa] {ON}
           Anc_6.9 YEL056W
          Length = 391

 Score =  775 bits (2000), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 375/391 (95%), Positives = 375/391 (95%)

Query: 1   MEKVEQQEEPLTVDQEYDLWKSNVPLLYDFVSETRLTWPSLTLQWLPGDKTSTRQHLILG 60
           MEKVEQQEEPLTVDQEYDLWKSNVPLLYDFVSETRLTWPSLTLQWLPGDKTSTRQHLILG
Sbjct: 1   MEKVEQQEEPLTVDQEYDLWKSNVPLLYDFVSETRLTWPSLTLQWLPGDKTSTRQHLILG 60

Query: 61  TLTSGAETDYLKIAALDLPDEIIIGXXXXXXXXXXXXXXXXFAHDGEINRARYMPQNTNI 120
           TLTSGAETDYLKIAALDLPDEIIIG                FAHDGEINRARYMPQNTNI
Sbjct: 61  TLTSGAETDYLKIAALDLPDEIIIGKKSDKVVKSNLKVVKKFAHDGEINRARYMPQNTNI 120

Query: 121 IATVNGEGTIFIYDCSRDKQSALLSTLKYHKDNAYGLAFNPNAEGELISGSDDSTIALWD 180
           IATVNGEGTIFIYDCSRDKQSALLSTLKYHKDNAYGLAFNPNAEGELISGSDDSTIALWD
Sbjct: 121 IATVNGEGTIFIYDCSRDKQSALLSTLKYHKDNAYGLAFNPNAEGELISGSDDSTIALWD 180

Query: 181 ATNDKLKQPIQEWTTSHSDIVNDCQWHCFNTNMFGSVSEDSTLQLFDKRNGGKSDVKISS 240
           ATNDKLKQPIQEWTTSHSDIVNDCQWHCFNTNMFGSVSEDSTLQLFDKRNGGKSDVKISS
Sbjct: 181 ATNDKLKQPIQEWTTSHSDIVNDCQWHCFNTNMFGSVSEDSTLQLFDKRNGGKSDVKISS 240

Query: 241 KGQYNSIAFSGFSENLFAAAGTTNNIYLYDIRNTGKILHSMTGHEEPVTSLEFSNDKDGI 300
           KGQYNSIAFSGFSENLFAAAGTTNNIYLYDIRNTGKILHSMTGHEEPVTSLEFSNDKDGI
Sbjct: 241 KGQYNSIAFSGFSENLFAAAGTTNNIYLYDIRNTGKILHSMTGHEEPVTSLEFSNDKDGI 300

Query: 301 LISGSSDRRVIMWDLFEIGAEQQPDEADDGLPEVMMIHAGSRSAINDISTHPSIPWLNAS 360
           LISGSSDRRVIMWDLFEIGAEQQPDEADDGLPEVMMIHAGSRSAINDISTHPSIPWLNAS
Sbjct: 301 LISGSSDRRVIMWDLFEIGAEQQPDEADDGLPEVMMIHAGSRSAINDISTHPSIPWLNAS 360

Query: 361 VEENNIVQVWKCSSKLPRISGTPEVSISDLE 391
           VEENNIVQVWKCSSKLPRISGTPEVSISDLE
Sbjct: 361 VEENNIVQVWKCSSKLPRISGTPEVSISDLE 391

>Kpol_1045.78 s1045 (183044..184222) [1179 bp, 392 aa] {ON}
           (183046..184224) [1179 nt, 393 aa]
          Length = 392

 Score =  518 bits (1333), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 248/393 (63%), Positives = 294/393 (74%), Gaps = 3/393 (0%)

Query: 1   MEKVEQQEEPLTVDQEYDLWKSNVPLLYDFVSETRLTWPSLTLQWLPGDKTSTRQHLILG 60
           ME   +QEEPLTVDQEY+LWK+NVPL+YDFVSETRLTWPSLT QWLPG +  TRQ++ILG
Sbjct: 1   MEAQREQEEPLTVDQEYELWKTNVPLMYDFVSETRLTWPSLTAQWLPGSEEDTRQYMILG 60

Query: 61  TLTSGAETDYLKIAALDLPDEIIIGXXX--XXXXXXXXXXXXXFAHDGEINRARYMPQNT 118
           T TSG E DYLK+AALDLPDE++ G                  F HDGEINRARYMP+++
Sbjct: 61  THTSGEEVDYLKVAALDLPDEVVTGEANDDNRRTKSNIKIVKKFEHDGEINRARYMPKDS 120

Query: 119 NIIATVNGEGTIFIYDCSRDKQSALLSTLKYHKDNAYGLAFNPNAEGELISGSDDSTIAL 178
           NIIAT+NGEG + IYD S+ +   L +TLKYHK+N YGL+FNPN   ELISGSDD TIAL
Sbjct: 121 NIIATINGEGNVSIYDRSKSRSDGLRTTLKYHKENGYGLSFNPNVSNELISGSDDFTIAL 180

Query: 179 WDATNDKLKQPIQEWTTSHSDIVNDCQWHCFNTNMFGSVSEDSTLQLFDKRNGGKSDVKI 238
           WD  +   K P   W   HSDIVNDC WH F+ N+FGSVSEDSTL+L DKR+  K    I
Sbjct: 181 WDIDSGS-KSPKSVWDNIHSDIVNDCSWHHFDENLFGSVSEDSTLKLHDKRSTSKVINTI 239

Query: 239 SSKGQYNSIAFSGFSENLFAAAGTTNNIYLYDIRNTGKILHSMTGHEEPVTSLEFSNDKD 298
            +K  +N++AFS  S NLFAAAG   NIYLYD R T K LH M GHE+ +T L+F   +D
Sbjct: 240 QAKAAFNTLAFSKHSANLFAAAGLDTNIYLYDRRQTTKPLHVMAGHEDAITCLQFHPKED 299

Query: 299 GILISGSSDRRVIMWDLFEIGAEQQPDEADDGLPEVMMIHAGSRSAINDISTHPSIPWLN 358
           GIL+SG +DRRVI+WDL EIGAEQQPDEADDG PE++MIHAG RSAIND + HP+IPWL+
Sbjct: 300 GILVSGGADRRVILWDLAEIGAEQQPDEADDGSPEILMIHAGHRSAINDFTLHPTIPWLS 359

Query: 359 ASVEENNIVQVWKCSSKLPRISGTPEVSISDLE 391
           ASVEE+N+VQVWKCS  L R+ GTPE+    L+
Sbjct: 360 ASVEEDNVVQVWKCSKNLSRVGGTPEIDTKMLQ 392

>TDEL0G04620 Chr7 (842202..843380) [1179 bp, 392 aa] {ON} Anc_6.9
           YEL056W
          Length = 392

 Score =  482 bits (1240), Expect = e-170,   Method: Compositional matrix adjust.
 Identities = 235/390 (60%), Positives = 287/390 (73%), Gaps = 4/390 (1%)

Query: 5   EQQEEPLTVDQEYDLWKSNVPLLYDFVSETRLTWPSLTLQWLPGDKTSTRQHLILGTLTS 64
           EQ ++PL++D+EY+LW+SNVPL+YDFVSET LTWP+LTL+WLPG+  S RQ LILGT TS
Sbjct: 4   EQVDKPLSIDEEYELWRSNVPLMYDFVSETNLTWPTLTLEWLPGNSHSNRQELILGTHTS 63

Query: 65  GAETDYLKIAALDLPDEIIIGXXXXXX---XXXXXXXXXXFAHDGEINRARYMPQNTNII 121
             E +YLKIAA+DLPDEI+ G                   F H+ E+ RARYMPQ++N+I
Sbjct: 64  EEEPNYLKIAAIDLPDEIVPGKEDRERDGFTKSNIKIIKKFKHEQEVTRARYMPQDSNLI 123

Query: 122 ATVNGEGTIFIYDCSRDKQSALLSTLKYHKDNAYGLAFNPNAEGELISGSDDSTIALWDA 181
           AT+NG GT+F+YD S+D    LLS+L +H+DN YGL+FNP  +G+L+SGSDDS IALWD 
Sbjct: 124 ATINGSGTVFLYDRSKDGDEGLLSSLGFHEDNGYGLSFNPVDKGKLLSGSDDSKIALWDI 183

Query: 182 TNDKLKQPIQEWTTSHSDIVNDCQWHCFNTNMFGSVSEDSTLQLFDKRNGGKSDVKISSK 241
           T +  K P+  W + H D VNDC+WH  N N FGSVSED TLQL D+R       KI + 
Sbjct: 184 TTNSTK-PVSTWESCHQDGVNDCKWHELNGNTFGSVSEDCTLQLHDQRVKDSVTDKIKTV 242

Query: 242 GQYNSIAFSGFSENLFAAAGTTNNIYLYDIRNTGKILHSMTGHEEPVTSLEFSNDKDGIL 301
             +N+IAFS  S NLFAAAGT + IYLYD R TG +LH+M+GHE  VT+LEF   KDGI+
Sbjct: 243 TAFNTIAFSKHSTNLFAAAGTDSLIYLYDSRRTGNVLHTMSGHESNVTNLEFYAAKDGIV 302

Query: 302 ISGSSDRRVIMWDLFEIGAEQQPDEADDGLPEVMMIHAGSRSAINDISTHPSIPWLNASV 361
           +S   DRRVIMWDL EIGAEQ PD+ADDG PEV+MIHAG RS +ND S +P+IPWL AS 
Sbjct: 303 MSSGEDRRVIMWDLMEIGAEQVPDDADDGSPEVVMIHAGHRSPVNDFSMNPNIPWLMASA 362

Query: 362 EENNIVQVWKCSSKLPRISGTPEVSISDLE 391
           EE NIVQVWKCSSKLPR+ G P+V  S LE
Sbjct: 363 EEENIVQVWKCSSKLPRVGGLPKVDDSVLE 392

>ZYRO0F00462g Chr6 complement(46021..47202) [1182 bp, 393 aa] {ON}
           similar to uniprot|P39984 Saccharomyces cerevisiae
           YEL056W
          Length = 393

 Score =  479 bits (1233), Expect = e-169,   Method: Compositional matrix adjust.
 Identities = 232/387 (59%), Positives = 287/387 (74%), Gaps = 4/387 (1%)

Query: 8   EEPLTVDQEYDLWKSNVPLLYDFVSETRLTWPSLTLQWLPGDKTSTRQHLILGTLTSGAE 67
           E+PL++D+EYDLWKSNVPL+YDFVSET LTWPSLTL+WLPG ++S RQ +ILGT TS  E
Sbjct: 8   EKPLSIDEEYDLWKSNVPLMYDFVSETNLTWPSLTLEWLPGSRSSNRQEMILGTHTSDEE 67

Query: 68  TDYLKIAALDLPDEIIIGXXXXXXXXXXXXXXX---XFAHDGEINRARYMPQNTNIIATV 124
            +YLKIAA+ LPDE++                     F H+ E+ RARYMPQ+ N+IAT+
Sbjct: 68  QNYLKIAAIYLPDEVVPDAEPKEEEEVLKSNVKIIKKFEHENEVTRARYMPQDDNLIATI 127

Query: 125 NGEGTIFIYDCSRDKQSALLSTLKYHKDNAYGLAFNPNAEGELISGSDDSTIALWDATND 184
           +G GTI++Y+ + + +S LLST ++H +N YGL+FNPN +G+L+SGSDDS I LWD T  
Sbjct: 128 SGVGTIYLYNRANEVESGLLSTFQFHNENGYGLSFNPNEKGKLLSGSDDSNIVLWDVTG- 186

Query: 185 KLKQPIQEWTTSHSDIVNDCQWHCFNTNMFGSVSEDSTLQLFDKRNGGKSDVKISSKGQY 244
           K ++PI  +T  HSDIVNDC+WH F+ N+FGSVSEDSTLQL D+R    +  K+ +K  Y
Sbjct: 187 KSQEPILTFTDRHSDIVNDCKWHNFDQNIFGSVSEDSTLQLHDQRIRDAAVEKVQAKKPY 246

Query: 245 NSIAFSGFSENLFAAAGTTNNIYLYDIRNTGKILHSMTGHEEPVTSLEFSNDKDGILISG 304
           N++AFS  S NLFAAAGT + +YLYD R   K LH M GHE+ VTSLEF   +DG+LIS 
Sbjct: 247 NTLAFSAHSTNLFAAAGTDSMVYLYDRRRASKPLHMMPGHEDAVTSLEFHPQEDGVLISA 306

Query: 305 SSDRRVIMWDLFEIGAEQQPDEADDGLPEVMMIHAGSRSAINDISTHPSIPWLNASVEEN 364
            SDRR I+WDL EIGAEQ PD+ADDG PEVMMIHAG RS+IND S +P+IPWL A+ EE 
Sbjct: 307 GSDRRTILWDLAEIGAEQVPDDADDGSPEVMMIHAGHRSSINDFSMNPNIPWLTATAEEE 366

Query: 365 NIVQVWKCSSKLPRISGTPEVSISDLE 391
           NIVQVWK SSKLPRI GTP V    LE
Sbjct: 367 NIVQVWKPSSKLPRIGGTPSVDTQLLE 393

>NDAI0K02900 Chr11 (657436..658752) [1317 bp, 438 aa] {ON} Anc_6.9
          Length = 438

 Score =  472 bits (1214), Expect = e-165,   Method: Compositional matrix adjust.
 Identities = 232/402 (57%), Positives = 293/402 (72%), Gaps = 21/402 (5%)

Query: 11  LTVDQEYDLWKSNVPLLYDFVSETRLTWPSLTLQWLPGDKTST----RQHLILGTLTSGA 66
           LT+D+EYDLWKSNVPL+YDFVSET+LTWP+LT++WLP   +ST    RQ LILGT TSG 
Sbjct: 37  LTIDEEYDLWKSNVPLMYDFVSETKLTWPTLTVEWLPSSHSSTPVSNRQELILGTHTSGE 96

Query: 67  ETDYLKIAALDLPDEII---------------IGXXXXXXXXXXXXXXXXFAHDGEINRA 111
           E +YLKIAA+DLPDE++                                 F H+ EI RA
Sbjct: 97  EDNYLKIAAIDLPDEVVQPSTNSLKAQREDDEDEDDQKQKPRSNIKIVKKFKHEEEITRA 156

Query: 112 RYMPQNTNIIATVNGEGTIFIYDCSRDKQSALLSTLKYHKDNAYGLAFNPNAEGELISGS 171
           R+MPQNT+IIAT+NG GT+FIY+ S DKQSAL+STL++HK+N YGL+FNPN +G+L+SGS
Sbjct: 157 RFMPQNTDIIATINGSGTVFIYNQSNDKQSALISTLRFHKENGYGLSFNPNDKGKLLSGS 216

Query: 172 DDSTIALWDATNDK--LKQPIQEWTTSHSDIVNDCQWHCFNTNMFGSVSEDSTLQLFDKR 229
           DD TIALWD   +    K+P++ W + H+DIVNDC+W+ FN+N+F SVSEDSTLQL D+R
Sbjct: 217 DDGTIALWDIQENSTLAKKPLKIWDSVHNDIVNDCKWNEFNSNVFASVSEDSTLQLHDQR 276

Query: 230 NGGKSDVKISSKGQYNSIAFSGFSENLFAAAGTTNNIYLYDIRNTGKILHSMTGHEEPVT 289
                   I +   +N++AFS  S+ L AAAGT + +YLYD RN    L+SM GHE+ +T
Sbjct: 277 EQNTIINSIKTTDPFNTLAFSKHSQYLMAAAGTDSLVYLYDSRNLSVPLYSMNGHEDSIT 336

Query: 290 SLEFSNDKDGILISGSSDRRVIMWDLFEIGAEQQPDEADDGLPEVMMIHAGSRSAINDIS 349
           +LEFS   DG+LIS  +DRRVIMWD+ +IGAEQ PD+A+DG PEV+MIHAG RSA+ND S
Sbjct: 337 NLEFSPHTDGVLISSGNDRRVIMWDINDIGAEQIPDDAEDGAPEVIMIHAGHRSAVNDFS 396

Query: 350 THPSIPWLNASVEENNIVQVWKCSSKLPRISGTPEVSISDLE 391
            +P+IPWL AS EE NI+QVWKCS KLP + GTPEVS+S LE
Sbjct: 397 INPNIPWLMASAEEENIIQVWKCSHKLPIVGGTPEVSVSILE 438

>NCAS0F00190 Chr6 complement(29012..30247) [1236 bp, 411 aa] {ON}
           Anc_6.9 YEL056W
          Length = 411

 Score =  463 bits (1192), Expect = e-162,   Method: Compositional matrix adjust.
 Identities = 226/408 (55%), Positives = 295/408 (72%), Gaps = 18/408 (4%)

Query: 1   MEKVE----QQEEP---LTVDQEYDLWKSNVPLLYDFVSETRLTWPSLTLQWLPGDKTS- 52
           MEK+     ++E+P   L++D+EY+LW+SNVPL+YDFVSETRLTWPSL+L+WLP +K++ 
Sbjct: 5   MEKMAAVQGEEEDPNKELSIDEEYELWRSNVPLMYDFVSETRLTWPSLSLEWLPQEKSAQ 64

Query: 53  --TRQHLILGTLTSGAETDYLKIAALDLPDEIIIGXXXXXXXXXXXXXXXX-------FA 103
              RQ LI+GT TSG E +YLKIAA+DLP++II                         F 
Sbjct: 65  APNRQELIIGTHTSGEEDNYLKIAAIDLPNDIIPSTEKLEDQQKGETTTKSNIKIIKKFK 124

Query: 104 HDGEINRARYMPQNTNIIATVNGEGTIFIYDCSRDKQSALLSTLKYHKDNAYGLAFNPNA 163
           H+ EI RARYMPQN+N++AT+NG G +F+YD S+DK S L+ST +YHK+N YGL+FN N 
Sbjct: 125 HEEEITRARYMPQNSNLVATINGSGKVFLYDRSKDKHSGLVSTFEYHKENGYGLSFNCND 184

Query: 164 EGELISGSDDSTIALWDATNDKLKQPIQEWTTSHSDIVNDCQWHCFNTNMFGSVSEDSTL 223
            G+L+SGSDD TIALW+  N     PI  W++ HSDIVNDC+W  F+ N+FGSVSEDSTL
Sbjct: 185 AGKLLSGSDDGTIALWNVNNSN-SSPIYVWSSVHSDIVNDCKWSNFDLNVFGSVSEDSTL 243

Query: 224 QLFDKRNGGKSDVKISSKGQYNSIAFSGFSENLFAAAGTTNNIYLYDIRNTGKILHSMTG 283
           QL D+R       +      +N++AFS  S+ LFAAAGT +++YL+D R+  + LHSM G
Sbjct: 244 QLHDQREKDTFTSQFKVDAPFNTLAFSKHSQYLFAAAGTDSHVYLFDRRDISRPLHSMAG 303

Query: 284 HEEPVTSLEFSNDKDGILISGSSDRRVIMWDLFEIGAEQQPDEADDGLPEVMMIHAGSRS 343
           H+  VT++EFS D+DGIL++   DRR I+WD+ +IG EQ PD+A+DG PEV+MIHAG RS
Sbjct: 304 HDGAVTNMEFSPDQDGILMTSGEDRRAIIWDICDIGVEQIPDDAEDGAPEVLMIHAGHRS 363

Query: 344 AINDISTHPSIPWLNASVEENNIVQVWKCSSKLPRISGTPEVSISDLE 391
           AIND S +P+IPWL AS EE NI+QVWKCS KLPR+ GTP VS+S LE
Sbjct: 364 AINDFSMNPNIPWLMASSEEENIIQVWKCSHKLPRVGGTPTVSVSQLE 411

>CAGL0B03575g Chr2 complement(357525..358784) [1260 bp, 419 aa] {ON}
           similar to uniprot|P39984 Saccharomyces cerevisiae
           YEL056w HAT2
          Length = 419

 Score =  453 bits (1166), Expect = e-158,   Method: Compositional matrix adjust.
 Identities = 229/395 (57%), Positives = 287/395 (72%), Gaps = 13/395 (3%)

Query: 9   EPLTVDQEYDLWKSNVPLLYDFVSETRLTWPSLTLQWLPGDK---TSTRQHLILGTLTSG 65
           EP+TVD+EY+LWKSNVP+LYDFVSETRLTWP+LT++WLP        TRQ LILGT TSG
Sbjct: 26  EPMTVDEEYELWKSNVPMLYDFVSETRLTWPTLTVEWLPQKNLVAARTRQQLILGTHTSG 85

Query: 66  AETDYLKIAALDLPDEII--------IGXXXXXXXXXXXXXXXXFAHDGEINRARYMPQN 117
            E +YLKI A+DLP E+         I                 F HDGEI RARYMPQ+
Sbjct: 86  EEQNYLKIGAVDLPVEVTENSKKDREIDEEDEDMVLSNVKIVKKFPHDGEITRARYMPQD 145

Query: 118 TNIIATVNGEGTIFIYDCSRDKQSALLSTLKYHKDNAYGLAFNPNAEGELISGSDDSTIA 177
            NIIAT+NGEG IFIYD S++   ALLSTL+YH +N YGLAFN N +  L+SGSDDS IA
Sbjct: 146 DNIIATINGEGKIFIYDRSKNGVEALLSTLEYHTENGYGLAFNANEKYSLLSGSDDSNIA 205

Query: 178 LWDATN-DKLKQPIQEWTTSHSDIVNDCQWHCFNTNMFGSVSEDSTLQLFDKRNGGKSDV 236
           LWD +N +K  +P   +  +H+DI+ND +WH    ++FGSVSEDST++LFDKR+  +   
Sbjct: 206 LWDISNFEKNIKPTITFEDAHTDIINDVKWHSSEAHIFGSVSEDSTMKLFDKRSS-QIIH 264

Query: 237 KISSKGQYNSIAFSGFSENLFAAAGTTNNIYLYDIRNTGKILHSMTGHEEPVTSLEFSND 296
            I++K  YN++AFS FS NLFAAAGT N +YLYDIR+    L++MTGHE+ VT++EF  +
Sbjct: 265 NINTKKPYNTLAFSPFSSNLFAAAGTDNLVYLYDIRDVSNPLYAMTGHEDAVTAIEFDPN 324

Query: 297 KDGILISGSSDRRVIMWDLFEIGAEQQPDEADDGLPEVMMIHAGSRSAINDISTHPSIPW 356
            DGIL S  SDRR I+WDL EIGAEQ  DE +DG PEV+MIHAG +++INDI+ +P+I W
Sbjct: 325 NDGILYSSGSDRRTIVWDLQEIGAEQTQDEIEDGPPEVLMIHAGHKTSINDIAVNPNINW 384

Query: 357 LNASVEENNIVQVWKCSSKLPRISGTPEVSISDLE 391
           L AS EE+NIVQ+WKCSS +PRI G PEV +S L+
Sbjct: 385 LVASAEEDNIVQIWKCSSNIPRIGGEPEVDLSILD 419

>KNAG0E00980 Chr5 complement(186207..187451) [1245 bp, 414 aa] {ON}
           Anc_6.9 YEL056W
          Length = 414

 Score =  432 bits (1110), Expect = e-150,   Method: Compositional matrix adjust.
 Identities = 212/391 (54%), Positives = 274/391 (70%), Gaps = 9/391 (2%)

Query: 7   QEEPLTVDQEYDLWKSNVPLLYDFVSETRLTWPSLTLQWLPGDKTS--TRQHLILGTLTS 64
           +  PL   +EYDLWKSNVP++YDFVSETRL WPSLT+QWLP    +  TRQ LILGT TS
Sbjct: 27  ENRPLDPSEEYDLWKSNVPMMYDFVSETRLVWPSLTVQWLPHSAPNPVTRQELILGTHTS 86

Query: 65  GAETDYLKIAALDLPDEII----IGXXXXXXXXXXXXXXXXFAHDGEINRARYMPQNTNI 120
             E +YLKIA +DLP E+     +                 F HD E+ RARYMPQ+ NI
Sbjct: 87  DEEQNYLKIAVVDLPTEVTDTSNLTESDEEQVRSNIRVTRKFKHDSEVTRARYMPQDPNI 146

Query: 121 IATVNGEGTIFIYDCSRDKQSALLSTLKYHKDNAYGLAFNPNAEGELISGSDDSTIALWD 180
           +AT++G GT++IYD S ++ +A + TL+YH DN YGLAFNP  +G L+SGSDDS +ALWD
Sbjct: 147 LATISGTGTVYIYDRSNERDTASI-TLQYHTDNGYGLAFNPLIKGHLLSGSDDSNVALWD 205

Query: 181 ATNDKLKQPIQEWTTSHSDIVNDCQWHCFNTNMFGSVSEDSTLQLFDKRNGGKSDVKISS 240
            T+D+  +P+Q+W   HSDIVNDCQWH F  ++FG+VSEDS+LQ+ D R   K    I+ 
Sbjct: 206 VTSDR-NEPVQKWENIHSDIVNDCQWHNFQKSLFGTVSEDSSLQIHDTRES-KPVATING 263

Query: 241 KGQYNSIAFSGFSENLFAAAGTTNNIYLYDIRNTGKILHSMTGHEEPVTSLEFSNDKDGI 300
              +N+++FS  SENL A  G  + +YLYD R   + LH M+GH + VTSL+FS+  DGI
Sbjct: 264 TKPFNTLSFSHHSENLLATGGVNSEVYLYDRRYVEEPLHLMSGHTDAVTSLDFSSQDDGI 323

Query: 301 LISGSSDRRVIMWDLFEIGAEQQPDEADDGLPEVMMIHAGSRSAINDISTHPSIPWLNAS 360
           ++S  +D+RVI+WD+ +IGAEQ  ++A+D   EVMMIHAG RS IND + +PSIPWL AS
Sbjct: 324 ILSAGADKRVIIWDINDIGAEQVLEDAEDATSEVMMIHAGHRSPINDFAINPSIPWLVAS 383

Query: 361 VEENNIVQVWKCSSKLPRISGTPEVSISDLE 391
            EE NIVQ+WKCS KLPRISGTP V +  L+
Sbjct: 384 AEEENIVQLWKCSHKLPRISGTPPVRVDMLQ 414

>Ecym_3012 Chr3 complement(24573..25766) [1194 bp, 397 aa] {ON}
           similar to Ashbya gossypii ACR017W
          Length = 397

 Score =  428 bits (1100), Expect = e-149,   Method: Compositional matrix adjust.
 Identities = 211/381 (55%), Positives = 270/381 (70%), Gaps = 9/381 (2%)

Query: 2   EKVEQQEEPLTVDQEYDLWKSNVPLLYDFVSETRLTWPSLTLQWLPGDKTST---RQHLI 58
           E++E  E PLTVDQEY+LWKSNV L+YDFVSET+LTWPSL++QWLP    +    +Q +I
Sbjct: 5   EEIEHDESPLTVDQEYELWKSNVSLMYDFVSETKLTWPSLSIQWLPSVDANVPLKQQEMI 64

Query: 59  LGTLTSGAETDYLKIAALDLPDEII---IGXXXXXXXXXXXXXXXXFAHDGEINRARYMP 115
           LGT TSG E +YLKIAA+DLP E++                     F H+ E+ RARYMP
Sbjct: 65  LGTHTSGDENNYLKIAAIDLPYEVVGLPDEDNSSEPVKSMIKVTKKFEHEDEVIRARYMP 124

Query: 116 QNTNIIATVNGEGTIFIYDCSRDKQSALLSTLKYHKDNAYGLAFNPNAEGELISGSDDST 175
           +N  IIAT+NG+G IFIYD S+ K   L  TL YHKDN YGLAFNP  EGEL+S SDD+T
Sbjct: 125 KNDKIIATINGKGKIFIYDRSKSKSEGLCKTLSYHKDNGYGLAFNPQIEGELLSASDDTT 184

Query: 176 IALWDATNDKLKQPIQEWTTSHSDIVNDCQWHCFNTNMFGSVSEDSTLQLFDKRNGGKSD 235
           +ALWD   +   +P+     +H+DIVND +WH F+ N+FG+VSED TLQ+ DKR+   S 
Sbjct: 185 VALWDI--NSTDRPVS-IVMNHTDIVNDSKWHEFDENIFGTVSEDKTLQVHDKRSLSNSA 241

Query: 236 VKISSKGQYNSIAFSGFSENLFAAAGTTNNIYLYDIRNTGKILHSMTGHEEPVTSLEFSN 295
             +  +   N++AFS  S+NL AAAGT   +YLYD+R   + LH+M GH++ VTS+EFS+
Sbjct: 242 QVLPVEKPLNALAFSKHSKNLIAAAGTDTRVYLYDLRRLSEPLHTMAGHQDAVTSIEFSS 301

Query: 296 DKDGILISGSSDRRVIMWDLFEIGAEQQPDEADDGLPEVMMIHAGSRSAINDISTHPSIP 355
            KDGIL S  SDRR+ +WDL +IGAEQ  ++ADDG+PE+MM+HAG RSAIND S +P +P
Sbjct: 302 HKDGILCSSGSDRRLFIWDLTQIGAEQAQEDADDGVPELMMMHAGHRSAINDFSFNPQVP 361

Query: 356 WLNASVEENNIVQVWKCSSKL 376
           WL AS EE+N+VQVWK S KL
Sbjct: 362 WLIASAEEDNVVQVWKISKKL 382

>SAKL0E00814g Chr5 complement(59724..60920) [1197 bp, 398 aa] {ON}
           similar to uniprot|P39984 Saccharomyces cerevisiae
           YEL056W
          Length = 398

 Score =  422 bits (1086), Expect = e-146,   Method: Compositional matrix adjust.
 Identities = 208/401 (51%), Positives = 280/401 (69%), Gaps = 18/401 (4%)

Query: 4   VEQQEEPLTVDQEYDLWKSNVPLLYDFVSETRLTWPSLTLQWLPGDKTSTRQHLILGTLT 63
           +E++ + L++++EY+LWK+NVPL+YDFVSET+LTWPSLT+QWLPG+ +ST+Q +ILGT T
Sbjct: 3   IEEENKLLSIEEEYELWKTNVPLMYDFVSETKLTWPSLTIQWLPGNSSSTKQEMILGTHT 62

Query: 64  SGAETDYLKIAALDLPDEII-----------IGXXXXXXXXXXXXXXXXFAHDGEINRAR 112
           SG + +YLKIA+++LP++I+                               H+ EI RAR
Sbjct: 63  SGEDDNYLKIASIELPEDILGAEFSETPESTEETEQQRNVQSRIKITKKIKHEEEITRAR 122

Query: 113 YMPQNTNIIATVNGEGTIFIYDCSRDKQSALLSTLKYHKDNAYGLAFNPNAEGELISGSD 172
           +MPQ+ N IAT+NG G +F++D S+DK  AL+S   +HKDN YGL+FNP  +GEL+S SD
Sbjct: 123 FMPQDPNFIATINGVGKVFLFDRSKDKNEALVSEHAFHKDNGYGLSFNPRTKGELLSCSD 182

Query: 173 DSTIALWD--ATNDKLKQPIQEWTTSHSDIVNDCQWHCFNTNMFGSVSEDSTLQLFDKRN 230
           D TIALW+   TN    + +    T+H DIVNDC WH FN N+FGSVSED TLQ+ DKR 
Sbjct: 183 DGTIALWNVMGTNTSPSKAV----TTHEDIVNDCTWHEFNENLFGSVSEDKTLQIHDKRT 238

Query: 231 GGKSDVKISSKGQYNSIAFSGFSENLFAAAGTTNNIYLYDIRNTGKILHSMTGHEEPVTS 290
                 +++    +N++ FS  S+NLFAAAGT + +YLYD+RNT   LH+M+GHE+ VTS
Sbjct: 239 NSTVH-RLTLSSPFNTLDFSKHSQNLFAAAGTDSLVYLYDLRNTADALHTMSGHEDSVTS 297

Query: 291 LEFSNDKDGILISGSSDRRVIMWDLFEIGAEQQPDEADDGLPEVMMIHAGSRSAINDIST 350
           LEFS  KDGIL S  SDRRV++WDL +IG+EQ  ++A DG+PE+MM+HAG +SA+ND S 
Sbjct: 298 LEFSPHKDGILCSSGSDRRVLLWDLMQIGSEQAQEDAADGVPELMMMHAGHKSAVNDFSF 357

Query: 351 HPSIPWLNASVEENNIVQVWKCSSKLPRISGTPEVSISDLE 391
           + +IPWL ASVEE+NIV VWK S KL       +  I  LE
Sbjct: 358 NWNIPWLMASVEEDNIVHVWKVSKKLTSPGLIQDYDIRSLE 398

>Suva_5.12 Chr5 (23273..24478) [1206 bp, 401 aa] {ON} YEL056W (REAL)
          Length = 401

 Score =  416 bits (1070), Expect = e-144,   Method: Compositional matrix adjust.
 Identities = 207/401 (51%), Positives = 272/401 (67%), Gaps = 21/401 (5%)

Query: 4   VEQQEEPLTVDQEYDLWKSNVPLLYDFVSETRLTWPSLTLQWLPG-----DKTSTRQHLI 58
           +E QE+PL+VD+EYDLWKSNVPL+YDFVSETRLTWPSLT+QWLP      +    +Q LI
Sbjct: 1   METQEKPLSVDEEYDLWKSNVPLMYDFVSETRLTWPSLTVQWLPTPVQEPEGGFIKQELI 60

Query: 59  LGTLTSGAETDYLKIAALDLPDEIIIGX-----------XXXXXXXXXXXXXXXFAHDGE 107
           +GT TSG E +YLK A ++LP EI+                             + H+ E
Sbjct: 61  IGTHTSGEEENYLKFAEINLPKEILNNEDPQEEAGEDDEVSAPAPRSNIKITAKYKHEEE 120

Query: 108 INRARYMPQNTNIIATVNGEGTIFIYDCSRDKQSALLSTLKYHKDNAYGLAFNPNAEGEL 167
           I RARYMPQN   +AT+NG+GT+FIY  S      L STLK+H++N Y L+F+P  EG L
Sbjct: 121 ITRARYMPQNPGTVATINGQGTVFIYSRSE----GLQSTLKFHEENGYALSFSPLVEGLL 176

Query: 168 ISGSDDSTIALWDAT-NDKLKQPIQEWTTSHSDIVNDCQWHCFNTNMFGSVSEDSTLQLF 226
           +SGSDD T+ALWD   N    +PI+ W+  HSDIVND +WH FN ++FG+VSEDS L++ 
Sbjct: 177 LSGSDDHTVALWDVNGNSDSTRPIRTWSDLHSDIVNDSKWHNFNKDLFGTVSEDSLLKIN 236

Query: 227 DKRNGGKSDVKISSKGQYNSIAFSGFSENLFAAAGTTNNIYLYDIRNTGKILHSMTGHEE 286
           D R    +         +N++AFS  S NL AAAGT +++YLYD+RN  + LH M+GHE+
Sbjct: 237 DLRVENTTTGTAKCPEPFNTLAFSHHSSNLLAAAGTDSHVYLYDLRNMKEPLHHMSGHED 296

Query: 287 PVTSLEFSNDKDGILISGSSDRRVIMWDLFEIGAEQQPDEADDGLPEVMMIHAGSRSAIN 346
            VT+LEFS   DG+++S  SD R+IMWDL +IGAEQ PD+A+DG+PE++M+HAG +SA+N
Sbjct: 297 AVTNLEFSPHVDGVVVSSGSDNRLIMWDLKQIGAEQTPDDAEDGVPELIMVHAGHKSAVN 356

Query: 347 DISTHPSIPWLNASVEENNIVQVWKCSSKLPRISGTPEVSI 387
           D   +  IPWL AS EE NI+QVWKCS  LP + G P+VS+
Sbjct: 357 DFDLNAQIPWLVASTEEENILQVWKCSHSLPVVGGPPKVSM 397

>KLLA0D00814g Chr4 complement(76687..77913) [1227 bp, 408 aa] {ON}
           similar to uniprot|P39984 Saccharomyces cerevisiae
           YEL056W
          Length = 408

 Score =  416 bits (1069), Expect = e-144,   Method: Compositional matrix adjust.
 Identities = 205/410 (50%), Positives = 280/410 (68%), Gaps = 21/410 (5%)

Query: 1   MEKVEQQEEPLTVDQEYDLWKSNVPLLYDFVSETRLTWPSLTLQWLPGD--------KTS 52
           M +VE+ E+P T+++EYDLW SNVP++YDFVSETRLTWPSLT+QWLP +        +  
Sbjct: 1   MTEVEEPEQPTTINEEYDLWVSNVPMMYDFVSETRLTWPSLTVQWLPTEMQPREVDGQQL 60

Query: 53  TRQHLILGTLTSGAETDYLKIAALDLPDEII---------IGXXXXXXXXXXXXXXXXFA 103
            RQ L++GTLT+  E +YLKIAA+DLP+ +                            F 
Sbjct: 61  LRQELLIGTLTTDNEPNYLKIAAIDLPENVTSSKPSVSDDAKENELSHRQSKIKIVRKFK 120

Query: 104 HDGEINRARYMPQNTNIIATVNGEGTIFIYDCS-RDKQSALLSTLKYHKDNAYGLAFNPN 162
           H+ E+ RARYMPQ+ NIIAT+NG G ++I+D + ++K    +++  YHK+N YGLAFNP 
Sbjct: 121 HEQEVTRARYMPQSPNIIATLNGAGIVYIFDRNIKEKDHGAIASFSYHKENGYGLAFNPT 180

Query: 163 AEGELISGSDDSTIALWDATNDKLKQPIQEWTTSHSDIVNDCQWHCFNTNMFGSVSEDST 222
             G+L+S SDD T+ALWD T+   K P Q +   H+DIVNDC+WH F +++FG+VSED+T
Sbjct: 181 VSGQLLSASDDGTVALWDVTSTANKSPSQTFDV-HTDIVNDCKWHEFQSSLFGTVSEDNT 239

Query: 223 LQLFDKRNGGKSDVKISSKGQYNSIAFSGFSENLFAAAGTTNNIYLYDIRNTGKILHSMT 282
           L + D  N  ++  K+S    +N++AFS  SENL AAAGT +N+YLYD+R   K LHSM 
Sbjct: 240 LIIHDT-NSDRAIQKLSVSSAFNTLAFSKRSENLLAAAGTDSNVYLYDLRRLQKPLHSMA 298

Query: 283 GHEEPVTSLEFSNDKDGILISGSSDRRVIMWDLFEIGAEQQPDEADDGLPEVMMIHAGSR 342
           GHE+ VTSLEFS  +DG+L S  SDRR+IMWDLF IGAEQQPD+A DG+PE+ M+H G R
Sbjct: 299 GHEDSVTSLEFSPHQDGLLTSSGSDRRIIMWDLFNIGAEQQPDDAYDGVPELFMMHGGHR 358

Query: 343 SAINDISTHPSIPWLNASVEENNIVQVWKCSSKLPRISGTP-EVSISDLE 391
           S +N+ S + ++PWL  SVEE N++Q+WK ++K+ R    P +  I+ LE
Sbjct: 359 SPVNEFSHNSNVPWLMCSVEEENVLQIWKPANKIVRPPQPPADFDITTLE 408

>YEL056W Chr5 (47168..48373) [1206 bp, 401 aa] {ON}  HAT2Subunit of
           the Hat1p-Hat2p histone acetyltransferase complex;
           required for high affinity binding of the complex to
           free histone H4, thereby enhancing Hat1p activity;
           similar to human RbAp46 and 48; has a role in telomeric
           silencing
          Length = 401

 Score =  410 bits (1055), Expect = e-142,   Method: Compositional matrix adjust.
 Identities = 201/400 (50%), Positives = 270/400 (67%), Gaps = 21/400 (5%)

Query: 4   VEQQEEPLTVDQEYDLWKSNVPLLYDFVSETRLTWPSLTLQWLPG-----DKTSTRQHLI 58
           +E QE+PL+VD+EYDLWKSNVPL+YDFVSETRLTWPSLT+QWLP      D    +Q LI
Sbjct: 1   MENQEKPLSVDEEYDLWKSNVPLMYDFVSETRLTWPSLTVQWLPTPVQELDGGFIKQELI 60

Query: 59  LGTLTSGAETDYLKIAALDLPDEIIIGXXXXXXXXXXXXXX-----------XXFAHDGE 107
           +GT TSG E +YLK A ++LP EI+                             + H+ E
Sbjct: 61  IGTHTSGEEENYLKFAEINLPKEILSNEDPQEEAGEEYQSSLPAPRSNIRITAKYEHEEE 120

Query: 108 INRARYMPQNTNIIATVNGEGTIFIYDCSRDKQSALLSTLKYHKDNAYGLAFNPNAEGEL 167
           I RARYMPQ+ NI+AT+NG+GT+F+Y  S      L STLK+HKDN Y L+F+   +G L
Sbjct: 121 ITRARYMPQDPNIVATINGQGTVFLYSRSE----GLQSTLKFHKDNGYALSFSTLVKGRL 176

Query: 168 ISGSDDSTIALWD-ATNDKLKQPIQEWTTSHSDIVNDCQWHCFNTNMFGSVSEDSTLQLF 226
           +SGSDD T+ALW+  +     +P++ W   HSDI+ND +WH FN ++FG+VSEDS L++ 
Sbjct: 177 LSGSDDHTVALWEVGSGGDPTKPVRTWNDLHSDIINDNKWHNFNKDLFGTVSEDSLLKIN 236

Query: 227 DKRNGGKSDVKISSKGQYNSIAFSGFSENLFAAAGTTNNIYLYDIRNTGKILHSMTGHEE 286
           D R    +   +     +N++AFS  S NL AAAG  + +YLYD+RN  + LH M+GHE+
Sbjct: 237 DVRANNTTIDTVKCPQPFNTLAFSHHSSNLLAAAGMDSYVYLYDLRNMKEPLHHMSGHED 296

Query: 287 PVTSLEFSNDKDGILISGSSDRRVIMWDLFEIGAEQQPDEADDGLPEVMMIHAGSRSAIN 346
            V +LEFS   DG+++S  SD R++MWDL +IGAEQ PD+A+DG+PE++M+HAG RS++N
Sbjct: 297 AVNNLEFSTHVDGVVVSSGSDNRLMMWDLKQIGAEQTPDDAEDGVPELIMVHAGHRSSVN 356

Query: 347 DISTHPSIPWLNASVEENNIVQVWKCSSKLPRISGTPEVS 386
           D   +P IPWL AS EE NI+QVWKCS  LP + G P+V+
Sbjct: 357 DFDLNPQIPWLVASAEEENILQVWKCSHSLPIVGGPPKVN 396

>Smik_5.31 Chr5 (49406..50689) [1284 bp, 427 aa] {ON} YEL056W (REAL)
          Length = 427

 Score =  409 bits (1052), Expect = e-141,   Method: Compositional matrix adjust.
 Identities = 200/400 (50%), Positives = 269/400 (67%), Gaps = 21/400 (5%)

Query: 4   VEQQEEPLTVDQEYDLWKSNVPLLYDFVSETRLTWPSLTLQWLP-----GDKTSTRQHLI 58
           +E QE+ L+VD+EYDLWKSNVPL+YDFVSETRLTWPSL++QWLP      +    RQ LI
Sbjct: 27  METQEKALSVDEEYDLWKSNVPLMYDFVSETRLTWPSLSVQWLPTPIQEAEGGFIRQELI 86

Query: 59  LGTLTSGAETDYLKIAALDLPDEIIIG-----------XXXXXXXXXXXXXXXXFAHDGE 107
           +GT TSG E +YLK A +++P EI+                             + H+ E
Sbjct: 87  IGTHTSGEEENYLKFAEINIPKEILNNQDPQEEAEEDDKATLNAPKSNIRITAKYVHEEE 146

Query: 108 INRARYMPQNTNIIATVNGEGTIFIYDCSRDKQSALLSTLKYHKDNAYGLAFNPNAEGEL 167
           I RARYMPQN + +AT+NG+GT+F+Y     +   L STLK+HKDN Y L+FN   EG+L
Sbjct: 147 ITRARYMPQNPDFVATLNGQGTVFLYS----RSGGLQSTLKFHKDNGYALSFNALVEGQL 202

Query: 168 ISGSDDSTIALWD-ATNDKLKQPIQEWTTSHSDIVNDCQWHCFNTNMFGSVSEDSTLQLF 226
           +SGSDD T+ALW+  +N     P++ W   HSDIVND +WH FN  +FG+VSEDS L++ 
Sbjct: 203 LSGSDDHTVALWEVGSNSTSISPVRTWNDLHSDIVNDIKWHNFNEKLFGTVSEDSLLKIN 262

Query: 227 DKRNGGKSDVKISSKGQYNSIAFSGFSENLFAAAGTTNNIYLYDIRNTGKILHSMTGHEE 286
           D R    +   +     +N++AFS  S NL AAAG  +++YLYD+RN  + LH M+GHE+
Sbjct: 263 DVRAHNITIDAVKCPQPFNTLAFSHHSSNLLAAAGMDSHVYLYDLRNMREPLHHMSGHED 322

Query: 287 PVTSLEFSNDKDGILISGSSDRRVIMWDLFEIGAEQQPDEADDGLPEVMMIHAGSRSAIN 346
            VT++EFS   DG+++S  SD R+IMWDL +IGAEQ PD+A+DG+PE++M+HAG RS++N
Sbjct: 323 AVTNIEFSTHVDGVVVSSGSDNRLIMWDLKQIGAEQTPDDAEDGVPELIMVHAGHRSSVN 382

Query: 347 DISTHPSIPWLNASVEENNIVQVWKCSSKLPRISGTPEVS 386
           D   +  IPWL AS EE NI+QVWKCS  LP + G P+V+
Sbjct: 383 DFDLNAQIPWLVASSEEENILQVWKCSHNLPIVGGPPKVN 422

>Skud_5.33 Chr5 (46184..47389) [1206 bp, 401 aa] {ON} YEL056W (REAL)
          Length = 401

 Score =  407 bits (1045), Expect = e-140,   Method: Compositional matrix adjust.
 Identities = 199/400 (49%), Positives = 269/400 (67%), Gaps = 21/400 (5%)

Query: 4   VEQQEEPLTVDQEYDLWKSNVPLLYDFVSETRLTWPSLTLQWLPGDKTS-----TRQHLI 58
           +E QE+PL+VD+EYDLWKSNVPL+YDFVSETRLTWPSLT+QWLP           +Q LI
Sbjct: 1   MEGQEKPLSVDEEYDLWKSNVPLMYDFVSETRLTWPSLTVQWLPTPVQQPKGGFIKQELI 60

Query: 59  LGTLTSGAETDYLKIAALDLPDEIIIGXXXXXXXXXXXXXX-----------XXFAHDGE 107
           +GT TSG E +YLK A ++LP E++                             + H+ E
Sbjct: 61  IGTHTSGEEENYLKFAEINLPKEVLNNENPQEQAEMGDEASLPPPRSNIRITAKYEHEEE 120

Query: 108 INRARYMPQNTNIIATVNGEGTIFIYDCSRDKQSALLSTLKYHKDNAYGLAFNPNAEGEL 167
           I RARYMPQ+ N++AT+NG+GT+F+Y     +   L STLK+HKDN Y L+F+P  +G L
Sbjct: 121 ITRARYMPQDPNMVATINGQGTVFLYS----RSDGLQSTLKFHKDNGYALSFSPLIKGHL 176

Query: 168 ISGSDDSTIALWDATN-DKLKQPIQEWTTSHSDIVNDCQWHCFNTNMFGSVSEDSTLQLF 226
           +SGSDD ++ALWD +       PI+ W   HSDIVND +WH FN ++FG+VSEDS L++ 
Sbjct: 177 LSGSDDHSVALWDVSGGSDSTTPIRTWDDLHSDIVNDSKWHNFNKDLFGTVSEDSLLKIN 236

Query: 227 DKRNGGKSDVKISSKGQYNSIAFSGFSENLFAAAGTTNNIYLYDIRNTGKILHSMTGHEE 286
           D R    +         +N++AFS  S N+ AAAG  +++YLYD+RN  + LH M+GHE+
Sbjct: 237 DIRAENTTIDTAKCPQPFNTLAFSHHSSNILAAAGMDSHVYLYDLRNMKEPLHHMSGHED 296

Query: 287 PVTSLEFSNDKDGILISGSSDRRVIMWDLFEIGAEQQPDEADDGLPEVMMIHAGSRSAIN 346
            VT+LEFS   DG+++S  SD R+IMWDL +IGAEQ PD+A+DG+PE++M+HAG RSA+N
Sbjct: 297 AVTNLEFSPHVDGVVVSSGSDNRLIMWDLKQIGAEQTPDDAEDGVPELIMVHAGHRSAVN 356

Query: 347 DISTHPSIPWLNASVEENNIVQVWKCSSKLPRISGTPEVS 386
           D   +  +PWL AS EE NI+QVWKCS  LP + G P+++
Sbjct: 357 DFDLNAQVPWLIASTEEENILQVWKCSHSLPIVGGLPKIN 396

>KLTH0C11550g Chr3 (949063..950259) [1197 bp, 398 aa] {ON} similar
           to uniprot|P39984 Saccharomyces cerevisiae YEL056W
          Length = 398

 Score =  404 bits (1039), Expect = e-139,   Method: Compositional matrix adjust.
 Identities = 203/380 (53%), Positives = 264/380 (69%), Gaps = 14/380 (3%)

Query: 8   EEPLTVDQEYDLWKSNVPLLYDFVSETRLTWPSLTLQWLPGDKTSTRQHLILGTLTSGAE 67
           E  ++VD+EYDLWKSNVPL+YDFVSET+L WPSLT+QWLP +  S  Q LILGT TSG E
Sbjct: 7   ENEVSVDEEYDLWKSNVPLMYDFVSETKLLWPSLTIQWLPSNDRSNEQELILGTHTSGTE 66

Query: 68  TDYLKIAALDLPDEIII-----------GXXXXXXXXXXXXXXXXFAHDGEINRARYMPQ 116
            +YLKIA++ LPDE++                             F H  E+ RARY P 
Sbjct: 67  QNYLKIASVHLPDEVVSDVKCSAPSTDDSKESGHQPQSKIKIVRKFEHRDEVTRARYAPF 126

Query: 117 NTNIIATVNGEGTIFIYDCSRDKQSALLSTLKYHKDNAYGLAFNPNAEGELISGSDDSTI 176
           N N+IAT++G G +F+YD S+D  SAL +   +HK+N YGL F+  + GEL+S SDD +I
Sbjct: 127 NPNLIATISGSGKVFLYDRSKDSDSALTAEFSFHKENGYGLNFSVISPGELLSCSDDGSI 186

Query: 177 ALWDATNDKLKQPIQEWTTSHSDIVNDCQWHCFNTNMFGSVSEDSTLQLFDKRNGGKSDV 236
           A+WD  + K   P++   TSH++IVN+C+WH  +  +FGSVS+DSTL + DKR   K  V
Sbjct: 187 AIWDVCSGK-NTPVKV-DTSHNNIVNECKWHEKSPFLFGSVSDDSTLIIHDKR-IDKPVV 243

Query: 237 KISSKGQYNSIAFSGFSENLFAAAGTTNNIYLYDIRNTGKILHSMTGHEEPVTSLEFSND 296
           KI     YN++AFS  S NLFAAAGT + + LYD+R     +HSM+GH + VTSLEF+  
Sbjct: 244 KILQSEPYNTLAFSKHSSNLFAAAGTDSQVQLYDLRKPEAPIHSMSGHHDSVTSLEFAPH 303

Query: 297 KDGILISGSSDRRVIMWDLFEIGAEQQPDEADDGLPEVMMIHAGSRSAINDISTHPSIPW 356
           KDGIL SGSSDRRV++WDLF+IGAEQQ ++ADDG+PE++M+HAG +S +ND S  P+IPW
Sbjct: 304 KDGILCSGSSDRRVLIWDLFQIGAEQQQEDADDGVPELLMMHAGHKSPVNDFSCSPNIPW 363

Query: 357 LNASVEENNIVQVWKCSSKL 376
           L ASVEE N+VQ+WK S KL
Sbjct: 364 LMASVEEENVVQIWKASKKL 383

>ACR017W Chr3 (387122..388393) [1272 bp, 423 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YEL056W (HAT2)
          Length = 423

 Score =  401 bits (1030), Expect = e-137,   Method: Compositional matrix adjust.
 Identities = 200/383 (52%), Positives = 265/383 (69%), Gaps = 10/383 (2%)

Query: 11  LTVDQEYDLWKSNVPLLYDFVSETRLTWPSLTLQWLPGDKTSTRQHLILGTLTSGAETDY 70
           LTV++EY+LW SNVP++Y+FVSET+LTWPSLT+QWLP D  S  Q LI GT T+G E +Y
Sbjct: 42  LTVEEEYELWNSNVPVMYEFVSETKLTWPSLTIQWLPSDGQSPEQSLIFGTHTAGEEVNY 101

Query: 71  LKIAALDLPDEIII----GXXXXXXXXXXXXXXXXFAHDGEINRARYMPQNTNIIATVNG 126
           LK+A ++LP  I                       F H  E+ RARYMP N+NIIAT+NG
Sbjct: 102 LKVATINLPAGIAGLDQGDEEDEANDHSSFAIANKFPHIEEVIRARYMPANSNIIATING 161

Query: 127 EGTIFIYDCSRDKQSALLSTLKYHKDNAYGLAFNPNAEGELISGSDDSTIALWDATNDKL 186
           +GTI I+D + ++  A +STL +HK+N YGLAFNP+  GEL+SGSDD+T+ALWD    K 
Sbjct: 162 KGTISIFDRTLEESKAQVSTLAFHKENGYGLAFNPHISGELLSGSDDTTVALWDIEAAKK 221

Query: 187 KQPIQEWTTSHSDIVNDCQWHCFNTNMFGSVSEDSTLQLFDKRNGGKSDVKISSKGQYNS 246
            + I    TSH DIVND +WH F +N+FG+VSED TLQ+ DKR   +   K+ +   +N+
Sbjct: 222 PKSI---LTSHDDIVNDVKWHEFESNVFGTVSEDKTLQVHDKRVRLEPVKKLPTASPFNT 278

Query: 247 IAFSGFSENLFAAAGTTNNIYLYDIRNTGKILHSMTGHEEPVTSLEFSNDKDGILISGSS 306
           ++FS  S NL AAAG  + IYLYD+R+    LH M+GH++ VT++EFS   DGI+ S  S
Sbjct: 279 LSFSKHSRNLLAAAGVDSQIYLYDMRDMSSPLHVMSGHQDSVTTVEFSPHTDGIICSSGS 338

Query: 307 DRRVIMWDLFEIGAEQQPDEADDGLPEVMMIHAGSRSAINDISTHPSIPWLNASVEENNI 366
           DRR I+WDL +IGAEQ  D+ADDG PE+MM+HAG RS +N+ S +P IPWL AS EE+N+
Sbjct: 339 DRRAIIWDLTQIGAEQSQDDADDGAPELMMMHAGHRSPVNEFSFNPQIPWLLASTEEDNV 398

Query: 367 VQVWKCSSKLPRISGTPEVSISD 389
           +Q WK S KL  ++ +P  +ISD
Sbjct: 399 IQAWKVSMKL--VNASPP-AISD 418

>Kwal_56.22345 s56 complement(58523..59713) [1191 bp, 396 aa] {ON}
           YEL056W (HAT2) - subunit of a cytoplasmic histone
           acetyltransferase [contig 186] FULL
          Length = 396

 Score =  397 bits (1020), Expect = e-136,   Method: Compositional matrix adjust.
 Identities = 204/385 (52%), Positives = 267/385 (69%), Gaps = 13/385 (3%)

Query: 1   MEKVEQQEEPLTVDQEYDLWKSNVPLLYDFVSETRLTWPSLTLQWLPGDKTSTRQHLILG 60
           M+  E + E L++D EYDLWKSNVPL+YDFVSETRL WPSLT+QWLP  + ST Q L++G
Sbjct: 1   MQSTEPERE-LSIDDEYDLWKSNVPLMYDFVSETRLLWPSLTIQWLPRAEDSTEQELLVG 59

Query: 61  TLTSGAETDYLKIAALDLPDEIIIGXX---------XXXXXXXXXXXXXXFAHDGEINRA 111
           T TS +E +YLKIA ++LP EI+                           F H+ E+ RA
Sbjct: 60  THTSDSEQNYLKIAEINLPQEILSNEGPVLQNDNNGSDEQVPSKIKIIKKFKHENEVTRA 119

Query: 112 RYMPQNTNIIATVNGEGTIFIYDCSRDKQSALLSTLKYHKDNAYGLAFNPNAEGELISGS 171
           RY P ++N+IAT++G GT+F+YD ++D ++AL     YHK+N YGL F+  + GELIS S
Sbjct: 120 RYAPFDSNLIATISGTGTVFLYDRTKDDENALRGKYAYHKENGYGLNFSVASPGELISCS 179

Query: 172 DDSTIALWDATNDKLKQPIQEWTTSHSDIVNDCQWHCFNTNMFGSVSEDSTLQLFDKRNG 231
           DD +IA+WD  + K         + HSDIVN+C+WH  + N++GSVSEDS L + DKR+ 
Sbjct: 180 DDGSIAIWDIKSGKTVP--TSVNSLHSDIVNECKWHESDPNIYGSVSEDSFLMIHDKRSE 237

Query: 232 GKSDVKISSKGQYNSIAFSGFSENLFAAAGTTNNIYLYDIRNTGKILHSMTGHEEPVTSL 291
            K   K+  K  +N+IAFS  S NLFAAAGT   +YL+D R   + LHSM+GH+E VTSL
Sbjct: 238 -KPLQKLLQKEPFNTIAFSKHSSNLFAAAGTDAMVYLFDSRKPTEALHSMSGHQEAVTSL 296

Query: 292 EFSNDKDGILISGSSDRRVIMWDLFEIGAEQQPDEADDGLPEVMMIHAGSRSAINDISTH 351
           EF++ KDGIL SG SDRRV++WDLF+IG EQQ ++ADDG PE++M+HAG +SAIND S  
Sbjct: 297 EFAHHKDGILCSGGSDRRVLLWDLFQIGTEQQEEDADDGGPELLMMHAGHKSAINDFSFS 356

Query: 352 PSIPWLNASVEENNIVQVWKCSSKL 376
           P++PWL ASVEE NIVQ+WK S KL
Sbjct: 357 PNVPWLMASVEEENIVQIWKPSRKL 381

>KAFR0L00320 Chr12 (56449..57624) [1176 bp, 391 aa] {ON} Anc_6.9
           YEL056W
          Length = 391

 Score =  397 bits (1019), Expect = e-136,   Method: Compositional matrix adjust.
 Identities = 195/382 (51%), Positives = 274/382 (71%), Gaps = 8/382 (2%)

Query: 5   EQQEEPLTVDQEYDLWKSNVPLLYDFVSETRLTWPSLTLQWLPGDKTS--TRQHLILGTL 62
           +++E  L++D+EY LWKSNVPL+YDFVSET+LTWPSLT++WLP D  +  T+Q +I+GT 
Sbjct: 4   QEEERELSIDEEYKLWKSNVPLMYDFVSETKLTWPSLTVEWLPHDPQAPLTQQEMIIGTH 63

Query: 63  TSGAETDYLKIAALDLPDEII-IGXXXXXXXXXXXXXXXXFAHDGEINRARYMPQNTNII 121
           TS  E +Y+KIA+++LP+E+I                   F  + EI R+RYM Q+ NII
Sbjct: 64  TSDQEPNYVKIASIELPNEVIDPHNVSDAPVKSNVRITKKFKLEKEITRSRYMVQDPNII 123

Query: 122 ATVNGEGTIFIYDCSRDKQSALLSTLKYHKDNAYGLAFNPNAEGELISGSDDSTIALWDA 181
           +T++G GT+ I+D  R+   + + T  YHKDN YGL+FNP ++G+L+S +DD  IA++D 
Sbjct: 124 STIDGNGTVSIFD--RNSSDSPVKTYSYHKDNGYGLSFNPISKGQLLSAADDGYIAMYD- 180

Query: 182 TNDKLKQPIQEWTTSHSDIVNDCQWHCFNTNMFGSVSED-STLQLFDKRNGGKSDVKISS 240
            N + + P++ W ++ + I+ND +WH F+  +FG+VSE+ +TL ++D R   K    I  
Sbjct: 181 INAESEDPVETWQSTDNCIINDIKWHHFDATLFGTVSEEKNTLSIYDLRTKDKV-TSIEM 239

Query: 241 KGQYNSIAFSGFSENLFAAAGTTNNIYLYDIRNTGKILHSMTGHEEPVTSLEFSNDKDGI 300
           +  +NS+AFS  S+NLF+AAGT  N+YLYD+RNT K LHSM+GHE PVT+LEF +  DGI
Sbjct: 240 EQPFNSLAFSKHSKNLFSAAGTDQNVYLYDLRNTRKTLHSMSGHEGPVTNLEFHDSVDGI 299

Query: 301 LISGSSDRRVIMWDLFEIGAEQQPDEADDGLPEVMMIHAGSRSAINDISTHPSIPWLNAS 360
           L+S S DRR+I+WDL EIG+EQ  ++A D  PE+MMIHAG RS++ND S + SIPWL AS
Sbjct: 300 LVSSSEDRRIIIWDLMEIGSEQVNEDAQDATPELMMIHAGHRSSVNDFSLNSSIPWLIAS 359

Query: 361 VEENNIVQVWKCSSKLPRISGT 382
            EE NI+QVWK SS+LPRIS +
Sbjct: 360 TEEENIIQVWKSSSRLPRISNS 381

>TBLA0A07120 Chr1 complement(1765718..1766941) [1224 bp, 407 aa]
           {ON} Anc_6.9 YEL056W
          Length = 407

 Score =  374 bits (959), Expect = e-127,   Method: Compositional matrix adjust.
 Identities = 197/389 (50%), Positives = 263/389 (67%), Gaps = 22/389 (5%)

Query: 4   VEQQEEPLTVDQEYDLWKSNVPLLYDFVSETRLTWPSLTLQWLPGDKT----STRQHLIL 59
           ++++EEPLT DQEY+LWKSNVPLLYDFVSET+L WPSLT++WLP ++T    S  Q L+L
Sbjct: 13  IKEEEEPLTTDQEYELWKSNVPLLYDFVSETKLVWPSLTVEWLPSNETTNLPSNEQRLLL 72

Query: 60  GTLTSGAETDYLKIAALDLPDEII---IGXXXXXXXXXXXXXXXXFAHDGEINRARYMPQ 116
           GT TSG E +YLKIA + LPD+II                     F H+ E+ RA YMPQ
Sbjct: 73  GTHTSGEEQNYLKIAEITLPDQIINEKTEDNSDKHVKSNIRIIKKFKHELEVTRAHYMPQ 132

Query: 117 NTNIIATVNGEGTIFIYDCSRDKQSA--LLSTLKYHKDNAYGLAFNPNAEGELISGSDDS 174
           ++ IIAT+NG+GT+FIYD S D+  +  ++S L +HK+N YGLAFNP  +G+L+S SDD 
Sbjct: 133 DSTIIATINGDGTVFIYDTSIDENQSNPIISKLSHHKENGYGLAFNPLDKGKLLSSSDDG 192

Query: 175 TIALWDATNDKLKQPIQEWTTSHSDIVNDCQWHCFNTNMFGSVSEDSTLQLFDKRNGGKS 234
           ++A W+     +++ I   T   + I+ND +W+ FN N+FG V+E S L L D RN   +
Sbjct: 193 SVAYWN-----IQKSIPLLTLQETSIINDVRWNQFNQNLFGYVTESSCLNLKDVRNNN-N 246

Query: 235 DVKISSK------GQYNSIAFSGFSENLFAAAGTTNNIYLYDIRNTGKILHSMTGHEEPV 288
           D+KI S         +N++AFS  SE L AA+G  + IYLYD RN  + LH M GHE+ V
Sbjct: 247 DLKIVSNHDIKTPSAFNAMAFSFHSEYLMAASGEDSLIYLYDTRNLNQPLHYMRGHEDSV 306

Query: 289 TSLEFSNDKDGILISGSSDRRVIMWDLFEIGAEQQPDEADDG-LPEVMMIHAGSRSAIND 347
           TSL+F    DGI+ISG SD+RV +WDL +IG EQ  DE +DG +PE++MIHAG RS IND
Sbjct: 307 TSLDFHALNDGIVISGGSDKRVAVWDLKQIGQEQTSDEIEDGDVPELLMIHAGHRSPIND 366

Query: 348 ISTHPSIPWLNASVEENNIVQVWKCSSKL 376
            S   ++ WL AS+EE+NIVQVWK ++ L
Sbjct: 367 FSMSNNLNWLCASIEEDNIVQVWKMNNSL 395

>YBR195C Chr2 complement(610614..611882) [1269 bp, 422 aa] {ON}
           MSI1Subunit of chromatin assembly factor I (CAF-1);
           chromatin assembly by CAF-1 is important for multiple
           processes including silencing at telomeres, mating type
           loci, and rDNA; maintenance of kinetochore structure;
           deactivation of the DNA damage checkpoint after DNA
           repair; and chromatin dynamics during transcription;
           Msi1p localizes to both nucleus and cytoplasm and has an
           independent role as a negative regulator of the RAS/cAMP
           pathway via sequestration of Npr1p kinase
          Length = 422

 Score =  132 bits (331), Expect = 7e-34,   Method: Compositional matrix adjust.
 Identities = 115/417 (27%), Positives = 176/417 (42%), Gaps = 64/417 (15%)

Query: 10  PLTVDQEYDLWKSNVPLLYDFVSETRLTWPSLTLQWLPG-DKTSTRQHLILGTLTSGA-- 66
           P+ + + Y  WK N  LLYD+++     WPSLT Q+ P  D TS    ++L + TS    
Sbjct: 16  PIDLQERYSHWKKNTKLLYDYLNTNSTKWPSLTCQFFPDLDTTSDEHRILLSSFTSSQKP 75

Query: 67  --ETDYL-KIAAL-----------DLPD-EIIIGXXXXXXXXXXXXXXXXFAHDGEINRA 111
             ET Y+ KI+ L           D+ + E                    F  +GE NRA
Sbjct: 76  EDETIYISKISTLGHIKWSSLNNFDMDEMEFKPENSTRFPSKHLVNDISIFFPNGECNRA 135

Query: 112 RYMPQNTNIIATVNGEGTIFIYD-----CSRDKQSAL--------------------LST 146
           RY+PQN +IIA  + +G I+I+D      +R +QS +                    + T
Sbjct: 136 RYLPQNPDIIAGASSDGAIYIFDRTKHGSTRIRQSKISHPFETKLFGSHGVIQDVEAMDT 195

Query: 147 LKYHKDNAYGLAFNPNAEGELISGSDDSTIALWDATNDKLKQPIQEW----TTSHSDIVN 202
                + A  LA+N   E  L+S   +  + +WD      + PI +       S    VN
Sbjct: 196 SSADINEATSLAWNLQQEALLLSSHSNGQVQVWDIKQYSHENPIIDLPLVSINSDGTAVN 255

Query: 203 DCQWHCFNTNMFGSVSEDSTLQLFDKRNGGKSDVKISSK--GQYNSIAFSGFSENLFAAA 260
           D  W   + ++F + +E + + L D R   +       K  G  NS  F+  +  + A+A
Sbjct: 256 DVTWMPTHDSLFAACTEGNAVSLLDLRTKKEKLQSNREKHDGGVNSCRFNYKNSLILASA 315

Query: 261 GTTNNIYLYDIRNTGKILHSMTGHEEPVTSLEFSNDKDGIL-ISGSSDRRVIMWDLFEIG 319
            +   + L+DIRN  K   +   H   V++LE+S + D +L  +G  D  V +WD     
Sbjct: 316 DSNGRLNLWDIRNMNKSPIATMEHGTSVSTLEWSPNFDTVLATAGQEDGLVKLWDT---- 371

Query: 320 AEQQPDEADDGLPEVMMIHAGSRSAINDISTHPSIPWLNASVEENNIVQVWKCSSKL 376
                        E +  H G    +NDIS     PWL  SV  +N V +WK +  L
Sbjct: 372 ----------SCEETIFTHGGHMLGVNDISWDAHDPWLMCSVANDNSVHIWKPAGNL 418

 Score = 36.6 bits (83), Expect = 0.097,   Method: Compositional matrix adjust.
 Identities = 37/175 (21%), Positives = 73/175 (41%), Gaps = 22/175 (12%)

Query: 210 NTNMFGSVSEDSTLQLFDKRNGGKSDVKISSKGQYNSIAFSGFSENLFAAAGTTNNIYLY 269
           N ++    S D  + +FD+   G + ++ S            F   LF + G   ++   
Sbjct: 141 NPDIIAGASSDGAIYIFDRTKHGSTRIRQSKISH-------PFETKLFGSHGVIQDVEAM 193

Query: 270 DIRNTGKILHSMTGHEEPVTSLEFSNDKDGILISGSSDRRVIMWDLFEIGAEQQPDEADD 329
           D         + +      TSL ++  ++ +L+S  S+ +V +WD+ +   E    +   
Sbjct: 194 D---------TSSADINEATSLAWNLQQEALLLSSHSNGQVQVWDIKQYSHENPIID--- 241

Query: 330 GLPEVMMIHAGSRSAINDISTHPSIPWLNASVEENNIVQVWKCSSKLPRISGTPE 384
            LP V +   G+  A+ND++  P+   L A+  E N V +    +K  ++    E
Sbjct: 242 -LPLVSINSDGT--AVNDVTWMPTHDSLFAACTEGNAVSLLDLRTKKEKLQSNRE 293

>TBLA0H03650 Chr8 (888840..890099) [1260 bp, 419 aa] {ON} Anc_8.548
           YBR195C
          Length = 419

 Score =  130 bits (328), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 117/420 (27%), Positives = 186/420 (44%), Gaps = 74/420 (17%)

Query: 13  VDQEYDLWKSNVPLLYDFVSETRLTWPSLTLQWLPG-DKTSTRQHLILGTLTSGA----E 67
           + Q Y  WK N  LLYD+++     WPSLT Q+ P  DK++    L+L T TS      E
Sbjct: 13  LQQRYSHWKKNTKLLYDYLNTNSNKWPSLTCQFFPDIDKSNDTHRLLLSTFTSSQIPDDE 72

Query: 68  TDYLK-IAALDLPDEIIIGXXXXXXXXXXXXXXXXFAH------------DGEINRARYM 114
           + Y+  I+ L+  D   +                 F              +G+ N+ARYM
Sbjct: 73  SIYISHISTLNHLDWSSLNNFDMDEMEFKPDNRIKFPSKNLITDISITFPEGDCNKARYM 132

Query: 115 PQNTNIIATVNGEGTIFIYDCSRDKQSALLSTL--------------KYHKDNAY----- 155
           PQN +II   +  G I+I+D  R K+ + LST               K  K   +     
Sbjct: 133 PQNPDIIGCASSNGCIYIFD--RTKRGSKLSTTTSARFSSGSKAYEAKLAKQRKFVIEDG 190

Query: 156 ---------GLAFNPNAEGELISGSDDSTIALWD------ATNDKLKQPIQEWTTSHSDI 200
                     +A+NP  EG+L+S   +  I LWD      + N ++   I  W T+  D+
Sbjct: 191 TKNDEFECLSIAWNPQQEGQLLSCESNGNIHLWDFQKEFSSKNREINNTI--WDTNFDDL 248

Query: 201 -VNDCQWHCFNTNMFGSVSEDSTLQLFDKRNGG--KSDVKISSKGQYNSIAFSGFSENLF 257
             N+  W   + ++F +  E++ + +FD R  G   S  + +  G  NS  F+  +  L 
Sbjct: 249 GCNEVTWMNGHNSIFATCGENNKMAVFDTRKEGIVNSIEQGNHNGGINSCKFNYENAMLL 308

Query: 258 AAAGTTNNIYLYDIRNTGKILHSMTGHEEPVTSLEFSNDKDGILISGSS-DRRVIMWDLF 316
           A+  +   I L+DIR   K + ++  H   ++++E+S   + ++ SG   D  V +WD  
Sbjct: 309 ASGDSNGIINLWDIRKLNKPIRNLY-HGSSISTIEWSPLMNEMIASGGQEDGLVKLWD-- 365

Query: 317 EIGAEQQPDEADDGLPEVMMIHAGSRSAINDISTHPSIPWLNASVEENNIVQVWKCSSKL 376
            I  E++P          + IH G    IND+S     PWL  SV  +N +Q+WK +  L
Sbjct: 366 -ISNEEEP----------IFIHGGHMLGINDLSWDLHDPWLLCSVGSDNSIQIWKPAKHL 414

>KLLA0E23541g Chr5 (2095246..2096499) [1254 bp, 417 aa] {ON} similar
           to uniprot|P13712 Saccharomyces cerevisiae YBR195C MSI1
           Subunit of chromatin assembly factor I (CAF- I)
           regulates the RAS/cAMP pathway via sequestration of
           Npr1p kinase localizes to the nucleus and cytoplasm
           homologous to human retinoblastoma binding proteins
           RbAp48 and RbAp46
          Length = 417

 Score =  130 bits (327), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 102/402 (25%), Positives = 190/402 (47%), Gaps = 46/402 (11%)

Query: 13  VDQEYDLWKSNVPLLYDFVSETRLTWPSLTLQWLPGDKTST--RQHLILGTLTSG----- 65
           V Q Y  WK N  LLYD+++     WPSL+ Q+ P D+T T  +Q ++L + TS      
Sbjct: 20  VQQRYTNWKKNTKLLYDYLNTNTSKWPSLSCQFFP-DRTLTNDKQRILLSSFTSQQLPQD 78

Query: 66  --------AETDYLKIAALDLPD----EIIIGXXXXXXXXXXXXXXXXFAHDGEINRARY 113
                   +  +++K ++++  D    E  +                    DG+ NR RY
Sbjct: 79  ESIYIGSISTMNHMKWSSINNFDMDEMEFKLDNSLKLNDKTLEEEVRITYPDGDCNRCRY 138

Query: 114 MPQNTNIIATVNGEGTIFIYDCSRDKQSALLSTLKY-----------HKDNAYGLAFNPN 162
           MPQN +II T +  G+++I+D  R K    +ST +             +D +  LA+N  
Sbjct: 139 MPQNPDIIGTASSNGSVYIFD--RTKHGNKISTGRKFEIECRNNGDDEQDESLSLAWNYQ 196

Query: 163 AEGELISGSDDSTIALWDATN-DKLKQ----PIQEWTTSHSDIVNDCQWHCFNTNMFGSV 217
            EG L +   +  + +WD T  DK KQ    P +E +   ++ VND  W   +T++  S 
Sbjct: 197 LEGTLATCQSNGKVKVWDLTKFDKSKQRMEIPERE-SVMDANGVNDVSWMVNHTSILASC 255

Query: 218 SEDSTLQLFDKRNGGKSDV--KISSKGQYNSIAFSGFSENLFAAAGTTNNIYLYDIRNTG 275
            E + + L D R   K D   + +     N+I F+  ++ +     +   + ++DIR+  
Sbjct: 256 GESNVIGLIDIRQDTKMDTLHRTTHTDGINAIEFNYKNDMILCTGDSQGQLKIWDIRDFK 315

Query: 276 KILHSMT-GHEEPVTSLEFSNDKDGILISGSSDRRVIMWDLFEIGAEQQPDEADDGLPEV 334
           + +     G ++P+++++++     IL   ++D++  +  +++   EQ+   A++ +  +
Sbjct: 316 EPIKEWEHGDQDPISAIQWNPQIPQIL--ATADQQSGLVKIWDASGEQEDSNAENNM--L 371

Query: 335 MMIHAGSRSAINDISTHPSIPWLNASVEENNIVQVWKCSSKL 376
           + +H G    +NDIS     PW   SV  +N + +WK ++ L
Sbjct: 372 LFVHGGHMLGVNDISWSQHDPWTMCSVSNDNSIHIWKPAANL 413

>Skud_2.321 Chr2 complement(577912..579180) [1269 bp, 422 aa] {ON}
           YBR195C (REAL)
          Length = 422

 Score =  127 bits (319), Expect = 3e-32,   Method: Compositional matrix adjust.
 Identities = 113/410 (27%), Positives = 176/410 (42%), Gaps = 66/410 (16%)

Query: 13  VDQEYDLWKSNVPLLYDFVSETRLTWPSLTLQWLPGDKTSTRQH-LILGTLTSGAETD-- 69
           + + Y  WK N  LLYD+++     WPSLT Q+ P   T+  +H ++L + TS  + +  
Sbjct: 19  LQERYSHWKKNTKLLYDYLNTNSTKWPSLTCQFFPDLDTTLNEHRILLSSFTSSQKPEDE 78

Query: 70  -----------YLKIAALDLPD----EIIIGXXXXXXXXXXXXXXXXFAHDGEINRARYM 114
                      ++K A+L+  D    E                    F  +GE NRARY+
Sbjct: 79  TIYISRISTLGHIKWASLNNFDMDEMEFKPENTTTYPSKHLVDDIRIFFPNGECNRARYL 138

Query: 115 PQNTNIIATVNGEGTIFIYD-----CSRDKQSAL-----LSTLKYHK------------- 151
           PQN +IIA  + +G I+I+D      +R +QS +     +  L  H              
Sbjct: 139 PQNPDIIAGASSDGAIYIFDRTKHGSTRIRQSKISHPFEIKLLGSHGVIQDVETMDTSLV 198

Query: 152 --DNAYGLAFNPNAEGELISGSDDSTIALWDATNDKLKQPIQEW----TTSHSDIVNDCQ 205
             + A  LA+N   E  L+S   +  I +WD        PI +       S    VND  
Sbjct: 199 DINEATSLAWNLQQEALLLSSHSNGQIQVWDIKQYSHDNPIIDVPLMSIDSDGSSVNDVT 258

Query: 206 WHCFNTNMFGSVSEDSTLQLFD---KRNGGKSDVKISSKGQYNSIAFSGFSENLFAAAGT 262
           W   + ++F + +E + + L D   K+   KS+ KI   G  NS  F+  +  + A+A +
Sbjct: 259 WMPTHDSLFAACTERNAVSLLDLRTKKEKLKSNCKIHGGG-VNSCKFNYKNSLILASADS 317

Query: 263 TNNIYLYDIRNTGKILHSMTGHEEPVTSLEFSNDKDGIL-ISGSSDRRVIMWDLFEIGAE 321
              + L+DIRN  +   +   H   V++LE+S + D +L  +G  D  V +WD       
Sbjct: 318 NGRLNLWDIRNMNENPIATMEHGASVSTLEWSPNFDTVLATAGQEDGLVKLWDTTR---- 373

Query: 322 QQPDEADDGLPEVMMIHAGSRSAINDISTHPSIPWLNASVEENNIVQVWK 371
                      E +  H G    +NDIS     PWL  SV  +N V +WK
Sbjct: 374 ----------EESIFTHGGHMFGVNDISWDVHDPWLMCSVANDNSVHIWK 413

 Score = 30.4 bits (67), Expect = 8.3,   Method: Compositional matrix adjust.
 Identities = 34/177 (19%), Positives = 75/177 (42%), Gaps = 24/177 (13%)

Query: 210 NTNMFGSVSEDSTLQLFDKRNGGKSDVKISSKGQYNSIAFSGFSENLFAAAGTTNNIYLY 269
           N ++    S D  + +FD+   G + ++ S            F   L  + G   ++   
Sbjct: 141 NPDIIAGASSDGAIYIFDRTKHGSTRIRQSKISH-------PFEIKLLGSHGVIQDVETM 193

Query: 270 DIRNTGKILHSMTGHEEPVTSLEFSNDKDGILISGSSDRRVIMWDLFEIGAEQQPDEADD 329
           D         S+    E  TSL ++  ++ +L+S  S+ ++ +WD+ +          D+
Sbjct: 194 DT--------SLVDINE-ATSLAWNLQQEALLLSSHSNGQIQVWDIKQYSH-------DN 237

Query: 330 GLPEVMMIHAGSR-SAINDISTHPSIPWLNASVEENNIVQVWKCSSKLPRISGTPEV 385
            + +V ++   S  S++ND++  P+   L A+  E N V +    +K  ++    ++
Sbjct: 238 PIIDVPLMSIDSDGSSVNDVTWMPTHDSLFAACTERNAVSLLDLRTKKEKLKSNCKI 294

>NDAI0C05510 Chr3 (1281190..1282449) [1260 bp, 419 aa] {ON}
           Anc_8.548
          Length = 419

 Score =  126 bits (316), Expect = 7e-32,   Method: Compositional matrix adjust.
 Identities = 113/430 (26%), Positives = 183/430 (42%), Gaps = 84/430 (19%)

Query: 5   EQQEEPLTVDQEYDLWKSNVPLLYDFVSETRLTWPSLTLQWLPG-DKTSTRQHLILGTLT 63
           EQ   P  + Q Y  WK N  LLYD+++     WPSLT Q+ P  D TS    +++ + T
Sbjct: 9   EQSTIPNDLQQRYSNWKKNTKLLYDYLNTNATKWPSLTCQFFPDLDTTSDTHRILISSFT 68

Query: 64  SGA-----------------------------ETDYLKIAALDLPDEIIIGXXXXXXXXX 94
           S                               E ++     L LP + ++          
Sbjct: 69  SSQLPEDEAIHISKISTLKHLNWASVNNFDMDEMEFKPDTNLKLPSKHLVNDLTIKFP-- 126

Query: 95  XXXXXXXFAHDGEINRARYMPQNTNIIATVNGEGTIFIYD-----CSRDKQSALLS---- 145
                     +G+ NRARY+PQN ++IA  +  G+++I+D      SR +QS  L     
Sbjct: 127 ----------NGDCNRARYLPQNPDVIAAASSNGSVYIFDRTKHGSSRIRQSKNLKPYDA 176

Query: 146 ----------TLKYHKDNAYGLAFNPNAEGELISGSDDSTIALWDA-----TNDKLKQPI 190
                      L  + + A  LA+N   EG L S      + +WD      +N  L +P+
Sbjct: 177 VLFNNSETVEELHENTNEAISLAWNYQKEGTLASCYLQGQVQIWDIKQYFHSNPVLDKPV 236

Query: 191 QEWTTSHSDIVNDCQWHCFNTNMFGSVSEDSTLQLFDKRNGGKSDVKISS---KGQYNSI 247
                  +  VND  W   + ++F +  E  TL LFD+R  GK   +I+     G  NS 
Sbjct: 237 LN-IQFDALGVNDVSWMPSHDSLFVACGESDTLALFDQR-IGKEVSRIAQNRHNGGVNSC 294

Query: 248 AFSGFSENLFAAAGTTNNIYLYDIRNTGKILHSMTGHEEPVTSLEFSNDKDGIL-ISGSS 306
            F+  +  L A+A +   + ++DIRN  +       H   ++++E++ + D I+  +G +
Sbjct: 295 KFNYQNNMLLASADSEGLVNMWDIRNLDQYPIKSINHGSSISTIEWNPNLDTIIATAGQN 354

Query: 307 DRRVIMWDLFEIGAEQQPDEADDGLPEVMMIHAGSRSAINDISTHPSIPWLNASVEENNI 366
           D  V +WD+            D+   E++ +H G    +NDIS      WL  SV  +N 
Sbjct: 355 DGLVKLWDV---------SNTDN---ELLFVHGGHMLGVNDISWDLHDSWLMCSVSNDNS 402

Query: 367 VQVWKCSSKL 376
           +Q+WK +  L
Sbjct: 403 IQIWKPAHNL 412

>Smik_2.335 Chr2 complement(596903..598171) [1269 bp, 422 aa] {ON}
           YBR195C (REAL)
          Length = 422

 Score =  125 bits (314), Expect = 2e-31,   Method: Compositional matrix adjust.
 Identities = 110/423 (26%), Positives = 180/423 (42%), Gaps = 66/423 (15%)

Query: 5   EQQEEPLTVDQEYDLWKSNVPLLYDFVSETRLTWPSLTLQWLPGDKTSTRQH-LILGTLT 63
           E    P  + + Y  WK N  LLY++++     WPSLT Q+ P   T+  +H ++L + T
Sbjct: 11  EASNIPPNLQERYSHWKKNTKLLYEYLNTNSTKWPSLTCQFFPDLDTTLDEHRILLSSFT 70

Query: 64  SGAETD-------------YLKIAALDLPD----EIIIGXXXXXXXXXXXXXXXXFAHDG 106
           S  + +             ++K ++L+  D    E                    F  +G
Sbjct: 71  SSQKPEDESIYISKISTLGHIKWSSLNNFDMDEMEFKPENSTRYPPKHLVNDISIFFPNG 130

Query: 107 EINRARYMPQNTNIIATVNGEGTIFIYD-----CSRDKQSALLSTLKYHKDNAYG----- 156
           E NRARY+PQN +IIA  + +G I+I+D      +R +QS +    +     ++G     
Sbjct: 131 ECNRARYLPQNPDIIAGASSDGAIYIFDRTKHGSTRIRQSKISHPFEAKLFGSHGVIQDV 190

Query: 157 ---------------LAFNPNAEGELISGSDDSTIALWDATNDKLKQPIQEW----TTSH 197
                          +A+N   E  L+S   +  + +WD      + PI +       S 
Sbjct: 191 ETMDASSADINEATSIAWNLQQEALLLSSHSNGQVQVWDIKQYSHENPIIDLPLVSINSD 250

Query: 198 SDIVNDCQWHCFNTNMFGSVSEDSTLQLFD---KRNGGKSDVKISSKGQYNSIAFSGFSE 254
              VND  W   + ++F + +E +T+ L D   K+   KS+ + S  G  NS  F+  + 
Sbjct: 251 GSGVNDVTWMPTHDSLFAACTEGNTVSLLDLRTKKEKLKSNCR-SHNGGVNSCKFNYRNS 309

Query: 255 NLFAAAGTTNNIYLYDIRNTGKILHSMTGHEEPVTSLEFSNDKDGIL-ISGSSDRRVIMW 313
            + A+A +   + L+DIRN      +   H   V++LE+S + D +L  +G  D  V +W
Sbjct: 310 LILASADSNGKLNLWDIRNMNDCPLTTMEHGGSVSTLEWSPNFDTVLATAGQEDGLVKLW 369

Query: 314 DLFEIGAEQQPDEADDGLPEVMMIHAGSRSAINDISTHPSIPWLNASVEENNIVQVWKCS 373
           D                  E +  H G    +NDIS     PWL  SV  +N V +WK +
Sbjct: 370 DT--------------SREENIFTHGGHMLGVNDISWDAHDPWLMCSVANDNSVHIWKPA 415

Query: 374 SKL 376
             L
Sbjct: 416 VNL 418

>Kpol_1024.39 s1024 complement(104336..105589) [1254 bp, 417 aa]
           {ON} complement(104336..105589) [1254 nt, 418 aa]
          Length = 417

 Score =  125 bits (313), Expect = 2e-31,   Method: Compositional matrix adjust.
 Identities = 108/412 (26%), Positives = 179/412 (43%), Gaps = 61/412 (14%)

Query: 10  PLTVDQEYDLWKSNVPLLYDFVSETRLTWPSLTLQWLPGDKTSTRQHLIL-----GTLTS 64
           P      Y  WK N  LLY++++     WPSLT Q+ P   T    H IL      +L  
Sbjct: 18  PKERQDRYTTWKKNTKLLYEYLNTNSNKWPSLTCQFFPDVNTKNDSHRILLSSFTSSLVP 77

Query: 65  GAETDYL-KIAAL-----------DLPDEIIIGXXXXXXXXXXXXXXXXFA---HDGEIN 109
             E+ Y+ +I+ L           DL DE+                         +G+ N
Sbjct: 78  EDESLYITRISTLKHLSWASLNNFDL-DEMEFKPDNSNIKLPPKNLTTELVIRFPNGDCN 136

Query: 110 RARYMPQNTNIIATVNGEGTIFIYDCSR------DKQSALLSTLKYH------------K 151
           RARY+PQN ++IA  + +G+++I+D ++       +QS    + +              +
Sbjct: 137 RARYLPQNPDLIAAASSDGSVYIFDRTKHGTAMHSRQSGFTQSYQAKLAVNNNSQSLNGE 196

Query: 152 DNAYGLAFNPNAEGELISGSDDSTIALWDATNDKLKQPIQEWTTSHSDI----VNDCQWH 207
           + A  + +N   EG L+    D  +  WD T  K   P+ +    +  +     ND  W 
Sbjct: 197 NEALTIDWNHQKEGHLVVAYSDGHVKAWDITKYKRSDPVIKAPEYNYKLDESGCNDAVWM 256

Query: 208 CFNTNMFGSVSEDSTLQLFDKRNGGKS-DVKIS-SKGQYNSIAFSGFSENLFAAAGTTNN 265
             + ++F + SED+ L LFD R+     D+  S  KG  N+  F+  +  L A+  +  N
Sbjct: 257 PEHNSLFAACSEDNRLSLFDTRDESNIIDISTSVHKGGINACRFNPRNSLLLASGDSIGN 316

Query: 266 IYLYDIRNTGKILHSMTGHEEPVTSLEFSNDKDGILIS-GSSDRRVIMWDLFEIGAEQQP 324
           I L+DIR     + ++  H   ++++E++ +   +L S G  D  V +WD          
Sbjct: 317 ICLWDIRKKETPI-NILDHGSSISTIEWNPNLSTVLASAGQDDGLVKLWDA--------- 366

Query: 325 DEADDGLPEVMMIHAGSRSAINDISTHPSIPWLNASVEENNIVQVWKCSSKL 376
                G  + + IH G    +NDIS +   PWL  SV ++N +Q+WK +  L
Sbjct: 367 -----GSDKPVFIHGGHMLGVNDISWNMHDPWLMCSVSKDNSIQIWKPAHNL 413

>CAGL0M05291g Chr13 complement(566250..567509) [1260 bp, 419 aa]
           {ON} similar to uniprot|P13712 Saccharomyces cerevisiae
           YBR195c MSI1
          Length = 419

 Score =  124 bits (310), Expect = 5e-31,   Method: Compositional matrix adjust.
 Identities = 117/420 (27%), Positives = 187/420 (44%), Gaps = 65/420 (15%)

Query: 1   MEKVEQQEE---PLTVDQEYDLWKSNVPLLYDFVSETRLTWPSLTLQWLPGDKTSTRQH- 56
           +E +E+Q     P  V   Y  WK N  LLYD+++     WPSLT Q+ P   TS+ QH 
Sbjct: 6   IEDIEEQPVSTIPEDVQTRYIHWKKNTKLLYDYLNTNSTKWPSLTCQFFPDLDTSSDQHR 65

Query: 57  LILGTLTSGA----ETDYL-KIAAL-----------DLPD-EIIIGXXXXXXXXXXXXXX 99
           L+L + TS      E+ Y+ KI+ L           D+ + E                  
Sbjct: 66  LLLSSFTSSQLPEDESVYISKISTLKHLNWSSLNNFDMDEMEFKPDPSVKLPPKNLTTEV 125

Query: 100 XXFAHDGEINRARYMPQNTNIIATVNGEGTIFIYDCSRDKQSALLSTLK----------- 148
                +G+ NR+RY+PQN ++IA  + +G+++I++ ++   S L S              
Sbjct: 126 SIRFPNGDCNRSRYLPQNPDLIAAASSDGSVYIFNKTKHGNSVLRSKSSDDFQARLFSGS 185

Query: 149 ---YHKDN---AYGLAFNPNAEGELISGSDDSTIALWDA-----TNDKLKQPIQEWTTSH 197
               + DN   A  L++N + EG L          +WD      +N  + QP +   T  
Sbjct: 186 HDAQNLDNFNEAVSLSWNKHKEGILGVSYSQGQCNIWDVKKFSRSNILISQP-ELTVTFD 244

Query: 198 SDIVNDCQWHCFNTNMFGSVSEDSTLQLFDKRNGGKSDVKISSKGQY----NSIAFSGFS 253
           S+  ND  W   + +MF +  E + L LFD R  G+ +V   S  ++    N+  F+  +
Sbjct: 245 SNGCNDLDWMPMHDSMFIACGESNKLGLFDMRLNGEKEVNSISNYKHEDGINTCKFNPGN 304

Query: 254 ENLFAAAGTTNNIYLYDIRNTGKILHSMTGHEEPVTSLEFSNDKDGILI--SGSSDRRVI 311
             L A+A T   I L+DIR   +   S   H   ++++E+ N   G++   +G  D  V 
Sbjct: 305 SLLVASADTCGRINLWDIRKLDQEPISTMQHGSSISTIEW-NPNIGVVFASAGQEDGLVK 363

Query: 312 MWDLFEIGAEQQPDEADDGLPEVMMIHAGSRSAINDISTHPSIPWLNASVEENNIVQVWK 371
           +WD   +G E             + +H G    +NDIS     PWL ASV  +N +Q+W+
Sbjct: 364 LWDA-SVGKE-------------IFVHGGHMLGVNDISWDMHDPWLMASVSNDNTIQIWR 409

>KAFR0I00840 Chr9 complement(162878..164119) [1242 bp, 413 aa] {ON}
           Anc_8.548 YBR195C
          Length = 413

 Score =  124 bits (310), Expect = 5e-31,   Method: Compositional matrix adjust.
 Identities = 111/420 (26%), Positives = 185/420 (44%), Gaps = 59/420 (14%)

Query: 4   VEQQEEPLTVDQEYDLWKSNVPLLYDFVSETRLTWPSLTLQWLPGDKTSTRQH-LILGTL 62
           +E    P  + + Y  WK N  LLY +++     WPSLT Q+ P   T+T  H ++L T 
Sbjct: 7   IEPSSIPDDLQERYSRWKKNTKLLYSYLNTNTSKWPSLTCQFFPDLDTTTDTHRILLSTF 66

Query: 63  TSG--AETDYLKIAALDLPDEI---IIGXXXXXXXXXXXXXXXXFAH------------D 105
           TS    E + L IA L   + +    +                 F              +
Sbjct: 67  TSSQLPEDESLYIANLSTSNHLNWSSLNNFDMDEMEFKPDNSTKFPSKNLNVDISIPFPN 126

Query: 106 GEINRARYMPQNTNIIATVNGEGTIFIYDCS-----------RDKQSALLSTLKY----- 149
           G+ NRARY+PQN +++A  +  G+I+I++ +           R  ++ L ST K      
Sbjct: 127 GDCNRARYLPQNPDLLAAASSNGSIYIFNRTKHGSRRLNSNQRSFEARLYSTDKMDENFT 186

Query: 150 HKDNAYGLAFNPNAEGELISGSDDSTIALWDATNDKLKQPI---QEWTTSHS-DIVNDCQ 205
           + + A  +A+N    G L S     +I +WD T      P     E T     +  N+  
Sbjct: 187 NSNEAVSIAWNLQKNGTLASSYSQGSIKIWDITKYSCSDPTLRENELTIPFDPEGCNEVT 246

Query: 206 WHCFNTNMFGSVSEDSTLQLFDKRNGGKSDVKISSK-----GQYNSIAFSGFSENLFAAA 260
           W   + ++F + SE + L LFD R   +  +K++       G  NS  F+ +++ L A+A
Sbjct: 247 WMVNHDSIFAACSESNKLSLFDVRTKEEM-LKMTENIGTHSGGINSCKFNYYNDMLLASA 305

Query: 261 GTTNNIYLYDIRNTGKILHSMTGHEEPVTSLEFSNDKDGILIS-GSSDRRVIMWDLFEIG 319
            +T  I ++DIR   K       H   +++LE++ + + IL++ G  D  V +WD     
Sbjct: 306 DSTGKINMWDIRKLDKEPIKSFNHNSSISTLEWNPNLETILVTAGQDDGLVKIWD----- 360

Query: 320 AEQQPDEADDGLPEVMMIHAGSRSAINDISTHPSIPWLNASVEENNIVQVWKCSSKLPRI 379
                    +G  + + +H G    +ND+S     PWL +SV  +N + VWK ++ L  I
Sbjct: 361 -------TANG--QNIFVHGGHMLGVNDVSWDLHDPWLLSSVSNDNSIHVWKPATNLVDI 411

>Suva_4.449 Chr4 complement(780822..782096) [1275 bp, 424 aa] {ON}
           YBR195C (REAL)
          Length = 424

 Score =  117 bits (294), Expect = 8e-29,   Method: Compositional matrix adjust.
 Identities = 103/417 (24%), Positives = 175/417 (41%), Gaps = 64/417 (15%)

Query: 10  PLTVDQEYDLWKSNVPLLYDFVSETRLTWPSLTLQWLPGDKTSTRQH-LILGTLTSGA-- 66
           P+ + + Y  WK N  LLYD+++     WPSLT Q+ P   T+  +H ++L + TS    
Sbjct: 16  PIDLQERYSHWKKNTKLLYDYLNTNSTKWPSLTCQFFPDLDTTLDEHRILLSSFTSSQKP 75

Query: 67  --ETDYL-KIAAL-----------DLPD-EIIIGXXXXXXXXXXXXXXXXFAHDGEINRA 111
             ET Y+ KI+ L           D+ + E                    F  +G+ NRA
Sbjct: 76  EDETIYISKISTLGHIKWSSLNNFDMDEMEFKPENTTRLPPSHLVNDISIFFPNGDCNRA 135

Query: 112 RYMPQNTNIIATVNGEGTIFIYDCSRDKQSALLSTLKYHK-------------------- 151
           RY+PQN +IIA  + +G I+I+D ++   + +  +   H                     
Sbjct: 136 RYLPQNPDIIAGASSDGAIYIFDRTKHGSTRIRQSKNSHPFEAKLFGSHGVIQDVEAMDT 195

Query: 152 -----DNAYGLAFNPNAEGELISGSDDSTIALWDATNDKLKQPI--QEWTTSHSDI--VN 202
                + A  LA+N   E  L+S   +  + +WD      + P+      +  SD   VN
Sbjct: 196 SSADVNEATSLAWNLQQEALLLSSHSNGQVQIWDIKQYSHENPLIDSPLVSIESDASGVN 255

Query: 203 DCQWHCFNTNMFGSVSEDSTLQLFDKRNGGKS--DVKISSKGQYNSIAFSGFSENLFAAA 260
           D  W   + ++F + +E + + L D R   +     + +  G  NS  F+  +  + A+A
Sbjct: 256 DVTWMPTHDSLFAACTEGNVVSLLDLRTKKEKLRSNRQNHTGGVNSCKFNYRNSLVLASA 315

Query: 261 GTTNNIYLYDIRNTGKILHSMTGHEEPVTSLEFSNDKDGIL-ISGSSDRRVIMWDLFEIG 319
            +   + L+DIR   +   +   H   +++LE++ +   +L  +G  D  V +WD     
Sbjct: 316 DSNGRLNLWDIRKMNESPITTMEHGASISTLEWNPNFSTVLATAGQQDGLVKLWDT---- 371

Query: 320 AEQQPDEADDGLPEVMMIHAGSRSAINDISTHPSIPWLNASVEENNIVQVWKCSSKL 376
                        E +  H G    +ND+S     PWL  SV  +N V +WK +  L
Sbjct: 372 ----------AREETIFTHGGHMLGVNDVSWDVHDPWLMCSVANDNSVHIWKPAENL 418

 Score = 35.8 bits (81), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 34/170 (20%), Positives = 71/170 (41%), Gaps = 22/170 (12%)

Query: 210 NTNMFGSVSEDSTLQLFDKRNGGKSDVKISSKGQYNSIAFSGFSENLFAAAGTTNNIYLY 269
           N ++    S D  + +FD+   G + ++ S            F   LF + G   ++   
Sbjct: 141 NPDIIAGASSDGAIYIFDRTKHGSTRIRQSKNSH-------PFEAKLFGSHGVIQDVEAM 193

Query: 270 DIRNTGKILHSMTGHEEPVTSLEFSNDKDGILISGSSDRRVIMWDLFEIGAEQQPDEADD 329
           D         + +      TSL ++  ++ +L+S  S+ +V +WD+ +   E    ++  
Sbjct: 194 D---------TSSADVNEATSLAWNLQQEALLLSSHSNGQVQIWDIKQYSHENPLIDS-- 242

Query: 330 GLPEVMMIHAGSRSAINDISTHPSIPWLNASVEENNIVQVWKCSSKLPRI 379
             P V +      S +ND++  P+   L A+  E N+V +    +K  ++
Sbjct: 243 --PLVSI--ESDASGVNDVTWMPTHDSLFAACTEGNVVSLLDLRTKKEKL 288

>AEL250C Chr5 complement(168010..169263) [1254 bp, 417 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YBR195C
           (MSI1)
          Length = 417

 Score =  117 bits (293), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 105/409 (25%), Positives = 179/409 (43%), Gaps = 61/409 (14%)

Query: 13  VDQEYDLWKSNVPLLYDFVSETRLTWPSLTLQWLPGDKTSTRQH-LILGTLTSG--AETD 69
           + Q Y  WK N  LLYD+++     WPSLT Q++P  +  T +H L+L + TS    E +
Sbjct: 21  LQQRYTNWKKNTKLLYDYLNTNSTKWPSLTCQFMPDLEVPTDKHRLLLSSFTSSQLPEDE 80

Query: 70  YLKIAAL--------------DLPD-EIIIGXXXXXXXXXXXXXXXXFAHDGEINRARYM 114
            + I+ L              D+ + E  +                     G+ NRA YM
Sbjct: 81  AVYISELSTMRHVPWSSLNNFDMDEMEFKVDNQAKLPNKNLVETVRIQFPSGDCNRACYM 140

Query: 115 PQNTNIIATVNGEGTIFIYDCSR---DKQSALLSTLKYH-------------KDNAYGLA 158
           PQN +II  +   G + I+D ++   ++   L S   Y                 A  LA
Sbjct: 141 PQNPDIIGAIASTGAVNIFDRTKHGTNRPKLLGSAASYEIQLNEPESLGDADSAEALSLA 200

Query: 159 FNPNAEGELISGSDDSTIALWDATNDKLKQPIQEWTTSHSDI--------VNDCQWHCFN 210
           +N    G + S   +  I +WD T  +  QP    T S+ ++         ND  W   +
Sbjct: 201 WNWQKAGIIASSYSNGLIKVWDITRYQKSQP----TISNPELRILQDKAGTNDVSWMVHH 256

Query: 211 TNMFGSVSEDSTLQLFDKR--NGGKSDVKISSKGQYNSIAFSGFSENLFAAAGTTNNIYL 268
           +++  +  E +T+ L D R  +  K        G  N++ F+  ++ L  AA +   I L
Sbjct: 257 SSILAACGESNTIGLLDTRAPDAFKPTKASPHTGGINALQFNYANDMLLCAADSNGGIAL 316

Query: 269 YDIRNTGKILHSMTGHEEPVTSLEFSNDKDGIL-ISGSSDRRVIMWDLFEIGAEQQPDEA 327
           +D R   K L S+  H + V++L+++ +   I+  +G  D  + +WD       ++P+++
Sbjct: 317 WDCRAFSKPL-SVFNHGDSVSALQWNPNLPTIVATAGQGDGLIKIWD-----TSREPEDS 370

Query: 328 DDGLPEVMMIHAGSRSAINDISTHPSIPWLNASVEENNIVQVWKCSSKL 376
                 ++ +H G    +NDI+ +   PWL  SV  +N V VWK ++ L
Sbjct: 371 ------LLFVHGGHMLGVNDIAWNYHDPWLMCSVANDNSVHVWKPAANL 413

>KLTH0E12694g Chr5 (1126940..1128196) [1257 bp, 418 aa] {ON} similar
           to uniprot|P13712 Saccharomyces cerevisiae YBR195C MSI1
           Subunit of chromatin assembly factor I (CAF- I)
           regulates the RAS/cAMP pathway via sequestration of
           Npr1p kinase localizes to the nucleus and cytoplasm
           homologous to human retinoblastoma binding proteins
           RbAp48 and RbAp46
          Length = 418

 Score =  115 bits (288), Expect = 6e-28,   Method: Compositional matrix adjust.
 Identities = 103/404 (25%), Positives = 174/404 (43%), Gaps = 54/404 (13%)

Query: 15  QEYDLWKSNVPLLYDFVSETRLTWPSLTLQWLPGDKTSTRQH-LILGTLTSG--AETDYL 71
           + Y  WK N  L YD+++     WPSLT Q  P    +T +H ++L + TS    E + L
Sbjct: 23  KRYTRWKKNSKLYYDYLNTNSTKWPSLTCQLFPDLDLATDEHRILLSSFTSSQVPEDESL 82

Query: 72  KIAALD----LP-----------DEIIIGXXXXXXXXXXXXXXXXFAHDGEINRARYMPQ 116
            +A L     +P            E  +                     G+ N+ARY P 
Sbjct: 83  YVARLSSMKHIPWSSLNNFDMEEKEFKVDNSLKLPSKSLVEDLRIKFPAGDCNKARYCPS 142

Query: 117 NTNIIATVNGEGTIFIYDCSR--------------DKQ--SALLSTLKYHKDNAYGLAFN 160
           N ++I + +  G+I+++D ++              D Q    L ++L+ HK+ A  LA+N
Sbjct: 143 NPDLIGSASSNGSIYVFDRTKHGFARQKLISAGDTDHQIHCQLSTSLEEHKNEAVSLAWN 202

Query: 161 PNAEGELISGSDDSTIALWDATNDKLKQP--IQEWTTSHSDI--VNDCQWHCFNTNMFGS 216
              +G L +      + +WD        P  I     S  D    N+  W   + ++   
Sbjct: 203 WQRQGLLATSYSHGQVCVWDLEKYDKNSPTLINPLAMSTVDPRGSNEVSWMVRHDSLLAY 262

Query: 217 VSEDSTLQLFDKRNGGKSDVKISSKGQYNSI---AFSGFSENLFAAAGTTNNIYLYDIRN 273
            SED+ + + D RN  K     S+    N I    F+   + L  +A +   I L+DIRN
Sbjct: 263 CSEDNLVGIMDIRNPEKGQSSGSNPHHSNGINTCQFNYHRDMLLCSADSAGRINLWDIRN 322

Query: 274 TGKILHSMTGHEEPVTSLEFSNDKDGILISGSSDRRVI-MWDLFEIGAEQQPDEADDGLP 332
             + L ++  H + ++ L+++  +  +L +G  D  ++ +WDL       QP+       
Sbjct: 323 FTQPLKTLL-HNDSISVLQWNPREPTVLATGGQDGGLVKIWDL------SQPEGQ----- 370

Query: 333 EVMMIHAGSRSAINDISTHPSIPWLNASVEENNIVQVWKCSSKL 376
           E++  H G    +NDIS  P   W+  SV  +N +QVW+ S+ L
Sbjct: 371 ELIFTHGGHMLGVNDISWDPHDTWMMCSVANDNSIQVWRPSNSL 414

>NCAS0B02170 Chr2 complement(354274..355518) [1245 bp, 414 aa] {ON}
           Anc_8.548
          Length = 414

 Score =  115 bits (288), Expect = 6e-28,   Method: Compositional matrix adjust.
 Identities = 116/423 (27%), Positives = 178/423 (42%), Gaps = 67/423 (15%)

Query: 2   EKVEQQEEPLTVDQEYDLWKSNVPLLYDFVSETRLTWPSLTLQWLPG-DKTSTRQHLILG 60
           E V Q   P  + Q Y  WK N  LLYD+++     WPSLT Q+    D TS    ++L 
Sbjct: 7   EHVPQSSIPEDLQQRYSNWKKNTRLLYDYLNTNSKKWPSLTCQFFHDLDTTSDTHRILLS 66

Query: 61  TLTSG--AETDYLKIAALDL-------------PDEIIIGXXXXXXXXXXXXXXXXFAH- 104
             TS    E + + IA L                DE+                       
Sbjct: 67  AFTSSQLPEDEAIYIAKLSTLKHLEWASINNFDMDEMEFKPENNIKLPSKNLTNDISIRF 126

Query: 105 -DGEINRARYMPQNTNIIATVNGEGTIFIYDCS-----RDKQSALLSTLKY--------- 149
            DG+ N ARY+PQN ++IA  +  G+I+I+D +     R +QS  L   +          
Sbjct: 127 PDGDCNIARYLPQNPDVIAGASSHGSIYIFDRTKHGSLRMRQSKNLKPYEAALYCPPKGI 186

Query: 150 ----HKDNAYGLAFNPNAEGELISGSDDSTIALWDA---TNDKLKQPIQEWTTSHSDI-V 201
               + + A  +++N   EG L S      I LWD    +N KL+            + V
Sbjct: 187 ENVENTNEATSISWNLQREGLLASCYSSGQIQLWDLKKYSNSKLEMDTPLLNVDFDALGV 246

Query: 202 NDCQWHCFNTNMFGSVSEDSTLQLFDKRNGG---KSDVKISSKGQYNSIAFSGFSENLFA 258
           ND  WH  + ++  +  E + + LFD R G    +S+ K+ + G  NS  F+   ++L  
Sbjct: 247 NDVNWHPSHDSILAASGESNIIGLFDNRLGTEILRSNEKMHNGG-INSCKFNSHCDSLLI 305

Query: 259 AAGTTNNIYLYDIRNTG----KILHSMTGHEEPVTSLEFSNDKDGILIS-GSSDRRVIMW 313
           +  +   I L+D+R       K LH    H   +++LE++ + + I+ S G  D  V +W
Sbjct: 306 SGDSEGRINLWDLRKLDGEPIKTLH----HGSSISTLEWNPNLETIVASAGQDDGLVKLW 361

Query: 314 DLFEIGAEQQPDEADDGLPEVMMIHAGSRSAINDISTHPSIPWLNASVEENNIVQVWKCS 373
           D+                 E++  H G    +NDIS +    WL  SV  +N VQVWK +
Sbjct: 362 DV--------------STDELVFTHGGHMLGVNDISWNLHDTWLMCSVSNDNSVQVWKPA 407

Query: 374 SKL 376
             L
Sbjct: 408 HNL 410

>ZYRO0A13068g Chr1 (1032695..1033888) [1194 bp, 397 aa] {ON} similar
           to uniprot|P13712 Saccharomyces cerevisiae YBR195C MSI1
           Subunit of chromatin assembly factor I (CAF- I)
           regulates the RAS/cAMP pathway via sequestration of
           Npr1p kinase localizes to the nucleus and cytoplasm
           homologous to human retinoblastoma binding proteins
           RbAp48 and RbAp46
          Length = 397

 Score =  114 bits (286), Expect = 8e-28,   Method: Compositional matrix adjust.
 Identities = 105/416 (25%), Positives = 180/416 (43%), Gaps = 61/416 (14%)

Query: 1   MEKVEQQEEPLTVDQEYDLWKSNVPLLYDFVSETRLTWPSLTLQWLPGDKTSTRQH-LIL 59
           ME + +  +     Q Y LWK N  LLYD+++     WPSL+ Q+ P   TS+  H L+ 
Sbjct: 1   METIPEDRQ-----QRYTLWKKNTKLLYDYLNTNSFKWPSLSCQFFPDLDTSSDTHRLLF 55

Query: 60  GTLTSG--AETDYLKIAALD----LP---------DEIIIG---XXXXXXXXXXXXXXXX 101
            + TS    + + + IA++     +P         DE+                      
Sbjct: 56  TSFTSSQLPQDENVTIASISTLRHVPWSSLNNFDMDEMEFKPDLSTKLPPKNLQIQLTIN 115

Query: 102 FAHDGEINRARYMPQNTNIIATVNGEGTIFIYDCSRDKQSAL--------LSTLKYHKDN 153
           F H G+ NRA Y+PQN ++I+T + +G+++I+D ++  +S +           L  +  +
Sbjct: 116 FPH-GDCNRATYLPQNPDLISTASSDGSVYIFDRTKRGKSPISHLRGPFEAQLLPNNNGS 174

Query: 154 AYG----LAFNPNAEGELISGSDDSTIALWD-----ATNDKLKQPIQEWTTSHSDIVNDC 204
             G    L +N   EG L S   +  + +WD       N  + QP  ++  + S   ND 
Sbjct: 175 PIGETVALDWNRQIEGILASTYSNGQLCIWDIKKFEKRNPIMSQPSADFIDTESQGFNDV 234

Query: 205 QWHCFNTNMFGSVSEDSTLQLFDKRNGGKSDVKISSKGQYNSIAFSGFSEN---LFAAAG 261
            W   +  +     ED+ + LFD R  G       S    + I  + F+ +   L A A 
Sbjct: 235 SWMPSHDCLLSIAREDNIMTLFDTRTNGNIAQTGPSTNHASGINCTKFNPSQPLLVATAS 294

Query: 262 TTNNIYLYDIRNTGKILHSMTGHEEPVTSLEFSNDKDGILISGSS-DRRVIMWDLFEIGA 320
               + L+DIR     + ++   E P+++LE++     +L +G   D  V +W+      
Sbjct: 295 GDGLVQLWDIRKLHNPIKTINC-ESPLSALEWNPQLPTVLATGGQEDGLVKLWN------ 347

Query: 321 EQQPDEADDGLPEVMMIHAGSRSAINDISTHPSIPWLNASVEENNIVQVWKCSSKL 376
                 A +G  +++  H G    +NDI+  P   WL  SV  +N   +WK +S+L
Sbjct: 348 ------ASNG--QLLFTHGGHMLGVNDIAWSPHDKWLMCSVANDNSTHLWKPASRL 395

>Ecym_7042 Chr7 (86859..88103) [1245 bp, 414 aa] {ON} similar to
           Ashbya gossypii AEL250C
          Length = 414

 Score =  114 bits (284), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 102/406 (25%), Positives = 180/406 (44%), Gaps = 54/406 (13%)

Query: 10  PLTVDQEYDLWKSNVPLLYDFVSETRLTWPSLTLQWLPG-DKTSTRQHLILGTLTSG--- 65
           P  + Q Y  WK N  LLY++++     WPSLT Q++P  D  S +  ++L + TS    
Sbjct: 18  PEPLQQRYTNWKKNTRLLYEYLNTNSTKWPSLTCQFMPDMDIASDKHRILLSSFTSAQLP 77

Query: 66  -------AETDYLK-IAALDLPD------EIIIGXXXXXXXXXXXXXXXXFAHDGEINRA 111
                  +E   +K IA   L +      E  +                 F  +G+ NRA
Sbjct: 78  EDEAIYISEISTMKHIAWSSLNNFHMEEMEFKVDNQVKLSKNLTETIKIQFP-EGDCNRA 136

Query: 112 RYMPQNTNIIATVNGEGTIFIYDCSR---DKQSALLSTLKYHKD----------NAYGLA 158
           RYMPQN ++IA+ +  G+++I+D ++   ++   L +T KY  +           A  LA
Sbjct: 137 RYMPQNPDVIASASSLGSVYIFDRTKHGSNRPKILGNTFKYDMELKEVESGCNYEASSLA 196

Query: 159 FNPNAEGELISGSDDSTIALWDATN-----DKLKQPIQEWTTSHSDIVNDCQWHCFNTNM 213
           +N    G L +   D  + +WD T       +L  P   W     +  N+  W   ++++
Sbjct: 197 WNYQRSGILAASYSDGDVKIWDITKYNKAQPQLTVPDLRWQVD-KEGANEVSWMVHHSSI 255

Query: 214 FGSVSEDSTLQLFDKRNGGKSDVKISS--KGQYNSIAFSGFSENLFAAAGTTNNIYLYDI 271
                E + L + D R       K  S   G  N++ F+  ++ L  +A +   + + DI
Sbjct: 256 LAVCGEGNGLTILDTRTPTTFSTKRHSCHTGGINAVQFNYDNDFLLCSADSEGTLNICDI 315

Query: 272 RNTGKILHSMTGHEEPVTSLEFSNDKDGILIS-GSSDRRVIMWDLFEIGAEQQPDEADDG 330
           R     + + + H + V++++++     ++ S G +D  V +WDL          + DD 
Sbjct: 316 RQLEHPVKTWS-HLDAVSTIQWNPKFPTVIASAGQNDGLVKIWDL---------AQEDDP 365

Query: 331 LPEVMMIHAGSRSAINDISTHPSIPWLNASVEENNIVQVWKCSSKL 376
           L   + IH G    +NDI+ +   PW+  SV  +N V +WK ++ +
Sbjct: 366 L---VFIHGGHMLGVNDIAWNHHDPWVMCSVSNDNSVHIWKPAANI 408

>SAKL0H09900g Chr8 complement(847975..849252) [1278 bp, 425 aa] {ON}
           similar to uniprot|P13712 Saccharomyces cerevisiae
           YBR195C MSI1 Subunit of chromatin assembly factor I
           (CAF- I) regulates the RAS/cAMP pathway via
           sequestration of Npr1p kinase localizes to the nucleus
           and cytoplasm homologous to human retinoblastoma binding
           proteins RbAp48 and RbAp46
          Length = 425

 Score =  114 bits (284), Expect = 3e-27,   Method: Compositional matrix adjust.
 Identities = 110/410 (26%), Positives = 183/410 (44%), Gaps = 58/410 (14%)

Query: 10  PLTVDQEYDLWKSNVPLLYDFVSETRLTWPSLTLQWLPGDKTSTRQH-LILGTLTSGA-- 66
           P  V   Y  WK N  LLYD+++     WPSLT Q+ P   T+  QH L+L + TS    
Sbjct: 27  PEEVQTRYTNWKKNTKLLYDYLNTNSTKWPSLTCQFFPDLDTTNDQHRLLLSSFTSSQLP 86

Query: 67  --ETDYL-KIAALD-LP---------DEI---IIGXXXXXXXXXXXXXXXXFAHDGEINR 110
             E+ Y+ +++ L  LP         DE+   +                  F   G+ N 
Sbjct: 87  EDESIYVSRVSTLKHLPWSSLNNFDMDEMEFKLDNSSKLPSKNLIKELNISFPM-GDCNG 145

Query: 111 ARYMPQNTNIIATVNGEGTIFIYDCSR---------DKQSAL-----LSTLKYHKDNAYG 156
           ARY+PQN ++IA  +  G+I+++D ++         D  S        S+L+ H++    
Sbjct: 146 ARYLPQNPDVIAAASSNGSIYVFDRTKHGLTRQKLHDGGSMFELEFQSSSLEEHQE-VVS 204

Query: 157 LAFNPNAEGELISGSDDSTIALWDATNDKLKQPIQEWT--TSHSDI--VNDCQWHCFNTN 212
           LA+N   EG L +      + +WD        P+ +    T ++D    ND  W   + +
Sbjct: 205 LAWNWQREGLLAACYSGGDVKVWDVKKYSRNFPVIDKADYTHNADPRGCNDVSWMVNHAS 264

Query: 213 MFGSVSEDSTLQLFDKRN-----GGKSDVKISSKGQYNSIAFSGFSENLFAAAGTTNNIY 267
           +     E +++ + D R          D K  S+G  NS  F+  ++ L  +  +T  + 
Sbjct: 265 ILACCGESNSINVIDTRAQKGVLSSTKDTKHHSRG-INSSQFNYHNDMLLCSGDSTGRVN 323

Query: 268 LYDIRNTGKILHSMTGHEEPVTSLEFSNDKDGILISG-SSDRRVIMWDLFEIGAEQQPDE 326
           L+DIR+    L S+  H   ++  +++ +   IL +   SD  V +WD+      Q+P E
Sbjct: 324 LWDIRDLETPLKSL-DHGSSISKTQWNPNLSTILATADQSDGLVKLWDI-----AQEPGE 377

Query: 327 ADDGLPEVMMIHAGSRSAINDISTHPSIPWLNASVEENNIVQVWKCSSKL 376
                 E++ +H G    +NDIS +   PWL  SV  +N VQ+W+ +  L
Sbjct: 378 ------ELLFVHGGHMLGVNDISWNYHDPWLMCSVANDNSVQLWRPARNL 421

>TPHA0L01720 Chr12 (362572..363831) [1260 bp, 419 aa] {ON} Anc_8.548
           YBR195C
          Length = 419

 Score =  113 bits (282), Expect = 3e-27,   Method: Compositional matrix adjust.
 Identities = 104/413 (25%), Positives = 181/413 (43%), Gaps = 70/413 (16%)

Query: 13  VDQEYDLWKSNVPLLYDFVSETRLTWPSLTLQWLPGDKTSTRQH-LILGTLTSG--AETD 69
           + + Y  WK N  LLYD+++     WPSL+ Q+     T    H ++L + TSG   E +
Sbjct: 23  LQERYTHWKKNTRLLYDYLNTNSTKWPSLSCQFFQDVNTKNDSHRILLSSFTSGLMPEQE 82

Query: 70  YLKIAALD----LP---------DEIII---GXXXXXXXXXXXXXXXXFAHDGEINRARY 113
            + I ++     +P         DE+                      F  +G+ NRARY
Sbjct: 83  SINIMSISTLKHVPWASLNNFDMDEMEFKPDNNLKLPPKNLHTEQTITFP-NGDCNRARY 141

Query: 114 MPQNTNIIATVNGEGTIFIYDCSRDKQSALL--------------------STLKYHKDN 153
           +PQN +IIA  + +GT++I++  R K  + L                     ++  + + 
Sbjct: 142 LPQNQDIIAGASSDGTVYIFN--RTKYGSTLRQTSSFQSYQARFAEPENTVQSVDSNPNE 199

Query: 154 AYGLAFNPNAEGELISGSDDSTIALWDATNDKLKQPIQEWTTSHSDIV------NDCQWH 207
           A  + +N   EG L +   D  I  WD    K        TT    I+      ND  W 
Sbjct: 200 ALSIDWNVQREGLLAASYSDGEIKTWDL--KKFSNANTTITTPTVSIMMDTNGANDVTWM 257

Query: 208 CFNTNMFGSVSEDSTLQLFDKRNGGKSDVKISS---KGQYNSIAFSGFSENLFAAAGTTN 264
             + ++  +  E + L ++D R G +    ISS   +   N+  F+  +  + A+A T  
Sbjct: 258 PLHDSLLAACGESNKLIIYDIR-GSREHTTISSGIHEDGINACRFNYANNLIVASADTVG 316

Query: 265 NIYLYDIRNTGKILHSMTGHEEPVTSLEFSNDKDGIL-ISGSSDRRVIMWDLFEIGAEQQ 323
           N++++DIR + +I+ ++  H   ++++E++ + D IL  +G  D  V +WD+ +      
Sbjct: 317 NVHIWDIRKSNEIVKTIP-HGSSISTIEWNPNMDTILATAGQDDGLVKLWDVTD------ 369

Query: 324 PDEADDGLPEVMMIHAGSRSAINDISTHPSIPWLNASVEENNIVQVWKCSSKL 376
                    E++  H G    +NDIS +   PWL  SV  +N VQ+W+ +  L
Sbjct: 370 --------SELIFTHGGHMLGVNDISWNRHDPWLMCSVARDNSVQIWRPAHNL 414

>TDEL0B02980 Chr2 complement(529584..530822) [1239 bp, 412 aa] {ON}
           Anc_8.548 YBR195C
          Length = 412

 Score =  112 bits (280), Expect = 7e-27,   Method: Compositional matrix adjust.
 Identities = 103/406 (25%), Positives = 176/406 (43%), Gaps = 60/406 (14%)

Query: 15  QEYDLWKSNVPLLYDFVSETRLTWPSLTLQWLPGDKTSTRQH-LILGTLTSGA----ETD 69
           Q Y  WK N  LLYD+++     WPSLT ++ P   T+T  H L+L + TS      E+ 
Sbjct: 17  QRYSNWKKNTKLLYDYLNTNSAKWPSLTCEFFPDLDTTTDSHRLLLSSFTSSQLPEDESI 76

Query: 70  YL-KIAAL-----------DLPD-EIIIGXXXXXXXXXXXXXXXXFAHDGEINRARYMPQ 116
           Y+ +I+ L           D+ + E                        G+ NRARY+PQ
Sbjct: 77  YISRISTLKHLHWSSLNNFDMDEMEFKPENSTKLPPRNLTDDISIRIPSGDSNRARYLPQ 136

Query: 117 NTNIIATVNGEGTIFIYDCSRDKQSALLST----------------LKYHKDNAYGLAFN 160
           N ++I+  + +G+I+I+D ++   +   ST                L    +    L +N
Sbjct: 137 NPDVISAASSDGSIYIFDRTKHNSTISRSTTSRPYEIKLEVAPQVELMDSPNEVVSLDWN 196

Query: 161 PNAEGELISGSDDSTIALWDA-----TNDKLKQPIQEWTTSHSDIVNDCQWHCFNTNMFG 215
              EG L S      + +WD      +N  ++ PI           ND  W   + ++  
Sbjct: 197 KRKEGILASCHSRGQLLVWDISQYLHSNPTIQTPICSIDDFDPQGANDITWMPSHDSLLA 256

Query: 216 SVSEDSTLQLFDKRNGGKSDV-KISS---KGQYNSIAFSGFSENLFAAAGTTNNIYLYDI 271
           +  E +T+ ++D R   KS V KI      G  NS  F+  ++ L A+A +   ++++DI
Sbjct: 257 ACGESNTVAIYDTR--SKSQVSKIQPGLHNGGINSCDFNAHNDYLLASADSIGTVHMWDI 314

Query: 272 RNTGKILHSMTGHEEPVTSLEFS-NDKDGILISGSSDRRVIMWDLFEIGAEQQPDEADDG 330
           R   +       H   +++++++ N    I ++G  D  V +WD            A +G
Sbjct: 315 RKLDQDPIQSVSHGSSISTVKWNPNVATIIAVAGQEDGLVKLWD------------ASNG 362

Query: 331 LPEVMMIHAGSRSAINDISTHPSIPWLNASVEENNIVQVWKCSSKL 376
             +++  H G    +NDI+ +   PWL  SV  +N + +W+ SS L
Sbjct: 363 --QLIFTHGGHMLGVNDIAWNAHDPWLMCSVSNDNSIHLWRPSSHL 406

>Kwal_27.12070 s27 (1071472..1072728) [1257 bp, 418 aa] {ON} YBR195C
           (MSI1) - p50 subunit of the yeast Chromatin Assembly
           Factor-I (CAF-I) negative regulator of ras-mediated cAMP
           induction; homologous to beta subunit of GTP-binding
           proteins [contig 24] FULL
          Length = 418

 Score =  107 bits (267), Expect = 4e-25,   Method: Compositional matrix adjust.
 Identities = 102/424 (24%), Positives = 174/424 (41%), Gaps = 84/424 (19%)

Query: 10  PLTVDQEYDLWKSNVPLLYDFVSETRLTWPSLTLQWLPG-DKTSTRQHLILGTLTSGA-- 66
           P    Q Y  WK N  LLY++++     WPSLT Q  P  D       ++L + TS    
Sbjct: 18  PEDRQQRYTHWKKNCKLLYEYLNTNNTKWPSLTCQLFPDLDLAGDEHRILLSSFTSSQLP 77

Query: 67  ------------------------ETDYLKIA---ALDLPDEIIIGXXXXXXXXXXXXXX 99
                                   +TD ++     +L LP + I+               
Sbjct: 78  EDEAIYVARLSSMKHIPWSSLNNFDTDEMEFKMDNSLKLPPKNIVEDLRIKFPA------ 131

Query: 100 XXFAHDGEINRARYMPQNTNIIATVNGEGTIFIYD-----CSRDK-----------QSAL 143
                 G+ N+ARY P N ++I++ +  G+++++D      +R K              L
Sbjct: 132 ------GDCNKARYCPSNPDLISSASSNGSVYVFDRTKHGSARQKLISGGDPDHQIHCQL 185

Query: 144 LSTLKYHKDNAYGLAFNPNAEGELISGSDDSTIALWD-ATNDKLKQPIQEWTTSHSDIV- 201
            ++L+  ++ A  LA+N   +G L +      + +WD A  DK    + +    HS ++ 
Sbjct: 186 STSLEERQNEALNLAWNWQQQGLLATCYSGGEVCVWDLAKYDKASPTLID---PHSSLLA 242

Query: 202 -----NDCQWHCFNTNMFGSVSEDSTLQLFDKRNGGKSDVKISSKGQYNSI---AFSGFS 253
                ND  W   + ++     E + L + D R   +     S+    N +    F+ + 
Sbjct: 243 DPQGSNDISWMVNHDSLLAYCGEGNALGVLDTRITKQPPQSFSNPHHSNGVNACQFNYYK 302

Query: 254 ENLFAAAGTTNNIYLYDIRNTGKILHSMTGHEEPVTSLEFSNDKDGIL-ISGSSDRRVIM 312
           + L  +A +   I L+DIR+    + S+  H   V++L+++     IL  +G  D  V +
Sbjct: 303 DLLLCSADSAGRINLWDIRDFSSPIRSL-DHHGSVSALQWNPHHPTILATAGQDDGLVKI 361

Query: 313 WDLFEIGAEQQPDEADDGLPEVMMIHAGSRSAINDISTHPSIPWLNASVEENNIVQVWKC 372
           WDL       QP +      E+   H G    +NDIS  P+ PW+  SV  +N +Q+WK 
Sbjct: 362 WDL------SQPVDQ-----ELKFTHGGHMLGVNDISWDPNDPWMMCSVSNDNSIQLWKP 410

Query: 373 SSKL 376
           S  L
Sbjct: 411 SQNL 414

>KNAG0A03670 Chr1 complement(472849..474129) [1281 bp, 426 aa] {ON}
           Anc_8.548 YBR195C
          Length = 426

 Score =  106 bits (264), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 104/424 (24%), Positives = 170/424 (40%), Gaps = 71/424 (16%)

Query: 16  EYDLWKSNVPLLYDFVSETRLTWPSLTLQWLPGDKTSTRQHLIL---------------- 59
            Y  WK N  LLYD+++     WPSLT Q+ P    +T  H IL                
Sbjct: 18  RYAYWKKNTKLLYDYLNTNTAKWPSLTCQFFPDVDANTDTHRILLSSYTSCQLPEDENVY 77

Query: 60  -GTLTSGAETDYLKIAALDLPD-EIIIGXXXXXXXXXXXXXXXXFAHDGEINRARYMPQN 117
             ++++ A  D+  +   D+ + E                        G+ NRARYMPQN
Sbjct: 78  VASISTLAHLDWASLNNFDMDEMEFKPDRTTKFPPKNLATNVSITFPRGDCNRARYMPQN 137

Query: 118 TNIIATVNGEGTIFIYDCSRDKQSALLSTLKYHKDNAYG--------------------- 156
            ++IA  +  G +++++ ++     +        +  YG                     
Sbjct: 138 PDVIAAASSNGAVYVFNRTKHGTRRIQKHAASDAEQDYGPYEARFYNEETDEARRTPVDN 197

Query: 157 ----LAFNPNAEGELISGSDDSTIALWDATN---DKLKQPIQEWTTSHSDI--VNDCQWH 207
               LA+N + EG L        + +WD      D       EW  S+ D   VND  W 
Sbjct: 198 EAVSLAWNHHREGTLAVAYSHGAVKVWDLQRFNVDNTTISETEWECSNFDSRGVNDVSWM 257

Query: 208 CFNTNMFGSVSEDS-TLQLFDKRNG---GKSDVKISSKGQYNSIAFSGFSENLFAAAGTT 263
             + ++  +  E S +L LFD R      K   +  S+G  N+  F+  +  L A+  +T
Sbjct: 258 SQHDSILAACGERSDSLALFDTRAQNAVAKIRNQFKSEG-INACKFNWENNLLLASTDST 316

Query: 264 NNIYLYDIRNTGK--ILHSMTGHEEPVTSLEFS-NDKDGILISGSSDRRVIMWDL-FEIG 319
               L+D+R      I+H    H   V++LE++ +D   +  +G SD  + +WD   EI 
Sbjct: 317 GRTNLWDVRKLSAEPIVH--FDHGGSVSTLEWNPHDHSVLATAGQSDGLIKIWDTSLEIE 374

Query: 320 AEQQPDEADDGLPEVMMIHAGSRSAINDISTHPSIPWLNASVEENNIVQVWKCSSKLPRI 379
                        + + +H+G    +NDI+     PWL  SV  +N V VWK ++ L + 
Sbjct: 375 ------------DKTIFVHSGHMLGVNDIAWDLHDPWLMCSVSNDNSVHVWKPAANLVQR 422

Query: 380 SGTP 383
             +P
Sbjct: 423 CTSP 426

>Suva_3.93 Chr3 complement(133524..136286) [2763 bp, 920 aa] {ON}
           YCR057C (REAL)
          Length = 920

 Score = 67.4 bits (163), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 64/250 (25%), Positives = 116/250 (46%), Gaps = 17/250 (6%)

Query: 114 MPQNTNIIATVNGEGTIFIYDCSRDKQ--------SALLSTLKYHKDNAYGLAFNPNAEG 165
           M QN     TVN  G    +  S+  Q         + +   + H D+   LA++P+   
Sbjct: 300 MGQNPVNTVTVNNTGEWLAFGSSKLGQLLVYEWQSESYILKQQGHFDSTNSLAYSPDG-S 358

Query: 166 ELISGSDDSTIALWDATNDKLKQPIQEWTTSHSDIVNDCQWHCFNTNMFGSVSEDSTLQL 225
            +++ SDD  I +WD T+       +E T+S    V   Q+      MF S S D T++ 
Sbjct: 359 RVVTASDDGKIKVWDVTSGFCLATFEEHTSS----VTAVQFAKRGQVMFSS-SMDGTVRA 413

Query: 226 FDK-RNGGKSDVKISSKGQYNSIAFSGFSENLFAAAGTTNNIYLYDIRNTGKILHSMTGH 284
           +D  R         + + Q+N +A     E + A +    +I+++ ++ TG++L +++GH
Sbjct: 414 WDLIRYRNFRTFTGTERIQFNCLAVDPSGEVVCAGSLDNFDIHVWSVQ-TGQLLDALSGH 472

Query: 285 EEPVTSLEFSNDKDGILISGSSDRRVIMWDLFEIGAEQQPDEADDGLPEVMMIHAGSRSA 344
           E PV+ L FS + + +L S S D+ + +W +F    + +P E    +  + M   G   A
Sbjct: 473 EGPVSCLSFSQE-NSVLASASWDKTIRIWSIFGRSQQVEPLEVYSDVLALSMRPDGKEVA 531

Query: 345 INDISTHPSI 354
           ++ +    SI
Sbjct: 532 VSTLKGQISI 541

>Suva_13.311 Chr13 complement(511812..513344) [1533 bp, 510 aa] {ON}
           YMR131C (REAL)
          Length = 510

 Score = 66.2 bits (160), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 88/400 (22%), Positives = 166/400 (41%), Gaps = 54/400 (13%)

Query: 25  PLLYDFVSETRLTWPSLTLQWLPGDKTSTR----QHLILGTLTSGA---ETDYLKIAALD 77
           P +Y+ +    + WP LTL  +P    + R    Q ++L T T  +   E + + +A  +
Sbjct: 114 PTVYEMLHNVNMPWPCLTLDVIPDTLGTERRNYPQSILLTTATQSSRKKENELMVLALSN 173

Query: 78  LPDEIIIGXXXXXXXXXXXXXXXXFAHDGE-------INRARYMP---QNTNII-ATVNG 126
           L   ++                     + E        NR +  P    N  ++ AT++ 
Sbjct: 174 LTKTLLKDDNEEDDEEGEDEEDVDPVIENENIPLRDTTNRLKVSPFAVSNQEVLTATMSE 233

Query: 127 EGTIFIYDCSRDKQS-------------ALLSTLKYHKD-NAYGLAFNPNAE-GELISGS 171
            G ++IYD +   ++               + T+K H +   YGL ++P  + G L+SG 
Sbjct: 234 NGDVYIYDLAAQSKAFSTPGYQIPKSAKRPIHTVKNHGNVEGYGLDWSPLIKTGALLSGD 293

Query: 172 DDSTIALWDATNDKLKQPIQEWTTSHSDIVNDCQWHCFNTNMFGSVSEDSTLQLFDKRNG 231
               I L      +     Q +T S+++ + D QW    + +F + + D  ++++D R+ 
Sbjct: 294 CSGQIYLTQRHTSRWVTDKQSFTVSNNESIEDIQWSRTESTVFATAACDGYIRIWDTRS- 352

Query: 232 GKSDVKISSKGQYNSIAFSGFSENL--FAAAGTTNNIY-LYDIR-------NTGKILHSM 281
            K    IS K     +    +S+ +    A+G  N  + ++D+R       +T + +   
Sbjct: 353 KKHKPAISVKASNTDVNVISWSDKIGYLLASGDDNGTWGVWDLRQFTPSNADTVQPVAQY 412

Query: 282 TGHEEPVTSLEFSNDKDGILISGSSDRRVIMWDL-FEIGAEQ------QPDEADDGLPEV 334
             H+  +TS+ F+   + I+  GS D  V +WDL  E   E+      +  E  D  P++
Sbjct: 413 DFHKGAITSIAFNPLDESIVAVGSEDNTVTLWDLSVEADDEEIKQQAAETKELQDIPPQL 472

Query: 335 MMIHAGSRSAINDISTHPSIPWLNASVEENNIVQVWKCSS 374
           + +H   +  + D+  H  IP    S   + +  VWK  S
Sbjct: 473 LFVHW--QREVKDVKWHKQIPGCLVSTGTDGL-NVWKTIS 509

>Smik_3.157 Chr3 complement(218522..221296) [2775 bp, 924 aa] {ON}
           YCR057C (REAL)
          Length = 924

 Score = 65.5 bits (158), Expect = 9e-11,   Method: Compositional matrix adjust.
 Identities = 55/206 (26%), Positives = 102/206 (49%), Gaps = 9/206 (4%)

Query: 150 HKDNAYGLAFNPNAEGELISGSDDSTIALWDATNDKLKQPIQEWTTSHSDIVNDCQWHCF 209
           H D+   LA++P+    +++ SDD  I +WD T+       +E T+S    V   Q+   
Sbjct: 342 HFDSTNSLAYSPDG-SRVVTASDDGKIKVWDITSGFCLATFEEHTSS----VTAVQFAKR 396

Query: 210 NTNMFGSVSEDSTLQLFDK-RNGGKSDVKISSKGQYNSIAFSGFSENLFAAAGTTNNIYL 268
              MF S S D T++ +D  R         + + Q+N +A     E + A +    +I++
Sbjct: 397 GQVMFSS-SLDGTVRAWDLIRYRNFRTFTGTERIQFNCLAVDPSGEVVCAGSLDNFDIHV 455

Query: 269 YDIRNTGKILHSMTGHEEPVTSLEFSNDKDGILISGSSDRRVIMWDLFEIGAEQQPDEAD 328
           + ++ TG++L +++GHE PV+ L FS + + +L S S D+ + +W +F    + +P E  
Sbjct: 456 WSVQ-TGQLLDALSGHEGPVSCLSFSQE-NSVLASASWDKTIRIWSIFGRSQQVEPLEVY 513

Query: 329 DGLPEVMMIHAGSRSAINDISTHPSI 354
             +  + M   G   A++ +    SI
Sbjct: 514 SDVLALSMRPDGKEVAVSTLKGQISI 539

>Skud_3.133 Chr3 complement(204741..207488) [2748 bp, 916 aa] {ON}
           YCR057C (REAL)
          Length = 916

 Score = 65.1 bits (157), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 55/206 (26%), Positives = 102/206 (49%), Gaps = 9/206 (4%)

Query: 150 HKDNAYGLAFNPNAEGELISGSDDSTIALWDATNDKLKQPIQEWTTSHSDIVNDCQWHCF 209
           H D+   LA++P+    +++ SDD  I +WD T+       +E T+S    V   Q+   
Sbjct: 339 HFDSTNCLAYSPDG-SRVVTASDDGKIKVWDITSGFCLATFEEHTSS----VTAVQFAKR 393

Query: 210 NTNMFGSVSEDSTLQLFDK-RNGGKSDVKISSKGQYNSIAFSGFSENLFAAAGTTNNIYL 268
              MF S S D T++ +D  R         + + Q+N +A     E + A +    +I++
Sbjct: 394 GQVMFSS-SLDGTVRAWDLIRYRNFRTFTGTERIQFNCLAVDPSGEVVCAGSLDNFDIHV 452

Query: 269 YDIRNTGKILHSMTGHEEPVTSLEFSNDKDGILISGSSDRRVIMWDLFEIGAEQQPDEAD 328
           + ++ TG++L +++GHE PV+ L FS + + +L S S D+ + +W +F    + +P E  
Sbjct: 453 WSVQ-TGQLLDALSGHEGPVSCLSFSQE-NSVLASASWDKTIRIWSIFGRSQQVEPLEVY 510

Query: 329 DGLPEVMMIHAGSRSAINDISTHPSI 354
             +  + M   G   A++ +    SI
Sbjct: 511 SDVLALSMRPDGKEVAVSTLKGQISI 536

>YCR057C Chr3 complement(220457..223228) [2772 bp, 923 aa] {ON}
           PWP2Conserved 90S pre-ribosomal component essential for
           proper endonucleolytic cleavage of the 35 S rRNA
           precursor at A0, A1, and A2 sites; contains eight
           WD-repeats; PWP2 deletion leads to defects in cell cycle
           and bud morphogenesis
          Length = 923

 Score = 64.3 bits (155), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 54/206 (26%), Positives = 102/206 (49%), Gaps = 9/206 (4%)

Query: 150 HKDNAYGLAFNPNAEGELISGSDDSTIALWDATNDKLKQPIQEWTTSHSDIVNDCQWHCF 209
           H D+   LA++P+    +++ S+D  I +WD T+       +E T+S    V   Q+   
Sbjct: 344 HFDSTNSLAYSPDG-SRVVTASEDGKIKVWDITSGFCLATFEEHTSS----VTAVQFAKR 398

Query: 210 NTNMFGSVSEDSTLQLFDK-RNGGKSDVKISSKGQYNSIAFSGFSENLFAAAGTTNNIYL 268
              MF S S D T++ +D  R         + + Q+N +A     E + A +    +I++
Sbjct: 399 GQVMFSS-SLDGTVRAWDLIRYRNFRTFTGTERIQFNCLAVDPSGEVVCAGSLDNFDIHV 457

Query: 269 YDIRNTGKILHSMTGHEEPVTSLEFSNDKDGILISGSSDRRVIMWDLFEIGAEQQPDEAD 328
           + ++ TG++L +++GHE PV+ L FS + + +L S S D+ + +W +F    + +P E  
Sbjct: 458 WSVQ-TGQLLDALSGHEGPVSCLSFSQE-NSVLASASWDKTIRIWSIFGRSQQVEPIEVY 515

Query: 329 DGLPEVMMIHAGSRSAINDISTHPSI 354
             +  + M   G   A++ +    SI
Sbjct: 516 SDVLALSMRPDGKEVAVSTLKGQISI 541

>Skud_13.291 Chr13 complement(506764..508293) [1530 bp, 509 aa] {ON}
           YMR131C (REAL)
          Length = 509

 Score = 63.9 bits (154), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 86/399 (21%), Positives = 163/399 (40%), Gaps = 53/399 (13%)

Query: 25  PLLYDFVSETRLTWPSLTLQWLPGDKTSTR----QHLILGTLTSGA---ETDYLKIAALD 77
           P +Y+ +    + WP LTL  +P    S R    Q ++L T T  +   E + + +A  +
Sbjct: 114 PSVYEMLHNVNMPWPCLTLDVIPDTLGSERRNYPQSILLATATQSSRKRENELMVLALSN 173

Query: 78  LPDEIIIGXXXXXXXXXXXXXXXXFAHDGEI------NRARYMP---QNTNII-ATVNGE 127
           L   ++                     +  +      NR +  P    N  ++ AT++  
Sbjct: 174 LTKTLLKDDNEEDDDEEEEDDVDAVIENENMPLKDTTNRLKVSPFAASNQEVLTATMSEN 233

Query: 128 GTIFIYDCSRDKQS-------------ALLSTLKYHKD-NAYGLAFNPNAE-GELISGSD 172
           G ++IYD +   ++               + T+K H +   YGL ++P  + G L+SG  
Sbjct: 234 GDVYIYDLAPQSKAFSTPGYQISKSAKRPIHTVKSHGNVEGYGLDWSPLIKTGALLSGDC 293

Query: 173 DSTIALWDATNDKLKQPIQEWTTSHSDIVNDCQWHCFNTNMFGSVSEDSTLQLFDKRNGG 232
              I        +     Q +T S++  + D QW    + +F +   D  ++++D R+  
Sbjct: 294 SGQIYFTQRHTSRWVTDKQPFTVSNNKSIEDIQWSRTESTVFATAGCDGYIRIWDTRS-K 352

Query: 233 KSDVKISSKGQYNSIAFSGFSENL--FAAAGTTNNIY-LYDIR-------NTGKILHSMT 282
           K    IS K     +    +S+ +    A+G  N  + ++D+R       +T + +    
Sbjct: 353 KHKPAISVKASNTDVNVISWSDKIGYLLASGDDNGTWGVWDLRQFTPSNADTVQPVAQYD 412

Query: 283 GHEEPVTSLEFSNDKDGILISGSSDRRVIMWDL-FEIGAEQ------QPDEADDGLPEVM 335
            H+  +TS+ F+   + I+  GS D  V +WDL  E   E+      +  E  +  P+++
Sbjct: 413 FHKGAITSIAFNPLDESIVAVGSEDNTVTLWDLSVEADDEEIKQQTAETKELQEIPPQLL 472

Query: 336 MIHAGSRSAINDISTHPSIPWLNASVEENNIVQVWKCSS 374
            +H   +  + D+  H  IP    S   + +  VWK  S
Sbjct: 473 FVHW--QKEVKDVKWHKQIPGCLVSTGTDGL-NVWKTIS 508

>AAR057W Chr1 (442821..445589) [2769 bp, 922 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YCR057C (PWP2)
          Length = 922

 Score = 63.2 bits (152), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 59/222 (26%), Positives = 107/222 (48%), Gaps = 17/222 (7%)

Query: 150 HKDNAYGLAFNPNAEGELISGSDDSTIALWDATNDKLKQPIQEWTTSHSDIVNDCQWHCF 209
           H D    LA++P+    +++ ++D  I +WD  +       +E T+S    V   Q+   
Sbjct: 355 HFDALNALAYSPDG-ARIVTAAEDGKIKIWDIVSGFCLATFEEHTSS----VTSVQFAKN 409

Query: 210 NTNMFGSVSEDSTLQLFD-KRNGGKSDVKISSKGQYNSIAFSGFSENLFAAAGTTNNIYL 268
              MF S S D T++ +D  R         + + Q++ +A     E     AG+ +N   
Sbjct: 410 GQIMFSS-SLDGTVKAWDLMRFRNFRTFTATERIQFSCLAADPTGE--VVCAGSLDN--- 463

Query: 269 YDIR----NTGKILHSMTGHEEPVTSLEFSNDKDGILISGSSDRRVIMWDLFEIGAEQQP 324
           YDI+     TG++L +++GHE PV+ L FS + + IL S S D+ + +W +F    + +P
Sbjct: 464 YDIQVWSVQTGQLLDTLSGHEGPVSCLSFSRE-NSILASASWDKTIRVWSIFGRSQQVEP 522

Query: 325 DEADDGLPEVMMIHAGSRSAINDISTHPSIPWLNASVEENNI 366
            EA   + ++ M   G + A++ ++   S   +  S +  NI
Sbjct: 523 IEAYSDVLDISMRPDGKQVAVSTLNGQLSFFDVETSRQVGNI 564

>KNAG0I02540 Chr9 (489509..492265) [2757 bp, 918 aa] {ON} Anc_6.325
           YCR057C
          Length = 918

 Score = 62.4 bits (150), Expect = 9e-10,   Method: Compositional matrix adjust.
 Identities = 58/221 (26%), Positives = 105/221 (47%), Gaps = 19/221 (8%)

Query: 114 MPQNTNIIATVNGEGTIFIYDCSRDKQ--------SALLSTLKYHKDNAYGLAFNPNAEG 165
           M QN     TVN  G    +  S+  Q         + +   + H D+   L ++P+   
Sbjct: 296 MGQNPVNTVTVNSTGEWLAFGSSKLGQLLVYEWQSESYILKQQGHFDSTNSLTYSPDGS- 354

Query: 166 ELISGSDDSTIALWDATNDKLKQPIQEWTTSHSDIVNDCQWHCFNTNMFGSVSEDSTLQL 225
            +++ ++D  I +WD  +      + E    H+  V   Q+      +F S S D T++ 
Sbjct: 355 RVVTAAEDGKIKVWDVVSGFCLATLDE----HTAAVTQVQFAKKGQVLF-SASLDGTVKA 409

Query: 226 FDK-RNGGKSDVKISSKGQYNSIAFSGFSENLFAAAGTTNNIYLYDIRNTGKILHSMTGH 284
           +D  R         + + Q+NS+A     E + A +    +I+++ ++ TG++L S++GH
Sbjct: 410 WDLIRYRNFRVFTAAERIQFNSLAVDPSGEVVCAGSMDNFDIHVWSVQ-TGQLLDSLSGH 468

Query: 285 EEPVTSLEFSNDKDGILISGSSDRRVIMWDLFEIGAEQQPD 325
           E PV+ L FS + +G+L S S D+ + +W +F  G  QQ D
Sbjct: 469 EGPVSCLAFSQE-NGVLASASWDKTIRIWYIF--GRSQQVD 506

>KLLA0C08976g Chr3 (784536..787271) [2736 bp, 911 aa] {ON} highly
           similar to uniprot|P25636 Saccharomyces cerevisiae
           YCR057C PWP2 part of small (ribosomal) subunit (SSU)
           processosome (contains U3 snoRNA) Eight WD-repeats with
           homology with G protein beta subunits flanked by
           nonhomologous N-terminal and C-terminal extensions
           regulatory protein
          Length = 911

 Score = 62.4 bits (150), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 49/201 (24%), Positives = 102/201 (50%), Gaps = 9/201 (4%)

Query: 150 HKDNAYGLAFNPNAEGELISGSDDSTIALWDATNDKLKQPIQEWTTSHSDIVNDCQWHCF 209
           H D   GL ++P+   ++++ S +  I +WD  +        E    H+  V+  ++   
Sbjct: 340 HFDTLNGLCYSPDGS-KIVTASHEGKIKIWDVASGFCLATFDE----HAGGVSAVEFAKK 394

Query: 210 NTNMFGSVSEDSTLQLFDK-RNGGKSDVKISSKGQYNSIAFSGFSENLFAAAGTTNNIYL 268
              +F S S D T++ +D  R         + + Q+NS+A     E + A +  + +I++
Sbjct: 395 GQVLF-SASLDGTVKAWDLIRYRNFRTFTATERIQFNSLAVDPSGEVVCAGSEDSFDIFV 453

Query: 269 YDIRNTGKILHSMTGHEEPVTSLEFSNDKDGILISGSSDRRVIMWDLFEIGAEQQPDEAD 328
           + ++ TG+++ +++GHE P++ L FSN+ +G+L S S D+ + +W LF    + +P E  
Sbjct: 454 WSVQ-TGQLVDTLSGHEGPISCLSFSNE-NGVLASASWDKTIRVWSLFGRSQQVEPFEVF 511

Query: 329 DGLPEVMMIHAGSRSAINDIS 349
             +  + M   G + A + ++
Sbjct: 512 SDVLSISMKPDGQQIAASTLA 532

>TDEL0A06890 Chr1 (1202790..1204133) [1344 bp, 447 aa] {ON}
           Anc_6.276 YPL247C Two N bases added to fix a frameshift
           that can't be corrected using the reads.
          Length = 447

 Score = 61.6 bits (148), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 52/222 (23%), Positives = 93/222 (41%), Gaps = 24/222 (10%)

Query: 159 FNPNAEGELISGSDDSTIALWDATNDKLKQPIQEWTTSHSDIVNDCQWHCFNTNMFGSVS 218
           +NP     LIS S D+T  +WD  +      I+    +H   V D ++   +T +F S  
Sbjct: 218 WNPTDPNLLISSSIDTTCIVWDLQSANY---IKTQLIAHDSEVFDVRFLTQSTQLFASCG 274

Query: 219 EDSTLQLFDKR--------------NGGKSDVKISSKGQYNSIAFSGFSENLFAA-AGTT 263
            D ++++FD R              +G       +       +  S F  N+ A  A  +
Sbjct: 275 GDGSVRVFDLRCLAHSTIIYEPTIPDGAPDLPSPTVPPALLRLEPSPFDPNVIATFAIDS 334

Query: 264 NNIYLYDIRNTGKILHSMTGHEEPVTSLEFSNDKDGILISGSSDRRVIMWDL-FEIGAEQ 322
           + + + D+R+ G  L ++  H  P+  +++   +  +L+S S D +V+ WDL   + +E 
Sbjct: 335 SKVLILDMRSPGSPLLTLEAHTAPINQIKWHPTRRNVLLSASDDCQVLYWDLNTHLDSES 394

Query: 323 QPDEADDGLPE-----VMMIHAGSRSAINDISTHPSIPWLNA 359
             D   D  P+       M +A     +N+I   P   W  A
Sbjct: 395 TKDTTPDSQPDSTVQKPAMFYASGGQEVNNIVWRPQGDWFGA 436

 Score = 39.3 bits (90), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 35/140 (25%), Positives = 63/140 (45%), Gaps = 19/140 (13%)

Query: 102 FAHDGEINRARYMPQNTNIIATVNGEGTIFIYDCSRDKQSALLSTLKYH---KDNAYGLA 158
            AHD E+   R++ Q+T + A+  G+G++ ++D     +    ST+ Y     D A  L 
Sbjct: 251 IAHDSEVFDVRFLTQSTQLFASCGGDGSVRVFDL----RCLAHSTIIYEPTIPDGAPDLP 306

Query: 159 FNPNAEGELI----SGSDDSTIALWDATNDK-----LKQPIQEWTT--SHSDIVNDCQWH 207
            +P     L+    S  D + IA +   + K     ++ P     T  +H+  +N  +WH
Sbjct: 307 -SPTVPPALLRLEPSPFDPNVIATFAIDSSKVLILDMRSPGSPLLTLEAHTAPINQIKWH 365

Query: 208 CFNTNMFGSVSEDSTLQLFD 227
               N+  S S+D  +  +D
Sbjct: 366 PTRRNVLLSASDDCQVLYWD 385

>Smik_13.329 Chr13 complement(515612..517141) [1530 bp, 509 aa] {ON}
           YMR131C (REAL)
          Length = 509

 Score = 61.6 bits (148), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 85/399 (21%), Positives = 163/399 (40%), Gaps = 53/399 (13%)

Query: 25  PLLYDFVSETRLTWPSLTLQWLPGDKTSTR----QHLILGTLTSGA---ETDYLKIAALD 77
           P +Y+ +    + WP LTL  +P    S R    Q ++L T T  +   E + + +A  +
Sbjct: 114 PTVYEMLHNVNMPWPCLTLDVIPDTLGSERRNYPQSILLTTATQSSRKKENELMVLALSN 173

Query: 78  LPDEIIIGXXXXXXXXXXXXXXXXFAHDGEI------NRARYMP---QNTNII-ATVNGE 127
           L   ++                     +  I      NR +  P    N  ++ AT++  
Sbjct: 174 LTKTLLKDENEEEDEEEDDDDIDPIIENENIPLRDTTNRLKVSPFAVSNQEVLTATMSEN 233

Query: 128 GTIFIYDCSRDKQSAL-------------LSTLKYHKD-NAYGLAFNPNAE-GELISGSD 172
           G ++IYD +   ++               + T+K H +   YGL ++P  + G L+SG  
Sbjct: 234 GDVYIYDLAPQSKAFATPGYQIPKSAKRPIHTVKNHGNVEGYGLDWSPLIKTGSLLSGDC 293

Query: 173 DSTIALWDATNDKLKQPIQEWTTSHSDIVNDCQWHCFNTNMFGSVSEDSTLQLFDKRNGG 232
              +        +     Q +T S++  + D QW    + +F +   D  ++++D R+  
Sbjct: 294 SGQVYFTQRHTSRWVTDKQPFTVSNNKSIEDIQWSRSESTVFATAGCDGYIRIWDTRS-K 352

Query: 233 KSDVKISSKGQYNSIAFSGFSENL--FAAAGTTNNIY-LYDIR-------NTGKILHSMT 282
           K    IS K     +    +S+ +    A+G  N  + ++D+R       ++ + +    
Sbjct: 353 KHKPAISVKASNTDVNVISWSDKIGYLLASGDDNGTWGVWDLRQFTPSNADSVQPVAQYD 412

Query: 283 GHEEPVTSLEFSNDKDGILISGSSDRRVIMWDL-FEIGAEQ------QPDEADDGLPEVM 335
            H+  +TS+ F+   + I+  GS D  V +WDL  E   E+      +  E  +  P+++
Sbjct: 413 FHKGAITSIAFNPLDESIVAVGSEDNTVTLWDLSVEADDEEIKQQTAETKELQEIPPQLL 472

Query: 336 MIHAGSRSAINDISTHPSIPWLNASVEENNIVQVWKCSS 374
            +H   +  + D+  H  IP    S   + +  VWK  S
Sbjct: 473 FVHW--QKEVKDVKWHKQIPGCLVSTGTDGL-NVWKTIS 508

>Ecym_2093 Chr2 (165578..168349) [2772 bp, 923 aa] {ON} similar to
           Ashbya gossypii AAR057W
          Length = 923

 Score = 61.6 bits (148), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 51/206 (24%), Positives = 98/206 (47%), Gaps = 9/206 (4%)

Query: 150 HKDNAYGLAFNPNAEGELISGSDDSTIALWDATNDKLKQPIQEWTTSHSDIVNDCQWHCF 209
           H D    LA++P+    +++ S D  I +WD  +       +E    H   V   Q+   
Sbjct: 356 HFDTMNDLAYSPDG-SRIVTASSDGKIKIWDIVSGFCLATFEE----HVSAVTAVQFAKK 410

Query: 210 NTNMFGSVSEDSTLQLFDK-RNGGKSDVKISSKGQYNSIAFSGFSENLFAAAGTTNNIYL 268
              MF S   D T++ +D  R         + + Q+N +A     E + A +    NI++
Sbjct: 411 GQIMF-SACLDGTVKAWDLIRYRNFRTFTATERIQFNCLAVDPSGEIVCAGSLDDFNIHV 469

Query: 269 YDIRNTGKILHSMTGHEEPVTSLEFSNDKDGILISGSSDRRVIMWDLFEIGAEQQPDEAD 328
           + ++ TG++L +++GHE PV+ L FSN+ + +L S S D+ + +W +F    + +P E  
Sbjct: 470 WSVQ-TGQLLDTLSGHEGPVSCLSFSNE-NSVLASASWDKTIRIWSIFGRSQQVEPIEVF 527

Query: 329 DGLPEVMMIHAGSRSAINDISTHPSI 354
             +  + M   G + +++ ++   S 
Sbjct: 528 SDVLAISMRPDGKQVSVSTLNGQISF 553

>CAGL0K03861g Chr11 complement(360277..361818) [1542 bp, 513 aa]
           {ON} highly similar to uniprot|Q04225 Saccharomyces
           cerevisiae YMR131c Ribosome assembly protein
          Length = 513

 Score = 60.8 bits (146), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 82/379 (21%), Positives = 158/379 (41%), Gaps = 51/379 (13%)

Query: 25  PLLYDFVSETRLTWPSLTLQWLPGDKTSTR----QHLILGTLTSGAETDYLKIAALDLPD 80
           P +Y+ +    + WP L+L  +P    S R    Q +++ T T  ++    ++  L L +
Sbjct: 119 PTVYEMLHNVNMPWPCLSLDIIPDTLGSERRNYPQSILMTTATQASKKKENELMVLSLSN 178

Query: 81  --EIIIGXXXXXXXXXXXXXXXXFAHDGEI------NRARYMP---QNTNII-ATVNGEG 128
             + ++                    +  I      NR +  P   Q+  ++ AT++  G
Sbjct: 179 LTKTLLKDEEEEEEEEDDDDVEPIIENENIALRDTTNRIKVSPFASQSQEVLTATMSENG 238

Query: 129 TIFIYDCSRD------------KQSAL-LSTLKYHKD-NAYGLAFNPNAE-GELISGSDD 173
            ++I+D                KQS   + T++ H +   YGL ++P  + G L+SG   
Sbjct: 239 EVYIFDIGAQAKCFNSPGYQIPKQSKRPVHTIRNHGNVEGYGLDWSPLIKSGALLSGDCS 298

Query: 174 STIALWDATNDKLKQPIQEWTTSHSDIVNDCQWHCFNTNMFGSVSEDSTLQLFDKRNGGK 233
             I L      K     Q ++  ++  + D QW    + +F +   D  ++++D R+  K
Sbjct: 299 GQIYLTQRHTSKWVTDKQAYSVGNNKSIEDIQWSKTESTVFATAGCDGYIRVWDTRSK-K 357

Query: 234 SDVKISSKGQYNSIAFSGFSENL--FAAAGTTNNIY-LYDIR-----NTGKI--LHSMTG 283
               IS K     +    ++E +    A+G  N  + ++D+R     N   I  +     
Sbjct: 358 HKPAISVKASNTDVNVISWNEKIGYLLASGDDNGSWGVWDLRQFTPDNAANIQPVAQYNF 417

Query: 284 HEEPVTSLEFSNDKDGILISGSSDRRVIMWDLF------EIGAE-QQPDEADDGLPEVMM 336
           H+  +TS+ F+  ++ I+  GS D  V +WDL       EI  + ++  E  +  P+++ 
Sbjct: 418 HKGAITSIAFNPLEESIVAVGSEDNTVTLWDLSVEADDEEIKQQTEETKELKEIPPQLLF 477

Query: 337 IHAGSRSAINDISTHPSIP 355
           +H   +  I D+  H  IP
Sbjct: 478 VHW--QKEIKDVKWHKQIP 494

>NCAS0D04610 Chr4 (881005..882552) [1548 bp, 515 aa] {ON} Anc_6.340
          Length = 515

 Score = 60.8 bits (146), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 47/178 (26%), Positives = 84/178 (47%), Gaps = 15/178 (8%)

Query: 145 STLKYHKDNAYGLAFNPNAEGELISGSDDSTIALWDATNDKLKQPIQEWTTSHSDIVNDC 204
           S +  H       AF PN    +++G+ D+T  +WD      K  +    T H + V  C
Sbjct: 137 SAIAGHGSTILCSAFAPNTSSRMVTGAGDNTARIWDCDTQTPKATL----TGHFNWVL-C 191

Query: 205 QWHCFNTNMFGSVSEDSTLQLFDKRNGG------KSDVKISSKGQYNSIAFSGFSEN-LF 257
             +C N  +  + S D+T++L+D ++G       +  +K  +   +  I      E+   
Sbjct: 192 VSYCPNGEVIATGSMDNTIRLWDSKDGKPLGDALRGHLKWITSLAWEPIHLVKPGESPRL 251

Query: 258 AAAGTTNNIYLYDIRNTGKILHSMTGHEEPVTSLEFSNDKDGILISGSSDRRVIMWDL 315
           A+A     I ++DI      L++M+GH   V+ +++S    GI+ SGS D+ V +WD+
Sbjct: 252 ASASKDGTIRIWDITRR-VCLYTMSGHTNSVSCIKWSG--QGIIYSGSHDKTVRVWDM 306

 Score = 51.6 bits (122), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 51/206 (24%), Positives = 90/206 (43%), Gaps = 26/206 (12%)

Query: 115 PQNTNIIATVNGEGTIFIYDCSRDKQSALLSTLKYHKDNAYGLAFNPNAEGELISGSDDS 174
           P  +  +A+ + +GTI I+D +R      L T+  H ++   + ++   +G + SGS D 
Sbjct: 245 PGESPRLASASKDGTIRIWDITR---RVCLYTMSGHTNSVSCIKWS--GQGIIYSGSHDK 299

Query: 175 TIALWDATNDKLKQPIQEWTTSHSDIVNDCQWHCFNTNMFGSVSEDSTLQL--FD---KR 229
           T+ +WD   D                +N  + H    N   S+S D  L++  FD    +
Sbjct: 300 TVRVWDMNAD-------------GKCINILKSHAHWVNHL-SLSTDYALRVGAFDHTGAQ 345

Query: 230 NGGKSDVKISSKGQYNSIAF-SGFSENLFAAAGTTNNIYLYDIRNTGKILHSMTGHEEPV 288
                D +  +   Y  +   +G  E L   A     ++L++   + K +  MTGH++ V
Sbjct: 346 PASAKDARDKALANYEKVVKKNGKLEELMVTASDDFTMFLWNPLKSNKPIARMTGHQKLV 405

Query: 289 TSLEFSNDKDGILISGSSDRRVIMWD 314
             + FS D   I +S S D  + +WD
Sbjct: 406 NHVAFSPDGRYI-VSASFDNSIKLWD 430

 Score = 32.7 bits (73), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 22/84 (26%), Positives = 43/84 (51%), Gaps = 5/84 (5%)

Query: 103 AHDGEINRARYMPQNTNIIATVNGEGTIFIYDCSRDKQSALLSTLKYHKDNAYGLAFNPN 162
            H   +N   + P    I+ + + + +I ++D  RD +   +ST + H  + Y +A++ +
Sbjct: 400 GHQKLVNHVAFSPDGRYIV-SASFDNSIKLWD-GRDGK--FISTFRGHVASVYQVAWSAD 455

Query: 163 AEGELISGSDDSTIALWDATNDKL 186
               L+S S D+T+ +WD    KL
Sbjct: 456 CR-LLVSCSKDTTLKVWDVRTRKL 478

>KAFR0H02450 Chr8 complement(468767..470020) [1254 bp, 417 aa] {ON}
           Anc_8.672 YPL151C
          Length = 417

 Score = 60.5 bits (145), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 64/216 (29%), Positives = 104/216 (48%), Gaps = 26/216 (12%)

Query: 157 LAFNPNAEGELISGSDDSTIALWDATNDKLKQPIQEWTTSHSDIVNDCQWHCFNTNMFGS 216
           +A +P       +GS+DSTI +WD  + KLK  +    + H   V D      +  MF S
Sbjct: 114 IAMDPVDNEWFATGSNDSTIKVWDFASGKLKLTL----SGHVMGVRDLVVSKRHPYMF-S 168

Query: 217 VSEDSTLQLFD-KRNGGKSDVKISSKGQYNSIAFSGFSENLFAAAGTTNNIYLYDIRNTG 275
            SED  ++ +D ++N    D      G +        S  L A+AG  + + L+DIR+  
Sbjct: 169 ASEDKLVKCWDLEKNAPIRDYFGHLSGVHTVDIHPTLS--LIASAGRDSVVKLWDIRSKK 226

Query: 276 KILHSMTGHEEPVTSLEFSNDKDGILISGSSDRRVIMWDLFEIGAEQQPDEADDGLPEVM 335
            ++ ++ GH+ P+ S++ +   D  +IS S+D  VI WDL  + A+          P  +
Sbjct: 227 AVI-TLVGHKSPINSVKCT-PADPQIISCSNDTTVITWDL--VAAK----------PMKV 272

Query: 336 MIHAGSRSAINDISTHPSIPWLNASVEENNIVQVWK 371
           + H   R A+ DI+ HP   +  AS   N+I + WK
Sbjct: 273 ITH--HRKAVRDIAVHPG-EFSVASCSTNDI-RSWK 304

>KNAG0I02840 Chr9 (554645..556204) [1560 bp, 519 aa] {ON} Anc_6.340
           YCR072C
          Length = 519

 Score = 60.1 bits (144), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 56/200 (28%), Positives = 95/200 (47%), Gaps = 24/200 (12%)

Query: 121 IATVNGEGTIFIYDCSRDKQSALLSTLKYHKDNAYGLAFNPNAEGELISGSDDSTIALWD 180
           +A+ + +GTI I+D +R      L TL  H ++   + +    EG L SGS D T+ +WD
Sbjct: 253 LASASKDGTIKIWDTAR---RVCLYTLSGHSNSVACVKWG--GEGLLYSGSHDKTVRVWD 307

Query: 181 ATNDKLKQPIQEWTTSHSDIVNDCQWHCFNTNMFGSVSEDSTLQL--FDK---RNGGKSD 235
             +  + + I       S + N   W     N   S+S D  L++  FD    +    ++
Sbjct: 308 MNSATVGKCI-------SILKNHAHW----VNHL-SLSTDYALRIGPFDHTGVKPSTPAE 355

Query: 236 VKISSKGQYNSIA-FSGFSENLFAAAGTTNNIYLYDIRNTGKILHSMTGHEEPVTSLEFS 294
            K  ++  Y+ +A  +G +E L   A     ++L++ +   K L  MTGH++ V  + FS
Sbjct: 356 AKRRAQANYDKVAKRNGSAEELMVTASDDFTMFLWNPKKLTKPLARMTGHQKLVNHVAFS 415

Query: 295 NDKDGILISGSSDRRVIMWD 314
            D   I +S S D  + +WD
Sbjct: 416 PDGRYI-VSASFDNSIKLWD 434

 Score = 45.1 bits (105), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 42/184 (22%), Positives = 80/184 (43%), Gaps = 21/184 (11%)

Query: 145 STLKYHKDNAYGLAFNPNAEGELISGSDDSTIALWDATNDKLKQPIQEWTTSHSDIVNDC 204
           S +  H       AF P+    +++G+ D+T  +WD         ++     HS+ V   
Sbjct: 133 SAIAGHGSTILCSAFAPDTSSRMVTGAGDNTARIWDCDTQTPLATLE----GHSNWVLCV 188

Query: 205 QWHCFNTNMFGSVSEDSTLQLFD----KRNGGKSDVKISSKGQYNSIAFSGF-------- 252
            W   +  +  + S DST++L++    K  GG +    + KG    I    +        
Sbjct: 189 SWSP-DGEVIATGSMDSTIRLWESTKGKPVGGGNGSSSALKGHMKWITSLSWEPLHLVPD 247

Query: 253 -SENLFAAAGTTNNIYLYDIRNTGKILHSMTGHEEPVTSLEFSNDKDGILISGSSDRRVI 311
            ++   A+A     I ++D       L++++GH   V  +++    +G+L SGS D+ V 
Sbjct: 248 GAKPRLASASKDGTIKIWDTARR-VCLYTLSGHSNSVACVKWGG--EGLLYSGSHDKTVR 304

Query: 312 MWDL 315
           +WD+
Sbjct: 305 VWDM 308

 Score = 33.9 bits (76), Expect = 0.84,   Method: Compositional matrix adjust.
 Identities = 23/84 (27%), Positives = 43/84 (51%), Gaps = 5/84 (5%)

Query: 103 AHDGEINRARYMPQNTNIIATVNGEGTIFIYDCSRDKQSALLSTLKYHKDNAYGLAFNPN 162
            H   +N   + P    I+ + + + +I ++D  RD +   LST + H  + Y +A++ +
Sbjct: 404 GHQKLVNHVAFSPDGRYIV-SASFDNSIKLWD-GRDGK--FLSTFRGHVASVYQVAWSSD 459

Query: 163 AEGELISGSDDSTIALWDATNDKL 186
               L+S S D+T+ +WD    KL
Sbjct: 460 CR-LLVSCSKDTTLKVWDVRTRKL 482

>TBLA0I02280 Chr9 complement(523331..526114) [2784 bp, 927 aa] {ON}
           Anc_6.325 YCR057C
          Length = 927

 Score = 60.5 bits (145), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 49/180 (27%), Positives = 88/180 (48%), Gaps = 11/180 (6%)

Query: 150 HKDNAYGLAFNPNAEGELISGSDDSTIALWDATNDKLKQPIQEWTTSHSDIVNDCQWHCF 209
           H D   GL ++P+    +++ S+D  I +WD  +       +E    H+  V+  Q+   
Sbjct: 340 HFDTLNGLTYSPDG-SRVVTASEDGKIKIWDVVSGFCLATFEE----HTSAVSAVQFSKR 394

Query: 210 NTNMFGSVSEDSTLQLFDK-RNGGKSDVKISSKGQYNSIAFSGFSENLFAAAGTTNNIYL 268
              +F S S D T++ +D  R         + + Q+NS+A     E + A +     I +
Sbjct: 395 GQVLF-SASLDGTVRAWDLIRYRNFRTFTAAERIQFNSLAVDPSGEVVCAGSIDNYEIQV 453

Query: 269 YDIRNTGKILHSMTGHEEPVTSLEFSNDKDGILISGSSDRRVIMWDLFEIGAEQQPDEAD 328
           + ++ TG++L  + GHE PV+ L FS + + +L S S D+ + +W +F  G  QQ +  D
Sbjct: 454 WSVQ-TGQLLDCLAGHEGPVSCLAFSQENN-VLASASWDKTIRVWSIF--GRSQQVEPID 509

>NCAS0F01970 Chr6 complement(396326..397861) [1536 bp, 511 aa] {ON}
           Anc_2.401 YMR131C
          Length = 511

 Score = 59.7 bits (143), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 88/405 (21%), Positives = 157/405 (38%), Gaps = 61/405 (15%)

Query: 25  PLLYDFVSETRLTWPSLTLQWLPGDKTSTR----QHLILGTLTSGAETDYLKIAALDLPD 80
           P +Y+ +    + WP +TL  +P +  S R    Q L++ T T  +     ++  L L +
Sbjct: 112 PSVYEMLHNVNVPWPCMTLDIIPDNLGSERRNYPQSLLMATATQASRKKENELMVLSLSN 171

Query: 81  --EIIIGXXXXXXXXXXXXXXXXFAHDGEI-----------NRARYMP----QNTNIIAT 123
             + ++                    D  I           NR +  P    +   + AT
Sbjct: 172 LVKTLVKDDEEEEEEDVDNEDDRDDSDPIIENENIPLRDTTNRLKISPFASSKEEVLAAT 231

Query: 124 VNGEGTIFIYDCSRDKQSALLSTLKYHKDNA----------------YGLAFNP-NAEGE 166
           ++  G ++I+D     QS   ST  Y    A                Y L ++P    G 
Sbjct: 232 MSENGEVYIFDLG--PQSKAFSTPGYKVPKAAKRPIHTVKNHGNVEGYALDWSPLTKTGA 289

Query: 167 LISGSDDSTIALWDATNDKLKQPIQEWTTSHSDIVNDCQWHCFNTNMFGSVSEDSTLQLF 226
           L++G     I        K     Q +T +++  + D QW    + +F S   D  ++++
Sbjct: 290 LLTGDCSGQIYFTQRHTSKWITDKQPFTVANNQSIEDIQWSRTESTVFASAGCDGYIRIW 349

Query: 227 DKRNGGKSDVKISSKGQYNSIAFSGFSENL--FAAAGTTNNIY-LYDIR-----NTGKI- 277
           D R+  K    IS K     +    +SE L    A+G  N  + ++D+R     N G + 
Sbjct: 350 DTRSK-KHKPAISVKASNTDVNVISWSEKLGYLLASGDDNGTWGVWDLRQFSPENAGSVQ 408

Query: 278 -LHSMTGHEEPVTSLEFSNDKDGILISGSSDRRVIMWDL-FEIGAEQQPDEADDGL---- 331
            +     H+  +TS+ F+   + I+  GS D  V +WDL  E   E+   +A +      
Sbjct: 409 PVAQYDFHKGAITSISFNPLDESIIAVGSEDNTVTLWDLSVEADDEEIKQQAAETKELQQ 468

Query: 332 --PEVMMIHAGSRSAINDISTHPSIPWLNASVEENNIVQVWKCSS 374
             P+++ +H   +  + D+  H  IP    S   + +  +WK  S
Sbjct: 469 IPPQLLFVHW--QKEVKDVKWHKQIPGCLVSTGTDGL-NIWKTIS 510

>NDAI0I00460 Chr9 (91809..94562) [2754 bp, 917 aa] {ON} Anc_6.325
          Length = 917

 Score = 60.1 bits (144), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 56/223 (25%), Positives = 104/223 (46%), Gaps = 17/223 (7%)

Query: 114 MPQNTNIIATVNGEGTIFIYDCSRDKQ--------SALLSTLKYHKDNAYGLAFNPNAEG 165
           M QN     TVN  G    +  S+  Q         + +   + H D+   L ++P+   
Sbjct: 296 MGQNPVNTVTVNSTGEWLAFGSSKLGQLLVYEWQSESYILKQQGHFDSTNSLTYSPDG-S 354

Query: 166 ELISGSDDSTIALWDATNDKLKQPIQEWTTSHSDIVNDCQWHCFNTNMFGSVSEDSTLQL 225
            +++ +DD  I +WD  +        E T+S    V   Q+      +F S S D T++ 
Sbjct: 355 RVVTAADDGKIKVWDVVSGFCLATFTEHTSS----VTQVQFAKKGQVLFSS-SLDGTVRA 409

Query: 226 FDK-RNGGKSDVKISSKGQYNSIAFSGFSENLFAAAGTTNNIYLYDIRNTGKILHSMTGH 284
           +D  R         + + Q+N +A     E + A +  + +I+++ ++ TG++L +++GH
Sbjct: 410 WDLIRYRNFRTFTAAERIQFNCLAVDPSGEVVCAGSIDSFDIHVWSVQ-TGQLLDTLSGH 468

Query: 285 EEPVTSLEFSNDKDGILISGSSDRRVIMWDLFEIGAEQQPDEA 327
           E PV+ L FS + + +L S S D+ V +W +F    + +P E 
Sbjct: 469 EGPVSCLSFSQE-NSVLASASWDKTVRIWSIFGRSQQVEPFEV 510

>KLLA0F15598g Chr6 (1439610..1441046) [1437 bp, 478 aa] {ON} highly
           similar to uniprot|P33750 Saccharomyces cerevisiae
           YLL011W
          Length = 478

 Score = 59.3 bits (142), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 59/252 (23%), Positives = 98/252 (38%), Gaps = 60/252 (23%)

Query: 119 NIIATVNGEGTIFIYDCSRDKQSALLSTLKYHKDNAYGLA-----FNPNAEGELISGSDD 173
           N +AT +G+G I  ++ S  ++   LS+ K H     GL       +P  E  ++S  DD
Sbjct: 81  NKLATASGDGVIKYWNMSTREE---LSSFKAHYGMVTGLCVTPSYLSPQRENFMLSCGDD 137

Query: 174 STIALWDATNDKLKQ----------------------------------------PIQEW 193
            T+ LW   +D                                             I+ W
Sbjct: 138 KTVKLWSVNSDDFSNVKDDTRLNTDEGIIKTFHGEHAFQSLDHHRQKSNFVTGGAQIELW 197

Query: 194 TTSHSDIVNDCQWHC-------FNTN---MFGSVSEDSTLQLFDKRNGGKSDVKISSKGQ 243
            T+ S  +++  W         FN N   +  S   D+++ L+D R    +  KI    +
Sbjct: 198 DTNRSKPISNLSWGADNINHVRFNQNEVDILASTGSDNSVVLYDLRTNSPTQ-KIVQTMR 256

Query: 244 YNSIAFSGFSENLFAAAGTTNNIYLYDIRNTGKILHSMTGHEEPVTSLEFSNDKDGILIS 303
            NSI ++      F  A   +N Y YD+RN  K LH    H   V  ++FS   D + ++
Sbjct: 257 TNSICWNPVEAFNFVIANEDHNAYYYDMRNMSKALHVFKDHVSAVMDVDFSPTGDEV-VT 315

Query: 304 GSSDRRVIMWDL 315
           GS D+ + ++ +
Sbjct: 316 GSYDKTIRIYQV 327

 Score = 34.3 bits (77), Expect = 0.62,   Method: Compositional matrix adjust.
 Identities = 39/183 (21%), Positives = 77/183 (42%), Gaps = 23/183 (12%)

Query: 150 HKDNAYGLAFNPNAEGELISGSDDSTIALWDATNDKLKQPIQEWTTSHSDIVNDCQWHCF 209
           H+D  Y +A N N   +L + S D  I  W+ +    ++ +  +   +  +   C    +
Sbjct: 66  HRDGVYTIAKNYNVLNKLATASGDGVIKYWNMST---REELSSFKAHYGMVTGLCVTPSY 122

Query: 210 ----NTNMFGSVSEDSTLQLF----DKRNGGKSDVKISS-----KGQYNSIAFSGFSENL 256
                 N   S  +D T++L+    D  +  K D ++++     K  +   AF     + 
Sbjct: 123 LSPQRENFMLSCGDDKTVKLWSVNSDDFSNVKDDTRLNTDEGIIKTFHGEHAFQSLDHHR 182

Query: 257 ----FAAAGTTNNIYLYDIRNTGKILHSMTGHEEPVTSLEFSNDKDGILISGSSDRRVIM 312
               F   G    I L+D  N  K + +++   + +  + F+ ++  IL S  SD  V++
Sbjct: 183 QKSNFVTGGA--QIELWDT-NRSKPISNLSWGADNINHVRFNQNEVDILASTGSDNSVVL 239

Query: 313 WDL 315
           +DL
Sbjct: 240 YDL 242

>YMR131C Chr13 complement(533163..534698) [1536 bp, 511 aa] {ON}
           RRB1Essential nuclear protein involved in early steps of
           ribosome biogenesis; physically interacts with the
           ribosomal protein Rpl3p
          Length = 511

 Score = 59.3 bits (142), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 85/400 (21%), Positives = 162/400 (40%), Gaps = 54/400 (13%)

Query: 25  PLLYDFVSETRLTWPSLTLQWLPGDKTSTR----QHLILGTLTSGA---ETDYLKIAALD 77
           P +Y+ +    + WP LTL  +P    S R    Q ++L T T  +   E + + +A  +
Sbjct: 115 PTVYEMLHNVNMPWPCLTLDVIPDTLGSERRNYPQSILLTTATQSSRKKENELMVLALSN 174

Query: 78  LPDEIIIGXXXXXXXXXXXXXXXXFAHDGE-------INRARYMP---QNTNII-ATVNG 126
           L   ++                     + E        NR +  P    N  ++ AT++ 
Sbjct: 175 LAKTLLKDDNEGEDDEEDDEDDVDPVIENENIPLRDTTNRLKVSPFAISNQEVLTATMSE 234

Query: 127 EGTIFIYDCSRDKQS-------------ALLSTLKYHKD-NAYGLAFNPNAE-GELISGS 171
            G ++IY+ +   ++               + T+K H +   YGL ++P  + G L+SG 
Sbjct: 235 NGDVYIYNLAPQSKAFSTPGYQIPKSAKRPIHTVKNHGNVEGYGLDWSPLIKTGALLSGD 294

Query: 172 DDSTIALWDATNDKLKQPIQEWTTSHSDIVNDCQWHCFNTNMFGSVSEDSTLQLFDKRNG 231
               I        +     Q +T S++  + D QW    + +F +   D  ++++D R+ 
Sbjct: 295 CSGQIYFTQRHTSRWVTDKQPFTVSNNKSIEDIQWSRTESTVFATAGCDGYIRIWDTRS- 353

Query: 232 GKSDVKISSKGQYNSIAFSGFSENL--FAAAGTTNNIY-LYDIR-------NTGKILHSM 281
            K    IS K     +    +S+ +    A+G  N  + ++D+R       +  + +   
Sbjct: 354 KKHKPAISVKASNTDVNVISWSDKIGYLLASGDDNGTWGVWDLRQFTPSNADAVQPVAQY 413

Query: 282 TGHEEPVTSLEFSNDKDGILISGSSDRRVIMWDL-FEIGAEQ------QPDEADDGLPEV 334
             H+  +TS+ F+   + I+  GS D  V +WDL  E   E+      +  E  +  P++
Sbjct: 414 DFHKGAITSIAFNPLDESIVAVGSEDNTVTLWDLSVEADDEEIKQQAAETKELQEIPPQL 473

Query: 335 MMIHAGSRSAINDISTHPSIPWLNASVEENNIVQVWKCSS 374
           + +H   +  + D+  H  IP    S   + +  VWK  S
Sbjct: 474 LFVHW--QKEVKDVKWHKQIPGCLVSTGTDGL-NVWKTIS 510

>TPHA0G02650 Chr7 (558370..559920) [1551 bp, 516 aa] {ON} Anc_2.401
           YMR131C
          Length = 516

 Score = 58.9 bits (141), Expect = 8e-09,   Method: Compositional matrix adjust.
 Identities = 85/401 (21%), Positives = 156/401 (38%), Gaps = 55/401 (13%)

Query: 25  PLLYDFVSETRLTWPSLTLQWLPGDKTSTR----QHLILGTLTSGAETDYLKIAALDLPD 80
           P +Y+ +    L WP LTL  +P +  S R    Q +++ T T  ++    ++  L L  
Sbjct: 119 PTVYEMLHNVNLPWPCLTLDIIPDNLGSERRNYPQSILMTTATQASKKKDNELMVLKL-S 177

Query: 81  EIIIGXXXXXXXXXXXXXXXXFAHDGE-------------INRARYMP----QNTNIIAT 123
            +                       GE              NR R  P    Q   + +T
Sbjct: 178 HLTKTLVKDDDNVDNEDDDEDDDEAGEPILENESLPLRDTTNRLRISPYATVQQEILTST 237

Query: 124 VNGEGTIFIYDCSRDKQS-------------ALLSTLKYHKD-NAYGLAFNPNAE-GELI 168
           ++  G +FIYD +   ++               L T++ H +   YGL ++P  + G L+
Sbjct: 238 MSENGEVFIYDLTPQTRAFETPGYQIPKTAKRPLHTIRNHGNVEGYGLDWSPLIKTGALL 297

Query: 169 SGSDDSTIALWDATNDKLKQPIQEWTTSHSDIVNDCQWHCFNTNMFGSVSEDSTLQLFDK 228
           +G     + L      K       +T  ++  + D QW    + +F +   D  ++++D 
Sbjct: 298 TGDCSGMVYLTQRHTSKWVTDKTPFTVGNNKSIEDIQWSRTESTVFATAGCDGYIRIWDT 357

Query: 229 RNGGKSDV--KISSKGQYNSIAFSGFSENLFAAAGTTNNIYLYDIR----NTGKIL--HS 280
           R+     V   + S    N I+++     L A+        ++D+R    N+ K L    
Sbjct: 358 RSKKHKPVISTVVSNTDVNVISWNEKMGYLLASGDDKGTWGIWDLRQFSPNSEKALPVAQ 417

Query: 281 MTGHEEPVTSLEFSNDKDGILISGSSDRRVIMWDLF------EIGAEQ-QPDEADDGLPE 333
              H+  +TS+ F+   + I+   S D  V +WDL       EI  ++ +  E +   P+
Sbjct: 418 YDFHKGAITSISFNPLDESIVAVASEDNTVTLWDLSVEADDEEIKQQKAEIKELEQIPPQ 477

Query: 334 VMMIHAGSRSAINDISTHPSIPWLNASVEENNIVQVWKCSS 374
           ++ +H   +  + D+  H  IP    S   + +  VWK  S
Sbjct: 478 LLFVHW--QKEVKDVKWHKQIPGCLVSTGTDGL-NVWKTIS 515

>KAFR0J02550 Chr10 complement(484360..487080) [2721 bp, 906 aa] {ON}
           Anc_6.325 YCR057C
          Length = 906

 Score = 59.3 bits (142), Expect = 9e-09,   Method: Compositional matrix adjust.
 Identities = 46/179 (25%), Positives = 91/179 (50%), Gaps = 9/179 (5%)

Query: 150 HKDNAYGLAFNPNAEGELISGSDDSTIALWDATNDKLKQPIQEWTTSHSDIVNDCQWHCF 209
           H D+   L ++P+    +++ ++D  I +WD  +       +E T+S    V   Q+   
Sbjct: 339 HFDSTNSLTYSPDG-SRVVTAAEDGKIKVWDVVSGFCLATFEEHTSS----VTQVQFAKK 393

Query: 210 NTNMFGSVSEDSTLQLFDK-RNGGKSDVKISSKGQYNSIAFSGFSENLFAAAGTTNNIYL 268
              +F S S D T++ +D  R         + + Q+NS+A     E + A +  + +I++
Sbjct: 394 GQVLF-SASLDGTVRAWDLIRYRNFRVFTAAERIQFNSLAVDPSGEVVCAGSVDSFDIHV 452

Query: 269 YDIRNTGKILHSMTGHEEPVTSLEFSNDKDGILISGSSDRRVIMWDLFEIGAEQQPDEA 327
           + ++ TG++L ++ GHE P++ L FS + + IL S S D+ + +W +F    + +P E 
Sbjct: 453 WSVQ-TGQLLDTLAGHEGPISCLAFSQE-NSILASASWDKTIRIWSIFGRSQQVEPIEV 509

>NCAS0D04480 Chr4 complement(851440..854187) [2748 bp, 915 aa] {ON}
           Anc_6.325
          Length = 915

 Score = 58.9 bits (141), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 49/180 (27%), Positives = 90/180 (50%), Gaps = 11/180 (6%)

Query: 150 HKDNAYGLAFNPNAEGELISGSDDSTIALWDATNDKLKQPIQEWTTSHSDIVNDCQWHCF 209
           H D    L ++P+    +++ ++D  I +WD  +       QE T+S    V   Q+   
Sbjct: 342 HFDATNSLTYSPDG-SRVVTAAEDGKIKVWDVVSGFCLATFQEHTSS----VTQVQFAKR 396

Query: 210 NTNMFGSVSEDSTLQLFDK-RNGGKSDVKISSKGQYNSIAFSGFSENLFAAAGTTNNIYL 268
              +F S S D T++ +D  R         + + Q+N +A     E + A +    +I++
Sbjct: 397 GQVLFSS-SLDGTVRAWDLIRYRNFRTFTAAERIQFNCLAVDPSGEVVCAGSLDNFDIHV 455

Query: 269 YDIRNTGKILHSMTGHEEPVTSLEFSNDKDGILISGSSDRRVIMWDLFEIGAEQQPDEAD 328
           + ++ TG++L +++GHE PV+ L FS + + +L S S D+ V +W +F  G  QQ +  D
Sbjct: 456 WSVQ-TGQLLDTLSGHEGPVSCLAFSQE-NSVLASASWDKTVRVWSIF--GRSQQVEPFD 511

>Kpol_1060.24 s1060 complement(61507..62967) [1461 bp, 486 aa] {ON}
           complement(61507..62967) [1461 nt, 487 aa]
          Length = 486

 Score = 58.5 bits (140), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 57/236 (24%), Positives = 102/236 (43%), Gaps = 30/236 (12%)

Query: 159 FNPNAEGELISGSDDSTIALWDATNDKLKQPIQEWTTSHSDIVNDCQWHCFNTNMFGSVS 218
           +NP     LIS S D+T  +WD  +      ++    +H   V D ++   +T +F S  
Sbjct: 230 WNPIDTNLLISSSIDTTCIVWDLQSSNY---VRTQLIAHDSEVFDVKFLAHSTQLFASCG 286

Query: 219 EDSTLQLFDKRNGGKSDVKISSKGQYNS----------------IAFSGFSENLFAA-AG 261
            D ++++FD R+   S +   S    N                 +  S    N+ A  A 
Sbjct: 287 GDGSVRVFDLRSLAHSTIIYESNSDQNGSDTLTDNEKSPSALLRLQPSPSDPNVMATFAL 346

Query: 262 TTNNIYLYDIRNTGKILHSMTGHEEPVTSLEFSNDKDGILISGSSDRRVIMWDLFE---- 317
            + +I + D+RN G  + ++ GH   V  +++   K  +L+S   D +V+ WDL E    
Sbjct: 347 DSKSILILDMRNPGSPVLTLEGHSAAVNQIKWHPKKSNVLLSCGDDCQVLYWDLNEWLSP 406

Query: 318 --IGAEQQPDEADDGLPEVMMIHAG----SRSAINDISTHPSIPWLNASVEENNIV 367
             + A +    A+DG      I+A     ++S + ++   P++ + N   E NNI 
Sbjct: 407 TSLSANENKVNANDGPISGQQINAPVSQWNQSNVQNVLDVPAMCYSNRQQEINNIA 462

 Score = 37.0 bits (84), Expect = 0.085,   Method: Compositional matrix adjust.
 Identities = 31/138 (22%), Positives = 62/138 (44%), Gaps = 13/138 (9%)

Query: 102 FAHDGEINRARYMPQNTNIIATVNGEGTIFIYDCSRDKQSALLSTLKYHKDNAYGLAFNP 161
            AHD E+   +++  +T + A+  G+G++ ++D      S ++      ++ +  L  N 
Sbjct: 263 IAHDSEVFDVKFLAHSTQLFASCGGDGSVRVFDLRSLAHSTIIYESNSDQNGSDTLTDNE 322

Query: 162 NAEGELI----SGSDDSTIALWDATNDK------LKQPIQEWTT--SHSDIVNDCQWHCF 209
            +   L+    S SD + +A + A + K      ++ P     T   HS  VN  +WH  
Sbjct: 323 KSPSALLRLQPSPSDPNVMATF-ALDSKSILILDMRNPGSPVLTLEGHSAAVNQIKWHPK 381

Query: 210 NTNMFGSVSEDSTLQLFD 227
            +N+  S  +D  +  +D
Sbjct: 382 KSNVLLSCGDDCQVLYWD 399

>NCAS0G01120 Chr7 complement(199561..201045) [1485 bp, 494 aa] {ON}
           Anc_6.276
          Length = 494

 Score = 58.2 bits (139), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 46/177 (25%), Positives = 79/177 (44%), Gaps = 14/177 (7%)

Query: 159 FNPNAEGELISGSDDSTIALWDATNDKLKQPIQEWTTSHSDIVNDCQWHCFNTNMFGSVS 218
           +NP     LIS S D+T  +WD  +      ++    +H   V D ++   +T +F S  
Sbjct: 240 WNPIDTNLLISSSIDTTCIVWDLQSSNY---VKTQLIAHDSEVYDVRFLTQSTQLFASCG 296

Query: 219 EDSTLQLFDKRNGGKSDVKI----------SSKGQYNSIAFSGFSENLFAA-AGTTNNIY 267
            D ++++FD R+   S +            +S+     +  S    N+ A  A  +N I 
Sbjct: 297 GDGSVRVFDLRSLAHSTIIYEPPVSDLNPDTSQFALLRLEPSPHDPNVMATFAADSNKIL 356

Query: 268 LYDIRNTGKILHSMTGHEEPVTSLEFSNDKDGILISGSSDRRVIMWDLFEIGAEQQP 324
           + D+RN    L  + GH   V  +++   K  +L+SG  D +V+ WDL +  A   P
Sbjct: 357 ILDMRNPESPLMILEGHSASVNQIKWHPIKRNVLLSGGDDCQVLYWDLNKCTASSDP 413

 Score = 40.0 bits (92), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 32/134 (23%), Positives = 56/134 (41%), Gaps = 11/134 (8%)

Query: 102 FAHDGEINRARYMPQNTNIIATVNGEGTIFIYDCSRDKQSALL-----STLKYHKDNAYG 156
            AHD E+   R++ Q+T + A+  G+G++ ++D      S ++     S L         
Sbjct: 273 IAHDSEVYDVRFLTQSTQLFASCGGDGSVRVFDLRSLAHSTIIYEPPVSDLNPDTSQFAL 332

Query: 157 LAFNPNAEGELISGS---DDSTIALWDATNDKLKQPIQEWTTSHSDIVNDCQWHCFNTNM 213
           L   P+     +  +   D + I + D  N +    I E    HS  VN  +WH    N+
Sbjct: 333 LRLEPSPHDPNVMATFAADSNKILILDMRNPESPLMILE---GHSASVNQIKWHPIKRNV 389

Query: 214 FGSVSEDSTLQLFD 227
             S  +D  +  +D
Sbjct: 390 LLSGGDDCQVLYWD 403

>ZYRO0A08690g Chr1 (691253..692803) [1551 bp, 516 aa] {ON} highly
           similar to uniprot|Q04225 Saccharomyces cerevisiae
           YMR131C RRB1 RiboSome Assembly 2
          Length = 516

 Score = 58.2 bits (139), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 82/402 (20%), Positives = 157/402 (39%), Gaps = 56/402 (13%)

Query: 25  PLLYDFVSETRLTWPSLTLQWLP----GDKTSTRQHLILGTLTSGAET--DYLKIAALDL 78
           P +Y+ +    + WP +TL  +P     ++ S  Q L+L T T       + L +  L  
Sbjct: 118 PSVYEMLHNVNMPWPCMTLDVIPDTLGSERRSYPQSLLLTTATQATRKKDNELMVLKLSQ 177

Query: 79  PDEIIIGXXXXXXXXXXXX----------XXXXFAHDGEINRARYMPQNTN----IIATV 124
             + ++                            A     NR +  P  T+    + AT+
Sbjct: 178 LSKTLVKDDTEENDEDDEDDEDADSDPIIENENIALKDTTNRLKVSPFATHGQEVLTATM 237

Query: 125 NGEGTIFIYDCSRDKQS-------------ALLSTLKYHKD-NAYGLAFNPNAE-GELIS 169
              G ++++D     ++               + T++ H +   YGL ++P  + G L++
Sbjct: 238 CENGEVYVFDLGAQTKAFETPGYQVPKTSRKAIHTIRNHGNVEGYGLDWSPLIKTGALLT 297

Query: 170 GSDDSTIALWDATNDKLKQPIQEWTTSHSDIVNDCQWHCFNTNMFGSVSEDSTLQLFDKR 229
           G     I L      K     Q +T +++  V D QW    + +F +   D  ++++D R
Sbjct: 298 GDCSGQIFLTQRHTSKWITDKQPFTAANNQSVEDIQWSPTESTVFATSGTDGYVRIWDTR 357

Query: 230 NGGKSDVKISSKGQYNSIAFSGFSENL--FAAAGTTNNIY-LYDIRNTG-------KILH 279
           +  K    IS++     +    ++E L    A+G  N  + ++D+R          + + 
Sbjct: 358 SK-KHKPAISTRASNTDVNVISWNEKLGYLLASGDDNGSWGVWDLRQFSPANSEGVQPVA 416

Query: 280 SMTGHEEPVTSLEFSNDKDGILISGSSDRRVIMWDLF------EIGAE-QQPDEADDGLP 332
               H  P+TS+ F+   D ++   S D  V +WDL       EI  + ++  E     P
Sbjct: 417 QYDFHRGPITSISFNPLDDSVVAVASEDNTVTLWDLSVEADDDEIQQQTKEYKELQKIPP 476

Query: 333 EVMMIHAGSRSAINDISTHPSIPWLNASVEENNIVQVWKCSS 374
           +++ +H   +  + D+  H  IP    S   + +  VWK  S
Sbjct: 477 QLLFVHW--QKEVKDVKWHKQIPGCLVSTGTDGL-NVWKTIS 515

>TPHA0D03830 Chr4 complement(802754..805492) [2739 bp, 912 aa] {ON}
           Anc_6.325 YCR057C
          Length = 912

 Score = 58.5 bits (140), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 52/206 (25%), Positives = 97/206 (47%), Gaps = 9/206 (4%)

Query: 150 HKDNAYGLAFNPNAEGELISGSDDSTIALWDATNDKLKQPIQEWTTSHSDIVNDCQWHCF 209
           H D    L ++P+    +++ S+D  I +WD  +       +E T+S    V   Q+   
Sbjct: 335 HFDALNDLTYSPDG-SRVVTSSEDGKIKIWDVVSGFCLATFEEHTSS----VTAVQFAKR 389

Query: 210 NTNMFGSVSEDSTLQLFDK-RNGGKSDVKISSKGQYNSIAFSGFSENLFAAAGTTNNIYL 268
              +F S S D T++ +D  R         + + Q+N +A     E + A +     I++
Sbjct: 390 GQVLF-SASLDGTVRAWDLIRYRNFRTFTSTDRIQFNCLAVDPSGEVVCAGSLDNFEIHV 448

Query: 269 YDIRNTGKILHSMTGHEEPVTSLEFSNDKDGILISGSSDRRVIMWDLFEIGAEQQPDEAD 328
           + ++ TG++L ++ GHE PV+ L FS + +G+L S S D+ + +W +F    + +P E  
Sbjct: 449 WSVQ-TGQLLDTLAGHEGPVSCLAFSQE-NGVLASASWDKTIRIWSIFARSQQVEPLEVY 506

Query: 329 DGLPEVMMIHAGSRSAINDISTHPSI 354
             +  + +   G   A + I    SI
Sbjct: 507 SDIVALTIRPDGKHVAASTIRGQISI 532

>NCAS0F03340 Chr6 complement(675569..676915) [1347 bp, 448 aa] {ON}
           Anc_5.429 YDR364C
          Length = 448

 Score = 57.8 bits (138), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 52/179 (29%), Positives = 82/179 (45%), Gaps = 14/179 (7%)

Query: 143 LLSTLKY----HKDNAYGLAFNPNAEGELISGSDDSTIALWDATNDKLKQPIQEWTTSHS 198
           L   +KY    H +    L F PN+   L+SG +D+ + +WD  +   K+ +      HS
Sbjct: 143 LPKKIKYAMDGHTNGTTSLTFLPNSGNLLLSGGNDNIVKVWDFYH---KRNLLRDYKGHS 199

Query: 199 DIVNDCQWHCFNTNMFGSVSEDSTLQLFDKRNGGKSDVKISSKGQYNSIAFSGFSENLFA 258
             +N   ++   TN F S S D T++++D    GK   K+  K   N + F  F+ + F 
Sbjct: 200 KAINSLDFNDDGTN-FISSSFDHTIKIWDTEQ-GKVKTKLHFKSTPNDVKFRPFNSSEFI 257

Query: 259 AAGTTNNIYLYDIR---NTGKILHSMTGHEEPVTSLEFSNDKDGILISGSSDRRVIMWD 314
                + IY YD R   N G++      H   + +L+F  D     IS S D+ V +WD
Sbjct: 258 VGFANSKIYHYDTRISENDGRV-QVYDHHMSSILALKFFPD-GSKFISSSEDKTVRIWD 314

 Score = 35.0 bits (79), Expect = 0.27,   Method: Compositional matrix adjust.
 Identities = 16/42 (38%), Positives = 24/42 (57%)

Query: 276 KILHSMTGHEEPVTSLEFSNDKDGILISGSSDRRVIMWDLFE 317
           KI ++M GH    TSL F  +   +L+SG +D  V +WD + 
Sbjct: 146 KIKYAMDGHTNGTTSLTFLPNSGNLLLSGGNDNIVKVWDFYH 187

>SAKL0A01738g Chr1 (157360..160089) [2730 bp, 909 aa] {ON} highly
           similar to uniprot|P25636 Saccharomyces cerevisiae
           YCR057C PWP2 part of small (ribosomal) subunit (SSU)
           processosome (contains U3 snoRNA) Eight WD-repeats with
           homology with G protein beta subunits flanked by
           nonhomologous N-terminal and C-terminal extensions
           regulatory protein
          Length = 909

 Score = 58.2 bits (139), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 49/180 (27%), Positives = 89/180 (49%), Gaps = 11/180 (6%)

Query: 150 HKDNAYGLAFNPNAEGELISGSDDSTIALWDATNDKLKQPIQEWTTSHSDIVNDCQWHCF 209
           H D+   L ++P+    +++ SDD  I +WD  +        + T+S    V   Q+   
Sbjct: 341 HFDSMNSLTYSPDG-SRVVTSSDDGKIKIWDVVSGFCLATFDDHTSS----VTAVQFAKK 395

Query: 210 NTNMFGSVSEDSTLQLFDK-RNGGKSDVKISSKGQYNSIAFSGFSENLFAAAGTTNNIYL 268
              +F S S D T++ +D  R         + + Q+N +A     E + A +  +  I++
Sbjct: 396 GQVLF-SASLDGTVKAWDLIRYRNFRTFTAAERIQFNCLAVDPSGEVVCAGSVDSFEIHV 454

Query: 269 YDIRNTGKILHSMTGHEEPVTSLEFSNDKDGILISGSSDRRVIMWDLFEIGAEQQPDEAD 328
           + ++ TG +L ++ GHE PV+ L FSN+ + +L S S D+ + +W +F  G  QQ +  D
Sbjct: 455 WSVQ-TGNLLDTLAGHEGPVSCLSFSNE-NSVLASASWDKTIRIWSIF--GRSQQVEPFD 510

>KAFR0A00380 Chr1 (70400..71950) [1551 bp, 516 aa] {ON} Anc_2.401
           YMR131C
          Length = 516

 Score = 57.4 bits (137), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 84/384 (21%), Positives = 150/384 (39%), Gaps = 58/384 (15%)

Query: 25  PLLYDFVSETRLTWPSLTLQWLPGDKTSTR----QHLILGTLTSGAETDYLKIAALDLP- 79
           P +YD +    + WP LTL  +P +  S R    Q L++ T T  +     ++  L L  
Sbjct: 119 PTVYDMLHNVTMPWPCLTLDIIPDNLGSQRRNYPQSLLMTTATQASRKKENELMVLSLSQ 178

Query: 80  ---------DEI-IIGXXXXXXXXXXXXXXXXFAHDGEINRARYMP---QNTNII-ATVN 125
                    DE+                     +     NR R  P    N  ++ AT++
Sbjct: 179 LAKTLVKDDDEVNSDEEDEDRDETDPIIENENISLRDTTNRLRVSPFAQSNKEVLTATMS 238

Query: 126 GEGTIFIYDCSRDKQSALLS---------------TLKYHKD-NAYGLAFNPNAE-GELI 168
             G ++I+D     QS   S               T+K H +   Y L ++P  + G L+
Sbjct: 239 ENGEVYIFDLG--PQSKAFSSPGYQVPKSSKRPVHTIKNHGNVEGYALDWSPLIKTGALL 296

Query: 169 SGSDDSTIALWDATNDKLKQPIQEWTTSHSDIVNDCQWHCFNTNMFGSVSEDSTLQLFDK 228
           +G     I L      K     Q +T  ++  V D QW      +F S   D  ++++D 
Sbjct: 297 TGDCSGQIYLTQRNTSKWVTDKQPFTVGNNKSVEDIQWSRTEATVFASCGCDGYVRIWDT 356

Query: 229 RNGGKSDVKISSKGQYNSIAFSGFSENL--FAAAGTTNNIY-LYDIR-------NTGKIL 278
           R+  +    +S K     +    ++E +    A+G  N  + ++D+R       N  + +
Sbjct: 357 RSK-QHKPALSVKASNTDVNVISWNEKIGYLLASGDDNGSWGVWDLRQFTPDNINNVQPV 415

Query: 279 HSMTGHEEPVTSLEFSNDKDGILISGSSDRRVIMWDL-FEIGAEQ------QPDEADDGL 331
                H+  +TS+ F+  ++ I+   S D  V +WDL  E   E+      +  E +   
Sbjct: 416 AQYDFHKGAITSISFNPLEESIIAVASEDNTVTLWDLSVEADDEEIKQQAAETKELESIP 475

Query: 332 PEVMMIHAGSRSAINDISTHPSIP 355
           P+++ +H   +  + D+  H  IP
Sbjct: 476 PQLLFVHW--QKEVKDVKWHKQIP 497

>Kpol_1028.54 s1028 (125940..128657) [2718 bp, 905 aa] {ON}
           (125940..128657) [2718 nt, 906 aa]
          Length = 905

 Score = 57.8 bits (138), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 51/218 (23%), Positives = 103/218 (47%), Gaps = 9/218 (4%)

Query: 150 HKDNAYGLAFNPNAEGELISGSDDSTIALWDATNDKLKQPIQEWTTSHSDIVNDCQWHCF 209
           H D+  GL ++P+    +++ ++D  I +WD  +        E T+S    V   Q+   
Sbjct: 337 HFDSLNGLTYSPDG-ARVVTAANDGKIKVWDVVSGFCLATFSEHTSS----VTAVQFAKR 391

Query: 210 NTNMFGSVSEDSTLQLFDK-RNGGKSDVKISSKGQYNSIAFSGFSENLFAAAGTTNNIYL 268
              +F S S D T++ +D  R         + +  +N +A     E + A +  +  I++
Sbjct: 392 GQVLFSS-SLDGTVRAWDLIRFRNFRTFTSTQRIPFNCLAVDPSGEVVCAGSSDSFEIHV 450

Query: 269 YDIRNTGKILHSMTGHEEPVTSLEFSNDKDGILISGSSDRRVIMWDLFEIGAEQQPDEAD 328
           + ++ TG++L S+ GHE PV+ L FS + + +L S S D+ + +W +F    + +P E  
Sbjct: 451 WSVQ-TGQLLDSLDGHEGPVSCLAFSQE-NSVLASASWDKTIRIWSIFSRSQQVEPIEVF 508

Query: 329 DGLPEVMMIHAGSRSAINDISTHPSIPWLNASVEENNI 366
             +  + +   G   A++ +    +I  + +  +  NI
Sbjct: 509 SDVLALTIRPDGKSVAVSTLKGQITIFDIESGQQTGNI 546

>AAR078W Chr1 (483989..485677) [1689 bp, 562 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YLR196W (PWP1)
          Length = 562

 Score = 57.0 bits (136), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 48/182 (26%), Positives = 81/182 (44%), Gaps = 11/182 (6%)

Query: 149 YHKDNAYGLAFNPNAEGELISGSDDSTIALWDATNDKLKQPIQEWTTSHSDIVNDCQWHC 208
           +H D    LA N +    L S S D T+ LWD  + +  + +       +  V+  QWH 
Sbjct: 269 HHTDAVLSLAHNRHFRAVLASTSADHTVKLWDLNHGRAARSLD--AVHSATAVSSSQWHP 326

Query: 209 FNTNMFGSVSEDSTLQLFDKR---NGGKSDV-KISSKGQYNSIAFSGFSENLFAAAGTTN 264
            + ++  +   DS + L D R   + G S   K+    +  S  F   SE +F A   + 
Sbjct: 327 SDGSILLTAGYDSRVALSDVRIANDAGMSKYWKVMKGEEIESATF--VSETVFLAGTDSG 384

Query: 265 NIYLYDIRN--TGKILHSMTGHEEPVTSLEFSNDKDGILISGSSDRRVI-MWDLFEIGAE 321
           N+Y +D+RN      L ++  H+  ++SL  S     +L++ +   +VI +W     GA 
Sbjct: 385 NVYSFDLRNGEDSAPLWTLNAHDSGISSLSVSPSIPNMLVTSAMGEKVIKLWKTPAEGAS 444

Query: 322 QQ 323
            Q
Sbjct: 445 AQ 446

>NDAI0I00350 Chr9 (71116..72663) [1548 bp, 515 aa] {ON} Anc_6.340
          Length = 515

 Score = 56.6 bits (135), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 44/178 (24%), Positives = 81/178 (45%), Gaps = 15/178 (8%)

Query: 145 STLKYHKDNAYGLAFNPNAEGELISGSDDSTIALWDATNDKLKQPIQEWTTSHSDIVNDC 204
           S +  H       AF PN+   +++G+ D+T  +WD      K  +    T H++ V   
Sbjct: 137 SAIAGHGSTILCSAFAPNSSSRMVTGAGDNTARIWDCDTQTPKATL----TGHTNWVLCV 192

Query: 205 QWHCFNTNMFGSVSEDSTLQLFDKRNGG------KSDVKISSKGQYNSIAFSGFSEN-LF 257
            W C N  +  + S D+T++L++ ++G       +  +K  +   +  I      E    
Sbjct: 193 SW-CPNGEVIATGSMDNTIRLWEGKSGKPVGDALRGHLKWITSLAWEPIHLVKAGEQPRL 251

Query: 258 AAAGTTNNIYLYDIRNTGKILHSMTGHEEPVTSLEFSNDKDGILISGSSDRRVIMWDL 315
           A+A     I ++D       L++++GH   V+ +++     GIL SGS D+ V  WD+
Sbjct: 252 ASASKDGTIKIWDTSRR-VCLYTLSGHTNSVSCIKWGG--QGILYSGSHDKTVRAWDM 306

 Score = 50.8 bits (120), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 54/200 (27%), Positives = 85/200 (42%), Gaps = 26/200 (13%)

Query: 121 IATVNGEGTIFIYDCSRDKQSALLSTLKYHKDNAYGLAFNPNAEGELISGSDDSTIALWD 180
           +A+ + +GTI I+D SR      L TL  H ++   + +    +G L SGS D T+  WD
Sbjct: 251 LASASKDGTIKIWDTSR---RVCLYTLSGHTNSVSCIKWG--GQGILYSGSHDKTVRAWD 305

Query: 181 ATNDKLKQPIQEWTTSHSDIVNDCQWHCFNTNMFGSVSEDSTLQL--FDKRN---GGKSD 235
                          S    +N  + H    N   S+S D  L++  FD          D
Sbjct: 306 MN-------------SEGRCINVLKSHAHWVNHL-SLSTDYALRVGPFDHTGVEPTSPED 351

Query: 236 VKISSKGQYNSIAF-SGFSENLFAAAGTTNNIYLYDIRNTGKILHSMTGHEEPVTSLEFS 294
            +  +   Y  +   +G  E L   A     ++L++   + K L  MTGH++ V  + FS
Sbjct: 352 ARDKALKNYEKVVKKNGRVEELMVTASDDFTMFLWNPLKSTKPLGRMTGHQKLVNHVAFS 411

Query: 295 NDKDGILISGSSDRRVIMWD 314
            D   I +S S D  + +WD
Sbjct: 412 PDGRYI-VSASFDNSIKLWD 430

 Score = 33.1 bits (74), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 22/84 (26%), Positives = 43/84 (51%), Gaps = 5/84 (5%)

Query: 103 AHDGEINRARYMPQNTNIIATVNGEGTIFIYDCSRDKQSALLSTLKYHKDNAYGLAFNPN 162
            H   +N   + P    I++  + + +I ++D  RD +   +ST + H  + Y +A++ +
Sbjct: 400 GHQKLVNHVAFSPDGRYIVS-ASFDNSIKLWD-GRDGK--FISTFRGHVASVYQVAWSAD 455

Query: 163 AEGELISGSDDSTIALWDATNDKL 186
               L+S S D+T+ +WD    KL
Sbjct: 456 CR-LLVSCSKDTTLKVWDVRTRKL 478

>NDAI0H02750 Chr8 (677299..678837) [1539 bp, 512 aa] {ON} Anc_2.401
           YMR131C
          Length = 512

 Score = 56.6 bits (135), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 78/384 (20%), Positives = 150/384 (39%), Gaps = 56/384 (14%)

Query: 25  PLLYDFVSETRLTWPSLTLQWLPGDKTSTR----QHLILGTLTSGA---ETDYLKIAALD 77
           P +Y+ +    + WP LTL  +P    S R    Q L++ T T  +   E + + ++  +
Sbjct: 113 PTVYEMLHNVNVPWPCLTLDIIPDSLGSERRNYPQSLLMTTATQASKKKENELMVLSLSN 172

Query: 78  LPDEIIIGXXXXXXXXXX----------XXXXXXFAHDGEINRARYMP----QNTNIIAT 123
           L   ++                                   NR +  P        + AT
Sbjct: 173 LTKTLVNEDKEDDEDEDDEDNEDNDKDPVMENENIPLRDTTNRLKVSPFANSSKEVLTAT 232

Query: 124 VNGEGTIFIYDCSRDKQS-------------ALLSTLKYHKD-NAYGLAFNPNAE-GELI 168
           ++  G ++I+D     ++               + T+K H +   Y L ++P+ + G L+
Sbjct: 233 MSENGEVYIFDLGPQSKAFSTPGYKIPKTAKRPIHTIKSHGNVEGYALDWSPSIQTGALL 292

Query: 169 SGSDDSTIALWDATNDKLKQPIQEWTTSHSDIVNDCQWHCFNTNMFGSVSEDSTLQLFDK 228
           +G     I        K     Q +T S++  + D QW      +F S   D  ++++D 
Sbjct: 293 TGDCSGQIYFTQRHTSKWVTDKQPFTVSNNKSIEDIQWSRTEGTVFASAGCDGYIRIWDT 352

Query: 229 RNGGKSDVKISSKGQYNSIAFSGFSENL--FAAAGTTNNIY-LYDIR-------NTGKIL 278
           R+  K    IS K     +    +S+ L    A+G  N ++ ++D+R       N+ + +
Sbjct: 353 RSK-KHKPAISVKASNTDVNVISWSDKLGYLLASGDDNGVWGVWDLRQFSPDTANSVQPV 411

Query: 279 HSMTGHEEPVTSLEFSNDKDGILISGSSDRRVIMWDL-FEIGAEQQPDEADDGL------ 331
                H+  +TS+ F+   + I+   S D  V +WDL  E   E+   +A +        
Sbjct: 412 AQYDFHKGAITSISFNPLDESIVAVASEDNTVTLWDLSVEADDEEIKQQAAETKELQQIP 471

Query: 332 PEVMMIHAGSRSAINDISTHPSIP 355
           P+++ +H   +  + D+  H  IP
Sbjct: 472 PQLLFVHW--QKEVKDVKWHKQIP 493

>CAGL0K09284g Chr11 (915766..918501) [2736 bp, 911 aa] {ON} highly
           similar to uniprot|P25635 Saccharomyces cerevisiae
           YCR057c PWP2 periodic tryptophan protein
          Length = 911

 Score = 56.6 bits (135), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 45/206 (21%), Positives = 98/206 (47%), Gaps = 9/206 (4%)

Query: 150 HKDNAYGLAFNPNAEGELISGSDDSTIALWDATNDKLKQPIQEWTTSHSDIVNDCQWHCF 209
           H D    L ++P+    +++ ++D  I +WD  +       +E    H+  V   Q+   
Sbjct: 340 HFDATNSLTYSPDGS-RVVTAAEDGKIKVWDVASGFCLATFEE----HTSAVTAVQFAKK 394

Query: 210 NTNMFGSVSEDSTLQLFDK-RNGGKSDVKISSKGQYNSIAFSGFSENLFAAAGTTNNIYL 268
              +F S S D T++ +D  R         + + Q+  +A     E + A +  + ++++
Sbjct: 395 GQVLF-SASLDGTVRAWDLIRYRNFRVFTATERVQFTCLAVEPSGEVVSAGSTDSFDVFV 453

Query: 269 YDIRNTGKILHSMTGHEEPVTSLEFSNDKDGILISGSSDRRVIMWDLFEIGAEQQPDEAD 328
           + ++ TG++L +++GHE PV+ L FS + + +L S S D+ + +W +F    + +P E  
Sbjct: 454 WSVQ-TGQLLDTLSGHEGPVSCLAFSME-NAVLASASWDKTIRIWSIFGRSQQVEPLEVF 511

Query: 329 DGLPEVMMIHAGSRSAINDISTHPSI 354
             +  + +   G   A++ +    +I
Sbjct: 512 ADILAITITPDGKHVAVSTLKGQLTI 537

>KNAG0E02180 Chr5 (440039..441592) [1554 bp, 517 aa] {ON} Anc_2.401
           YMR131C
          Length = 517

 Score = 55.8 bits (133), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 84/403 (20%), Positives = 156/403 (38%), Gaps = 59/403 (14%)

Query: 25  PLLYDFVSETRLTWPSLTLQWLPGDKTSTR----QHLILGTLT--SGAETDYLKIAALDL 78
           P +Y+ +    L WP +TL  +P    S R    Q +++ T T  S  + + L + +L  
Sbjct: 120 PTVYEMLHNVNLPWPCMTLDVIPDKLGSERRNYPQSILMTTATQASKKKENELMVLSLSQ 179

Query: 79  PDEIIIGXXXXXXXXXXXX---------XXXXFAHDGEINRARYMPQNTN----IIATVN 125
            ++ ++                             +   NR +  P  +     + AT++
Sbjct: 180 LNKTLVKSEEDEDEDEDSDEEDDSDPIIENENIKLNDTTNRLKVSPFASTDKEVLTATMS 239

Query: 126 GEGTIFIYDCSRDKQSALLSTLKYH----------------KDNAYGLAFNPNAE-GELI 168
             G ++I+D +   QS   ST  Y                     Y L ++P  + G L+
Sbjct: 240 ENGEVYIFDLA--PQSKAFSTPGYQIPKTARRPIHTVRNHGNVEGYALDWSPMIKNGALL 297

Query: 169 SGSDDSTIALWDATNDKLKQPIQEWTTSHSDIVNDCQWHCFNTNMFGSVSEDSTLQLFDK 228
           +G     I        K     Q +T  ++  V D QW    + +F S   D  ++++D 
Sbjct: 298 TGDCSGQIYFTQRHTSKWITDKQPFTAENNKSVEDIQWSRTESTVFASAGCDGYIRIWDT 357

Query: 229 RNGGKSDVKISSKGQYNSIAFSGFSENL--FAAAGTTNNIY-LYDIR-------NTGKIL 278
           R+  K    +S K     +    +SE +    A+G  N ++ ++D+R       N  + +
Sbjct: 358 RSK-KHKPALSVKASNTDVNVISWSEKIGYLLASGDDNGLWGVWDLRQFSPDNINDVQPV 416

Query: 279 HSMTGHEEPVTSLEFSNDKDGILISGSSDRRVIMWDL-FEIGAEQ------QPDEADDGL 331
                H+  +TS+ F+   D I+   S D  V +WDL  E   E+      +  E +   
Sbjct: 417 AQYDFHKGAITSINFNPLDDSIIAVASEDNTVTLWDLSVEADDEEIKQQIAETKELEKIP 476

Query: 332 PEVMMIHAGSRSAINDISTHPSIPWLNASVEENNIVQVWKCSS 374
           P+++ +H   +  + D+  H  IP    S   + +  +WK  S
Sbjct: 477 PQLLFVHW--QKDVKDVKWHKQIPGCLVSTGTDGL-NIWKTIS 516

>KAFR0L01520 Chr12 complement(278754..280508) [1755 bp, 584 aa] {ON}
           Anc_7.356 YLR196W
          Length = 584

 Score = 55.8 bits (133), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 46/181 (25%), Positives = 88/181 (48%), Gaps = 12/181 (6%)

Query: 149 YHKDNAYGLAFNPNAEGELISGSDDSTIALWDATNDKLKQPIQEWTTSHSDIVNDCQWHC 208
           +H D    L+ N +    L S S D T+ LWD  +    + +   +  ++  V+  QWH 
Sbjct: 287 HHTDAVLSLSHNKHFRAVLASTSADHTVKLWDLNSGNAARSMA--SIHNNKNVSSSQWHH 344

Query: 209 FNTNMFGSVSEDSTLQLFDKRNGGKSDV----KISSKGQYNSIAFSGFSENLFAAAGTTN 264
            N ++  +   DS + L D R   ++++     +S+  +  ++ F+   EN+  A   + 
Sbjct: 345 GNGSILLTGGYDSRIALTDVRISNENEMSKYWSVSNGEEVETVIFA--DENIILAGTDSG 402

Query: 265 NIYLYDIRNTG--KILHSMTGHEEPVTSLEFSNDKDGILISGS-SDRRVIMWDLFEIGAE 321
           NIY +DIRN    K + ++  H+  ++SL  +N   G++ +G+  ++ V +W  F  G  
Sbjct: 403 NIYSFDIRNNAGSKPVWTLKAHDAGISSLSVNNFIPGLMSTGAMGEKAVKLWK-FPTGDS 461

Query: 322 Q 322
           Q
Sbjct: 462 Q 462

>TDEL0A07550 Chr1 complement(1314676..1316223) [1548 bp, 515 aa]
           {ON} Anc_6.340 YCR072C
          Length = 515

 Score = 55.5 bits (132), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 65/300 (21%), Positives = 115/300 (38%), Gaps = 98/300 (32%)

Query: 103 AHDGEINRARYMPQNTNIIATVNGEGTIFIYDCSRDKQSALLSTLKYHKDNAYGLAFNPN 162
            H   I  +++ P  ++ + T  G+ T  ++DC  D Q+ + +TL  H++    +A++P+
Sbjct: 141 GHGATILCSQFAPHTSSRMVTGAGDNTARVWDC--DTQTPM-ATLSGHQNWVLCVAWSPD 197

Query: 163 AEGELISGSDDSTIALWDATNDKLKQPI-------QEWTTS------------------- 196
            E  + +GS D T+ LWD+   K  QP+       Q+W TS                   
Sbjct: 198 GE-TIATGSMDCTVRLWDS---KAGQPLGDALKGHQKWITSLVWEPLHLVKPGDKPRLAS 253

Query: 197 -----------------------HSDIVNDCQWHCFNTNMFGSVSEDSTLQLFDKRNGGK 233
                                  H++ V+  +W      +  S S D T++++D   GGK
Sbjct: 254 ASKDGTIKIWDTSRRVCIYTLSGHTNSVSCVKWG--GQGLLYSGSHDKTVRVWDMNVGGK 311

Query: 234 SDVKISSKGQY-NSIAFS--------------------------------------GFSE 254
               + S   + N ++ S                                      G +E
Sbjct: 312 CINILKSHAHWVNHLSLSTEYALRVGPFDHTATKFTSAEEARKKALENYEKIAKRNGKAE 371

Query: 255 NLFAAAGTTNNIYLYDIRNTGKILHSMTGHEEPVTSLEFSNDKDGILISGSSDRRVIMWD 314
            L   A     ++L+D   +GK L  +TGH++ V  + FS D    ++S S D  + +WD
Sbjct: 372 ELIVTASDDFTMFLWDPTKSGKPLARLTGHQKLVNHVAFSPDGR-FIVSASFDNSIKLWD 430

 Score = 50.8 bits (120), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 45/157 (28%), Positives = 80/157 (50%), Gaps = 13/157 (8%)

Query: 160 NPNAEGELISGSDDSTIALWDATNDKLKQPIQEWTTSHSDIVNDCQWHCFNTNMFGSVSE 219
           N  AE  +++ SDD T+ LWD T  K  +P+    T H  +VN   +   +     S S 
Sbjct: 367 NGKAEELIVTASDDFTMFLWDPT--KSGKPLAR-LTGHQKLVNHVAFS-PDGRFIVSASF 422

Query: 220 DSTLQLFDKRNGGKSDVKISS-KGQYNSIAFSGFSEN--LFAAAGTTNNIYLYDIRNTGK 276
           D++++L+D RNG      IS+ +G   S+    +S +  L  +      + ++D+R T K
Sbjct: 423 DNSIKLWDGRNG----TFISTFRGHVASVYQVAWSSDCRLLVSCSKDTTLKVWDVR-TRK 477

Query: 277 ILHSMTGHEEPVTSLEFSNDKDGILISGSSDRRVIMW 313
           +   + GH++ V ++++S D   +  SG  D+ V +W
Sbjct: 478 LSVDLPGHKDEVYTVDWSVDGKRV-CSGGKDKMVRLW 513

 Score = 38.5 bits (88), Expect = 0.024,   Method: Compositional matrix adjust.
 Identities = 35/164 (21%), Positives = 72/164 (43%), Gaps = 15/164 (9%)

Query: 159 FNPNAEGELISGSDDSTIALWDATNDKLKQPIQEWTTSHSDIVNDCQWHCFNTNMFGSVS 218
           F P+    +++G+ D+T  +WD      + P+    + H + V    W   +     + S
Sbjct: 151 FAPHTSSRMVTGAGDNTARVWDCDT---QTPMAT-LSGHQNWVLCVAWS-PDGETIATGS 205

Query: 219 EDSTLQLFDKRNGGK-SDVKISSKGQYNSIAFSGF------SENLFAAAGTTNNIYLYDI 271
            D T++L+D + G    D     +    S+ +          +   A+A     I ++D 
Sbjct: 206 MDCTVRLWDSKAGQPLGDALKGHQKWITSLVWEPLHLVKPGDKPRLASASKDGTIKIWDT 265

Query: 272 RNTGKILHSMTGHEEPVTSLEFSNDKDGILISGSSDRRVIMWDL 315
                 +++++GH   V+ +++     G+L SGS D+ V +WD+
Sbjct: 266 SRR-VCIYTLSGHTNSVSCVKWGG--QGLLYSGSHDKTVRVWDM 306

 Score = 33.1 bits (74), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 20/84 (23%), Positives = 40/84 (47%), Gaps = 5/84 (5%)

Query: 103 AHDGEINRARYMPQNTNIIATVNGEGTIFIYDCSRDKQSALLSTLKYHKDNAYGLAFNPN 162
            H   +N   + P     I + + + +I ++D    +    +ST + H  + Y +A++ +
Sbjct: 400 GHQKLVNHVAFSPDG-RFIVSASFDNSIKLWD---GRNGTFISTFRGHVASVYQVAWSSD 455

Query: 163 AEGELISGSDDSTIALWDATNDKL 186
               L+S S D+T+ +WD    KL
Sbjct: 456 CR-LLVSCSKDTTLKVWDVRTRKL 478

>KNAG0B02580 Chr2 (501215..502957) [1743 bp, 580 aa] {ON} Anc_7.356
           YLR196W
          Length = 580

 Score = 55.5 bits (132), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 45/169 (26%), Positives = 78/169 (46%), Gaps = 12/169 (7%)

Query: 149 YHKDNAYGLAFNPNAEGELISGSDDSTIALWDATNDKLKQPIQEWTTSHSDI-VNDCQWH 207
           +H D    LA N      L S S D T+ LWD  N  +   ++ + + HS   V+  +WH
Sbjct: 277 HHTDAVLSLAHNKLFRSVLASTSADHTVKLWDLNNASV---VRSFDSIHSGKNVSASEWH 333

Query: 208 CFNTNMFGSVSEDSTLQLFDKRNGGKSDV----KISSKGQYNSIAFSGFSENLFAAAGTT 263
             N ++  +   DS + L D R+    ++     +SS  +  S  F    EN+      T
Sbjct: 334 QSNGSILLTAGYDSRIALTDVRSNDAKNLSKYWSVSSGEEIESATF--VDENIILCGTDT 391

Query: 264 NNIYLYDIRNTG--KILHSMTGHEEPVTSLEFSNDKDGILISGSSDRRV 310
            N+Y +DIRN    K + ++  H+  +++L  +    G+L +G+   +V
Sbjct: 392 GNVYSFDIRNNAESKSVWTLKAHDSGISALAVNKFVPGLLTTGAMGDKV 440

>TBLA0C05010 Chr3 complement(1217846..1219564) [1719 bp, 572 aa]
           {ON} Anc_7.356 YLR196W
          Length = 572

 Score = 55.5 bits (132), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 49/172 (28%), Positives = 78/172 (45%), Gaps = 12/172 (6%)

Query: 149 YHKDNAYGLAFNPNAEGELISGSDDSTIALWDATNDKLKQPIQEWTTSHSDIVNDCQWHC 208
           +H D    LA N      L S S DST+ LWD  +    + + +    H   V+  QWH 
Sbjct: 291 HHTDAVLSLAHNQLFRAILASTSADSTVKLWDLNSGTAARSLNQ--VHHGSRVSSSQWHQ 348

Query: 209 FNTNMFGSVSEDSTLQLFDKRNGGKSDVKISSK----GQYNSIAFSGFSENLFAAAGTTN 264
            + ++  +   DS + L D R    SD K  SK         I  + F  +    AGT N
Sbjct: 349 TDGSILLTAGYDSKIALTDVR---ISDEKNMSKYWNVMSGEEIETASFINDYTVLAGTDN 405

Query: 265 -NIYLYDIRNT-GKILHSMTGHEEPVTSLEFSNDKDGILISGSSDRRVI-MW 313
            N+Y +D+R+   K L ++  H+  +  L    +  G+L++G+   +VI +W
Sbjct: 406 GNVYSFDVRSVESKPLWTLKAHDAGIAGLSVPKNIPGMLLTGAMGEKVIKLW 457

 Score = 32.0 bits (71), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 34/138 (24%), Positives = 64/138 (46%), Gaps = 13/138 (9%)

Query: 194 TTSHSDIVNDCQWHCFNTNMFGSVSEDSTLQLFDKRNG--GKSDVKISSKGQYNSIAFSG 251
           TT H+D V     +     +  S S DST++L+D  +G   +S  ++    + +S  +  
Sbjct: 289 TTHHTDAVLSLAHNQLFRAILASTSADSTVKLWDLNSGTAARSLNQVHHGSRVSSSQWHQ 348

Query: 252 FSENLFAAAGTTNNIYLYDIR-----NTGKILHSMTGHEEPVTSLEFSNDKDGILISGSS 306
              ++   AG  + I L D+R     N  K  + M+G E  + +  F ND    +++G+ 
Sbjct: 349 TDGSILLTAGYDSKIALTDVRISDEKNMSKYWNVMSGEE--IETASFINDY--TVLAGTD 404

Query: 307 DRRVIMWDLFEIGAEQQP 324
           +  V  +D+  +  E +P
Sbjct: 405 NGNVYSFDVRSV--ESKP 420

 Score = 30.8 bits (68), Expect = 6.9,   Method: Compositional matrix adjust.
 Identities = 26/84 (30%), Positives = 38/84 (45%), Gaps = 4/84 (4%)

Query: 107 EINRARYMPQNTNIIATVNGEGTIFIYDCSRDKQSALLSTLKYHKDNAYGLAFNPNAEGE 166
           EI  A ++   T +  T NG   ++ +D  R  +S  L TLK H     GL+   N  G 
Sbjct: 387 EIETASFINDYTVLAGTDNG--NVYSFDV-RSVESKPLWTLKAHDAGIAGLSVPKNIPGM 443

Query: 167 LISGS-DDSTIALWDATNDKLKQP 189
           L++G+  +  I LW       K P
Sbjct: 444 LLTGAMGEKVIKLWKFDPSNAKGP 467

>CAGL0L03201g Chr12 complement(368792..370531) [1740 bp, 579 aa]
           {ON} some similarities with uniprot|P47025 Saccharomyces
           cerevisiae YJL112w MDV1 or uniprot|P36130 Saccharomyces
           cerevisiae YKR036c CAF4 CCR4
          Length = 579

 Score = 55.5 bits (132), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 55/222 (24%), Positives = 96/222 (43%), Gaps = 49/222 (22%)

Query: 103 AHDGEINRARYMPQNTNIIATVNGEGTIFIYDCSR--DKQ-----SALLSTLKYHKDNAY 155
            H   +N  R++  +T ++A+   + ++ ++D     DK      +  L+T   HKD+  
Sbjct: 321 GHRATVNTTRFI-DDTRLLASAGKDASVKVWDVDNIVDKDGNANDNLCLATFDGHKDSVT 379

Query: 156 GLAFNPNAEGELISGSDDSTIALWDATNDKLKQPIQEWTTSHSDIVNDCQWHCFNTNMFG 215
            LA   NA   ++SGS+D T+  WD  + K  Q I                         
Sbjct: 380 ALATTGNA---IVSGSNDKTLRHWDLGSGKCIQSI------------------------- 411

Query: 216 SVSEDSTLQLFDKRNGGKSDVKISSKGQYNSIAFSGFS--ENLFAAAGTTNNIYLYDIRN 273
               D T+ L   +   +S  K+     +N+    G    +N          +YL+D+R 
Sbjct: 412 ----DLTIAL---KMVPQSVSKLDITPSFNTPLIGGADCIDNALVTGTKDGIVYLWDLR- 463

Query: 274 TGKILHSMTGHEEPVTSLEFSNDKDGILISGSSDRRVIMWDL 315
            G+++ S+ GH  P+TSL++   +   LI+GS D+   +WDL
Sbjct: 464 IGRVVGSLEGHRGPITSLKYMGSE---LITGSMDKSTRIWDL 502

>Kwal_33.15136 s33 (974095..975516) [1422 bp, 473 aa] {ON} YLL011W
           (SOF1) - 56 kDa nucleolar snRNP protein that shows
           homology to beta subunits of G-proteins and the splicing
           factor Prp4 [contig 94] FULL
          Length = 473

 Score = 54.7 bits (130), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 41/167 (24%), Positives = 82/167 (49%), Gaps = 8/167 (4%)

Query: 149 YHKDNAYGLAFNPNAEGELISGSDDSTIALWDATNDKLKQPIQEWTTSHSDIVNDCQWHC 208
           +H ++A+    +  +    ++G   + I LWD+T  +   PI   +   +D V+  +++ 
Sbjct: 171 FHGEHAFLGIDHHRSNSNFVTGG--AEINLWDSTRSR---PITNLSWG-ADNVSTVKFNQ 224

Query: 209 FNTNMFGSVSEDSTLQLFDKRNGGKSDVKISSKGQYNSIAFSGFSENLFAAAGTTNNIYL 268
             T++F S   D+++ L+D R    +  K   K + N++ ++      F  A   +N Y 
Sbjct: 225 NETDIFASAGSDNSVVLYDLRTNSPTQ-KFVQKMRTNALCWNPMEAYNFVVANEDHNAYY 283

Query: 269 YDIRNTGKILHSMTGHEEPVTSLEFSNDKDGILISGSSDRRVIMWDL 315
           YD+RN  + LH    H   V  ++FS   D I ++GS D+ + ++ +
Sbjct: 284 YDMRNLSRALHVFKDHVSAVMDVDFSPTGDEI-VTGSYDKTIRIYQV 329

>AGL234W Chr7 (257969..259858) [1890 bp, 629 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YCR084C (TUP1)
          Length = 629

 Score = 55.1 bits (131), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 54/207 (26%), Positives = 98/207 (47%), Gaps = 24/207 (11%)

Query: 121 IATVNGEGTIFIYDCSRDKQSALLSTLKYHKDNAYGLAFNPNAEGELISGSDDSTIALWD 180
           +AT   +  I I+D +  K   +L TL+ H+ + Y L + P  + +L+SGS D T+ +WD
Sbjct: 367 LATGAEDKLIRIWDLTTKK---ILMTLQGHEQDIYSLDYFPAGD-KLVSGSGDRTVRIWD 422

Query: 181 ATNDKLKQPIQEWTTSHSDIVNDCQWHCFNTNMFGSVSEDSTLQLFDKRNG-------GK 233
                L+      T S  D V        +     + S D T++++D   G        +
Sbjct: 423 -----LRTGQCSLTLSIEDGVTTVAVSPGDGKYIAAGSLDRTVRVWDSETGFLVERLDSE 477

Query: 234 SDVKISSKGQYNSIAFSGFSENLFAAAGTTNNIYLYDIRN-TGKILHSM-----TGHEEP 287
           +++    K    S+ F+   + + + +    ++ L+D+R   G+  H+      TGH++ 
Sbjct: 478 NELSTGHKDSVYSVVFTRDGQGVISGS-LDRSVKLWDLRGLNGQKSHATCEVTYTGHKDF 536

Query: 288 VTSLEFSNDKDGILISGSSDRRVIMWD 314
           V S+  + D D  ++SGS DR V+ WD
Sbjct: 537 VLSVATTQD-DEYILSGSKDRGVLFWD 562

 Score = 54.3 bits (129), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 45/173 (26%), Positives = 83/173 (47%), Gaps = 16/173 (9%)

Query: 157 LAFNPNAEGELISGSDDSTIALWDATNDKLKQPIQEWTTSHSDIVNDCQWHCFNTNMFGS 216
           + F+P+ +  L +G++D  I +WD T  K+   +Q     H   +    +      +  S
Sbjct: 358 VCFSPDGK-YLATGAEDKLIRIWDLTTKKILMTLQ----GHEQDIYSLDYFPAGDKLV-S 411

Query: 217 VSEDSTLQLFDKRNGGKSDVKISSKGQYNSIAFSGFSENLFAAAGTTNNIYLYDIRNTGK 276
            S D T++++D R G +  + +S +    ++A S       AA      + ++D   TG 
Sbjct: 412 GSGDRTVRIWDLRTG-QCSLTLSIEDGVTTVAVSPGDGKYIAAGSLDRTVRVWD-SETGF 469

Query: 277 ILHSM-------TGHEEPVTSLEFSNDKDGILISGSSDRRVIMWDLFEIGAEQ 322
           ++  +       TGH++ V S+ F+ D  G+ ISGS DR V +WDL  +  ++
Sbjct: 470 LVERLDSENELSTGHKDSVYSVVFTRDGQGV-ISGSLDRSVKLWDLRGLNGQK 521

 Score = 42.7 bits (99), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 34/93 (36%), Positives = 52/93 (55%), Gaps = 13/93 (13%)

Query: 230 NGGKSDVKI----SSKGQYNSIAFSGFSENLFAAAGTTNN-IYLYDIRNTGKILHSMTGH 284
           NGG++   I    SS     S+ FS   +  + A G  +  I ++D+  T KIL ++ GH
Sbjct: 337 NGGENSATIQPASSSDLYIRSVCFS--PDGKYLATGAEDKLIRIWDL-TTKKILMTLQGH 393

Query: 285 EEPVTSLEF--SNDKDGILISGSSDRRVIMWDL 315
           E+ + SL++  + DK   L+SGS DR V +WDL
Sbjct: 394 EQDIYSLDYFPAGDK---LVSGSGDRTVRIWDL 423

>Ecym_2523 Chr2 complement(1021566..1023506) [1941 bp, 646 aa] {ON}
           similar to Ashbya gossypii AGL234W
          Length = 646

 Score = 55.1 bits (131), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 56/207 (27%), Positives = 98/207 (47%), Gaps = 24/207 (11%)

Query: 121 IATVNGEGTIFIYDCSRDKQSALLSTLKYHKDNAYGLAFNPNAEGELISGSDDSTIALWD 180
           +AT   +  I I+D S  K   +L TL+ H+ + Y L + P A  +L+SGS D T+ +WD
Sbjct: 384 LATGAEDKLIRIWDLSSKK---ILMTLQGHEQDIYSLDYFP-AGDKLVSGSGDRTVRIWD 439

Query: 181 ATNDKLKQPIQEWTTSHSDIVNDCQWHCFNTNMFGSVSEDSTLQLFDKRNG-------GK 233
                L+      T S  D V        +     + S D T++++D   G        +
Sbjct: 440 -----LRTGQCSLTLSIEDGVTTVAVSPGDGKYIAAGSLDRTVRVWDSETGFLVERLDSE 494

Query: 234 SDVKISSKGQYNSIAFSGFSENLFAAAGTTNNIYLYDIRN-TGKILHSM-----TGHEEP 287
           +++    K    S+ F+    ++ + +    ++ L+D+R   G+  H+      TGH++ 
Sbjct: 495 NELSTGHKDSVYSVVFTRDGRSVVSGS-LDRSVKLWDLRGLNGQKSHATCEVTYTGHKDF 553

Query: 288 VTSLEFSNDKDGILISGSSDRRVIMWD 314
           V S+  + D D  ++SGS DR V+ WD
Sbjct: 554 VLSVATTQD-DEYILSGSKDRGVLFWD 579

 Score = 48.9 bits (115), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 42/173 (24%), Positives = 83/173 (47%), Gaps = 16/173 (9%)

Query: 157 LAFNPNAEGELISGSDDSTIALWDATNDKLKQPIQEWTTSHSDIVNDCQWHCFNTNMFGS 216
           + F+P+ +  L +G++D  I +WD ++ K+   +Q     H   +    +      +  S
Sbjct: 375 VCFSPDGK-YLATGAEDKLIRIWDLSSKKILMTLQ----GHEQDIYSLDYFPAGDKLV-S 428

Query: 217 VSEDSTLQLFDKRNGGKSDVKISSKGQYNSIAFSGFSENLFAAAGTTNNIYLYDIRNTGK 276
            S D T++++D R G +  + +S +    ++A S       AA      + ++D   TG 
Sbjct: 429 GSGDRTVRIWDLRTG-QCSLTLSIEDGVTTVAVSPGDGKYIAAGSLDRTVRVWD-SETGF 486

Query: 277 ILHSM-------TGHEEPVTSLEFSNDKDGILISGSSDRRVIMWDLFEIGAEQ 322
           ++  +       TGH++ V S+ F+ D   + +SGS DR V +WDL  +  ++
Sbjct: 487 LVERLDSENELSTGHKDSVYSVVFTRDGRSV-VSGSLDRSVKLWDLRGLNGQK 538

 Score = 40.0 bits (92), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 31/88 (35%), Positives = 50/88 (56%), Gaps = 15/88 (17%)

Query: 231 GGKSDVKISSKGQYNSIAFSGFSENLFAAAGTTNN-IYLYDIRNTGKILHSMTGHEEPVT 289
           G  SD+ I       S+ FS   +  + A G  +  I ++D+ ++ KIL ++ GHE+ + 
Sbjct: 365 GSSSDLYI------RSVCFS--PDGKYLATGAEDKLIRIWDL-SSKKILMTLQGHEQDIY 415

Query: 290 SLEF--SNDKDGILISGSSDRRVIMWDL 315
           SL++  + DK   L+SGS DR V +WDL
Sbjct: 416 SLDYFPAGDK---LVSGSGDRTVRIWDL 440

>YKR036C Chr11 complement(508702..510633) [1932 bp, 643 aa] {ON}
           CAF4WD40 repeat-containing protein associated with the
           CCR4-NOT complex, interacts in a Ccr4p-dependent manner
           with Ssn2p; also interacts with Fis1p, Mdv1p and Dnm1p
           and plays a role in mitochondrial fission
          Length = 643

 Score = 54.7 bits (130), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 58/230 (25%), Positives = 100/230 (43%), Gaps = 50/230 (21%)

Query: 103 AHDGEINRARYMPQNTNIIATVNGEGTIFIYDCSRDKQSAL----------------LST 146
            H   +N  +   +N N++ T + + T+ ++D +  ++  L                +  
Sbjct: 360 GHLATVNCMQIDKKNYNMLITGSKDATLKLWDLNLSREIYLDHSPLKEKTEEIVTPCIHN 419

Query: 147 LKYHKDNAYGLAFNPNAEGELISGSDDSTIALWDATNDKLKQPIQE-WTTSHSDIVNDCQ 205
            + HKD    L+F+  A   L+SGS D  I  WD T  K  Q +   +T +HSDI    +
Sbjct: 420 FELHKDEITALSFDSEA---LVSGSRDKKIFHWDLTTGKCIQQLDLIFTPTHSDIKMPAR 476

Query: 206 WHCFNTNMFGSVSEDSTLQLFDKRNGGKSDVKISSKGQYNSIAFSGFSENLFAAAGTTNN 265
                     S++  + L        G     I +   YNS   +G  + +         
Sbjct: 477 ----------SLNNGACLL-------GTEAPMIGALQCYNSALATGTKDGI--------- 510

Query: 266 IYLYDIRNTGKILHSMTGHEEPVTSLEFSNDKDGILISGSSDRRVIMWDL 315
           + L+D+R  GK +  + GH + +TSL+F ++K   L++GS D  V +WDL
Sbjct: 511 VRLWDLR-VGKPVRLLEGHTDGITSLKFDSEK---LVTGSMDNSVRIWDL 556

 Score = 34.3 bits (77), Expect = 0.57,   Method: Compositional matrix adjust.
 Identities = 41/163 (25%), Positives = 66/163 (40%), Gaps = 35/163 (21%)

Query: 165 GELISGS-DDSTIALWDATNDKLKQPIQEWTT-SHSDIVNDCQWHCFNTNMFGSVSEDST 222
           G L S S  D  + +WD     L   IQ      H   VN  Q    N NM  + S+D+T
Sbjct: 332 GTLCSSSYQDRIVKVWD-----LNHGIQVGELPGHLATVNCMQIDKKNYNMLITGSKDAT 386

Query: 223 LQLFDKRNGGKSDVKISSKGQYNSIAFSGFSENLFAAAGTTNNIYLYDIRNTGKILHSMT 282
           L+L+D        + +S +   +       +E +                     +H+  
Sbjct: 387 LKLWD--------LNLSREIYLDHSPLKEKTEEIVTPC-----------------IHNFE 421

Query: 283 GHEEPVTSLEFSNDKDGILISGSSDRRVIMWDLFEIGAEQQPD 325
            H++ +T+L F ++    L+SGS D+++  WDL      QQ D
Sbjct: 422 LHKDEITALSFDSEA---LVSGSRDKKIFHWDLTTGKCIQQLD 461

>Smik_10.126 Chr10 (196821..198959) [2139 bp, 712 aa] {ON} YJL112W
           (REAL)
          Length = 712

 Score = 54.7 bits (130), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 65/236 (27%), Positives = 108/236 (45%), Gaps = 44/236 (18%)

Query: 141 SALLSTLKYHKDNAYGLAFNPNAEGELISGSDDSTIALWDATNDKLKQPIQEWTTSHSDI 200
           S  + T + H D    L+ +P+    L+SGS D TI  WD  + K  Q I     S +++
Sbjct: 490 SPCVYTFEAHTDEVTALSLDPSF---LVSGSQDRTIRQWDLRSGKCMQTID---LSFANV 543

Query: 201 VNDCQWHCFNTNMFGSVSEDSTLQLFDKRNGGKSDVKISSKGQYNSI-AFSGFSENLFAA 259
           +         TN+  S    STL              ++ + +  SI A   F   L  A
Sbjct: 544 LTAA------TNVDLS---KSTL--------------LTQRSERPSIGALQSFDAAL--A 578

Query: 260 AGTTNNIY-LYDIRNTGKILHSMTGHEEPVTSLEFSNDKDGILISGSSDRRVIMWDLF-- 316
            GT + I  L+D+R +GK++ ++ GH + +TSL+F ++    L++GS DR V +WDL   
Sbjct: 579 TGTKDGIVRLWDLR-SGKVIRTLKGHTDAITSLKFGSE---CLVTGSYDRTVRVWDLRTG 634

Query: 317 ---EIGAEQQPDEADDGLPEVMMIHAGSRSAINDISTHPSIPWLNASVEENNIVQV 369
              +  A  +P  + D   E   +   + +A+    ++    W  + VE+ N V V
Sbjct: 635 LLSKFHAYSEPILSLDLCQENAAVIVANETAVQIYDSNKDESW--SCVEQGNEVNV 688

>Kwal_14.1710 s14 (433526..435250) [1725 bp, 574 aa] {ON} YGL116W
           (CDC20) - anaphase promoting complex subunit [contig
           237] FULL
          Length = 574

 Score = 54.7 bits (130), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 59/233 (25%), Positives = 107/233 (45%), Gaps = 25/233 (10%)

Query: 120 IIATVNGEGTIFIYDCSRDKQSALLSTLKYHKDNAYGLAFNPNAEGELISGSDDSTIALW 179
           +IAT +  G I I D     ++ ++ST + HK    G+A+ P+   +L SGS+D+T+A+W
Sbjct: 333 LIATGSKSGEIHINDVR--IKNHIVSTWEEHKGEVCGIAYRPDGL-QLASGSNDNTVAIW 389

Query: 180 DATNDKLKQPIQEWTTSHSDIVNDCQWHCFNTNMF--GSVSEDSTLQLFDKRNGGKSDVK 237
           D T   L Q I+     H+  V    W    +N+   G    D  +  ++   G ++   
Sbjct: 390 D-TRTSLPQHIKR---QHTAAVKALAWSPDISNLLATGGGQTDKHIHFWNTTTGARTG-S 444

Query: 238 ISSKGQYNSIAF------SGFSENLFAAAGTTNN---IYLYDIR-NTGKILHSMTGHEEP 287
           I++  Q +S+ +      +     + A  G   N   IY YD +    +I+H+   HE  
Sbjct: 445 INTGSQVSSLHWGQSYNSNAIQREIVATGGIPENAVSIYNYDTKFKVAEIVHA---HEAR 501

Query: 288 VTSLEFSNDKDGILISGSSDRRVIMWDLFEIGAEQQPDEADDGLPEVMMIHAG 340
           + S + S D   +L +   D  +  + +FE    ++P    DG   + +++ G
Sbjct: 502 ICSSQLSPDGT-VLATVGGDENLKFYKVFE-PRRKRPQGVCDGESLMGLLNVG 552

>NCAS0D04780 Chr4 (916321..918186) [1866 bp, 621 aa] {ON} Anc_6.363
          Length = 621

 Score = 54.7 bits (130), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 59/223 (26%), Positives = 103/223 (46%), Gaps = 33/223 (14%)

Query: 139 KQSALLSTLKYHKDNAYGLAFNPNAEGELISGSDDSTIALWDATNDKLKQPIQEWTTSHS 198
           K+  ++  LK H+ + Y L + P+ + +L+SGS D +I +WD     LK      T S  
Sbjct: 371 KERKIVMVLKGHEQDIYSLDYFPDGQ-KLVSGSGDRSIRIWD-----LKTGQCSLTLSIE 424

Query: 199 DIVNDCQWHCFNTNMFGSVSEDSTLQLFDKRNGG-----KSDVKISSKGQYNSIAFSGFS 253
           D V           +  + S D +++++D   G       SD + S  G  +S+    F+
Sbjct: 425 DGVTTVAVSPNEGKLIAAGSLDRSVRIWDSSTGFLVERLDSDNE-SGNGHQDSVYSVAFT 483

Query: 254 EN--LFAAAGTTNNIYLYDIRNT----GKILHSMTGHEEPVTSLEFSNDKDGILISGSSD 307
           ++     +      + L+++ +T    GK   +  GH++ V S+  SND D  + SGS D
Sbjct: 484 KDGQHVVSGSLDRTVKLWNLGDTQSGTGKCEVTYIGHKDFVLSVATSND-DKYIFSGSKD 542

Query: 308 RRVIMWDLFEIGAEQQPDEADDGLPEVMMIHAGSRSAINDIST 350
           R VI+WD             D G P +M+   G R+++  ++T
Sbjct: 543 RGVIIWD------------KDSGNPILML--QGHRNSVISVAT 571

>KLTH0A06754g Chr1 complement(560921..562465) [1545 bp, 514 aa] {ON}
           highly similar to uniprot|P25382 Saccharomyces
           cerevisiae YCR072C Protein required for cell viability
          Length = 514

 Score = 54.3 bits (129), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 57/206 (27%), Positives = 89/206 (43%), Gaps = 26/206 (12%)

Query: 115 PQNTNIIATVNGEGTIFIYDCSRDKQSALLSTLKYHKDNAYGLAFNPNAEGELISGSDDS 174
           P +   +A+ + +GTI I+D +R      L TL  H ++   + +     G L SGS D 
Sbjct: 244 PGDKPRLASASKDGTIKIWDTAR---RVCLFTLSGHTNSVSCVKWG--GRGVLYSGSHDK 298

Query: 175 TIALWDATNDKLKQPIQEWTTSHSDIVNDCQWHCFNTNMFGSVSEDSTLQL--FD---KR 229
           TI  WD               +    +N  + H    N   S+S D  L++  FD   K+
Sbjct: 299 TIRAWD-------------MNAGGKCINILKSHAHWINHL-SLSTDYALRVGAFDHTGKK 344

Query: 230 NGGKSDVKISSKGQYNSIAF-SGFSENLFAAAGTTNNIYLYDIRNTGKILHSMTGHEEPV 288
                + +  +   Y  IA  +G  E L   A     +YL+D   + K +  MTGH++ V
Sbjct: 345 PSSPEEARAKALENYEKIAKKNGKLEELMVTASDDFTMYLWDPIKSTKPITRMTGHQKLV 404

Query: 289 TSLEFSNDKDGILISGSSDRRVIMWD 314
             + FS D   I +S S D  + +WD
Sbjct: 405 NHVAFSPDGRYI-VSASFDNSIKLWD 429

 Score = 40.8 bits (94), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 40/179 (22%), Positives = 75/179 (41%), Gaps = 17/179 (9%)

Query: 145 STLKYHKDNAYGLAFNPNAEGELISGSDDSTIALWDATNDKLKQPIQEWTTSHSDIVNDC 204
           S +  H       AF P+    +++G+ D+T  +WD   +   Q ++     H + V   
Sbjct: 136 SAIAGHGSTILCSAFAPHTSSRMVTGAGDNTARIWDCNTNTPMQTLK----GHFNWVLCV 191

Query: 205 QWHCFNTNMFGSVSEDSTLQLFDKRNG--------GKSDVKISSKGQYNSIAFSGFSENL 256
            W   +  +  + S D+T++L+    G        G S    S   +   +   G    L
Sbjct: 192 AWSP-DGELIATGSMDNTIRLWQSEKGENFGDALRGHSKWITSLSWEPIHLVKPGDKPRL 250

Query: 257 FAAAGTTNNIYLYDIRNTGKILHSMTGHEEPVTSLEFSNDKDGILISGSSDRRVIMWDL 315
            A+A     I ++D       L +++GH   V+ +++     G+L SGS D+ +  WD+
Sbjct: 251 -ASASKDGTIKIWDTARR-VCLFTLSGHTNSVSCVKWGG--RGVLYSGSHDKTIRAWDM 305

 Score = 32.0 bits (71), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 19/84 (22%), Positives = 41/84 (48%), Gaps = 5/84 (5%)

Query: 103 AHDGEINRARYMPQNTNIIATVNGEGTIFIYDCSRDKQSALLSTLKYHKDNAYGLAFNPN 162
            H   +N   + P    I+ + + + +I ++D    +    ++T + H  + Y +A++ +
Sbjct: 399 GHQKLVNHVAFSPDGRYIV-SASFDNSIKLWD---GRDGTFIATFRGHVASVYQVAWSSD 454

Query: 163 AEGELISGSDDSTIALWDATNDKL 186
               L+S S D+T+ +WD    KL
Sbjct: 455 CR-LLVSCSKDTTLKVWDVRTKKL 477

>KLLA0E19515g Chr5 complement(1733708..1735426) [1719 bp, 572 aa]
           {ON} similar to uniprot|P21304 Saccharomyces cerevisiae
           YLR196W PWP1
          Length = 572

 Score = 54.3 bits (129), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 47/173 (27%), Positives = 77/173 (44%), Gaps = 13/173 (7%)

Query: 149 YHKDNAYGLAFNPNAEGELISGSDDSTIALWDATNDKLKQPIQEWTTSHSDI-VNDCQWH 207
           +H D    LA N      L S S D T+ LWD       + +      HS+  V+  QWH
Sbjct: 286 HHTDAILSLAHNKQFRAVLASTSADHTVKLWDLNTATAARSL---INIHSNTNVSASQWH 342

Query: 208 CFNTNMFGSVSEDSTLQLFDKRNGGKSDV----KISSKGQYNSIAFSGFSENLFAAAGTT 263
             N ++  +   DS   L D R    +D+     +SS  +   + F+   EN+F      
Sbjct: 343 PSNGSVLLTAGYDSRAALSDVRIENDNDMSKYWNVSSGEEIECVRFA--DENIFICGTDN 400

Query: 264 NNIYLYDIRNTG--KILHSMTGHEEPVTSLEFSND-KDGILISGSSDRRVIMW 313
            N+Y +DIRN    K + ++  H+  V+S+E +    + +L S   ++ V +W
Sbjct: 401 GNVYSFDIRNGAESKPVWTLKAHDAGVSSVEINRHIPNMLLTSAMGEKPVKLW 453

>TPHA0E03080 Chr5 complement(646691..648157) [1467 bp, 488 aa] {ON}
           Anc_5.201 YLL011W
          Length = 488

 Score = 54.3 bits (129), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 50/176 (28%), Positives = 83/176 (47%), Gaps = 12/176 (6%)

Query: 139 KQSALLSTLKYHKDNAY-GLAFNPNAEGELISGSDDSTIALWDATNDKLKQPIQEWTTSH 197
           K   LL T  Y+ D+A+ GL  + N    +  G+    I LWDA   K   PI   T   
Sbjct: 162 KGDGLLKT--YYGDHAFFGLDHHRNNSTFVTGGAQ---IQLWDANRSK---PISNLTWG- 212

Query: 198 SDIVNDCQWHCFNTNMFGSVSEDSTLQLFDKRNGGKSDVKISSKGQYNSIAFSGFSENLF 257
           +D V   +++   T++  S   D+++ L+D R    +  KI    + N+I ++      F
Sbjct: 213 ADNVTSVKFNQTETDILASTGSDNSIVLYDLRTNSPTQ-KIRQSMRTNAICWNPMEAFNF 271

Query: 258 AAAGTTNNIYLYDIRNTGKILHSMTGHEEPVTSLEFSNDKDGILISGSSDRRVIMW 313
             A   +N Y YD+RN  + L+    H   V  ++FS   D I ++GS D+ + ++
Sbjct: 272 VIANEDHNAYYYDMRNMSRALNVFKDHVSAVMDVDFSPTGDEI-VTGSYDKTIRIY 326

 Score = 35.4 bits (80), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 46/184 (25%), Positives = 78/184 (42%), Gaps = 24/184 (13%)

Query: 150 HKDNAYGLAFNPNAEGELISGSDDSTIALWDATNDKLKQPIQEWTTSHSDIVNDC---QW 206
           H+D  Y +A N N   +L S S D  +  ++ +    ++ I  +   +  +   C   + 
Sbjct: 66  HRDGVYTIAKNYNQLNKLASSSADGVVKYFNMST---REEICSFKAHYGLVTGLCVRPET 122

Query: 207 HCFNTNMFGSVS--EDSTLQLF-----DKRNGGKSDVKISSKG----QYNSIAFSGFSEN 255
              N N    +S  +D T++L+     D  N  K D      G     Y   AF G   +
Sbjct: 123 SATNKNEHYMISCGDDKTVKLWSVDSNDFSNNKKDDTIHKGDGLLKTYYGDHAFFGLDHH 182

Query: 256 ----LFAAAGTTNNIYLYDIRNTGKILHSMTGHEEPVTSLEFSNDKDGILISGSSDRRVI 311
                F   G    I L+D  N  K + ++T   + VTS++F+  +  IL S  SD  ++
Sbjct: 183 RNNSTFVTGGA--QIQLWDA-NRSKPISNLTWGADNVTSVKFNQTETDILASTGSDNSIV 239

Query: 312 MWDL 315
           ++DL
Sbjct: 240 LYDL 243

>CAGL0A04037g Chr1 complement(404063..405814) [1752 bp, 583 aa] {ON}
           highly similar to uniprot|P21304 Saccharomyces
           cerevisiae YLR196w PWP1
          Length = 583

 Score = 54.3 bits (129), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 46/178 (25%), Positives = 80/178 (44%), Gaps = 23/178 (12%)

Query: 149 YHKDNAYGLAFNPNAEGELISGSDDSTIALWDATNDKLKQPIQEWTTSHSDIVNDCQWHC 208
           +H D    LA N      L S S D T+ LWD  N    + +    ++ +  V+  QWH 
Sbjct: 288 HHTDAVLSLAHNRQFRTVLASTSADHTVKLWDLNNATAARSMANIHSNKN--VSSSQWHM 345

Query: 209 FNTNMFGSVSEDSTLQLFDKRNGGKSDVKISSKGQYNS---------IAFSGF-SENLFA 258
            N ++  +   DS   L        +DV+IS + Q +          I  + F SEN+  
Sbjct: 346 QNASILLTAGYDSRAAL--------TDVRISDEAQMSKYWSVLPGEEIETATFASENIIL 397

Query: 259 AAGTTNNIYLYDIRNT--GKILHSMTGHEEPVTSLEFSNDKDGILISGS-SDRRVIMW 313
                 N+Y +DIRN    K + ++  H+  ++SL  +    G++ +G+  +++V +W
Sbjct: 398 CGTDAGNVYSFDIRNNEGSKPVWTLKAHDAGISSLSCNRFISGMMATGAMGEKQVKLW 455

>ZYRO0D08206g Chr4 (711937..713484) [1548 bp, 515 aa] {ON} highly
           similar to uniprot|P25382 Saccharomyces cerevisiae
           YCR072C Protein required for cell viability
          Length = 515

 Score = 54.3 bits (129), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 53/200 (26%), Positives = 86/200 (43%), Gaps = 26/200 (13%)

Query: 121 IATVNGEGTIFIYDCSRDKQSALLSTLKYHKDNAYGLAFNPNAEGELISGSDDSTIALWD 180
           +A+ + +GTI I+D SR      L TL  H ++   + +    +G L +GS D TI +WD
Sbjct: 251 LASASKDGTIKIWDASR---RTCLYTLSGHTNSVSCVKWG--GQGLLYTGSHDKTIRVWD 305

Query: 181 ATNDKLKQPIQEWTTSHSDIVNDCQWHCFNTNMFGSVSEDSTLQLFDKRNGGKSDVK--- 237
                          +    +N  + H    N   S+S D  +++      GK+      
Sbjct: 306 -------------IKAGGKCINILKSHAHWVNHL-SLSTDYAIRVGPFGPDGKASPSPQE 351

Query: 238 ---ISSKGQYNSIAFSGFSENLFAAAGTTNNIYLYDIRNTGKILHSMTGHEEPVTSLEFS 294
              I+ K     +  SG  E L   A     ++L++   + K L  MTGH++ V  + FS
Sbjct: 352 ARDIAKKNYEKVVRKSGQVEELMVTASDDFTMFLWNPLKSAKPLARMTGHQKLVNHVAFS 411

Query: 295 NDKDGILISGSSDRRVIMWD 314
            D   I +S S D  + +WD
Sbjct: 412 PDGRYI-VSASFDNSIKLWD 430

 Score = 43.5 bits (101), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 40/167 (23%), Positives = 79/167 (47%), Gaps = 19/167 (11%)

Query: 158 AFNPNAEGELISGSDDSTIALWDATNDKLKQPIQEWTTSHSDIVNDCQWHCFNTNMFGSV 217
           AF P+    +++G+ D+T  +WD      + P+      HS+ V    W   +  +  + 
Sbjct: 150 AFAPDTSSRMVTGAGDNTARIWDCAT---QTPLSV-LKGHSNWVLCVAWSP-DGELIATG 204

Query: 218 SEDSTLQLFDKRNG--------GKSDVKISSKGQYNSIAFSGFSENLFAAAGTTNNIYLY 269
           S D+T++L++ + G        G S    S   +   +  +G    L A+A     I ++
Sbjct: 205 SMDNTIRLWESKAGKPWGDAMKGHSKWITSLTWEPLHLVAAGDKPRL-ASASKDGTIKIW 263

Query: 270 DI-RNTGKILHSMTGHEEPVTSLEFSNDKDGILISGSSDRRVIMWDL 315
           D  R T   L++++GH   V+ +++     G+L +GS D+ + +WD+
Sbjct: 264 DASRRT--CLYTLSGHTNSVSCVKWGG--QGLLYTGSHDKTIRVWDI 306

 Score = 32.0 bits (71), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 21/84 (25%), Positives = 43/84 (51%), Gaps = 5/84 (5%)

Query: 103 AHDGEINRARYMPQNTNIIATVNGEGTIFIYDCSRDKQSALLSTLKYHKDNAYGLAFNPN 162
            H   +N   + P    I+ + + + +I ++D  RD +   ++T + H  + Y +A++ +
Sbjct: 400 GHQKLVNHVAFSPDGRYIV-SASFDNSIKLWD-GRDGK--FIATFRGHVASVYQVAWSSD 455

Query: 163 AEGELISGSDDSTIALWDATNDKL 186
               L+S S D+T+ +WD    KL
Sbjct: 456 CR-LLVSCSKDTTLKVWDVKTRKL 478

>Kpol_1041.20 s1041 complement(56019..57566) [1548 bp, 515 aa] {ON}
           complement(56019..57566) [1548 nt, 516 aa]
          Length = 515

 Score = 54.3 bits (129), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 81/399 (20%), Positives = 154/399 (38%), Gaps = 53/399 (13%)

Query: 25  PLLYDFVSETRLTWPSLTLQWLPGDKTSTR----QHLILGTLTSGAETDYLKIAALDLPD 80
           P +Y+ +    L WP +TL  +P    S R    Q +++ T T  A+    ++  L L  
Sbjct: 120 PTVYEMLHNVNLPWPCMTLDIIPDTYGSERRNYPQSILMTTATQAAKKKDNELMVLKLSQ 179

Query: 81  E----IIIGXXXXXXXXXXXXXXXXFAHDGEI------NRARYMPQNTN----IIATVNG 126
                +                      D  +      NR R  P  ++    + AT++ 
Sbjct: 180 LSKTLVKENEEEEEDEDNSDNESDPILEDENVPLKDTTNRLRVSPFASSGQEVLTATMSE 239

Query: 127 EGTIFIYDCSRDKQS-------------ALLSTLKYHKD-NAYGLAFNPNAE-GELISGS 171
            G ++I+D +   ++               + T++ H +   Y L ++P    G L++G 
Sbjct: 240 NGEVYIFDIAPQSRAFDTPGYQIPKTAKRPIHTIRNHGNVEGYALDWSPLIRSGALLTGD 299

Query: 172 DDSTIALWDATNDKLKQPIQEWTTSHSDIVNDCQWHCFNTNMFGSVSEDSTLQLFDKRNG 231
               +        K     Q +T S++  + D QW      +F +   D  ++++D R+ 
Sbjct: 300 CSGQVYFTQRHTSKWVTDKQPFTVSNNKSIEDIQWSRTEATVFATAGCDGYIRVWDTRSK 359

Query: 232 GKSDVKISSKGQYNSIAFSGFSENL--FAAAGTTNNIY-LYDIRN------TGKILHSMT 282
            K    IS+K     +    ++E +    A+G  N  + ++D+R         + +    
Sbjct: 360 -KHKPAISTKASNTDVNVISWNEKMGYLLASGDDNGTWGVWDLRQFSPSNENAQPVAQYD 418

Query: 283 GHEEPVTSLEFSNDKDGILISGSSDRRVIMWDL-FEIGAE---QQPDEADDGL---PEVM 335
            H+  +TS+ F    + I+   S D  V +WDL  E   E   QQ  E  +     P+++
Sbjct: 419 FHKGAITSISFHPTDESIVAVASEDNTVTLWDLSVEADDEEIKQQTAETKELAQIPPQLL 478

Query: 336 MIHAGSRSAINDISTHPSIPWLNASVEENNIVQVWKCSS 374
            +H   +  + D+  H  IP    S   + +  +WK  S
Sbjct: 479 FVHW--QKEVKDVKWHKQIPGCLVSTGTDGL-NIWKTIS 514

>TDEL0D01310 Chr4 complement(251119..253248) [2130 bp, 709 aa] {ON}
           Anc_1.247 YKR036C
          Length = 709

 Score = 53.9 bits (128), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 55/177 (31%), Positives = 82/177 (46%), Gaps = 37/177 (20%)

Query: 140 QSALLSTLKYHKDNAYGLAFNPNAEGELISGSDDSTIALWDATNDKLKQPIQEWTTSHSD 199
           ++A + T   H D    L+F+    G L+SGS D T+  WD T+ K  Q I         
Sbjct: 487 ETACVYTFDSHVDEITALSFDS---GHLVSGSQDRTVRQWDLTSGKCLQTI--------- 534

Query: 200 IVNDCQWHCFNTNMFGSVSEDSTLQLFDKRNGGKSDVKISSKGQYNSIAFSGFSENLFAA 259
                     + +  G +S+ S+       N G S +  S+       A   F   L  A
Sbjct: 535 ----------DLSFAGRLSQTSS-------NSG-SGLLTSTDTSPIIGALQCFDAAL--A 574

Query: 260 AGTTNN-IYLYDIRNTGKILHSMTGHEEPVTSLEFSNDKDGILISGSSDRRVIMWDL 315
            GT +  + L+D+R +GKI+ ++ GH   VTSL+F +     LI+GS DR V +WDL
Sbjct: 575 TGTRDGAVRLWDLR-SGKIIRTLEGHTGAVTSLKFDSKN---LITGSLDRSVRIWDL 627

>ZYRO0E08184g Chr5 (639823..641343) [1521 bp, 506 aa] {ON} similar
           to uniprot|Q12523 Saccharomyces cerevisiae YPL247C
           Hypothetical ORF
          Length = 506

 Score = 53.5 bits (127), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 58/242 (23%), Positives = 101/242 (41%), Gaps = 35/242 (14%)

Query: 159 FNPNAEGELISGSDDSTIALWDATNDKLKQPIQEWTTSHSDIVNDCQWHCFNTNMFGSVS 218
           +NP     LIS S D+T  +WD  +      ++    +H   V D ++    T +F S  
Sbjct: 251 WNPVDPNLLISSSIDTTCIVWDLQSSNY---VRTQLIAHDSEVYDVRFLTQTTQLFSSCG 307

Query: 219 EDSTLQLFDKRNGGKSDVKISSKGQYNSIAF-----------------------SGFSEN 255
            D ++++FD R    S +         ++                         S F  N
Sbjct: 308 GDGSVRVFDLRCLAHSTIIYEPPSSPATLQPTTAAGSSSAADSDTGVPLLRLEPSPFDPN 367

Query: 256 LFAA-AGTTNNIYLYDIRNTGKILHSMTGHEEPVTSLEFSNDKDGILISGSSDRRVIMWD 314
           + A  A  +  + + D+RN G  +  + GH   V  + +   K  +L+S + D +V+ WD
Sbjct: 368 VIATFAIDSPRVLILDMRNPGSPVLVLEGHSAAVNQMRWHPSKRNVLLSCADDCQVLYWD 427

Query: 315 L--FEIG--AEQQPDEADDGLPEVMMIHA-GSRSAINDISTHPSIPWLNASVEENNIVQV 369
           L  + +G   +Q PD A D   +   +    S++ +  + T PS+ + N   E NNI  V
Sbjct: 428 LNNYIMGHPTDQDPDHAVDSQQQNNPVAKWNSKNVLRTLDT-PSMFYSNGGQEVNNI--V 484

Query: 370 WK 371
           W+
Sbjct: 485 WR 486

 Score = 32.3 bits (72), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 33/151 (21%), Positives = 60/151 (39%), Gaps = 28/151 (18%)

Query: 103 AHDGEINRARYMPQNTNIIATVNGEGTIFIYDCSRDKQSALL-------STLK------- 148
           AHD E+   R++ Q T + ++  G+G++ ++D      S ++       +TL+       
Sbjct: 285 AHDSEVYDVRFLTQTTQLFSSCGGDGSVRVFDLRCLAHSTIIYEPPSSPATLQPTTAAGS 344

Query: 149 -YHKDNAYGL--------AFNPNAEGELISGSDDSTIALWDATNDKLKQPIQEWTTSHSD 199
               D+  G+         F+PN         D   + + D  N      + E    HS 
Sbjct: 345 SSAADSDTGVPLLRLEPSPFDPNVIATF--AIDSPRVLILDMRNPGSPVLVLE---GHSA 399

Query: 200 IVNDCQWHCFNTNMFGSVSEDSTLQLFDKRN 230
            VN  +WH    N+  S ++D  +  +D  N
Sbjct: 400 AVNQMRWHPSKRNVLLSCADDCQVLYWDLNN 430

 Score = 30.4 bits (67), Expect = 7.8,   Method: Compositional matrix adjust.
 Identities = 19/58 (32%), Positives = 28/58 (48%), Gaps = 5/58 (8%)

Query: 258 AAAGTTNNIYLYDIRNTGKILHSMTGHEEPVTSLEFSNDKDGILISGSSDRRVIMWDL 315
           AAAG + +I     R   +    + G   P+TS  ++     +LIS S D   I+WDL
Sbjct: 221 AAAGGSGSI-----RTNPQQQQGLIGELPPITSFHWNPVDPNLLISSSIDTTCIVWDL 273

>TDEL0G03340 Chr7 (618276..619820) [1545 bp, 514 aa] {ON} Anc_2.401
           YMR131C
          Length = 514

 Score = 53.5 bits (127), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 84/400 (21%), Positives = 160/400 (40%), Gaps = 54/400 (13%)

Query: 25  PLLYDFVSETRLTWPSLTLQWLP-GDKTSTR---QHLILGTLTSGA-----ETDYLKIAA 75
           P +Y+ +    + WP LTL  +P G  T  R   Q +++ T T  +     E   LK++ 
Sbjct: 118 PTVYEMLHNVNMPWPCLTLDIIPDGLGTERRNYPQSILMATATQASKKKENELMVLKLSQ 177

Query: 76  LDLPDEIIIGXXXXXXXXXXXXXXXXFAHDGEI------NRARYMPQNTN---IIATVNG 126
           L+                           + EI      NR +  P  ++   + AT++ 
Sbjct: 178 LNKTLVKDDADEEEDDEDDEDNDSDPIIENEEISLRDTTNRLKISPFASSQEVLTATMSE 237

Query: 127 EGTIFIYDCSRDKQS-------------ALLSTLKYHKD-NAYGLAFNPNAE-GELISGS 171
            G ++I+D     ++               L T++ H +   YGL ++P  + G L++G 
Sbjct: 238 NGEVYIHDLGPQTKAFETPGYQIPKSAKKPLHTIRNHGNVEGYGLDWSPLIKTGALLTGD 297

Query: 172 DDSTIALWDATNDKLKQPIQEWTTSHSDIVNDCQWHCFNTNMFGSVSEDSTLQLFDKRNG 231
               + L      K     Q +T S++  + D QW    + +F +   D  ++++D R+ 
Sbjct: 298 CSGQVYLTQRHTSKWVTDKQPFTFSNNKSIEDIQWSRTESTVFATSGCDGYIRIWDTRSK 357

Query: 232 GKSDVKISSKGQYNSIAFSGFSEN---LFAAAGTTNNIYLYDIR----NTGKILHSMTG- 283
            K    IS++     +    ++E    L A+        ++D+R    N  + +  +   
Sbjct: 358 -KHKPAISTRASATDVNVISWNEKIGYLLASGDDDGRWGVWDLRQLSPNNSENVQPVAQY 416

Query: 284 --HEEPVTSLEFSNDKDGILISGSSDRRVIMWDL-FEIGAEQQPDEADDGL------PEV 334
             H+  +TS+ F+   + I+   S D  V +WDL  E   E+   +A +        P++
Sbjct: 417 DFHKGAITSISFNPLDESIIAVASEDNTVTLWDLSVEADDEEIKQQAAETKELQQIPPQL 476

Query: 335 MMIHAGSRSAINDISTHPSIPWLNASVEENNIVQVWKCSS 374
           + +H   +  + D+  H  IP    S   + +  VWK  S
Sbjct: 477 LFVHW--QKEVKDVKWHRQIPGCLVSTGTDGL-NVWKTIS 513

>NDAI0B05630 Chr2 complement(1376242..1377549) [1308 bp, 435 aa]
           {ON} Anc_5.429 YDR364C
          Length = 435

 Score = 53.5 bits (127), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 54/216 (25%), Positives = 96/216 (44%), Gaps = 23/216 (10%)

Query: 130 IFIYDCSRDKQSALLSTLKYHKDNAYGLAFNPNAEGELISGSDDSTIALWDATNDKLKQP 189
           +  Y C   K++    TL  H +    L   P     ++SG +D+ + +WD  +D  ++ 
Sbjct: 123 VLSYKCYLPKRTKY--TLSGHINGTTSLKLLPKTGHLILSGGNDNVVKIWDFYHD--RKV 178

Query: 190 IQEWTTSHSDIVNDCQWHCFNTN--MFGSVSEDSTLQLFDKRNGGKSDVKISSKGQY--- 244
           ++++   HS  +      CFN +   F S S D T++++D  +G      I  K ++   
Sbjct: 179 LRDY-KGHSKAIKSL---CFNDDGTKFISSSFDRTVKIWDTESGS-----IQKKLRFGCI 229

Query: 245 -NSIAFSGFSENLFAAAGTTNNIYLYDIRNTGK--ILHSMTGHEEPVTSLEFSNDKDGIL 301
            N+I F   + N F    + + IY YD R + K   +     H   + +LE+  D     
Sbjct: 230 PNAIKFRPLNSNEFIVGLSNSKIYHYDDRISAKDGRVQVYDHHMSSILALEYFPDGSK-F 288

Query: 302 ISGSSDRRVIMWD-LFEIGAEQQPDEADDGLPEVMM 336
           IS S D+ V +W+    I  +Q  D A   +P + +
Sbjct: 289 ISSSEDKTVRLWENQINIPIKQISDTAQHSMPYISI 324

>Suva_16.159 Chr16 complement(275378..276733) [1356 bp, 451 aa] {ON}
           YPL151C (REAL)
          Length = 451

 Score = 53.5 bits (127), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 44/160 (27%), Positives = 80/160 (50%), Gaps = 12/160 (7%)

Query: 158 AFNPNAEGELISGSDDSTIALWDATNDKLKQPIQEWTTSHSDIVNDCQWHCFNTNMFGSV 217
           A +P      ++GS+D+T+ +WD  + KLK  +    T H   V D      +  +F SV
Sbjct: 146 AIDPVDNEWFVTGSNDTTMKVWDLASGKLKVTL----TGHVMTVRDIAVSDRHPYLF-SV 200

Query: 218 SEDSTLQLFDKRNGGKSDVKISSKGQYNSIAFSGF--SENLFAAAGTTNNIYLYDIRNTG 275
           SED T++ +D     K+ +     G  + +       + +L A AG  + + L+DIR   
Sbjct: 201 SEDKTVKCWDLE---KNQIIRDYHGHLSGVRTVSIHPTLDLIATAGRDSVVKLWDIRTRV 257

Query: 276 KILHSMTGHEEPVTSLEFSNDKDGILISGSSDRRVIMWDL 315
            ++ ++ GH+ P+  +E +   D  ++S S+D  V +WD+
Sbjct: 258 PVI-TLVGHKGPINQVECA-PVDPQIVSSSTDATVRLWDI 295

 Score = 31.6 bits (70), Expect = 3.8,   Method: Compositional matrix adjust.
 Identities = 48/221 (21%), Positives = 92/221 (41%), Gaps = 34/221 (15%)

Query: 119 NIIATVNGEGTIFIYDCSRDKQSALLSTLKYHKDNAYGLAFNPNAEGELISGSDDSTIAL 178
           ++IAT   +  + ++D    +    + TL  HK     +   P  + +++S S D+T+ L
Sbjct: 237 DLIATAGRDSVVKLWDI---RTRVPVITLVGHKGPINQVECAP-VDPQIVSSSTDATVRL 292

Query: 179 WDATNDKLKQPIQEWTTSHSDIVNDCQWHCFNTNMFGSVSEDSTLQLFDKRNGGKSDVKI 238
           WD    K  + +    T H   V     H    +M  + ++D        R+ G +D  +
Sbjct: 293 WDIVAGKAMKVL----THHKRSVRAIALHPNEFSMASACTDDI-------RSWGLADGSL 341

Query: 239 ------SSKGQYNSIAFSGFSENLFAAAGTTNNIYLYDIRNTGKILHSMTGHEEPVTSLE 292
                    G  N+++ +   +++  A G    +  YD ++  K  +      E + SLE
Sbjct: 342 LTNFESEKTGIINTLSIN--QDDVLFAGGDDGMLSFYDYKSGHK--YQSLATREMIGSLE 397

Query: 293 FSN-------DKDGI-LISGSSDRRVIMWDLFEIGA-EQQP 324
                     DK G+ LI+G +D+ + +W   E  + E +P
Sbjct: 398 SERGVLCSTFDKTGLRLITGETDKSIKIWKQDETASRESEP 438

>Skud_10.102 Chr10 (173179..175305) [2127 bp, 708 aa] {ON} YJL112W
           (REAL)
          Length = 708

 Score = 53.5 bits (127), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 54/177 (30%), Positives = 85/177 (48%), Gaps = 37/177 (20%)

Query: 141 SALLSTLKYHKDNAYGLAFNPNAEGELISGSDDSTIALWDATNDKLKQPIQEWTTSHSDI 200
           S  + T + H D    L+ +PN    L+SGS D TI  WD  + K  Q I     S +++
Sbjct: 486 SPCVFTFEAHIDEVTALSLDPNF---LVSGSQDRTIRQWDLCSGKCMQTID---LSFANV 539

Query: 201 VNDCQWHCFNTNMFGSVSEDSTLQLFDKRNGGKSDVKISSKGQYNSI-AFSGFSENLFAA 259
           +         TN+  S    STL              ++ + +  +I A   F   L  A
Sbjct: 540 LTTA------TNVDLS---KSTL--------------LTQRSERPTIGALQSFDAAL--A 574

Query: 260 AGTTNNIY-LYDIRNTGKILHSMTGHEEPVTSLEFSNDKDGILISGSSDRRVIMWDL 315
            GT + I  L+D+R +GK++ ++ GH + +TSL+F +     L++GS DR V +WDL
Sbjct: 575 TGTKDGIVRLWDLR-SGKVIRTLEGHTDAITSLKFDS---ACLVTGSYDRTVRVWDL 627

>KNAG0I01050 Chr9 complement(200338..203817) [3480 bp, 1159 aa] {ON}
           Anc_8.288 YDR128W
          Length = 1159

 Score = 53.5 bits (127), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 33/127 (25%), Positives = 64/127 (50%)

Query: 197 HSDIVNDCQWHCFNTNMFGSVSEDSTLQLFDKRNGGKSDVKISSKGQYNSIAFSGFSENL 256
           HS  + D  ++  + ++  + S D+ +  +D R+  +     SS     S     F ++ 
Sbjct: 114 HSRAITDINFNSQHPDILATCSIDTYVHAWDMRSPHRPFYTTSSWRSSASQVKWNFKDSN 173

Query: 257 FAAAGTTNNIYLYDIRNTGKILHSMTGHEEPVTSLEFSNDKDGILISGSSDRRVIMWDLF 316
             A+   N+++++D+R+    LH +TGH   V S++FS  ++  ++S S+D  V  WDL 
Sbjct: 174 ILASSHGNDVFIWDLRHGSTPLHKLTGHNSGVNSIDFSRFEENKIMSSSNDGTVKFWDLS 233

Query: 317 EIGAEQQ 323
           +    QQ
Sbjct: 234 KEEKCQQ 240

 Score = 35.8 bits (81), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 36/166 (21%), Positives = 74/166 (44%), Gaps = 11/166 (6%)

Query: 120 IIATVNGEGTIFIYDCSRDKQSALLSTLKYHKDNAYGLAFNPNAEGELISGSDDSTIALW 179
           I++T N +    I++ ++   +A+   L  H      + FN      L + S D+ +  W
Sbjct: 86  IVSTSNQKA--IIWNLNKPSSNAIEYALHGHSRAITDINFNSQHPDILATCSIDTYVHAW 143

Query: 180 DATNDKLKQPIQEWTTSHS--DIVNDCQWHCFNTNMFGSVSEDSTLQLFDKRNGGKSDVK 237
           D     ++ P + + T+ S     +  +W+  ++N+  S S  + + ++D R+G     K
Sbjct: 144 D-----MRSPHRPFYTTSSWRSSASQVKWNFKDSNILAS-SHGNDVFIWDLRHGSTPLHK 197

Query: 238 ISSKGQ-YNSIAFSGFSENLFAAAGTTNNIYLYDIRNTGKILHSMT 282
           ++      NSI FS F EN   ++     +  +D+    K   ++T
Sbjct: 198 LTGHNSGVNSIDFSRFEENKIMSSSNDGTVKFWDLSKEEKCQQAIT 243

 Score = 33.5 bits (75), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 22/76 (28%), Positives = 40/76 (52%), Gaps = 4/76 (5%)

Query: 116 QNTNIIATVNGEGTIFIYDCSRDKQSALLSTLKYHKDNAYGLAFNPNAEGELISGSDDST 175
           +++NI+A+ +G   +FI+D      S  L  L  H      + F+   E +++S S+D T
Sbjct: 170 KDSNILASSHG-NDVFIWDLRHG--STPLHKLTGHNSGVNSIDFSRFEENKIMSSSNDGT 226

Query: 176 IALWD-ATNDKLKQPI 190
           +  WD +  +K +Q I
Sbjct: 227 VKFWDLSKEEKCQQAI 242

 Score = 30.8 bits (68), Expect = 8.3,   Method: Compositional matrix adjust.
 Identities = 37/174 (21%), Positives = 75/174 (43%), Gaps = 14/174 (8%)

Query: 103 AHDGEINRARYMPQNTNIIATVNGEGTIFIYDCSRDKQSALLSTLKYHKDNAYGLAFNPN 162
            H   I    +  Q+ +I+AT + +  +  +D  R       +T  + + +A  + +N  
Sbjct: 113 GHSRAITDINFNSQHPDILATCSIDTYVHAWDM-RSPHRPFYTTSSW-RSSASQVKWN-F 169

Query: 163 AEGELISGSDDSTIALWDATNDKLKQPIQEWTTSHSDIVNDCQWHCFNTNMFGSVSEDST 222
            +  +++ S  + + +WD  +     P+ +  T H+  VN   +  F  N   S S D T
Sbjct: 170 KDSNILASSHGNDVFIWDLRHGS--TPLHK-LTGHNSGVNSIDFSRFEENKIMSSSNDGT 226

Query: 223 LQLFDKRNGGKSDVKISS-----KGQYNSIAFSGFSENLFAAAGTTNNIYLYDI 271
           ++ +D     K    I++     +G+Y  + F G    +    G  N++YL D+
Sbjct: 227 VKFWDLSKEEKCQQAITTEFPIWRGRY--LPF-GHGYCVMPMIGGNNSVYLMDL 277

>ZYRO0D08558g Chr4 (736975..739713) [2739 bp, 912 aa] {ON} highly
           similar to uniprot|P25636 Saccharomyces cerevisiae
           YCR057C PWP2 part of small (ribosomal) subunit (SSU)
           processosome (contains U3 snoRNA) Eight WD-repeats with
           homology with G protein beta subunits flanked by
           nonhomologous N-terminal and C-terminal extensions
           regulatory protein
          Length = 912

 Score = 53.5 bits (127), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 51/218 (23%), Positives = 100/218 (45%), Gaps = 9/218 (4%)

Query: 150 HKDNAYGLAFNPNAEGELISGSDDSTIALWDATNDKLKQPIQEWTTSHSDIVNDCQWHCF 209
           H D+   L ++P+    +++ SDD  I +WD  +      ++     H+  V   Q+   
Sbjct: 336 HFDSMNSLTYSPDGS-RVVTASDDGKIKVWDVVSGFCIVTLE----GHTSSVTGIQFAKR 390

Query: 210 NTNMFGSVSEDSTLQLFDKRNGGKSDVKIS-SKGQYNSIAFSGFSENLFAAAGTTNNIYL 268
              +F S S D T++ +D        V  S  + Q+  +A     E + A +  + +I++
Sbjct: 391 GQVLFTS-SLDGTVRAWDLIRYRNFRVFTSVERIQFTCVAVDPSGEVVCAGSTDSFDIHV 449

Query: 269 YDIRNTGKILHSMTGHEEPVTSLEFSNDKDGILISGSSDRRVIMWDLFEIGAEQQPDEAD 328
           + ++ TG+++  + GHE PV+ L FS +    L S S DR + +W +F    + +P E  
Sbjct: 450 WSVQ-TGQLVDQLAGHEGPVSCLSFSRET-STLASASWDRTIRVWSIFGRSQQVEPIEVF 507

Query: 329 DGLPEVMMIHAGSRSAINDISTHPSIPWLNASVEENNI 366
             +  +     G + A + +    +I  + A+ +  NI
Sbjct: 508 SDVLAISTRPDGEQVACSTLHGQITIFDITAAKQVGNI 545

>Suva_16.60 Chr16 complement(91552..93132) [1581 bp, 526 aa] {ON}
           YPL247C (REAL)
          Length = 526

 Score = 53.1 bits (126), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 43/171 (25%), Positives = 76/171 (44%), Gaps = 25/171 (14%)

Query: 167 LISGSDDSTIALWDATNDKLKQPIQEWTTSHSDIVNDCQWHCFNTNMFGSVSEDSTLQLF 226
           +IS S D+T  +WD  +      ++    +H   V D ++   +T +F S   D ++++F
Sbjct: 259 IISSSIDTTCIVWDLQSSHY---VKTQLIAHDSEVFDVRFLTKSTQLFASCGGDGSVRVF 315

Query: 227 DKRNGGKSDV-------------------KISSKGQYNSIAF--SGFSENLFAA-AGTTN 264
           D R+   S +                     SS G Y  +    S +  N+ A  A  +N
Sbjct: 316 DLRSLAHSTIIYEPPSSSSSSSAPAAGTTTPSSDGSYALLRLEPSPYDPNVLATFAADSN 375

Query: 265 NIYLYDIRNTGKILHSMTGHEEPVTSLEFSNDKDGILISGSSDRRVIMWDL 315
            I + D+RN    + ++ GH   V  +++   K  +L+S S D +V+ WDL
Sbjct: 376 KIIILDMRNPESPILTLEGHSSSVNEIKWHPTKRNVLLSCSDDCQVLYWDL 426

 Score = 42.0 bits (97), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 35/150 (23%), Positives = 62/150 (41%), Gaps = 26/150 (17%)

Query: 102 FAHDGEINRARYMPQNTNIIATVNGEGTIFIYDCSRDKQSALL---------------ST 146
            AHD E+   R++ ++T + A+  G+G++ ++D      S ++                T
Sbjct: 284 IAHDSEVFDVRFLTKSTQLFASCGGDGSVRVFDLRSLAHSTIIYEPPSSSSSSSAPAAGT 343

Query: 147 LKYHKDNAYGL------AFNPNAEGELISGSDDSTIALWDATNDKLKQPIQEWTTSHSDI 200
                D +Y L       ++PN        +D + I + D  N   + PI      HS  
Sbjct: 344 TTPSSDGSYALLRLEPSPYDPNVLATF--AADSNKIIILDMRNP--ESPILT-LEGHSSS 398

Query: 201 VNDCQWHCFNTNMFGSVSEDSTLQLFDKRN 230
           VN+ +WH    N+  S S+D  +  +D  N
Sbjct: 399 VNEIKWHPTKRNVLLSCSDDCQVLYWDLNN 428

>Suva_6.187 Chr6 complement(344709..346853) [2145 bp, 714 aa] {ON}
           YJL112W (REAL)
          Length = 714

 Score = 53.1 bits (126), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 58/230 (25%), Positives = 106/230 (46%), Gaps = 61/230 (26%)

Query: 129 TIFIYDCSRDKQS-------ALLSTLKYHKDNAYGLAFNPNAEGELISGSDDSTIALWDA 181
           T+ I+D S+ K+        A ++ ++  +DN           G L++G  D+ + LW+ 
Sbjct: 422 TVKIWDLSKQKKLGELAGHLATINCMQIDRDN-----------GTLVTGGRDAALKLWNL 470

Query: 182 T-NDKLKQPIQEWTTSHSDIVNDCQWH-----------CFNTNMFGSVSEDSTLQLFDKR 229
           +   +L Q  Q  T+  S I + C +              +++   S S+D T++ +D R
Sbjct: 471 SLAQQLYQETQNITSPTSHIDSPCVYTFESHIDEITALSLDSDFLVSGSQDRTIRQWDLR 530

Query: 230 NG----------------------GKSDVKISSKGQYNSI-AFSGFSENLFAAAGTTNNI 266
           +G                       KS + ++ + +  SI A   F   L  A GT + +
Sbjct: 531 SGKCMQAIDLSFANVSSTATNVDLSKSTL-LTQRSERPSIGALQSFDAAL--ATGTKDGV 587

Query: 267 Y-LYDIRNTGKILHSMTGHEEPVTSLEFSNDKDGILISGSSDRRVIMWDL 315
             L+D+R +GK++ ++ GH + +TSL+F +     L++GS DR V +WDL
Sbjct: 588 VRLWDLR-SGKVIRTLEGHTDAITSLKFDS---ACLVTGSYDRTVRVWDL 633

>KLTH0A06380g Chr1 complement(532367..535114) [2748 bp, 915 aa] {ON}
           highly similar to uniprot|P25636 Saccharomyces
           cerevisiae YCR057C PWP2 part of small (ribosomal)
           subunit (SSU) processosome (contains U3 snoRNA) Eight
           WD-repeats with homology with G protein beta subunits
           flanked by nonhomologous N-terminal and C-terminal
           extensions regulatory protein
          Length = 915

 Score = 53.5 bits (127), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 43/179 (24%), Positives = 86/179 (48%), Gaps = 9/179 (5%)

Query: 150 HKDNAYGLAFNPNAEGELISGSDDSTIALWDATNDKLKQPIQEWTTSHSDIVNDCQWHCF 209
           H D    + ++P+    +++ S+D  I +WD  +       QE    H+  V    +   
Sbjct: 340 HFDATNAVTYSPDGS-RVVTASEDGKIKIWDVVSGFCLVTFQE----HTSAVTGLAFAKK 394

Query: 210 NTNMFGSVSEDSTLQLFD-KRNGGKSDVKISSKGQYNSIAFSGFSENLFAAAGTTNNIYL 268
              +F S S D T++ +D  R         + + Q+N +A     E + A +  +  I++
Sbjct: 395 GQVLF-SASLDGTVRAWDLVRYRNFRTFTAAERIQFNCLAADPSGEVVCAGSVDSFAIHV 453

Query: 269 YDIRNTGKILHSMTGHEEPVTSLEFSNDKDGILISGSSDRRVIMWDLFEIGAEQQPDEA 327
           + ++ TG+++ ++ GHE PV+ L FS + + +L S S D+ + +W +F    + +P E 
Sbjct: 454 WSVQ-TGQLVETLDGHEGPVSCLSFSRE-NSVLASASWDKTIRVWSIFGRSQQVEPLEV 510

>Sklu_YGOB_Anc_2.401 Chr5 complement(385202..386764) [1563 bp, 520
           aa] {ON} ANNOTATED BY YGOB -
          Length = 520

 Score = 53.1 bits (126), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 77/384 (20%), Positives = 151/384 (39%), Gaps = 57/384 (14%)

Query: 25  PLLYDFVSETRLTWPSLTLQWLPGDKTSTR----QHLILGTLTSGAETDYLKIAALDLPD 80
           P +Y+ +    + WP +TL  +P    S R    Q +++ T T  ++    ++  L L  
Sbjct: 122 PTVYEMLHNVNMPWPCMTLDIIPDSLGSERRNYPQSILMTTATQASKKKDNELMVLKL-S 180

Query: 81  EIIIGXXXXXXXXXXXXXXXXFAHDGEI-----------NRARYMPQNTN------IIAT 123
           ++                      D  I           NR +  P  ++      + AT
Sbjct: 181 QLTKTLAKEDNGEDEEEEDDDDTVDPIIENENIQLRDTTNRLKVSPFASSSNSQEILTAT 240

Query: 124 VNGEGTIFIYDCSRDKQS-------------ALLSTLKYHKD-NAYGLAFNPNAE-GELI 168
           ++  G ++I+D +   ++               + T+K H +   Y L ++P  + G L+
Sbjct: 241 MSENGEVYIFDLASQVKAFKTPGYQIPKAAKKPIHTIKSHGNVEGYALDWSPLIKTGALL 300

Query: 169 SGSDDSTIALWDATNDKLKQPIQEWTTSHSDIVNDCQWHCFNTNMFGSVSEDSTLQLFDK 228
           +G     + L      K     + +T +++  V D QW    + +F S   D  ++++D 
Sbjct: 301 TGDCSGQVYLTQRHTSKWISDKEPFTVANNQSVEDIQWSRTESTVFASCGCDGYIRVWDT 360

Query: 229 RNGGKSDVKISSKGQYNSIAFSGFSENL--FAAAGTTNNIY-LYDIR-------NTGKIL 278
           R+  K    IS K     +    +SE +    A+G  N  + ++D+R       N    +
Sbjct: 361 RSK-KHKPAISVKASNTDVNVISWSEKIGYLLASGDDNGTWGVWDLRQFSPSNSNNTSPV 419

Query: 279 HSMTGHEEPVTSLEFSNDKDGILISGSSDRRVIMWDL-FEIGAEQQPDEADDGL------ 331
                H+  +TS+ F+   + I+   S D  V +WDL  E   E+   +A +        
Sbjct: 420 AQYDFHKGAITSISFNPLDESIVAVASEDNTVTLWDLSVEADDEEIKQQAAETKELQQIP 479

Query: 332 PEVMMIHAGSRSAINDISTHPSIP 355
           P+++ +H   +  + D+  H  IP
Sbjct: 480 PQLLFVHW--QKEVKDVKWHRQIP 501

>NDAI0F01240 Chr6 complement(302631..304205) [1575 bp, 524 aa] {ON}
           Anc_6.276 YPL247C
          Length = 524

 Score = 52.8 bits (125), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 41/170 (24%), Positives = 76/170 (44%), Gaps = 16/170 (9%)

Query: 159 FNPNAEGELISGSDDSTIALWDATNDKLKQPIQEWTTSHSDIVNDCQWHCFNTNMFGSVS 218
           +NP     LIS S D+T  +WD  +      ++    +H   V D ++   +T +F S  
Sbjct: 256 WNPIDTNLLISSSIDTTCIIWDLESSNY---VKTQLIAHDSEVFDVRFLTQSTQLFASCG 312

Query: 219 EDSTLQLFDKRNGGKSDVKISSKGQYN------------SIAFSGFSENLFAA-AGTTNN 265
            D ++++FD R+   S +      Q +             +  S    N+ A  A  +N 
Sbjct: 313 GDGSVRVFDLRSLAHSTIIYEPPAQMDPSSSAAASNALLRLEPSPHDPNIVATFAADSNK 372

Query: 266 IYLYDIRNTGKILHSMTGHEEPVTSLEFSNDKDGILISGSSDRRVIMWDL 315
           I + D+RN    + ++ GH   +  +++   +  IL+S + D +V+ WDL
Sbjct: 373 IIILDMRNPETPVLTLQGHSSSLNQIKWHPTERNILLSCADDCQVLYWDL 422

 Score = 37.7 bits (86), Expect = 0.046,   Method: Compositional matrix adjust.
 Identities = 30/133 (22%), Positives = 59/133 (44%), Gaps = 7/133 (5%)

Query: 102 FAHDGEINRARYMPQNTNIIATVNGEGTIFIYDCSRDKQSALLSTLKYHKDNAYGLAFNP 161
            AHD E+   R++ Q+T + A+  G+G++ ++D      S ++       D +   A + 
Sbjct: 289 IAHDSEVFDVRFLTQSTQLFASCGGDGSVRVFDLRSLAHSTIIYEPPAQMDPSSSAAASN 348

Query: 162 NAEGELISGSDDSTIALWDATNDK-----LKQPIQEWTT--SHSDIVNDCQWHCFNTNMF 214
                  S  D + +A + A ++K     ++ P     T   HS  +N  +WH    N+ 
Sbjct: 349 ALLRLEPSPHDPNIVATFAADSNKIIILDMRNPETPVLTLQGHSSSLNQIKWHPTERNIL 408

Query: 215 GSVSEDSTLQLFD 227
            S ++D  +  +D
Sbjct: 409 LSCADDCQVLYWD 421

>YJL112W Chr10 (205305..207449) [2145 bp, 714 aa] {ON}
           MDV1Peripheral protein of the cytosolic face of the
           mitochondrial outer membrane, required for mitochondrial
           fission; interacts with Fis1p and with the
           dynamin-related GTPase Dnm1p; contains WD repeats
          Length = 714

 Score = 53.1 bits (126), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 54/177 (30%), Positives = 85/177 (48%), Gaps = 37/177 (20%)

Query: 141 SALLSTLKYHKDNAYGLAFNPNAEGELISGSDDSTIALWDATNDKLKQPIQEWTTSHSDI 200
           S  + T + H D    L+ +P+    L+SGS D TI  WD  + K  Q I     S +++
Sbjct: 492 SPCVHTFEAHTDEVTALSLDPSF---LVSGSQDRTIRQWDLRSGKCLQTID---LSFANV 545

Query: 201 VNDCQWHCFNTNMFGSVSEDSTLQLFDKRNGGKSDVKISSKGQYNSI-AFSGFSENLFAA 259
           +        +TN+  S S      L  +RN            +  SI A   F   L  A
Sbjct: 546 LTT------STNVDLSKS-----TLLTQRN------------ERPSIGALQSFDAAL--A 580

Query: 260 AGTTNNIY-LYDIRNTGKILHSMTGHEEPVTSLEFSNDKDGILISGSSDRRVIMWDL 315
            GT + +  L+D+R +GK++ ++ GH + +TSL+F +     L++GS DR V +WDL
Sbjct: 581 TGTKDGVVRLWDLR-SGKVIRTLKGHTDAITSLKFDS---ACLVTGSYDRTVRIWDL 633

>Skud_16.131 Chr16 complement(237797..239152) [1356 bp, 451 aa] {ON}
           YPL151C (REAL)
          Length = 451

 Score = 52.8 bits (125), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 46/176 (26%), Positives = 84/176 (47%), Gaps = 14/176 (7%)

Query: 143 LLSTLKYHKDNAYGLAFNPNAEGELISGSDDSTIALWDATNDKLKQPIQEWTTSHSDI-V 201
           LL  +  H       A +P      ++GS+D+T+ +WD    KLK  +     +  DI V
Sbjct: 131 LLRVINGHLGWVRCAAIDPVDNEWFVTGSNDTTMKVWDLATGKLKTTLAGHVMTVRDIAV 190

Query: 202 NDCQWHCFNTNMFGSVSEDSTLQLFDKRNGGKSDVKISSKGQYNSIAFSGF--SENLFAA 259
           +D   + F      SVSED T++ +D     K+ +     G  + +       + +L A 
Sbjct: 191 SDRHPYLF------SVSEDKTVKCWDLE---KNHIIRDYYGHLSGVRTVSIHPTLDLIAT 241

Query: 260 AGTTNNIYLYDIRNTGKILHSMTGHEEPVTSLEFSNDKDGILISGSSDRRVIMWDL 315
           AG  + + L+DIR    ++ ++ GH+ P+  ++ +   D  ++S S+D  V +WD+
Sbjct: 242 AGRDSVVKLWDIRTRMPVI-TLVGHKGPINQVQCT-PVDPQIVSSSTDATVRLWDI 295

 Score = 33.1 bits (74), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 51/225 (22%), Positives = 94/225 (41%), Gaps = 33/225 (14%)

Query: 119 NIIATVNGEGTIFIYDCSRDKQSALLSTLKYHKDNAYGLAFNPNAEGELISGSDDSTIAL 178
           ++IAT   +  + ++D  R +   +  TL  HK     +   P  + +++S S D+T+ L
Sbjct: 237 DLIATAGRDSVVKLWDI-RTRMPVI--TLVGHKGPINQVQCTP-VDPQIVSSSTDATVRL 292

Query: 179 WDATNDKLKQPIQEWTTSHSDIVNDCQWHCFNTNMFGSVSEDSTLQLFDKRNGGKSDVKI 238
           WD    K  + +    T H   V     H    ++  + ++D        R+ G +D  +
Sbjct: 293 WDIVAGKAMKVL----THHKRSVRATALHPKEFSLASACTDDI-------RSWGIADGSL 341

Query: 239 ------SSKGQYNSIAFSGFSENLFAAAGTTNNIYLYDIRNTGKI----LHSMTGHEEPV 288
                    G  N+++ +   +++  A G    +  YD ++  K        M G  E  
Sbjct: 342 LTNFESEKTGIINTLSIN--QDDVLFAGGDDGTLSFYDYKSGHKYQSLATREMVGSLESE 399

Query: 289 TSLEFSN-DKDGI-LISGSSDRRVIMWDLFEIGAEQQPDEADDGL 331
            S+  S  DK G+ LI+G +D+ + +W   E        E+D GL
Sbjct: 400 RSVLCSTFDKTGLRLITGEADKSIKIWKQDETATR----ESDPGL 440

>Skud_11.271 Chr11 complement(490869..492809) [1941 bp, 646 aa] {ON}
           YKR036C (REAL)
          Length = 646

 Score = 52.8 bits (125), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 57/231 (24%), Positives = 96/231 (41%), Gaps = 51/231 (22%)

Query: 103 AHDGEINRARYMPQNTNIIATVNGEGTIFIYDCSRDKQSAL-----------------LS 145
            H   +N  +    N NI+ T + + T+ ++D +  K+  L                 + 
Sbjct: 362 GHLATVNCMQMDKTNYNILITGSKDATLKMWDLNLSKELYLDHSPLRQNMEETIITPCIH 421

Query: 146 TLKYHKDNAYGLAFNPNAEGELISGSDDSTIALWDATNDKLKQPIQE-WTTSHSDIVNDC 204
             + H D    L+F+  A   LISGS D  I  WD    K  Q +   +T +H+D     
Sbjct: 422 NFELHNDEITALSFDSEA---LISGSKDKKIFHWDLATGKCVQELNLIFTPTHNDTKTST 478

Query: 205 QWHCFNTNMFGSVSEDSTLQLFDKRNGGKSDVKISSKGQYNSIAFSGFSENLFAAAGTTN 264
           +     T + G+ +                   I +   YNS   +G  + +        
Sbjct: 479 RSGKNGTYLLGTEAP-----------------MIGALQCYNSALATGTKDGV-------- 513

Query: 265 NIYLYDIRNTGKILHSMTGHEEPVTSLEFSNDKDGILISGSSDRRVIMWDL 315
            + L+D+R  GK + S+ GH + +TSL+F ++K   L++GS D  V +WDL
Sbjct: 514 -VRLWDLR-IGKPVRSLEGHTDGITSLKFDSEK---LVTGSMDNSVRIWDL 559

>TPHA0L01690 Chr12 (355859..358357) [2499 bp, 832 aa] {ON} Anc_8.544
           YBR198C
          Length = 832

 Score = 52.8 bits (125), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 61/215 (28%), Positives = 101/215 (46%), Gaps = 16/215 (7%)

Query: 103 AHDGEINRARYMPQNTNIIATVNGEGTIFIYDCSRDKQSALLSTLKYHKDNAYGLAFNPN 162
            H G I    + P N  ++ + + + TI ++  S D ++ L+ T K H    + + F+P 
Sbjct: 551 GHSGAIYSTSFSPDN-KLLVSASEDKTIRLW--SMDTRTTLV-TYKGHNHPVWDVQFSPV 606

Query: 163 AEGELISGSDDSTIALWDATNDKLKQPIQEWTTSHSDIVNDCQWHCFNTNMFGSVSEDST 222
                 + S D T  LW    D +  P++ ++   SD+  DC     N     + S D T
Sbjct: 607 GH-YFATASHDQTARLWSC--DHI-FPLRIFSGHISDV--DCVTFHPNGCYIFTGSSDKT 660

Query: 223 LQLFDKRNGGKSDVKISSKGQYNSIAFSGFSENLFAAAGTTNN-IYLYDIRNTGKILHSM 281
            +++D   G    + I       S+A +   + L  A G+ +  I+++DI  TGK L  +
Sbjct: 661 CRMWDITTGESVRLFIGHTAPILSVAVA--PDGLRLATGSEDGVIHIWDI-GTGKSLKKL 717

Query: 282 TGH-EEPVTSLEFSNDKDGILISGSSDRRVIMWDL 315
            GH +  V SL + N +  IL+SG SD  V +WDL
Sbjct: 718 IGHGKSAVNSLSY-NKESNILVSGGSDNSVRIWDL 751

>NCAS0A04270 Chr1 (862892..863425,863734..864156) [957 bp, 318 aa]
           {ON} Anc_2.431 YMR116C
          Length = 318

 Score = 52.0 bits (123), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 52/187 (27%), Positives = 82/187 (43%), Gaps = 13/187 (6%)

Query: 143 LLSTLKYHKDNAYGLAFNPNAEGELISGSDDSTIALWDATND--KLKQPIQEWTTSHSDI 200
           L  TL+ H      LA +      L+SGS D T+  W  T D  K   P++ +   HS I
Sbjct: 9   LRGTLEGHNGWVTSLATSAGQPNLLLSGSRDKTLISWKLTGDDQKFGVPVRSF-KGHSHI 67

Query: 201 VNDCQWHCFNTNMFGSVSEDSTLQLFDKRNGGKSDVKISSKGQYNSIAFSGFSENLFAAA 260
           V DC           S S D TL+L+D   G      +  K    S+A      ++  + 
Sbjct: 68  VQDCTLTQDGAYAL-SASWDKTLRLWDVATGETYQRFVGHKSDVMSVAID-RKASMIISG 125

Query: 261 GTTNNIYLYDIRNTGKILHSMTGHEEPVTSLEFS----NDKDGILISGSSDRRVIMWDL- 315
                I ++ I+  G+ L ++ GH + V+ +  +    ND    +IS  +D+ V  W+L 
Sbjct: 126 SRDKTIKVWTIK--GQCLATLLGHNDWVSQVRIAPTDQNDDSVTVISAGNDKMVKAWNLN 183

Query: 316 -FEIGAE 321
            F+I A+
Sbjct: 184 QFQIEAD 190

>Kwal_23.6240 s23 complement(1503990..1506731) [2742 bp, 913 aa]
           {ON} YCR057C (PWP2) - regulatory protein [contig 16]
           FULL
          Length = 913

 Score = 52.8 bits (125), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 41/179 (22%), Positives = 85/179 (47%), Gaps = 9/179 (5%)

Query: 150 HKDNAYGLAFNPNAEGELISGSDDSTIALWDATNDKLKQPIQEWTTSHSDIVNDCQWHCF 209
           H D    + ++P+    +++ S+D  I +WD  +       QE T + S +         
Sbjct: 340 HFDATNAVTYSPDG-SRVVTASEDGKIKIWDVVSGFCLVTFQEHTAAVSALA-----FAK 393

Query: 210 NTNMFGSVSEDSTLQLFD-KRNGGKSDVKISSKGQYNSIAFSGFSENLFAAAGTTNNIYL 268
              +  S S D T++ +D  R         + + Q+N +A     E + A +  +  +++
Sbjct: 394 RGQVLFSASLDGTVRAWDLVRYRNFRTFTAAERIQFNCLAADPSGEVVCAGSVDSFAVHV 453

Query: 269 YDIRNTGKILHSMTGHEEPVTSLEFSNDKDGILISGSSDRRVIMWDLFEIGAEQQPDEA 327
           + ++ TG+++ ++ GHE PV+ L FS + + +L S S D+ + +W +F    + +P E 
Sbjct: 454 WSVQ-TGQLVETLDGHEGPVSCLSFSQE-NSVLASASWDKTIRIWSIFGRSQQVEPLEV 510

>KLTH0B03410g Chr2 complement(276115..277548) [1434 bp, 477 aa] {ON}
           highly similar to uniprot|P33750 Saccharomyces
           cerevisiae YLL011W
          Length = 477

 Score = 52.4 bits (124), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 40/168 (23%), Positives = 84/168 (50%), Gaps = 10/168 (5%)

Query: 149 YHKDNAY-GLAFNPNAEGELISGSDDSTIALWDATNDKLKQPIQEWTTSHSDIVNDCQWH 207
           +H D A+ G+  + +    + +G++   I LWD++  +    +  W    +D V+  +++
Sbjct: 170 FHGDYAFLGIDHHRSKPYFVTAGAE---INLWDSSRSRPTANLS-WG---ADNVSTVKFN 222

Query: 208 CFNTNMFGSVSEDSTLQLFDKRNGGKSDVKISSKGQYNSIAFSGFSENLFAAAGTTNNIY 267
              T++F S   D+++ L+D R    +  K + + + N++ ++      F  A   +N Y
Sbjct: 223 QNETDIFASAGSDNSVVLYDLRTNSPTQ-KFTQRMRTNALCWNPMEAYNFVVASEDHNAY 281

Query: 268 LYDIRNTGKILHSMTGHEEPVTSLEFSNDKDGILISGSSDRRVIMWDL 315
            YD+RN  + LH    H   V  ++FS   D I ++GS D+ + ++ +
Sbjct: 282 YYDMRNLSRALHVFKDHVSAVMDVDFSPTGDEI-VTGSYDKTIRIYQV 328

 Score = 33.9 bits (76), Expect = 0.73,   Method: Compositional matrix adjust.
 Identities = 44/181 (24%), Positives = 82/181 (45%), Gaps = 18/181 (9%)

Query: 150 HKDNAYGLAFNPNAEGELISGSDDSTIALWD-ATNDKLKQPIQEWTTSHSDIVNDCQWHC 208
           H+D  Y +A N +A  +L S S D  +  W+ +T +++      +   H   V       
Sbjct: 66  HRDGVYTIAKNYHALNKLASASADGVVKYWNMSTREEICSFKAHYGLVHGLCVTPQHLSA 125

Query: 209 -FNTNMFGSVSEDSTLQLF----DKRNGGKSDVKISS-----KGQYNSIAFSGF----SE 254
             N N   S  +D T++L+    +  +  K+D + SS     K  +   AF G     S+
Sbjct: 126 NKNENYMLSCGDDKTVKLWSVNTEDFSSSKNDEEQSSTDGLIKTFHGDYAFLGIDHHRSK 185

Query: 255 NLFAAAGTTNNIYLYDIRNTGKILHSMTGHEEPVTSLEFSNDKDGILISGSSDRRVIMWD 314
             F  AG    I L+D  +  +   +++   + V++++F+ ++  I  S  SD  V+++D
Sbjct: 186 PYFVTAGA--EINLWD-SSRSRPTANLSWGADNVSTVKFNQNETDIFASAGSDNSVVLYD 242

Query: 315 L 315
           L
Sbjct: 243 L 243

>NDAI0G03830 Chr7 (919944..921476) [1533 bp, 510 aa] {ON} Anc_3.25
          Length = 510

 Score = 52.4 bits (124), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 40/151 (26%), Positives = 74/151 (49%), Gaps = 7/151 (4%)

Query: 165 GELISGSDDSTIALWDATNDKLKQPIQEWTTSHSDIVNDCQWHCFNTNMFGSVSEDSTLQ 224
           G +IS S D+ I LWD  +      I ++  +    V   ++     NM  ++S+D + +
Sbjct: 218 GLIISASKDNLIKLWDPRSGNCVSTILKFKHT----VLKVKFQPTGGNMIAAISKDKSCR 273

Query: 225 LFDKRNGGKSDVKISSKGQYNSIAFSGFSENLFAAAGTTNNIYLYD-IRNTGKILHSMT- 282
           +FD R+  K  + +  +  Y ++ ++  +E++F       +I  +D +++  K  H +  
Sbjct: 274 VFDIRHSMKELLCVRDEVDYMTLLWNPINESMFTVGNYDGSIKHFDLLQDLTKPTHVIPY 333

Query: 283 GHEEPVTSLEFSNDKDGILISGSSDRRVIMW 313
            H++ VTSL + N    IL S S DR V  W
Sbjct: 334 AHDKCVTSLSY-NPMGNILASASKDRTVRFW 363

 Score = 41.2 bits (95), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 45/202 (22%), Positives = 92/202 (45%), Gaps = 25/202 (12%)

Query: 120 IIATVNGE-----GTIFIYDCSRDKQSALLSTLKYHKDNAYGLAFNPNAEGELISGSDDS 174
           ++AT NGE     GT F ++       + ++T++Y  D  +           +ISG  D 
Sbjct: 95  VVATYNGEFSLWNGTSFNFESLMQAHDSSVTTMEYSHDGDW-----------MISGDSDG 143

Query: 175 TIALWDATNDKLKQPIQEWTTSHSDIVNDCQWHCFNTNMFGSVSEDSTLQLFDKRNGGKS 234
            I +W A  + +K    E   +H++ + D  +   N + F S S+D+ L++++  NG   
Sbjct: 144 IIKIWQANFNMVK----ELDDAHTECIRDVAF-SGNDSKFVSCSDDNILKIWNFSNGKLE 198

Query: 235 DVKISSKGQYNSIAFSGFSE-NLFAAAGTTNNIYLYDIRNTGKILHSMTGHEEPVTSLEF 293
             ++ S   ++  +     E  L  +A   N I L+D R +G  + ++   +  V  ++F
Sbjct: 199 --RVLSGHHWDVKSCDWHPEMGLIISASKDNLIKLWDPR-SGNCVSTILKFKHTVLKVKF 255

Query: 294 SNDKDGILISGSSDRRVIMWDL 315
                 ++ + S D+   ++D+
Sbjct: 256 QPTGGNMIAAISKDKSCRVFDI 277

>KNAG0E02310 Chr5 (463866..464402,464772..465194) [960 bp, 319 aa]
           {ON} Anc_2.431 YMR116C
          Length = 319

 Score = 51.6 bits (122), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 63/244 (25%), Positives = 102/244 (41%), Gaps = 31/244 (12%)

Query: 143 LLSTLKYHKDNAYGLAFNPNAEGELISGSDDSTIALWDATND--KLKQPIQEWTTSHSDI 200
           L  TL+ H      LA +      L+S S D T+  W  T D  K   P++ +   HS I
Sbjct: 9   LRGTLEGHNGWVTSLATSAGQPNLLVSASRDKTLISWKLTGDDQKFGVPVRSF-KGHSHI 67

Query: 201 VNDCQWHCFNTNMFGSVSEDSTLQLFDKRNGGKSDVKISSKGQYNSIAFSGFSENLFAAA 260
           V D            S S D TL+L+D   G      +  KG   S+A      ++  + 
Sbjct: 68  VQDVTLTPDGAYAL-SASWDKTLRLWDVATGETYQRFVGHKGDVMSVAIDR-KASMIISG 125

Query: 261 GTTNNIYLYDIRNTGKILHSMTGHEEPVTSLEFS-----NDKDGILISGSSDRRVIMWDL 315
               +I ++ I+  G+ L ++ GH + V+ +  +     ND    +IS  +D+ V  W+L
Sbjct: 126 SRDKSIKVWTIK--GQCLATLLGHNDWVSQVRVAPTEKENDDTVTVISAGNDKMVKAWNL 183

Query: 316 --FEIGAEQQPDEADDGLPEVMMIHAGSRSAINDISTHPSIPWLNASVEENNIVQVWKCS 373
             F+I       EAD           G  + +N I+  P    L AS +++  + +W   
Sbjct: 184 NQFQI-------EAD---------FVGHNANVNTITASPDGT-LIASADKSGEIMLWNLH 226

Query: 374 SKLP 377
           +K P
Sbjct: 227 NKTP 230

>KNAG0J01680 Chr10 (307280..308476) [1197 bp, 398 aa] {ON} Anc_8.672
           YPL151C
          Length = 398

 Score = 52.0 bits (123), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 49/197 (24%), Positives = 88/197 (44%), Gaps = 24/197 (12%)

Query: 157 LAFNPNAEGELISGSDDSTIALWDATNDKLKQPIQEWTTSHSDIVNDCQWHCFNTNMFGS 216
           +A  P      ++GS+D+T+ +WD  + KLK  +    + H+  V D      +  MF S
Sbjct: 92  VAVEPVDNEWFVTGSNDTTLKVWDLASGKLKLTL----SGHTMGVRDVAVSERHPYMF-S 146

Query: 217 VSEDSTLQLFD-KRNGGKSDVKISSKGQYNSIAFSGFSENLFAAAGTTNNIYLYDIRNTG 275
            SED  ++ +D ++N    D      G +          +L A  G    + L+DIR T 
Sbjct: 147 ASEDKLVKCWDLEKNTAIRDYYGHLSGVHTVDIHPTL--DLIATGGRDAVVKLWDIR-TR 203

Query: 276 KILHSMTGHEEPVTSLEFSNDKDGILISGSSDRRVIMWDLFEIGAEQQPDEADDGLPEVM 335
           K + ++ GH+ P+T ++ +   D  ++S S+D  V +WD+                 + M
Sbjct: 204 KAVKTLVGHKAPITKVKCT-PVDPQVVSSSTDTTVRLWDIVA--------------GKSM 248

Query: 336 MIHAGSRSAINDISTHP 352
            +    + A+  I+ HP
Sbjct: 249 KVLTHHKRAVRSIALHP 265

 Score = 33.9 bits (76), Expect = 0.59,   Method: Compositional matrix adjust.
 Identities = 51/224 (22%), Positives = 96/224 (42%), Gaps = 29/224 (12%)

Query: 119 NIIATVNGEGTIFIYDCSRDKQSALLSTLKYHKDNAYGLAFNPNAEGELISGSDDSTIAL 178
           ++IAT   +  + ++D    K    + TL  HK     +   P  + +++S S D+T+ L
Sbjct: 184 DLIATGGRDAVVKLWDIRTRKA---VKTLVGHKAPITKVKCTP-VDPQVVSSSTDTTVRL 239

Query: 179 WDATNDKLKQPIQEWTTSHSDIVNDCQWHCFNTNMFGSVSEDSTLQLFDKRNGG-KSDVK 237
           WD    K  + +    T H   V     H    ++  + ++D  ++ +    G   ++ +
Sbjct: 240 WDIVAGKSMKVL----THHKRAVRSIALHPGEFSLASACTDD--VRSWRLPEGSLLTNFQ 293

Query: 238 ISSKGQYNSIAFSGFSENLFAAAGTTNNIYLYDIRNTGKILHSMTGHEEPVTSLEFSN-- 295
             S G  N+++ +   +N+  A G    +  Y+ ++    L+  T  +E   SLE     
Sbjct: 294 SQSTGVINTLSIN--DDNVMFAGGDNGVLSFYEYKSGH--LYQQTSTQEVRGSLESERGV 349

Query: 296 -----DKDGI-LISGSSDRRVIMWDLFEIGAEQ-QPDEADDGLP 332
                D  G+ LI+G  D+ + +W   E   E+ QP     GLP
Sbjct: 350 LTSTFDATGLRLITGEVDKSIKIWRHVEDATEENQP-----GLP 388

>TDEL0A07400 Chr1 complement(1292494..1295199) [2706 bp, 901 aa]
           {ON} Anc_6.325 YCR057C
          Length = 901

 Score = 52.4 bits (124), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 44/180 (24%), Positives = 90/180 (50%), Gaps = 11/180 (6%)

Query: 150 HKDNAYGLAFNPNAEGELISGSDDSTIALWDATNDKLKQPIQEWTTSHSDIVNDCQWHCF 209
           H D+   L ++P+    +++ ++D  I +WD  +      ++     H+  V   Q+   
Sbjct: 332 HFDSLNALTYSPDG-SRVVTAAEDGKIKVWDVISGFCLVTLE----GHTSSVTAVQFAKR 386

Query: 210 NTNMFGSVSEDSTLQLFDK-RNGGKSDVKISSKGQYNSIAFSGFSENLFAAAGTTNNIYL 268
              +F S S D T++ +D  R         + + Q+N +A     E + A +  + +I++
Sbjct: 387 GQVLF-SASLDGTVRAWDLIRYRNFRVFTAAERIQFNCLAVDPSGECVCAGSVDSFDIHV 445

Query: 269 YDIRNTGKILHSMTGHEEPVTSLEFSNDKDGILISGSSDRRVIMWDLFEIGAEQQPDEAD 328
           + ++ T ++L +++GHE PV+ L FS + + +L S S D+ + +W +F  G  QQ +  D
Sbjct: 446 WSVQ-TSQLLDTLSGHEGPVSCLSFSQE-NSVLASASWDKTIRIWSIF--GRSQQVEPID 501

>NCAS0F01850 Chr6 complement(371372..371794,372104..372637) [957 bp,
           318 aa] {ON} Anc_2.431 YMR116C
          Length = 318

 Score = 51.2 bits (121), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 52/187 (27%), Positives = 82/187 (43%), Gaps = 13/187 (6%)

Query: 143 LLSTLKYHKDNAYGLAFNPNAEGELISGSDDSTIALWDATND--KLKQPIQEWTTSHSDI 200
           L  TL+ H      LA +      L+SGS D T+  W  T D  K   P++ +   HS I
Sbjct: 9   LRGTLEGHNGWVTSLATSAGQPNLLLSGSRDKTLISWKLTGDDQKFGVPVRSF-KGHSHI 67

Query: 201 VNDCQWHCFNTNMFGSVSEDSTLQLFDKRNGGKSDVKISSKGQYNSIAFSGFSENLFAAA 260
           V DC           S S D TL+L+D   G      +  K    S+A      ++  + 
Sbjct: 68  VQDCTLTQDGAYAL-SASWDKTLRLWDVATGETYQRFVGHKSDVMSVAID-RKASMIISG 125

Query: 261 GTTNNIYLYDIRNTGKILHSMTGHEEPVTSLEFS----NDKDGILISGSSDRRVIMWDL- 315
                I ++ I+  G+ L ++ GH + V+ +  +    ND    +IS  +D+ V  W+L 
Sbjct: 126 SRDKTIKVWTIK--GQCLATLLGHNDWVSQVRIAPTDQNDDAVTVISAGNDKMVKAWNLN 183

Query: 316 -FEIGAE 321
            F+I A+
Sbjct: 184 QFQIEAD 190

>NCAS0B03690 Chr2 complement(657488..660925) [3438 bp, 1145 aa] {ON}
           Anc_8.288
          Length = 1145

 Score = 52.4 bits (124), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 30/119 (25%), Positives = 60/119 (50%)

Query: 197 HSDIVNDCQWHCFNTNMFGSVSEDSTLQLFDKRNGGKSDVKISSKGQYNSIAFSGFSENL 256
           HS  + D  ++  N ++  + S D+ +  +D R+  +     S+     S     + ++ 
Sbjct: 116 HSRAITDINFNPENPDILATCSVDTYVHAWDMRSPHRPFYTTSAWRSGASQVKWNYKDSN 175

Query: 257 FAAAGTTNNIYLYDIRNTGKILHSMTGHEEPVTSLEFSNDKDGILISGSSDRRVIMWDL 315
             A+  +N+IY++D+R     LH + GH+  V S++F+  K   ++S S+D  V  WD+
Sbjct: 176 ILASAHSNDIYIWDLRMGSTPLHKLVGHDSSVNSIDFNRFKSSEIMSSSNDGTVKFWDI 234

>CAGL0J03476g Chr10 (334536..336089) [1554 bp, 517 aa] {ON} highly
           similar to uniprot|P25382 Saccharomyces cerevisiae
           YCR072c
          Length = 517

 Score = 52.0 bits (123), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 56/206 (27%), Positives = 91/206 (44%), Gaps = 26/206 (12%)

Query: 115 PQNTNIIATVNGEGTIFIYDCSRDKQSALLSTLKYHKDNAYGLAFNPNAEGELISGSDDS 174
           P +   +A+ + +GTI I+D SR      L TL  H ++   + +    EG L SGS D 
Sbjct: 247 PGSKPRLASASKDGTIRIWDSSR---RVCLMTLGGHTNSVSCVKWG--GEGILYSGSHDK 301

Query: 175 TIALWDATNDKLKQPIQEWTTSHSDIVNDCQWHCFNTNMFGSVSEDSTLQL--FDK---R 229
           T+  WD     +KQ        +   +N  + H    N   S+S D  L++  FD    +
Sbjct: 302 TVRAWD-----MKQ--------NGKCINILKSHAHWVNHL-SLSTDYALRVGAFDYTGVK 347

Query: 230 NGGKSDVKISSKGQYNSIAF-SGFSENLFAAAGTTNNIYLYDIRNTGKILHSMTGHEEPV 288
                + +  +   Y  +A  +G  E L   A     ++L++     K +  MTGH++ V
Sbjct: 348 PANAKEARDKALQNYEKVARKNGKHEELMVTASDDFTMFLWNPLKGTKPISRMTGHQKLV 407

Query: 289 TSLEFSNDKDGILISGSSDRRVIMWD 314
             + FS D   I +S S D  + +WD
Sbjct: 408 NHVAFSPDGKYI-VSASFDNSIKLWD 432

 Score = 50.4 bits (119), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 54/224 (24%), Positives = 94/224 (41%), Gaps = 61/224 (27%)

Query: 103 AHDGEINRARYMPQNTNIIATVNGEGTIFIYDCSRDKQSALLSTLKYHKDNAYGLAFNPN 162
            H   I  + + P  ++ + T  G+ T  I+DC  D Q+  + TL  H++  + L  + +
Sbjct: 143 GHGATILCSAFAPHTSSRVVTGGGDNTARIWDC--DTQTPKV-TLNGHRN--WVLCVSWS 197

Query: 163 AEGELIS-GSDDSTIALWDATNDKLKQPIQEWTTSHSDIVNDCQWHCFN------TNMFG 215
           A+GE+I+ GS D+TI LWDA + K   P+ +    HS  +    W   +           
Sbjct: 198 ADGEVIATGSMDNTIRLWDAESGK---PLGDALRGHSKWITSLTWEPIHLVEPGSKPRLA 254

Query: 216 SVSEDSTLQLFDKRNGGKSDVKISSKGQYNSIAFSGFSENLFAAAGTTNNIYLYDIRNTG 275
           S S+D T++++D      S  ++                                     
Sbjct: 255 SASKDGTIRIWD------SSRRV------------------------------------- 271

Query: 276 KILHSMTGHEEPVTSLEFSNDKDGILISGSSDRRVIMWDLFEIG 319
             L ++ GH   V+ +++  +  GIL SGS D+ V  WD+ + G
Sbjct: 272 -CLMTLGGHTNSVSCVKWGGE--GILYSGSHDKTVRAWDMKQNG 312

 Score = 35.4 bits (80), Expect = 0.24,   Method: Compositional matrix adjust.
 Identities = 22/84 (26%), Positives = 42/84 (50%), Gaps = 5/84 (5%)

Query: 103 AHDGEINRARYMPQNTNIIATVNGEGTIFIYDCSRDKQSALLSTLKYHKDNAYGLAFNPN 162
            H   +N   + P    I++  + + +I ++D    K+   LST + H  + Y +A++ +
Sbjct: 402 GHQKLVNHVAFSPDGKYIVS-ASFDNSIKLWD---GKEGTFLSTFRGHVASVYQVAWSSD 457

Query: 163 AEGELISGSDDSTIALWDATNDKL 186
               L+S S D+T+ +WD    KL
Sbjct: 458 CR-LLVSCSKDTTLKVWDVKTRKL 480

>ZYRO0G20152g Chr7 complement(1669233..1669655,1669872..1670408)
           [960 bp, 319 aa] {ON} highly similar to uniprot|P38011
           Saccharomyces cerevisiae YMR116C ASC1 WD repeat protein
           (G-beta like protein) involved in translation regulation
           required for repression of Gcn4p activity in the absence
           of amino-acid starvation core component of the ribosome
           ortholog of mammalian RACK1
          Length = 319

 Score = 51.2 bits (121), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 62/244 (25%), Positives = 101/244 (41%), Gaps = 31/244 (12%)

Query: 143 LLSTLKYHKDNAYGLAFNPNAEGELISGSDDSTIALWDATND--KLKQPIQEWTTSHSDI 200
           L  TL+ H      LA +      L+S S D T+  W  T D  +   P++ +   H+ I
Sbjct: 9   LRGTLEGHNGWVTSLATSAGQPNLLLSASRDKTLISWKLTGDDKQYGVPVRSF-QGHNHI 67

Query: 201 VNDCQWHCFNTNMFGSVSEDSTLQLFDKRNGGKSDVKISSKGQYNSIAFSGFSENLFAAA 260
           V DC           S S D TL+L+D   G      +  K    S+A      ++  + 
Sbjct: 68  VQDCSLTADGAYAL-SASWDKTLRLWDVATGQTYQRFVGHKSDVMSVAIDR-KASMIISG 125

Query: 261 GTTNNIYLYDIRNTGKILHSMTGHEEPVTSL-----EFSNDKDGILISGSSDRRVIMWDL 315
                + ++ IR  G+ L +M GH + V+ +     E +ND    +IS   D+ V  W++
Sbjct: 126 SRDRTVKVWTIR--GQCLATMLGHNDWVSQVRIAPTEDANDDTVTVISAGMDKMVKAWNV 183

Query: 316 --FEIGAEQQPDEADDGLPEVMMIHAGSRSAINDISTHPSIPWLNASVEENNIVQVWKCS 373
             F+I       EAD           G  + +N I+  P    L AS  ++  + +W  +
Sbjct: 184 NQFQI-------EAD---------FIGHNNYVNTITASPDGS-LVASAGKDGEIMLWNLA 226

Query: 374 SKLP 377
            K+P
Sbjct: 227 DKVP 230

>TBLA0D05560 Chr4 complement(1366222..1367991) [1770 bp, 589 aa]
           {ON} Anc_1.247 YKR036C
          Length = 589

 Score = 51.6 bits (122), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 58/209 (27%), Positives = 98/209 (46%), Gaps = 29/209 (13%)

Query: 120 IIATVNGEGTIFIYDCSRDKQSALLSTLKYHKDNAYGLAFNPNAEGELISGSDDSTIALW 179
           +++T      I +YD +       ++TLK HK +   L  +   +  ++SGS D+T+ LW
Sbjct: 269 LVSTNRFNHNIDVYDLNAKHA---ITTLKSHKSSLTALQLD---DHLIVSGSKDATVKLW 322

Query: 180 ------DATNDKLKQPIQEWTTSHSDIVNDCQWHCFNTNMFGSVSEDSTLQLFDKRNGGK 233
                 D TN  +  P+    +SH D +       F +++  + S D T++ +D  N  K
Sbjct: 323 DTKSLADTTNSNINSPLLHTFSSHKDEITAIS--LFQSSLI-TTSLDKTIRHWD-LNTNK 378

Query: 234 SDVKI---SSKGQYNSIAFSGFSENLFAAAGTTNN----IYLYDIRNTGKILHSMTGHEE 286
           +   I   S    Y S   +      F AA  T +    + L+D+R  GKI+ S   H +
Sbjct: 379 NIQTIPLPSPVSVYTSPIINTLQ--CFDAALATGSRDGIVRLWDLR-IGKIVRSFEKHND 435

Query: 287 PVTSLEFSNDKDGILISGSSDRRVIMWDL 315
            +T L+F+N +   L+S S D  + +WDL
Sbjct: 436 EITGLKFNNKQ---LVSTSLDNSIKIWDL 461

 Score = 50.4 bits (119), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 50/181 (27%), Positives = 82/181 (45%), Gaps = 20/181 (11%)

Query: 141 SALLSTLKYHKDNAYGLAFNPNAEGELISGSDDSTIALWDATNDK------LKQPIQEWT 194
           S LL T   HKD    ++     +  LI+ S D TI  WD   +K      L  P+  +T
Sbjct: 337 SPLLHTFSSHKDEITAISL---FQSSLITTSLDKTIRHWDLNTNKNIQTIPLPSPVSVYT 393

Query: 195 TSHSDIVNDCQWHCFNTNMFGSVSEDSTLQLFDKRNGGKSDVKISSKGQYNSIAFSGFSE 254
              S I+N  Q  CF+  +  + S D  ++L+D R G    +  S +   + I    F+ 
Sbjct: 394 ---SPIINTLQ--CFDAAL-ATGSRDGIVRLWDLRIGK---IVRSFEKHNDEITGLKFNN 444

Query: 255 NLFAAAGTTNNIYLYDIRNTGKILHSMTGHEEPVTSLEFSNDKDGILISGSSDRRVIMWD 314
               +    N+I ++D+  TGKI+  M G++  + S+ F+NDK    +      ++  W 
Sbjct: 445 KQLVSTSLDNSIKIWDL-GTGKII-DMFGYDHSIISMNFANDKIVCALRDQKSFQIYDWK 502

Query: 315 L 315
           L
Sbjct: 503 L 503

 Score = 33.9 bits (76), Expect = 0.74,   Method: Compositional matrix adjust.
 Identities = 29/95 (30%), Positives = 48/95 (50%), Gaps = 10/95 (10%)

Query: 224 QLFDKRNGGKSDVKISSKGQYNSIAFSGFSENLFAAAGTTN----NIYLYDIRNTGKILH 279
           QLF     G   +KI S    + I++  F+ N F    +TN    NI +YD+ N    + 
Sbjct: 235 QLFIPSQPGTHLLKIPSTSN-SPISYLDFN-NPFGILVSTNRFNHNIDVYDL-NAKHAIT 291

Query: 280 SMTGHEEPVTSLEFSNDKDGILISGSSDRRVIMWD 314
           ++  H+  +T+L+     D +++SGS D  V +WD
Sbjct: 292 TLKSHKSSLTALQLD---DHLIVSGSKDATVKLWD 323

>Suva_11.268 Chr11 complement(492639..494576) [1938 bp, 645 aa] {ON}
           YKR036C (REAL)
          Length = 645

 Score = 52.0 bits (123), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 61/229 (26%), Positives = 94/229 (41%), Gaps = 48/229 (20%)

Query: 103 AHDGEINRARYMPQNTNIIATVNGEGTIFIYDCSRDK-----QSAL-----------LST 146
            H   +N  +    N N++ T + + T+ ++D +  K     QS L           L  
Sbjct: 362 GHLATVNCMQMDRVNYNMLITGSKDATLKMWDLNLSKELYSDQSPLKQNAEEVVTPCLHN 421

Query: 147 LKYHKDNAYGLAFNPNAEGELISGSDDSTIALWDATNDKLKQPIQEWTTSHSDIVNDCQW 206
            + H D    L+F+  A   LISGS D  I  WD    K  Q +    T      ND + 
Sbjct: 422 FELHSDEITALSFDSEA---LISGSKDRKILHWDLVTGKCVQQLDLIVTP---TYNDTKV 475

Query: 207 HCFNTNMFGSVSEDSTLQLFDKRNGGKSDVKISSKGQYNSIAFSGFSENLFAAAGTTNNI 266
              + N   SV              G     I +   YNS   SG  + +         +
Sbjct: 476 SARSANNSTSVL-------------GSEAPMIGALQCYNSALASGTKDGV---------V 513

Query: 267 YLYDIRNTGKILHSMTGHEEPVTSLEFSNDKDGILISGSSDRRVIMWDL 315
            L+D+R  GK + ++ GH + +TSL+F ++K   L++GS D  V +WDL
Sbjct: 514 RLWDLR-IGKPVRALEGHTDGITSLKFDSEK---LVTGSMDNSVRIWDL 558

 Score = 38.1 bits (87), Expect = 0.035,   Method: Compositional matrix adjust.
 Identities = 41/162 (25%), Positives = 67/162 (41%), Gaps = 33/162 (20%)

Query: 165 GELISGS-DDSTIALWDATNDKLKQPIQEWTTSHSDIVNDCQWHCFNTNMFGSVSEDSTL 223
           G L S S  D  + +WD  +    + + E    H   VN  Q    N NM  + S+D+TL
Sbjct: 334 GTLCSSSYQDRIVKVWDLNHG---EQVGELP-GHLATVNCMQMDRVNYNMLITGSKDATL 389

Query: 224 QLFDKRNGGKSDVKISSKGQYNSIAFSGFSENLFAAAGTTNNIYLYDIRNTGKILHSMTG 283
           +++D        + +S +   +       +E +                     LH+   
Sbjct: 390 KMWD--------LNLSKELYSDQSPLKQNAEEVVTPC-----------------LHNFEL 424

Query: 284 HEEPVTSLEFSNDKDGILISGSSDRRVIMWDLFEIGAEQQPD 325
           H + +T+L F ++    LISGS DR+++ WDL      QQ D
Sbjct: 425 HSDEITALSFDSEA---LISGSKDRKILHWDLVTGKCVQQLD 463

>KAFR0B00370 Chr2 complement(83264..84649) [1386 bp, 461 aa] {ON}
           Anc_7.534 YPR178W
          Length = 461

 Score = 51.6 bits (122), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 43/166 (25%), Positives = 82/166 (49%), Gaps = 7/166 (4%)

Query: 150 HKDNAYGLAFNPNAEGELISGSDDSTIALWDATNDKLKQPIQEWTTSHSDIVNDCQWHCF 209
           H     GL +N    G L++G++D  + L+  T++++K+        H   V   ++H  
Sbjct: 218 HSGKIGGLDWNKTG-GMLVTGAEDGMVKLYSYTSNEIKETTV--LKGHEKRVVATKFHP- 273

Query: 210 NTNMFGSVSEDSTLQLFDKRNGGKSDVKISSKGQYNSIAFSGFSENLFAAAGTTNNIYLY 269
           +T   GS S D+T +L+D     +  ++     +  S++F G   +L    G  N   L+
Sbjct: 274 STRFLGSTSFDTTWRLWDIATSQELLLQEGHSKEVYSLSFQG-DGSLVCTGGLDNTALLW 332

Query: 270 DIRNTGKILHSMTGHEEPVTSLEFSNDKDGILISGSSDRRVIMWDL 315
           DIR  GK + ++ GH +PV  +++S +   +  +G  D  + +WD+
Sbjct: 333 DIR-CGKSIMTLNGHSKPVYCVDWSCNGYNV-ATGGGDGLINIWDI 376

>Kwal_26.8776 s26 (938508..939809) [1302 bp, 433 aa] {ON} YPL151C
           (PRP46) - pre-mRNA splicing factor [contig 67] FULL
          Length = 433

 Score = 51.6 bits (122), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 55/215 (25%), Positives = 94/215 (43%), Gaps = 27/215 (12%)

Query: 116 QNTNIIATVNGEGTIFIYDCSRDKQS-----------ALLSTLKYHKDNAYGLAFNPNAE 164
           Q+ +++  V GE   F     R KQ             L+  +  H      +  +P   
Sbjct: 75  QSESLVQKVFGEKDSFGSLMERHKQQLELQPEWHAPWKLMRVINGHNGWVRCVCPDPVDN 134

Query: 165 GELISGSDDSTIALWDATNDKLKQPIQEWTTSHSDIVNDCQWHCFNTNMFGSVSEDSTLQ 224
               +GS+D+TI +WD  + KLK  +    T H   V        +  MF S SED  ++
Sbjct: 135 AWFATGSNDTTIKVWDMASGKLKLTL----TGHVMTVRSVAVSQRHPLMF-SASEDKMVK 189

Query: 225 LFD-KRNGGKSDVKISSKGQYNSIAFSGF--SENLFAAAGTTNNIYLYDIRNTGKILHSM 281
            +D +RN    D      G ++ +       + +L A+AG    + L+DIR    ++ ++
Sbjct: 190 CWDLERNAAIRDY----HGHFSGVNTVDVHPTLDLIASAGRDAVVRLWDIRTRLPVM-TL 244

Query: 282 TGHEEPVTSLE-FSNDKDGILISGSSDRRVIMWDL 315
            GH+ P+  ++ F  D    ++S SSD  V +WD+
Sbjct: 245 AGHKSPINQVKCFPVDPQ--IMSCSSDATVRLWDI 277

 Score = 33.5 bits (75), Expect = 0.83,   Method: Compositional matrix adjust.
 Identities = 57/253 (22%), Positives = 104/253 (41%), Gaps = 62/253 (24%)

Query: 119 NIIATVNGEGTIFIYDCSRDKQSALLSTLKYHKDNAYGLAFNPNAEGELISGSDDSTIAL 178
           ++IA+   +  + ++D    +    + TL  HK     +   P  + +++S S D+T+ L
Sbjct: 219 DLIASAGRDAVVRLWDI---RTRLPVMTLAGHKSPINQVKCFP-VDPQIMSCSSDATVRL 274

Query: 179 WDATNDKLKQPIQEWTTSHSDIVNDCQWHCFNTNMFGSVSEDSTLQLFDKRNGGKSDVKI 238
           WD    K  + +    T HS  V     H   +++       +T    D R+   SD ++
Sbjct: 275 WDIRAGKATKIL----THHSKSVRAIAAHPAESSV-------ATASTSDVRSWRHSDGQL 323

Query: 239 SSK------GQYNSIAFSGFSENLFAAAGTTNNIYLYDIRN--------TGKILHSMTGH 284
            +       G  NS++ +  ++ +    G   N+  +D ++        T KI  S+   
Sbjct: 324 LTNYHSEGIGIINSLSVN--ADGVLFGGGDDGNLSFFDYKSGHKYQELPTTKIPGSLDS- 380

Query: 285 EEPVTSLEFSNDKDGI-LISGSSDRRVIMWDLFEIGAEQQPDEADDGLPEVMMIHAGSRS 343
           E  + S  F  D+ G+ LI+G SD+ + MW       +Q P    +  PE          
Sbjct: 381 ERGILSASF--DQTGLRLITGESDKSIKMW-------KQIP----EATPE---------- 417

Query: 344 AINDISTHPSIPW 356
                 THP++PW
Sbjct: 418 ------THPNLPW 424

>NCAS0D02730 Chr4 (523453..524880) [1428 bp, 475 aa] {ON} Anc_5.201
          Length = 475

 Score = 51.6 bits (122), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 44/174 (25%), Positives = 85/174 (48%), Gaps = 10/174 (5%)

Query: 141 SALLSTLKYHKDNAYGLAFNPNAEGELISGSDDSTIALWDATNDKLKQPIQEWTTSHSDI 200
           S LL T  Y+ D A+    +  ++   ++G   + I LWD+   K   P+ + +   +D 
Sbjct: 164 SGLLKT--YYSDFAFQGIDHHRSKSNFVTGG--AKIQLWDSNRSK---PLTDLSWG-ADN 215

Query: 201 VNDCQWHCFNTNMFGSVSEDSTLQLFDKRNGGKSDVKISSKGQYNSIAFSGFSENLFAAA 260
           ++  +++   T++  S   D++L L+D R    +  KI    + N+I ++      F  A
Sbjct: 216 ISTVKFNQNETDILASAGSDNSLVLYDLRTNSPTQ-KIVQTMRTNAICWNPMEAFNFVVA 274

Query: 261 GTTNNIYLYDIRNTGKILHSMTGHEEPVTSLEFSNDKDGILISGSSDRRVIMWD 314
              +N Y YD+RN  + L+    H   V  ++FS   D I ++GS D+ + +++
Sbjct: 275 NEDHNAYYYDMRNMSRALNVFKDHVSAVMDVDFSPTGDEI-VTGSYDKTIRIFN 327

 Score = 39.3 bits (90), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 42/184 (22%), Positives = 82/184 (44%), Gaps = 24/184 (13%)

Query: 150 HKDNAYGLAFNPNAEGELISGSDDSTIALWDATNDKLKQPIQEWTTSHSDIVNDCQW--- 206
           H+D  Y +A N     +L +GS D  +  W+ +    ++ +  +   +  I   C     
Sbjct: 66  HRDGVYVIAKNYKNLNKLATGSADGVVKYWNMST---REELCSFKAHYGLITGLCVTPEH 122

Query: 207 --HCFNTNMFGSVSEDSTLQLFDKRNGGKSDVKISS---------KGQYNSIAFSGF--- 252
                N N   S S+D T++L+   +   +++K +          K  Y+  AF G    
Sbjct: 123 LSKQKNENFMLSCSDDKTVKLWSVNSEDYANLKNAEDINTASGLLKTYYSDFAFQGIDHH 182

Query: 253 -SENLFAAAGTTNNIYLYDIRNTGKILHSMTGHEEPVTSLEFSNDKDGILISGSSDRRVI 311
            S++ F   G    I L+D  N  K L  ++   + +++++F+ ++  IL S  SD  ++
Sbjct: 183 RSKSNFVTGGA--KIQLWD-SNRSKPLTDLSWGADNISTVKFNQNETDILASAGSDNSLV 239

Query: 312 MWDL 315
           ++DL
Sbjct: 240 LYDL 243

 Score = 35.8 bits (81), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 50/205 (24%), Positives = 81/205 (39%), Gaps = 39/205 (19%)

Query: 124 VNGEGTIFIYDCSRDKQSALLSTLKYHKDNAYGLAFNPNAEGELISGSDDSTIALWD-AT 182
           V G   I ++D +R K    L+ L +  DN   + FN N    L S   D+++ L+D  T
Sbjct: 189 VTGGAKIQLWDSNRSKP---LTDLSWGADNISTVKFNQNETDILASAGSDNSLVLYDLRT 245

Query: 183 NDKLKQPIQEWTTSHSDIVNDCQWHCFNTNMFGSVSEDSTLQLFDKRNGGKSDVKISSKG 242
           N   ++ +Q   T      N   W+      F   +ED     +D RN  +         
Sbjct: 246 NSPTQKIVQTMRT------NAICWNPMEAFNFVVANEDHNAYYYDMRNMSR--------- 290

Query: 243 QYNSIAFSGFSENLFAA-----AGTTNNIYLYDIRNTGKILHSMTGHE---------EPV 288
                A + F +++ A      + T + I       T +I ++  GH          + V
Sbjct: 291 -----ALNVFKDHVSAVMDVDFSPTGDEIVTGSYDKTIRIFNTTHGHSREIYHTKRMQHV 345

Query: 289 TSLEFSNDKDGILISGSSDRRVIMW 313
             ++FS D   I +SGS D  V +W
Sbjct: 346 FQVKFSMDAKYI-VSGSDDGNVRLW 369

>CAGL0H00781g Chr8 complement(77292..78833) [1542 bp, 513 aa] {ON}
           similar to uniprot|Q12523 Saccharomyces cerevisiae
           YPL247c
          Length = 513

 Score = 51.6 bits (122), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 56/230 (24%), Positives = 89/230 (38%), Gaps = 56/230 (24%)

Query: 144 LSTLKYHKDNAYGLAF-------------NPNAEGE----------------LISGSDDS 174
           LS  K+HK +    AF             NP+  GE                LIS S D+
Sbjct: 199 LSLCKFHKQHPNNKAFVGLSQIPTKTSDVNPSVLGEFPPITSFHWNPVDTNILISSSIDT 258

Query: 175 TIALWDATNDKLKQPIQEWTTSHSDIVNDCQWHCFNTNMFGSVSEDSTLQLFDKR----- 229
           T  +WD  +      ++    +H   V D ++   +T +F S   D ++++FD R     
Sbjct: 259 TCIVWDLQSSNY---VKTQLIAHDSEVFDVRFLTQSTQLFASCGGDGSVRVFDLRCLAHS 315

Query: 230 ---------------NGGKSDVKISSKGQYNSIAFSGFSENLFAA-AGTTNNIYLYDIRN 273
                          N  +SD    +      +  S    N+ A  A  +N I + D+RN
Sbjct: 316 TIIYEPPASEPGTGNNSSRSDSTDENSHALLRLEPSPHDPNVLATFAIASNEILILDMRN 375

Query: 274 TGKILHSMTGHEEPVTSLEFSNDKDGILISGSSDRRVIMWDL---FEIGA 320
               L  + GH   +  +++   K   LIS S D +V+ WD+   F+ GA
Sbjct: 376 PDSPLVVLNGHSASINQIKWHPTKKNTLISCSDDCQVLFWDISSYFDQGA 425

 Score = 33.9 bits (76), Expect = 0.76,   Method: Compositional matrix adjust.
 Identities = 11/33 (33%), Positives = 22/33 (66%)

Query: 102 FAHDGEINRARYMPQNTNIIATVNGEGTIFIYD 134
            AHD E+   R++ Q+T + A+  G+G++ ++D
Sbjct: 276 IAHDSEVFDVRFLTQSTQLFASCGGDGSVRVFD 308

>SAKL0D04796g Chr4 (372598..374907) [2310 bp, 769 aa] {ON} similar
           to uniprot|P47025 Saccharomyces cerevisiae YJL112W MDV1
           WD repeat protein that regulates steps in the
           Dnm1p-dependent process of mitochondrial fission
          Length = 769

 Score = 51.6 bits (122), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 51/178 (28%), Positives = 82/178 (46%), Gaps = 34/178 (19%)

Query: 139 KQSALLSTLKYHKDNAYGLAFNPNAEGELISGSDDSTIALWDATNDKLKQPIQEWTTSHS 198
           K+ A + T   H D    L+F+ +    LISGS D TI  WD  + K  Q I     S  
Sbjct: 540 KEDACVYTFDAHVDEITALSFSGD---NLISGSQDRTIRQWDLNSGKCVQTIDINFASR- 595

Query: 199 DIVNDCQWHCFNTNMFGSVSEDSTLQLFDKRNGGKSDVKISSKGQYNSIAFSGFSENLFA 258
                      N++  G++S  S+  L            I +   Y++   +G  + L  
Sbjct: 596 ----------VNSSTSGTLSSRSSTLLVPNEQP-----VIGALQCYDAALATGTKDGL-- 638

Query: 259 AAGTTNNIYLYDIRNTGKILHSMTGHEEPVTSLEFSNDKDGI-LISGSSDRRVIMWDL 315
                  + L+D+R +G+++ ++ GH + +TSL+F    D I LI+GS DR + +WDL
Sbjct: 639 -------VRLWDLR-SGQVVRTLQGHTDAITSLQF----DSINLITGSIDRSIRIWDL 684

 Score = 36.2 bits (82), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 33/152 (21%), Positives = 68/152 (44%), Gaps = 13/152 (8%)

Query: 164 EGELISGSDDSTIALWDATNDKLKQPIQEWTTSHSDIVNDCQWHCFNTNMFGSVSEDSTL 223
           +  L +G+ D  + LWD  + ++ + +Q     H+D +   Q+   N  + GS+  D ++
Sbjct: 627 DAALATGTKDGLVRLWDLRSGQVVRTLQ----GHTDAITSLQFDSINL-ITGSI--DRSI 679

Query: 224 QLFDKRNGGKSDVKISSKGQYNSIAFSGFSENLFAAAGTTNNIYLYDIRNTGKIL--HSM 281
           +++D R G  +D    +    N ++   F  +    A   N + +YD +         + 
Sbjct: 680 RIWDLRTGTLAD----AFAYENPVSHLEFDLDKIVVANNENTVKIYDRKQDEHWFCGGNN 735

Query: 282 TGHEEPVTSLEFSNDKDGILISGSSDRRVIMW 313
            G      ++EF   K G ++ G+S+  V +W
Sbjct: 736 DGETNDSETVEFVKYKHGYMVEGNSNGDVHVW 767

>CAGL0M02563g Chr13 complement(295156..296529) [1374 bp, 457 aa]
           {ON} weakly similar to uniprot|Q03010 Saccharomyces
           cerevisiae YPL139c UME1 or uniprot|Q12206 Saccharomyces
           cerevisiae YOR229w WTM2 or uniprot|Q12363 Saccharomyces
           cerevisiae YOR230w WTM1
          Length = 457

 Score = 51.2 bits (121), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 51/197 (25%), Positives = 80/197 (40%), Gaps = 35/197 (17%)

Query: 209 FNTNMFGSVSEDSTLQLFDKRNGGKSDVKISSKGQYNSIAFSGFSENLFAAAGTTNNIYL 268
           +N N+FG       L  +D RN      KI ++    S AFS   E L    G    I  
Sbjct: 250 YNDNIFGFCDNSGNLYFYDSRNLATPIWKIENE-HILSFAFSPLVETLLITGGANGIINF 308

Query: 269 YDIRN-------TG-----KILHSMTGH-EEPVTSLEFSNDKDGILISGSSDRRVIMWDL 315
           +D++        TG     + L S++ H EEP++S+EFS       I+      +  WD+
Sbjct: 309 WDVKRLTVKTATTGGDKRQESLLSLSNHVEEPISSVEFSASSPSEFITVGISGSIYHWDV 368

Query: 316 F-------EIGAEQQPDEADDGL------PEVMMI--------HAGSRSAINDISTHPSI 354
           F       E+ +E     A D L       E +          H G  +  N +S HP I
Sbjct: 369 FNYFEKVSELFSEGGDQSAIDSLDTEEIQAESLTFYHTGGSRRHLGKSTKKNSVSVHPII 428

Query: 355 PWLNASVEENNIVQVWK 371
             L  +++ + ++ V+K
Sbjct: 429 EGLIGTIDTDGLITVYK 445

>Smik_6.348 Chr6 (556719..558074) [1356 bp, 451 aa] {ON} YPL151C
           (REAL)
          Length = 451

 Score = 51.2 bits (121), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 43/161 (26%), Positives = 80/161 (49%), Gaps = 14/161 (8%)

Query: 158 AFNPNAEGELISGSDDSTIALWDATNDKLKQPIQEWTTSHSDI-VNDCQWHCFNTNMFGS 216
           A +P      I+GS+D+T+ +WD    KL+  +     +  DI ++D   + F      S
Sbjct: 146 AIDPVNNEWFITGSNDTTMKVWDLATGKLRTTLAGHVMTVRDIAISDRHPYLF------S 199

Query: 217 VSEDSTLQLFDKRNGGKSDVKISSKGQYNSIAFSGF--SENLFAAAGTTNNIYLYDIRNT 274
           VSED T++ +D     K+ +     G  + +       + +L A AG  + I L+DIR  
Sbjct: 200 VSEDKTVKCWDLE---KNQIIRDYYGHLSGVRTVSIHPTLDLIATAGRDSVIKLWDIRTR 256

Query: 275 GKILHSMTGHEEPVTSLEFSNDKDGILISGSSDRRVIMWDL 315
             ++ ++ GH+ P+  ++ +   D  ++S S+D  V +WD+
Sbjct: 257 VPVI-TLVGHKGPINQVQCT-PVDPQIVSSSTDATVRLWDV 295

 Score = 31.2 bits (69), Expect = 5.0,   Method: Compositional matrix adjust.
 Identities = 44/204 (21%), Positives = 89/204 (43%), Gaps = 23/204 (11%)

Query: 119 NIIATVNGEGTIFIYDCSRDKQSALLSTLKYHKDNAYGLAFNPNAEGELISGSDDSTIAL 178
           ++IAT   +  I ++D    +    + TL  HK     +   P  + +++S S D+T+ L
Sbjct: 237 DLIATAGRDSVIKLWDI---RTRVPVITLVGHKGPINQVQCTP-VDPQIVSSSTDATVRL 292

Query: 179 WDATNDKLKQPIQEWTTSHSDIVNDCQWHCFNTNMFGSVSEDSTLQLFDKRNGG-KSDVK 237
           WD    K  + +    T H   V     H    ++  + ++D  ++ +    G   ++ +
Sbjct: 293 WDVVAGKAMKVL----THHKRSVRATALHPKEFSVASACTDD--IRSWGLVEGSLLTNFE 346

Query: 238 ISSKGQYNSIAFSGFSENLFAAAGTTNNIYLYDIRNTGKILHSMTGHEEPVTSLEFSN-- 295
               G  N+++ +   +++  A G    +  YD ++  K  +     +E V SLE     
Sbjct: 347 SEKTGIINTLSIN--QDDVLFAGGDNGILSFYDYKSGHK--YQSLATKEMVGSLEGERSV 402

Query: 296 -----DKDGI-LISGSSDRRVIMW 313
                DK G+ LI+G +D+ + +W
Sbjct: 403 LCSTFDKTGLRLITGEADKSIKIW 426

>TPHA0E01790 Chr5 (359679..361004) [1326 bp, 441 aa] {ON} Anc_5.429
           YDR364C
          Length = 441

 Score = 51.2 bits (121), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 53/200 (26%), Positives = 88/200 (44%), Gaps = 14/200 (7%)

Query: 144 LSTLKYHKDNAYGLAFNPNAEGELISGSDDSTIALWDATNDKLKQPIQEWTTSHSDIVND 203
           L   K H +    L F PN     +SG +D+ I LWD  +D  ++ I+++   H   V  
Sbjct: 141 LYRYKGHTNGTTDLKFFPNTAHMFLSGGNDNMIRLWDFYHD--RRCIRDY-KGHKKAVRS 197

Query: 204 CQWHCFNTN--MFGSVSEDSTLQLFDKRNGGKSDVKISSKGQYNSIAFSGFSENLFAAAG 261
                FN N  +F S S D T++++D    GK   K+      N +     S++ +    
Sbjct: 198 VD---FNNNGTVFFSSSYDQTVKIWDTET-GKVKAKVKCNSIPNDVKPRPLSDSEYIVGL 253

Query: 262 TTNNIYLYDIRNTGK--ILHSMTGHEEPVTSLEFSNDKDGILISGSSDRRVIMWD-LFEI 318
           + + I  YD R + K  ++ +   H+  +  L++  D     IS S D+ V +W+    I
Sbjct: 254 SNSKINHYDQRVSSKNGLVQTYDHHQGSILCLKYFPDGSK-FISSSEDKTVRIWENKINI 312

Query: 319 GAEQQPDEADDGLPEVMMIH 338
             +Q  D     +P  M IH
Sbjct: 313 PIKQIADTTQHSMP-YMDIH 331

 Score = 39.3 bits (90), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 44/188 (23%), Positives = 88/188 (46%), Gaps = 13/188 (6%)

Query: 133 YDCSRDKQSALLSTLKYHKDNAYGLAFNPNAEGELISGSDDSTIALWDATNDKLKQPIQE 192
           YD     ++ L+ T  +H+ +   L + P+   + IS S+D T+ +W+   +K+  PI++
Sbjct: 261 YDQRVSSKNGLVQTYDHHQGSILCLKYFPDGS-KFISSSEDKTVRIWE---NKINIPIKQ 316

Query: 193 W--TTSHSDIVNDC--QWHCFNTNMFGSVSEDSTLQLFDKRNGGKSDVKISSKGQYNSIA 248
              TT HS    D   + H F+T    +      ++   KR   K      S G   S++
Sbjct: 317 IADTTQHSMPYMDIHPEGHYFSTQSMDNTIYSYGMKPKYKRQNKKVFKGHQSVGYKISLS 376

Query: 249 FSGFSENLFAAAGTTNN-IYLYDIRNTGKILHSMT-GHEEPVTSLEFSNDKDGILISGSS 306
           FS   +  +  +G TN+ ++++D + T K+L  +T    +P+T + +   +   L+    
Sbjct: 377 FS--PDGRYICSGDTNSRVFIWDWKTT-KLLRCLTINGNKPITQVTWHPQETSKLLCSGG 433

Query: 307 DRRVIMWD 314
              + ++D
Sbjct: 434 SGYIYIYD 441

>KLTH0A07282g Chr1 complement(604949..607126) [2178 bp, 725 aa] {ON}
           some similarities with uniprot|P18323 Saccharomyces
           cerevisiae YCR084C
          Length = 725

 Score = 51.6 bits (122), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 43/166 (25%), Positives = 81/166 (48%), Gaps = 16/166 (9%)

Query: 157 LAFNPNAEGELISGSDDSTIALWDATNDKLKQPIQEWTTSHSDIVNDCQWHCFNTNMFGS 216
           + F+P+ +  L +G++D  I +WD T  ++   +Q     H   +    +      +  S
Sbjct: 454 VCFSPDGK-FLATGAEDKLIRIWDLTTRRIVMTLQ----GHEQDIYSLDYFPSGDKLV-S 507

Query: 217 VSEDSTLQLFDKRNGGKSDVKISSKGQYNSIAFSGFSENLFAAAGTTNNIYLYDIRNTGK 276
            S D T++++D R  G+  + +S +    ++A S     L AA      + ++D   TG 
Sbjct: 508 GSGDRTVRIWDLR-AGQCSLTLSIEDGVTTVAVSPGDGKLIAAGSLDRTVRIWD-SETGF 565

Query: 277 ILHSM-------TGHEEPVTSLEFSNDKDGILISGSSDRRVIMWDL 315
           ++  +       TGH++ V S+ F+ D  G+ +SGS DR V +W+L
Sbjct: 566 LVERLDSENELGTGHKDSVYSVVFTRDGHGV-VSGSLDRSVKLWNL 610

 Score = 48.9 bits (115), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 50/213 (23%), Positives = 98/213 (46%), Gaps = 29/213 (13%)

Query: 120 IIATVNGEGTIFIYDCSRDKQSALLSTLKYHKDNAYGLAFNPNAEGELISGSDDSTIALW 179
            +AT   +  I I+D +  +   ++ TL+ H+ + Y L + P+ + +L+SGS D T+ +W
Sbjct: 462 FLATGAEDKLIRIWDLTTRR---IVMTLQGHEQDIYSLDYFPSGD-KLVSGSGDRTVRIW 517

Query: 180 DATNDKLKQPIQEWTTSHSDIVNDCQWHCFNTNMFGSVSEDSTLQLFDKRNG-------G 232
           D     L+      T S  D V        +  +  + S D T++++D   G        
Sbjct: 518 D-----LRAGQCSLTLSIEDGVTTVAVSPGDGKLIAAGSLDRTVRIWDSETGFLVERLDS 572

Query: 233 KSDVKISSKGQYNSIAFSGFSENLFAAAGTTNNIYLYDIR-----------NTGKILHSM 281
           ++++    K    S+ F+     + + +    ++ L+++R           NT     + 
Sbjct: 573 ENELGTGHKDSVYSVVFTRDGHGVVSGS-LDRSVKLWNLRSANGGSTEGKANTAASEVTY 631

Query: 282 TGHEEPVTSLEFSNDKDGILISGSSDRRVIMWD 314
           TGH++ V S+  + + D  ++SGS DR V+ WD
Sbjct: 632 TGHKDFVLSVATTQN-DEFILSGSKDRGVLFWD 663

 Score = 40.8 bits (94), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 28/73 (38%), Positives = 44/73 (60%), Gaps = 9/73 (12%)

Query: 246 SIAFSGFSENLFAAAGTTNN-IYLYDIRNTGKILHSMTGHEEPVTSLEF--SNDKDGILI 302
           S+ FS   +  F A G  +  I ++D+  T +I+ ++ GHE+ + SL++  S DK   L+
Sbjct: 453 SVCFS--PDGKFLATGAEDKLIRIWDL-TTRRIVMTLQGHEQDIYSLDYFPSGDK---LV 506

Query: 303 SGSSDRRVIMWDL 315
           SGS DR V +WDL
Sbjct: 507 SGSGDRTVRIWDL 519

>NCAS0A05520 Chr1 complement(1085200..1087215) [2016 bp, 671 aa]
           {ON} Anc_6.363
          Length = 671

 Score = 51.2 bits (121), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 54/215 (25%), Positives = 97/215 (45%), Gaps = 39/215 (18%)

Query: 103 AHDGEINRARYMPQNTNIIATVNGEGTIFIYDCSRDKQSALLSTLKYHKDNAYGLAFNPN 162
            H+ ++    Y P    +++  +G+ T+ I+D  R  Q +L  +++Y       +A +PN
Sbjct: 427 GHEQDVYSLDYFPNGEKLVSG-SGDRTVRIWDL-RTGQCSLTLSIEY---GVTTVAVSPN 481

Query: 163 AEGELISGSDDSTIALWDATNDKLKQPI---QEWTTSHSDIVNDCQWHCFNTNMFGSVSE 219
               + +GS D  + +WD+T   L + +    E  T H D V    +   + N   S S 
Sbjct: 482 DGKFIAAGSLDRAVRVWDSTTGFLVERLDSENELGTGHRDSVYSVVF-TRDGNEVVSGSL 540

Query: 220 DSTLQLFDKRNGGKSDVKISSKGQYNSIAFSGFSENLFAAAGTTNNIYLYDIRNTGKILH 279
           D T++L++ R+ G S+ + + KG               +A+ T    Y+           
Sbjct: 541 DKTVKLWNMRHSGNSNNESNDKG---------------SASATCEVTYV----------- 574

Query: 280 SMTGHEEPVTSLEFSNDKDGILISGSSDRRVIMWD 314
              GH++ V S+  S D D  ++SGS DR ++ WD
Sbjct: 575 ---GHKDFVLSVTTSQD-DKYILSGSKDRGILFWD 605

 Score = 40.0 bits (92), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 28/71 (39%), Positives = 42/71 (59%), Gaps = 5/71 (7%)

Query: 246 SIAFSGFSENLFAAAGTTNN-IYLYDIRNTGKILHSMTGHEEPVTSLEFSNDKDGILISG 304
           S+ FS   E  F A G  +  I ++DI+   KI+  + GHE+ V SL++  + +  L+SG
Sbjct: 392 SVCFSPDGE--FLATGAEDKLIRIWDIQER-KIVMVLKGHEQDVYSLDYFPNGEK-LVSG 447

Query: 305 SSDRRVIMWDL 315
           S DR V +WDL
Sbjct: 448 SGDRTVRIWDL 458

>SAKL0G12892g Chr7 complement(1102157..1103587) [1431 bp, 476 aa]
           {ON} highly similar to uniprot|P33750 Saccharomyces
           cerevisiae YLL011W
          Length = 476

 Score = 51.2 bits (121), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 57/253 (22%), Positives = 95/253 (37%), Gaps = 61/253 (24%)

Query: 119 NIIATVNGEGTIFIYDCSRDKQSALLSTLKYHKDNAYGLAFNPNA------EGELISGSD 172
           N +AT +G+G +  ++ S  ++   L + K H     GL   P        E  ++S  D
Sbjct: 81  NKLATASGDGVVKYWNMSTREE---LCSFKAHYGLVTGLCVTPQHLSKNKNENYMLSCGD 137

Query: 173 DSTIALWDATNDKLKQ----------------------------------------PIQE 192
           D  I LW   +D                                             I+ 
Sbjct: 138 DKMIKLWSVNSDDFSSTRDNDELNTGDGLLKTFHGEYAFQSIDHHRTKSTFVTGGAQIEL 197

Query: 193 WTTSHSDIVNDCQWHC-------FN---TNMFGSVSEDSTLQLFDKRNGGKSDVKISSKG 242
           W T  S  V++  W         FN   T++  S   D+++ L+D R    +  KI    
Sbjct: 198 WDTGRSKPVSNLSWGADNVTSVKFNQNETDILASTGSDNSVVLYDLRTNSPTQ-KIVQTM 256

Query: 243 QYNSIAFSGFSENLFAAAGTTNNIYLYDIRNTGKILHSMTGHEEPVTSLEFSNDKDGILI 302
           + N+I ++      F  A   +N Y YD+RN  + L+    H   V  ++FS   D I +
Sbjct: 257 RTNAICWNPMEAFNFVIANEDHNAYYYDMRNMSRALNVFKDHVSAVMDVDFSPTGDEI-V 315

Query: 303 SGSSDRRVIMWDL 315
           +GS D+ V ++ +
Sbjct: 316 TGSYDKTVRIYQV 328

 Score = 40.8 bits (94), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 60/256 (23%), Positives = 101/256 (39%), Gaps = 26/256 (10%)

Query: 124 VNGEGTIFIYDCSRDKQSALLSTLKYHKDNAYGLAFNPNAEGELISGSDDSTIALWD-AT 182
           V G   I ++D  R K    +S L +  DN   + FN N    L S   D+++ L+D  T
Sbjct: 189 VTGGAQIELWDTGRSKP---VSNLSWGADNVTSVKFNQNETDILASTGSDNSVVLYDLRT 245

Query: 183 NDKLKQPIQEWTTSHSDIVNDCQWHCFNTNMFGSVSEDSTLQLFDKRNGGKS-DVKISSK 241
           N   ++ +Q   T      N   W+      F   +ED     +D RN  ++ +V     
Sbjct: 246 NSPTQKIVQTMRT------NAICWNPMEAFNFVIANEDHNAYYYDMRNMSRALNVFKDHV 299

Query: 242 GQYNSIAFSGFSENLFAAA-GTTNNIYLYDIRNTGKILHSMTGHEEPVTSLEFSNDKDGI 300
                + FS   + +   +   T  IY  +  ++ +I H  T   + V  +++S D    
Sbjct: 300 SAVMDVDFSPTGDEIVTGSYDKTVRIYQVNHGHSREIYH--TKRMQHVFQVKYSMD-SKY 356

Query: 301 LISGSSDRRVIMWDL-------FEIGAEQQPDEADDGLPEVMMIHAGSRSAINDISTHPS 353
           ++SGS D  V +W          +   E+   E DD L E           +  IS H  
Sbjct: 357 VVSGSDDGNVRLWRARAWERSDVKSTREKNKLEYDDKLKERF----KHMPEVRRISRHRH 412

Query: 354 IPWLNASVEENNIVQV 369
           +P +    +E   V++
Sbjct: 413 VPQVVKKAQEIKRVEL 428

 Score = 30.8 bits (68), Expect = 6.3,   Method: Compositional matrix adjust.
 Identities = 43/188 (22%), Positives = 82/188 (43%), Gaps = 32/188 (17%)

Query: 150 HKDNAYGLAFNPNAEGELISGSDDSTIALWDATNDKLKQPIQEWTTSHSDIVNDC--QWH 207
           H+D  Y +A N +A  +L + S D  +  W+ +    ++ +  +   +  +   C    H
Sbjct: 66  HRDGVYVVAKNYHALNKLATASGDGVVKYWNMST---REELCSFKAHYGLVTGLCVTPQH 122

Query: 208 CF---NTNMFGSVSEDSTLQLF-------------DKRNGGKSDVKISSKGQYNSIAFSG 251
                N N   S  +D  ++L+             D+ N G   +K +  G+Y   AF  
Sbjct: 123 LSKNKNENYMLSCGDDKMIKLWSVNSDDFSSTRDNDELNTGDGLLK-TFHGEY---AFQS 178

Query: 252 F----SENLFAAAGTTNNIYLYDIRNTGKILHSMTGHEEPVTSLEFSNDKDGILISGSSD 307
                +++ F   G    I L+D     K + +++   + VTS++F+ ++  IL S  SD
Sbjct: 179 IDHHRTKSTFVTGGA--QIELWDT-GRSKPVSNLSWGADNVTSVKFNQNETDILASTGSD 235

Query: 308 RRVIMWDL 315
             V+++DL
Sbjct: 236 NSVVLYDL 243

>Suva_3.109 Chr3 complement(158211..159758) [1548 bp, 515 aa] {ON}
           YCR072C (REAL)
          Length = 515

 Score = 51.2 bits (121), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 43/156 (27%), Positives = 79/156 (50%), Gaps = 11/156 (7%)

Query: 160 NPNAEGELISGSDDSTIALWDATNDKLKQPIQEWTTSHSDIVNDCQWHCFNTNMFGSVSE 219
           N N+E  +++ SDD TI LW+    K  +PI    T H  +VN   +   +     S S 
Sbjct: 367 NGNSEEMMVTASDDFTIFLWNPL--KSTKPIAR-MTGHQKLVNHVAFS-PDGRYIVSASF 422

Query: 220 DSTLQLFDKRNGGKSDVKISSKGQYNSIAFSGFSEN--LFAAAGTTNNIYLYDIRNTGKI 277
           D++++L+D R+G       + +G   S+    +S +  L  +      + ++D+R TGK+
Sbjct: 423 DNSIKLWDGRDG---KFISTFRGHVASVYQVAWSSDCRLLVSCSKDTTLKVWDVR-TGKL 478

Query: 278 LHSMTGHEEPVTSLEFSNDKDGILISGSSDRRVIMW 313
              + GH++ V ++++S D   +  SG  D+ V +W
Sbjct: 479 SVDLPGHQDEVYTVDWSVDGKRVC-SGGRDKMVRLW 513

 Score = 48.5 bits (114), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 55/207 (26%), Positives = 91/207 (43%), Gaps = 28/207 (13%)

Query: 115 PQNTNIIATVNGEGTIFIYD-CSRDKQSALLSTLKYHKDNAYGLAFNPNAEGELISGSDD 173
           P +   +A+ + +GTI I+D  SR  Q     T+  H ++   + +    +G L SGS D
Sbjct: 245 PGSKPRLASSSKDGTIKIWDTVSRVCQY----TMSGHTNSVSCVKWG--GQGLLYSGSHD 298

Query: 174 STIALWDATNDKLKQPIQEWTTSHSDIVNDCQWHCFNTNMFGSVSEDSTLQL--FD---K 228
            T+ +WD               S    +N  + H    N   S+S D  L++  FD   +
Sbjct: 299 RTVRVWDMN-------------SQGRCINILKSHAHWVNHL-SLSTDYALRVGAFDHTGQ 344

Query: 229 RNGGKSDVKISSKGQYNSIAF-SGFSENLFAAAGTTNNIYLYDIRNTGKILHSMTGHEEP 287
           +     D +  +   Y  I   +G SE +   A     I+L++   + K +  MTGH++ 
Sbjct: 345 KPTSPEDAQKKALANYEKICKKNGNSEEMMVTASDDFTIFLWNPLKSTKPIARMTGHQKL 404

Query: 288 VTSLEFSNDKDGILISGSSDRRVIMWD 314
           V  + FS D   I +S S D  + +WD
Sbjct: 405 VNHVAFSPDGRYI-VSASFDNSIKLWD 430

 Score = 42.7 bits (99), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 42/183 (22%), Positives = 79/183 (43%), Gaps = 17/183 (9%)

Query: 145 STLKYHKDNAYGLAFNPNAEGELISGSDDSTIALWDATNDKLKQPIQEWTTSHSDIVNDC 204
           S +  H       AF P+    +++G+ D+T  +WD         ++     H + V   
Sbjct: 137 SAIAGHGSTILCSAFAPHTSSRMVTGAGDNTARIWDCDTQTPMHTLK----GHFNWVLCV 192

Query: 205 QWHCFNTNMFGSVSEDSTLQLFDKRNG--------GKSDVKISSKGQYNSIAFSGFSENL 256
            W   +  +  + S D+T++L+D + G        G S    S   +   +   G S+  
Sbjct: 193 AWS-PDGEVIATGSMDNTIRLWDPKTGECLGDALRGHSKWITSLSWEPIHLVKPG-SKPR 250

Query: 257 FAAAGTTNNIYLYDIRNTGKILHSMTGHEEPVTSLEFSNDKDGILISGSSDRRVIMWDLF 316
            A++     I ++D  +     ++M+GH   V+ +++     G+L SGS DR V +WD+ 
Sbjct: 251 LASSSKDGTIKIWDTVSR-VCQYTMSGHTNSVSCVKWGG--QGLLYSGSHDRTVRVWDMN 307

Query: 317 EIG 319
             G
Sbjct: 308 SQG 310

 Score = 33.1 bits (74), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 22/84 (26%), Positives = 43/84 (51%), Gaps = 5/84 (5%)

Query: 103 AHDGEINRARYMPQNTNIIATVNGEGTIFIYDCSRDKQSALLSTLKYHKDNAYGLAFNPN 162
            H   +N   + P    I++  + + +I ++D  RD +   +ST + H  + Y +A++ +
Sbjct: 400 GHQKLVNHVAFSPDGRYIVS-ASFDNSIKLWD-GRDGK--FISTFRGHVASVYQVAWSSD 455

Query: 163 AEGELISGSDDSTIALWDATNDKL 186
               L+S S D+T+ +WD    KL
Sbjct: 456 CR-LLVSCSKDTTLKVWDVRTGKL 478

>Kpol_2002.99 s2002 (237070..238533) [1464 bp, 487 aa] {ON}
           (237070..238533) [1464 nt, 488 aa]
          Length = 487

 Score = 50.8 bits (120), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 38/142 (26%), Positives = 70/142 (49%), Gaps = 6/142 (4%)

Query: 174 STIALWDATNDKLKQPIQEWTTSHSDIVNDCQWHCFNTNMFGSVSEDSTLQLFDKRNGGK 233
           + I LWD++  K   PI   T   +D V + +++   T++  S   D+++ L+D R    
Sbjct: 193 AQIQLWDSSRSK---PISNLTWG-ADNVTNVKFNQTETDILASTGSDNSIVLYDLRTNSP 248

Query: 234 SDVKISSKGQYNSIAFSGFSENLFAAAGTTNNIYLYDIRNTGKILHSMTGHEEPVTSLEF 293
           +  KI    + N+I ++      F  A   +N Y YD+RN  + L+    H   V  ++F
Sbjct: 249 TQ-KIVQSMRSNAICWNPMEAFNFVIANEDHNAYYYDMRNMSRALNVFKDHVSAVMDVDF 307

Query: 294 SNDKDGILISGSSDRRVIMWDL 315
           S      L++GS D+ + ++D+
Sbjct: 308 S-PTGTELVTGSYDKTIRIYDI 328

>Kwal_56.24332 s56 (959476..960732) [1257 bp, 418 aa] {ON} YPL247C -
           Hypothetical ORF [contig 164] FULL
          Length = 418

 Score = 50.8 bits (120), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 40/179 (22%), Positives = 78/179 (43%), Gaps = 35/179 (19%)

Query: 167 LISGSDDSTIALWDATNDKLKQP--IQEWTTSHSDIVNDCQWHCFNTNMFGSVSEDSTLQ 224
           +IS S D+T  +WD     L+ P  ++    +H   V D ++   +T +F S   D +++
Sbjct: 181 IISSSIDTTCTVWD-----LQSPNYVKTQLIAHDSEVYDVKFLAQSTQLFASCGGDGSVR 235

Query: 225 LFDKRNGGKSDVKISSKGQYNS---------------------------IAFSGFSENLF 257
           +FD R+   S +     GQ  +                           +  S F  N+ 
Sbjct: 236 VFDLRSLAHSTIIYEPNGQSAATLSQSQDSGGASGTSRDGSNSDNALLRLEPSPFDPNVV 295

Query: 258 AA-AGTTNNIYLYDIRNTGKILHSMTGHEEPVTSLEFSNDKDGILISGSSDRRVIMWDL 315
           A  A  ++N+ + D+R  G  + ++ GH   V  +++   +  +LI+ + D + ++WDL
Sbjct: 296 ATFAHDSSNVLILDMRYPGAAVLTLEGHSGAVNQIQWHQSRQNVLITCADDCQALLWDL 354

 Score = 36.2 bits (82), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 35/154 (22%), Positives = 63/154 (40%), Gaps = 36/154 (23%)

Query: 103 AHDGEINRARYMPQNTNIIATVNGEGTIFIYDCSRDKQSALL--------STLKYHKDN- 153
           AHD E+   +++ Q+T + A+  G+G++ ++D      S ++        +TL   +D+ 
Sbjct: 207 AHDSEVYDVKFLAQSTQLFASCGGDGSVRVFDLRSLAHSTIIYEPNGQSAATLSQSQDSG 266

Query: 154 -AYGLA-----------------FNPNAEGELISGSDDSTIALWDATNDKLKQPIQEWTT 195
            A G +                 F+PN         D S + + D     ++ P     T
Sbjct: 267 GASGTSRDGSNSDNALLRLEPSPFDPNVVATF--AHDSSNVLILD-----MRYPGAAVLT 319

Query: 196 --SHSDIVNDCQWHCFNTNMFGSVSEDSTLQLFD 227
              HS  VN  QWH    N+  + ++D    L+D
Sbjct: 320 LEGHSGAVNQIQWHQSRQNVLITCADDCQALLWD 353

>Skud_12.521 Chr12 (924571..926508) [1938 bp, 645 aa] {ON} YLR429W
           (REAL)
          Length = 645

 Score = 51.2 bits (121), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 46/176 (26%), Positives = 80/176 (45%), Gaps = 19/176 (10%)

Query: 159 FNPNAEGELISGSDDSTIALWDATN--------DKLKQPIQ----EWTTSHSDIVNDCQW 206
           F+P  +  + SGSDDS I +W+           D+  +PI     ++ T H+  V    +
Sbjct: 89  FDPFDDHRIASGSDDSKIGIWNIPENYKFHDHADEDGEPIDIKPVKFLTGHARKVGHILY 148

Query: 207 HCFNTNMFGSVSEDSTLQLFDKRNGGKSDVKISSKGQYNSIAFSGFSENLFAAAGTTNNI 266
           H    N+  S S D+T++L+D    GK  + +       S++FS +  N  A       +
Sbjct: 149 HPVAKNVLASSSGDNTVKLWDVET-GKDMITLKHPNMVTSMSFS-YDGNHLATVARDKKL 206

Query: 267 YLYDIRNTGKILHSMTGH----EEPVTSLEFSNDKDGILISGSSDRRVIMWDLFEI 318
            +++IR+ G+I+     H     + V  L  S+       S  SDR++ +WD F +
Sbjct: 207 RVWNIRD-GRIVSEGPAHTGAKNQRVVWLGNSDRLATTGFSKLSDRQIGIWDAFNL 261

 Score = 36.2 bits (82), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 28/118 (23%), Positives = 53/118 (44%), Gaps = 16/118 (13%)

Query: 147 LKYHKDNAYGLAFNPNAEGELISGSDDSTIALWDATNDKLKQPIQEWTTSHSDIVNDCQW 206
           L  H      + ++P A+  L S S D+T+ LWD    K        T  H ++V    +
Sbjct: 136 LTGHARKVGHILYHPVAKNVLASSSGDNTVKLWDVETGK-----DMITLKHPNMVTSMSF 190

Query: 207 HCFNTNMFGSVSEDSTLQLFDKRNG----------GKSDVKISSKGQYNSIAFSGFSE 254
             ++ N   +V+ D  L++++ R+G          G  + ++   G  + +A +GFS+
Sbjct: 191 -SYDGNHLATVARDKKLRVWNIRDGRIVSEGPAHTGAKNQRVVWLGNSDRLATTGFSK 247

>SAKL0F11506g Chr6 complement(894080..895786) [1707 bp, 568 aa] {ON}
           similar to uniprot|P21304 Saccharomyces cerevisiae
           YLR196W PWP1
          Length = 568

 Score = 50.8 bits (120), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 42/172 (24%), Positives = 80/172 (46%), Gaps = 11/172 (6%)

Query: 149 YHKDNAYGLAFNPNAEGELISGSDDSTIALWDATNDKLKQPIQEWTTSHSDIVNDCQWHC 208
           +H D    L+ N +    L S S D T+ LWD  N    + I   +  ++  V+  QWH 
Sbjct: 277 HHTDAVLSLSHNRHFRAVLASTSADHTVKLWDLNNGIAARSIA--SIHNNKNVSSSQWHS 334

Query: 209 FNTNMFGSVSEDSTLQLFDKRNGGKSDV----KISSKGQYNSIAFSGFSENLFAAAGTTN 264
            + ++  +   DS + + D R    S +     + +  +  S+ F+  SEN+      + 
Sbjct: 335 TDGSILLTGGYDSRVAVSDVRIADDSAMSKYWSVMAGEEIESVRFA--SENVIMCGTDSG 392

Query: 265 NIYLYDIRN--TGKILHSMTGHEEPVTSLEFSNDKDGILISGSSDRRVI-MW 313
           N+Y +DIRN    K L ++  H+  ++SL+ +     +L + +   +V+ +W
Sbjct: 393 NVYSFDIRNGEGSKPLWTLKAHDAGISSLDVNQHVPNMLATSAMGEKVVKLW 444

>YPL151C Chr16 complement(266180..267535) [1356 bp, 451 aa] {ON}
           PRP46Member of the NineTeen Complex (NTC) that contains
           Prp19p and stabilizes U6 snRNA in catalytic forms of the
           spliceosome containing U2, U5, and U6 snRNAs
          Length = 451

 Score = 50.8 bits (120), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 43/162 (26%), Positives = 81/162 (50%), Gaps = 14/162 (8%)

Query: 157 LAFNPNAEGELISGSDDSTIALWDATNDKLKQPIQEWTTSHSDI-VNDCQWHCFNTNMFG 215
           +A +P      I+GS+D+T+ +WD    KLK  +     +  D+ V+D   + F      
Sbjct: 145 VAIDPVDNEWFITGSNDTTMKVWDLATGKLKTTLAGHVMTVRDVAVSDRHPYLF------ 198

Query: 216 SVSEDSTLQLFDKRNGGKSDVKISSKGQYNSIAFSGF--SENLFAAAGTTNNIYLYDIRN 273
           SVSED T++ +D     K+ +     G  + +       + +L A AG  + I L+D+R 
Sbjct: 199 SVSEDKTVKCWDLE---KNQIIRDYYGHLSGVRTVSIHPTLDLIATAGRDSVIKLWDMRT 255

Query: 274 TGKILHSMTGHEEPVTSLEFSNDKDGILISGSSDRRVIMWDL 315
              ++ ++ GH+ P+  ++ +   D  ++S S+D  V +WD+
Sbjct: 256 RIPVI-TLVGHKGPINQVQCT-PVDPQVVSSSTDATVRLWDV 295

 Score = 30.8 bits (68), Expect = 7.2,   Method: Compositional matrix adjust.
 Identities = 45/211 (21%), Positives = 91/211 (43%), Gaps = 19/211 (9%)

Query: 119 NIIATVNGEGTIFIYDCSRDKQSALLSTLKYHKDNAYGLAFNPNAEGELISGSDDSTIAL 178
           ++IAT   +  I ++D    +    + TL  HK     +   P  + +++S S D+T+ L
Sbjct: 237 DLIATAGRDSVIKLWDM---RTRIPVITLVGHKGPINQVQCTP-VDPQVVSSSTDATVRL 292

Query: 179 WDATNDKLKQPIQEWTTSHSDIVNDCQWHCFNTNMFGSVSEDSTLQLFDKRNGG-KSDVK 237
           WD    K  + +    T H   V     H    ++  + ++D  ++ +    G   ++ +
Sbjct: 293 WDVVAGKTMKVL----THHKRSVRATALHPKEFSVASACTDD--IRSWGLAEGSLLTNFE 346

Query: 238 ISSKGQYNSIAFSGFSENLFAAAGTTNNIYLYDIRNTGKI----LHSMTGHEEPVTSLEF 293
               G  N+++ +   +++  A G    +  YD ++  K        M G  E   S+  
Sbjct: 347 SEKTGIINTLSIN--QDDVLFAGGDNGVLSFYDYKSGHKYQSLATREMVGSLEGERSVLC 404

Query: 294 SN-DKDGI-LISGSSDRRVIMWDLFEIGAEQ 322
           S  DK G+ LI+G +D+ + +W   E   ++
Sbjct: 405 STFDKTGLRLITGEADKSIKIWKQDETATKE 435

>AAL157C Chr1 complement(70077..71516) [1440 bp, 479 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YLL011W
           (SOF1)
          Length = 479

 Score = 50.8 bits (120), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 41/159 (25%), Positives = 76/159 (47%), Gaps = 18/159 (11%)

Query: 160 NPNAEGELISGSDDSTIALWDATNDKLKQPIQEWTTSHSDIVNDCQWHCFNTN---MFGS 216
           NPN     ++G   + I LWD      K+P+   +      V++  +  FN N   +  S
Sbjct: 188 NPN----FVTGG--AQIQLWDVNR---KKPLSNLSWG----VDNVSFVRFNQNEEDILAS 234

Query: 217 VSEDSTLQLFDKRNGGKSDVKISSKGQYNSIAFSGFSENLFAAAGTTNNIYLYDIRNTGK 276
              D+++ L+D R    +  K+  + + N++ ++      FA A   +N Y YD+RN  +
Sbjct: 235 TGSDNSIVLYDLRTNSPTQ-KVVQRMRTNALCWNPMEPFNFAIANEDHNAYYYDMRNMSR 293

Query: 277 ILHSMTGHEEPVTSLEFSNDKDGILISGSSDRRVIMWDL 315
            LH    H   V  ++FS   + I ++GS D+ + +++L
Sbjct: 294 ALHVFKDHVSAVMDVDFSPTGEEI-VTGSYDKTIRIFNL 331

 Score = 42.4 bits (98), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 50/184 (27%), Positives = 79/184 (42%), Gaps = 21/184 (11%)

Query: 150 HKDNAYGLAFNPNAEGELISGSDDSTIALWD-ATNDKLKQPIQEWTTSHSDIVNDCQWHC 208
           H+D  Y LA N N   +L SGS D  +  W+ AT ++L      +       V       
Sbjct: 66  HRDGCYVLAKNYNVLNKLASGSADGVVKYWNMATREELCSFRAHYGLVTGLCVTPTHLSP 125

Query: 209 FNTNMFG-SVSEDSTLQLF----DKRNGGKSDVKISS--------KGQYNSIAFSGFSEN 255
              + F  S  +D T++L+    D  N  K D KI S        K  Y   AF     +
Sbjct: 126 TKKDSFMLSCGDDKTIKLWSVNSDDFNSIKDDTKIVSDTGDGALLKTFYGEHAFQSIDHH 185

Query: 256 L----FAAAGTTNNIYLYDIRNTGKILHSMTGHEEPVTSLEFSNDKDGILISGSSDRRVI 311
                F   G    I L+D+ N  K L +++   + V+ + F+ +++ IL S  SD  ++
Sbjct: 186 RRNPNFVTGGA--QIQLWDV-NRKKPLSNLSWGVDNVSFVRFNQNEEDILASTGSDNSIV 242

Query: 312 MWDL 315
           ++DL
Sbjct: 243 LYDL 246

>KLLA0C08547g Chr3 (749737..751284) [1548 bp, 515 aa] {ON} highly
           similar to uniprot|P25382 Saccharomyces cerevisiae
           YCR072C Protein required for cell viability,
          Length = 515

 Score = 50.8 bits (120), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 58/207 (28%), Positives = 89/207 (42%), Gaps = 28/207 (13%)

Query: 115 PQNTNIIATVNGEGTIFIYDCSRDKQSALLSTLKYHKDNAYGLAFNPNAEGELISGSDDS 174
           P +   +AT + +GTI I+D +R      L TL  H  +   + +    +  L SGS D 
Sbjct: 245 PGDKPRLATASKDGTIKIWDTTR---RVCLLTLCGHTSSVSCVKWG--GKNVLYSGSHDK 299

Query: 175 TIALWDAT-NDKLKQPIQEWTTSHSDIVNDCQWHCFNTNMFGSVSEDSTLQL--FDKRN- 230
           TI  WD   N K    ++    SH+  VN             S+S D  L+L  FD +  
Sbjct: 300 TIRCWDMNLNGKCINILK----SHAHWVNHL-----------SLSTDYALRLGAFDHKGE 344

Query: 231 --GGKSDVKISSKGQYNSIA-FSGFSENLFAAAGTTNNIYLYDIRNTGKILHSMTGHEEP 287
                 + +  +   Y  +A   G  E L   A     +YL++   + K +  MTGH++ 
Sbjct: 345 TPASPEEAQQKALKNYEKVAKRKGDFEELMVTASDDFTMYLWNPLKSTKPITRMTGHQKL 404

Query: 288 VTSLEFSNDKDGILISGSSDRRVIMWD 314
           V  + FS D   I +S S D  + +WD
Sbjct: 405 VNHVAFSPDGRYI-VSASFDNSIKLWD 430

 Score = 45.1 bits (105), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 42/189 (22%), Positives = 75/189 (39%), Gaps = 37/189 (19%)

Query: 145 STLKYHKDNAYGLAFNPNAEGELISGSDDSTIALWDATNDKLKQPIQEWTTSHSDIVNDC 204
           S +  H       AF PN    +++G+ D+T  +WD         +Q     H + V  C
Sbjct: 137 SAIAGHGSTILCSAFAPNTSSRMVTGAGDNTACIWDCDTQTRMCTLQ----GHHNWVLCC 192

Query: 205 QWHCFNTNMFGSVSEDSTLQLFDKRNGGKSDVKISSKGQYNSIAFSGFSENL-------- 256
            W   +  +  + S D+T++L++           SSKG+    A  G S+ +        
Sbjct: 193 SWS-PDGELIATGSMDNTIRLWE-----------SSKGKPYGDALRGHSKWITSLSWEPI 240

Query: 257 ----------FAAAGTTNNIYLYDIRNTGKILHSMTGHEEPVTSLEFSNDKDGILISGSS 306
                      A A     I ++D      +L ++ GH   V+ +++      +L SGS 
Sbjct: 241 HLVKPGDKPRLATASKDGTIKIWDTTRRVCLL-TLCGHTSSVSCVKWGGKN--VLYSGSH 297

Query: 307 DRRVIMWDL 315
           D+ +  WD+
Sbjct: 298 DKTIRCWDM 306

 Score = 34.3 bits (77), Expect = 0.61,   Method: Compositional matrix adjust.
 Identities = 23/84 (27%), Positives = 43/84 (51%), Gaps = 5/84 (5%)

Query: 103 AHDGEINRARYMPQNTNIIATVNGEGTIFIYDCSRDKQSALLSTLKYHKDNAYGLAFNPN 162
            H   +N   + P    I++  + + +I ++D  RD +   LST + H  + Y +A++ +
Sbjct: 400 GHQKLVNHVAFSPDGRYIVS-ASFDNSIKLWD-GRDGK--FLSTFRGHVASVYQVAWSSD 455

Query: 163 AEGELISGSDDSTIALWDATNDKL 186
               L+S S D+T+ +WD    KL
Sbjct: 456 CR-LLVSCSKDTTLKVWDVKTRKL 478

>CAGL0C03608g Chr3 (360681..362612) [1932 bp, 643 aa] {ON} similar
           to uniprot|P16649 Saccharomyces cerevisiae YCR084c TUP1
           general transcription repressor
          Length = 643

 Score = 50.8 bits (120), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 54/230 (23%), Positives = 108/230 (46%), Gaps = 22/230 (9%)

Query: 157 LAFNPNAEGELISGSDDSTIALWDATNDKLKQPIQEWTTSHSDIVNDCQWHCFNT-NMFG 215
           + F+P+ +  L +G++D  I +WD    K+   ++     H   +    +  F + N   
Sbjct: 379 VCFSPDGKF-LATGAEDKLIRIWDIAQRKIVMVLR----GHEQDIYSLDY--FQSGNKLV 431

Query: 216 SVSEDSTLQLFDKRNGGKSDVKISSKGQYNSIAFSGFSENLFAAAGTTNNIYLYDIRNTG 275
           S S D T++++D   G +  + +S +    ++A S  + N  AA      + ++D  N+G
Sbjct: 432 SGSGDRTIRIWDLHTG-QCSLTLSIEDGVTTVAVSPGNGNYVAAGSLDRTVRVWD-SNSG 489

Query: 276 KILHSM-------TGHEEPVTSLEFSNDKDGILISGSSDRRVIMWDLFEI-GAEQQPDEA 327
            ++  +        GH++ V S+ F+ D   I +SGS DR V +W+L  I GA   P   
Sbjct: 490 FLVERLDSEGETGVGHKDSVYSVVFTRDGKNI-VSGSLDRSVKLWNLRNINGASTSPQPK 548

Query: 328 DDGLPEVMMIHAGSRSAINDISTHPSIPWLNASVEENNIVQVWKCSSKLP 377
            +G  E  M + G +  +  ++T  +  ++ +  ++  ++  W   S +P
Sbjct: 549 TEGNCE--MTYIGHKDFVLSVTTTENDQYILSGSKDRGVI-FWDKVSGVP 595

 Score = 50.8 bits (120), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 52/214 (24%), Positives = 96/214 (44%), Gaps = 30/214 (14%)

Query: 120 IIATVNGEGTIFIYDCSRDKQSALLSTLKYHKDNAYGLAFNPNAEGELISGSDDSTIALW 179
            +AT   +  I I+D ++ K   ++  L+ H+ + Y L +  +   +L+SGS D TI +W
Sbjct: 387 FLATGAEDKLIRIWDIAQRK---IVMVLRGHEQDIYSLDYFQSG-NKLVSGSGDRTIRIW 442

Query: 180 DATNDKLKQPIQEWTTSHSDIVNDCQWHCFNTNMFGSVSEDSTLQLFDKRNG-------G 232
           D    +        T S  D V        N N   + S D T++++D  +G        
Sbjct: 443 DLHTGQC-----SLTLSIEDGVTTVAVSPGNGNYVAAGSLDRTVRVWDSNSGFLVERLDS 497

Query: 233 KSDVKISSKGQYNSIAFSGFSENLFAAAGTTNNIYLYDIRNT------------GKILHS 280
           + +  +  K    S+ F+   +N+ + +    ++ L+++RN             G    +
Sbjct: 498 EGETGVGHKDSVYSVVFTRDGKNIVSGS-LDRSVKLWNLRNINGASTSPQPKTEGNCEMT 556

Query: 281 MTGHEEPVTSLEFSNDKDGILISGSSDRRVIMWD 314
             GH++ V S+  + + D  ++SGS DR VI WD
Sbjct: 557 YIGHKDFVLSVT-TTENDQYILSGSKDRGVIFWD 589

 Score = 39.7 bits (91), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 32/108 (29%), Positives = 52/108 (48%), Gaps = 7/108 (6%)

Query: 211 TNMFGSVSEDSTLQLFDKRNGGKSDVKISSKGQY--NSIAFSGFSENLFAAAGTTNN-IY 267
           T +F   + +   +L D    G  D   +S       S+ FS   +  F A G  +  I 
Sbjct: 341 TKIFEVATGNLVTELVDDTKTGTEDANSASSADLYIRSVCFS--PDGKFLATGAEDKLIR 398

Query: 268 LYDIRNTGKILHSMTGHEEPVTSLEFSNDKDGILISGSSDRRVIMWDL 315
           ++DI    KI+  + GHE+ + SL++    +  L+SGS DR + +WDL
Sbjct: 399 IWDIAQR-KIVMVLRGHEQDIYSLDYFQSGNK-LVSGSGDRTIRIWDL 444

>KLLA0F17237g Chr6 (1577197..1578768) [1572 bp, 523 aa] {ON} highly
           similar to uniprot|Q04225 Saccharomyces cerevisiae
           YMR131C RRB1 essential nuclear protein involved in early
           steps of ribosome biogenesis
          Length = 523

 Score = 50.8 bits (120), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 80/400 (20%), Positives = 157/400 (39%), Gaps = 54/400 (13%)

Query: 25  PLLYDFVSETRLTWPSLTLQWLPGDKTSTR----QHLILGTLTSGAETDYLKIAAL---D 77
           P +Y+ +    + WP +TL  +P    S R    Q L++ T T  ++ +  ++  L    
Sbjct: 127 PTVYEMLHTVNVPWPCMTLDVIPDTLGSGRRNYPQSLLMATATQASKKNQNELMVLKMSQ 186

Query: 78  LPDEIIIGXXXXXXXXXXXXXXXXFAHDGE-------INRARYMP----QNTNIIATVNG 126
           L   ++                     + E        NR +  P        + +T++ 
Sbjct: 187 LAKTLVKEDEDENEGEDEDEDGTDPVIENENISLKDTTNRLKVSPFANAAQEVLCSTMSE 246

Query: 127 EGTIFIYDCSRD------------KQSAL-LSTLKYHKD-NAYGLAFNPNAE-GELISGS 171
            G ++I+D +              KQ+   + T++ H     Y   ++P  + G ++SG 
Sbjct: 247 NGEVYIFDLASQVKAFETPGYQIPKQAKRPIHTVRNHGSVEGYANDWSPIIKTGAMLSGD 306

Query: 172 DDSTIALWDATNDKLKQPIQEWTTSHSDIVNDCQWHCFNTNMFGSVSEDSTLQLFDKRNG 231
               + L      K     Q +T +++  + D QW    + +F S   D  ++++D R+ 
Sbjct: 307 CSGQVFLTQRHTSKWITDKQAFTVANNKSIEDLQWSRTESTVFASCGIDGYIRIWDTRS- 365

Query: 232 GKSDVKISSKGQYNSIAFSGFSENL--FAAAGTTNNIY-LYDIR-------NTGKILHSM 281
            K    IS K     +    +SE +    A+G  +  + ++D+R       +T   +   
Sbjct: 366 KKHKPAISVKASNTDVNVISWSEKIGYLLASGDDDGTWGVWDLRQFTPQNASTASPVAQY 425

Query: 282 TGHEEPVTSLEFSNDKDGILISGSSDRRVIMWDL-FEIGAEQQPDEADDGL------PEV 334
             H+  +TS+ F+   + I+   S D  V +WDL  E   E+   +A +        P++
Sbjct: 426 QFHKGAITSISFNPLDESIIAVASEDNTVTLWDLSVEADDEEIKQQAAETKELQQIPPQL 485

Query: 335 MMIHAGSRSAINDISTHPSIPWLNASVEENNIVQVWKCSS 374
           + +H   +  + D+  H  IP    S   + +  VWK  S
Sbjct: 486 LFVHW--QKEVKDVKWHKQIPGCLVSTGTDGL-NVWKTIS 522

>ACR137W Chr3 (590077..591354) [1278 bp, 425 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YPL151C (PRP46)
          Length = 425

 Score = 50.4 bits (119), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 45/160 (28%), Positives = 76/160 (47%), Gaps = 10/160 (6%)

Query: 157 LAFNPNAEGELISGSDDSTIALWDATNDKLKQPIQEWTTSHSDIVNDCQWHCFNTNMFGS 216
           +  +P       +GS+DSTI +WD    KLK  +Q     H   V D      +  MF S
Sbjct: 119 VCVDPVDNAWFATGSNDSTIRVWDLATGKLKVTLQ----GHIMTVRDICISARHPYMF-S 173

Query: 217 VSEDSTLQLFD-KRNGGKSDVKISSKGQYNSIAFSGFSENLFAAAGTTNNIYLYDIRNTG 275
            S+D  ++ +D +RN    D   +  G ++       S +L  +AG  + + ++DIR+  
Sbjct: 174 ASQDKLVKCWDLERNTVVRDFHGTLSGVHSVDLHP--SLDLIVSAGRDSVVRVWDIRSRS 231

Query: 276 KILHSMTGHEEPVTSLEFSNDKDGILISGSSDRRVIMWDL 315
            +L ++ GH  P+  +      D  ++S S+D  V +WDL
Sbjct: 232 CVL-TLAGHRGPINKVR-CLPVDPQIVSCSTDATVKLWDL 269

 Score = 40.4 bits (93), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 34/131 (25%), Positives = 57/131 (43%), Gaps = 11/131 (8%)

Query: 103 AHDGEINRARYMPQNTNIIATVNGEGTIFIYDCSRDKQSALLSTLKYHKDNAYGLAFNPN 162
            H G IN+ R +P +  I+ + + + T+ ++D    K    + TL +HK N   LAFNP 
Sbjct: 238 GHRGPINKVRCLPVDPQIV-SCSTDATVKLWDLVAGKP---MKTLTHHKRNVRDLAFNPT 293

Query: 163 AEGELISGSDDSTIALWDATNDKLKQPIQEWTTSHSDIVNDCQWHCFNTNMFGSVSEDST 222
                 + +DD  I  W   + +L   +  + +    IVN     C    +  +  +   
Sbjct: 294 EFSFASACTDD--IRSWKLVDGQL---LTNFNSEALGIVNTLA--CNQDGVLFAGGDTGE 346

Query: 223 LQLFDKRNGGK 233
           L  FD + G K
Sbjct: 347 LSFFDYKTGHK 357

>Ecym_2498 Chr2 complement(974601..976229) [1629 bp, 542 aa] {ON}
           similar to Ashbya gossypii AER263C
          Length = 542

 Score = 50.8 bits (120), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 56/206 (27%), Positives = 89/206 (43%), Gaps = 26/206 (12%)

Query: 115 PQNTNIIATVNGEGTIFIYDCSRDKQSALLSTLKYHKDNAYGLAFNPNAEGELISGSDDS 174
           P N   IA+ + +GTI ++D  R +Q  L  TL  H  +   + +    +G + +GS D 
Sbjct: 272 PGNKPRIASASKDGTIKVWDTVR-RQCIL--TLSGHTSSVSCIKWG--GQGVIYTGSHDR 326

Query: 175 TIALWDATNDKLKQPIQEWTTSHSDIVNDCQWHCFNTNMFGSVSEDSTLQL--FD---KR 229
           TI  WD               +    +N  + H    N   S+S D  L++  FD    R
Sbjct: 327 TIRCWDMN-------------AGGKCINILKSHAHWVNHL-SLSTDYALKVGAFDHTYSR 372

Query: 230 NGGKSDVKISSKGQYNSIA-FSGFSENLFAAAGTTNNIYLYDIRNTGKILHSMTGHEEPV 288
                + +  +   Y  +A  +G  E L A A     +YL++     K L  MTGH++ V
Sbjct: 373 PATAEEAQKRALKNYEKVAKRNGVLEELIATASDDFTMYLWNPLKGTKPLTRMTGHQKLV 432

Query: 289 TSLEFSNDKDGILISGSSDRRVIMWD 314
             + FS D   I +S S D  + +W+
Sbjct: 433 NHVAFSPDGRYI-VSASFDNSIKLWE 457

 Score = 42.0 bits (97), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 39/178 (21%), Positives = 77/178 (43%), Gaps = 15/178 (8%)

Query: 145 STLKYHKDNAYGLAFNPNAEGELISGSDDSTIALWDATNDKLKQPIQEWTTSHSDIVNDC 204
           S +  H        F P+    +++GS D+   +WD      + PI      H++ V   
Sbjct: 164 SAIAGHSSTILCSTFAPHTSSRMVTGSGDNNARIWDCDT---QTPIYT-LKGHTNWVLCV 219

Query: 205 QWHCFNTNMFGSVSEDSTLQLFDKRNG-GKSDVKISSKGQYNSIAFSGF------SENLF 257
            W   +  +  + S D+T++L+D + G  K D          S+++         ++   
Sbjct: 220 AWSA-DGEVIATGSMDNTIRLWDAQTGDSKGDALRGHSKWITSMSWEPIHLVTPGNKPRI 278

Query: 258 AAAGTTNNIYLYDIRNTGKILHSMTGHEEPVTSLEFSNDKDGILISGSSDRRVIMWDL 315
           A+A     I ++D      IL +++GH   V+ +++     G++ +GS DR +  WD+
Sbjct: 279 ASASKDGTIKVWDTVRRQCIL-TLSGHTSSVSCIKWGG--QGVIYTGSHDRTIRCWDM 333

 Score = 32.3 bits (72), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 21/84 (25%), Positives = 42/84 (50%), Gaps = 5/84 (5%)

Query: 103 AHDGEINRARYMPQNTNIIATVNGEGTIFIYDCSRDKQSALLSTLKYHKDNAYGLAFNPN 162
            H   +N   + P    I++  + + +I +++ S  K    +ST + H  + Y +A++ +
Sbjct: 427 GHQKLVNHVAFSPDGRYIVS-ASFDNSIKLWEGSSGK---FISTFRGHVASVYQVAWSSD 482

Query: 163 AEGELISGSDDSTIALWDATNDKL 186
               L+S S D+T+ +WD    KL
Sbjct: 483 CR-LLVSCSKDTTLKVWDVRTRKL 505

>NDAI0J01180 Chr10 complement(273472..276876) [3405 bp, 1134 aa]
           {ON} Anc_8.288 YDR128W
          Length = 1134

 Score = 50.8 bits (120), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 32/118 (27%), Positives = 58/118 (49%)

Query: 197 HSDIVNDCQWHCFNTNMFGSVSEDSTLQLFDKRNGGKSDVKISSKGQYNSIAFSGFSENL 256
           HS  + D  ++  N ++  + S D+ +  +D R+  K     S+     S     F ++ 
Sbjct: 112 HSRAITDINFNPENPDILATCSIDTYVHAWDMRSPHKPFYSTSAWRSSASQVKWNFKDSN 171

Query: 257 FAAAGTTNNIYLYDIRNTGKILHSMTGHEEPVTSLEFSNDKDGILISGSSDRRVIMWD 314
             A+   N+++++D+RN    L  + GHE  V S++FS  K   ++S S+D  V  WD
Sbjct: 172 ILASSHGNDVFIWDLRNGSTPLCQLVGHESSVNSIDFSRFKSTEIMSSSNDGTVKFWD 229

 Score = 32.7 bits (73), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 33/153 (21%), Positives = 65/153 (42%), Gaps = 9/153 (5%)

Query: 120 IIATVNGEGTIFIYDCSRDKQSALLSTLKYHKDNAYGLAFNPNAEGELISGSDDSTIALW 179
           +++T N +    I++ ++    A+   L  H      + FNP     L + S D+ +  W
Sbjct: 84  VVSTSNQKA--LIWNLAKSSSDAIEHVLHGHSRAITDINFNPENPDILATCSIDTYVHAW 141

Query: 180 DATN-DKLKQPIQEWTTSHSDIVNDCQWHCFNTNMFGSVSEDSTLQLFDKRNGGKSDVK- 237
           D  +  K       W +S S +    +W+  ++N+  S S  + + ++D RNG     + 
Sbjct: 142 DMRSPHKPFYSTSAWRSSASQV----KWNFKDSNILAS-SHGNDVFIWDLRNGSTPLCQL 196

Query: 238 ISSKGQYNSIAFSGFSENLFAAAGTTNNIYLYD 270
           +  +   NSI FS F      ++     +  +D
Sbjct: 197 VGHESSVNSIDFSRFKSTEIMSSSNDGTVKFWD 229

 Score = 30.8 bits (68), Expect = 7.5,   Method: Compositional matrix adjust.
 Identities = 19/65 (29%), Positives = 35/65 (53%), Gaps = 3/65 (4%)

Query: 116 QNTNIIATVNGEGTIFIYDCSRDKQSALLSTLKYHKDNAYGLAFNPNAEGELISGSDDST 175
           +++NI+A+ +G   +FI+D      S  L  L  H+ +   + F+     E++S S+D T
Sbjct: 168 KDSNILASSHG-NDVFIWDLR--NGSTPLCQLVGHESSVNSIDFSRFKSTEIMSSSNDGT 224

Query: 176 IALWD 180
           +  WD
Sbjct: 225 VKFWD 229

>Kwal_56.23685 s56 complement(656691..659999) [3309 bp, 1102 aa]
           {ON} YDR128W - Hypothetical ORF [contig 174] FULL
          Length = 1102

 Score = 50.8 bits (120), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 36/155 (23%), Positives = 72/155 (46%), Gaps = 2/155 (1%)

Query: 160 NPNAEGELISGSDDSTIALWDATNDKLKQPIQEWTTSHSDIVNDCQWHCFNTNMFGSVSE 219
           +P+    +IS S+   + LW+ + +     I+     HS  + D  +H  +  +  + S 
Sbjct: 78  HPSKPSWVISTSNQKAL-LWNLSRNS-SDAIEHVLHGHSRAITDINFHPTHPEILATCSI 135

Query: 220 DSTLQLFDKRNGGKSDVKISSKGQYNSIAFSGFSENLFAAAGTTNNIYLYDIRNTGKILH 279
           D+ +  +D R+  ++    S      S     +  +   A+  +N++Y++D+R     LH
Sbjct: 136 DAYVHAWDMRSPRRAYYSASVWSAGASQVKWNYKNSNVMASAHSNDVYIWDLRKGCTPLH 195

Query: 280 SMTGHEEPVTSLEFSNDKDGILISGSSDRRVIMWD 314
            + GH   V S++FS   +  ++S S+D  V  WD
Sbjct: 196 VLQGHVNSVNSIDFSKFDETEIMSSSNDGTVKFWD 230

 Score = 32.7 bits (73), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 18/65 (27%), Positives = 36/65 (55%), Gaps = 3/65 (4%)

Query: 116 QNTNIIATVNGEGTIFIYDCSRDKQSALLSTLKYHKDNAYGLAFNPNAEGELISGSDDST 175
           +N+N++A+ +    ++I+D    K    L  L+ H ++   + F+   E E++S S+D T
Sbjct: 169 KNSNVMASAHS-NDVYIWDLR--KGCTPLHVLQGHVNSVNSIDFSKFDETEIMSSSNDGT 225

Query: 176 IALWD 180
           +  WD
Sbjct: 226 VKFWD 230

>TBLA0B08730 Chr2 complement(2077729..2079114) [1386 bp, 461 aa]
           {ON} Anc_3.25 YNL317W
          Length = 461

 Score = 50.4 bits (119), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 44/195 (22%), Positives = 92/195 (47%), Gaps = 11/195 (5%)

Query: 121 IATVNGEGTIFIYDCSRDKQSALLSTLKYHKDNAYGLAFNPNAEGELISGSDDSTIALWD 180
             T + +  + I++ S  KQ  +L+    H  +     ++P   G ++SGS D+ +  WD
Sbjct: 182 FVTCSDDNILKIWNFSNGKQERILTG---HHWDVKSCDWHPEM-GLIVSGSKDNLVKFWD 237

Query: 181 ATNDKLKQPIQEWTTSHSDIVNDCQWHCFNTNMFGSVSEDSTLQLFDKRNGGKSDVKISS 240
             + +    I  +  +    V   ++     N    +S+D + ++FD RN  K  + +  
Sbjct: 238 PRSGQCVSTILNFKHT----VLRTRFQPTRGNYLLGISKDKSCRVFDIRNHTKELLTVRD 293

Query: 241 KGQYNSIAFSGFSENLFAAAGTTNNIYLYDI-RNTGKILHSMT-GHEEPVTSLEFSNDKD 298
           +  + ++++   +E++F  A    +I  +DI  +  K +H++   HE+ +T++ + N   
Sbjct: 294 EVDFMTLSWHPINESVFTLANYDGSIKHFDILEDLEKPIHTIPFAHEKCITAMSY-NPIG 352

Query: 299 GILISGSSDRRVIMW 313
            IL S S DR +  W
Sbjct: 353 HILASASKDRTIRFW 367

>SAKL0A00660g Chr1 (71855..73837) [1983 bp, 660 aa] {ON} some
           similarities with uniprot|P18323 Saccharomyces
           cerevisiae YCR084C
          Length = 660

 Score = 50.4 bits (119), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 43/176 (24%), Positives = 84/176 (47%), Gaps = 16/176 (9%)

Query: 157 LAFNPNAEGELISGSDDSTIALWDATNDKLKQPIQEWTTSHSDIVNDCQWHCFNTNMFGS 216
           + F+P+ +  L +G++D  I +WD +  ++   +Q     H   +    +      +  S
Sbjct: 384 VCFSPDGKF-LATGAEDKLIRIWDLSTKRIVMTLQ----GHEQDIYSLDYFPSGDKLV-S 437

Query: 217 VSEDSTLQLFDKRNGGKSDVKISSKGQYNSIAFSGFSENLFAAAGTTNNIYLYDIRNTGK 276
            S D T++++D R G +  + +S +    ++A S       AA      + ++D   TG 
Sbjct: 438 GSGDRTVRIWDLRTG-QCSLTLSIEDGVTTVAVSPGEGKFIAAGSLDRTLRVWD-SETGF 495

Query: 277 ILHSM-------TGHEEPVTSLEFSNDKDGILISGSSDRRVIMWDLFEIGAEQQPD 325
           ++  +       TGH++ V S+ F+ D  G+ +SGS DR V +W+L   G+  + D
Sbjct: 496 LVERLDSENELGTGHKDSVYSVVFTRDGQGV-VSGSLDRSVKLWNLHNTGSSSKND 550

 Score = 50.4 bits (119), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 52/214 (24%), Positives = 97/214 (45%), Gaps = 30/214 (14%)

Query: 120 IIATVNGEGTIFIYDCSRDKQSALLSTLKYHKDNAYGLAFNPNAEGELISGSDDSTIALW 179
            +AT   +  I I+D S  +   ++ TL+ H+ + Y L + P+ + +L+SGS D T+ +W
Sbjct: 392 FLATGAEDKLIRIWDLSTKR---IVMTLQGHEQDIYSLDYFPSGD-KLVSGSGDRTVRIW 447

Query: 180 DATNDKLKQPIQEWTTSHSDIVNDCQWHCFNTNMFGSVSEDSTLQLFDKRNG-------G 232
           D     L+      T S  D V              + S D TL+++D   G        
Sbjct: 448 D-----LRTGQCSLTLSIEDGVTTVAVSPGEGKFIAAGSLDRTLRVWDSETGFLVERLDS 502

Query: 233 KSDVKISSKGQYNSIAFSGFSENLFAAAGTTNNIYLYDIRNTGKILH------------S 280
           ++++    K    S+ F+   + + + +    ++ L+++ NTG                +
Sbjct: 503 ENELGTGHKDSVYSVVFTRDGQGVVSGS-LDRSVKLWNLHNTGSSSKNDSKPTAATCEVT 561

Query: 281 MTGHEEPVTSLEFSNDKDGILISGSSDRRVIMWD 314
            TGH++ V S+  + + D  ++SGS DR V+ WD
Sbjct: 562 YTGHKDFVLSVATTQN-DKYILSGSKDRGVLFWD 594

>Kpol_530.25 s530 (67445..69169) [1725 bp, 574 aa] {ON}
           (67445..69169) [1725 nt, 575 aa]
          Length = 574

 Score = 50.4 bits (119), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 46/171 (26%), Positives = 81/171 (47%), Gaps = 9/171 (5%)

Query: 149 YHKDNAYGLAFNPNAEGELISGSDDSTIALWDATNDKLKQPIQEWTTSHSDI-VNDCQWH 207
           +H D    LA N +    L S S D T+ LWD  +    + I    + HS+  V+  +WH
Sbjct: 284 HHTDAVLSLAHNKHFRSVLASTSADHTVKLWDLNSGTAARSI---ASIHSNKNVSASEWH 340

Query: 208 CFNTNMFGSVSEDSTLQLFDKRNGGKSDVKI--SSKGQYNSIAFSGFSENLFAAAGTTNN 265
             + ++  +   DS L L D R   +S++    S  G     A +  SENL      + N
Sbjct: 341 MSHGSILLTGGYDSRLALTDVRISDESNMSKYWSVMGGEEIEAATFASENLILCGTDSGN 400

Query: 266 IYLYDIRNT--GKILHSMTGHEEPVTSLEFSNDKDGILISGS-SDRRVIMW 313
           +Y +DIRN    K + ++  H+  +++L  +    G++ +G+  ++ V +W
Sbjct: 401 VYSFDIRNNEGSKPVWTLKAHDAGISTLNCNKFIPGMMSTGAMGEKAVKLW 451

>TBLA0B09100 Chr2 complement(2156320..2156742,2157014..2157544) [954
           bp, 317 aa] {ON} Anc_2.431 YMR116C
          Length = 317

 Score = 49.7 bits (117), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 67/254 (26%), Positives = 105/254 (41%), Gaps = 43/254 (16%)

Query: 143 LLSTLKYHKDNAYGLAFNPNAEGELISGSDDSTIALWDATND--KLKQPIQEWTTSHSDI 200
           L  TL+ H      LA +      L+S S D T+  W  T D  +   P++ +   HS I
Sbjct: 7   LRGTLEGHNGWVTSLATSAGQPNLLLSASRDKTLISWKLTGDDQQYGVPVRSF-KGHSHI 65

Query: 201 VNDCQWHCFNTNMFGSVSEDSTLQLFDKRNGGKSDVKISSKGQYNSIAFSGFSENLFAAA 260
           V DC           S S D T++L+D   G      +  KG   S+A      ++  + 
Sbjct: 66  VQDCALTADGAYAL-SASWDKTIRLWDVSTGETFQRFVGHKGDVMSVAID-RKASMIISG 123

Query: 261 GTTNNIYLYDIRNTGKILHSMTGHEEPVTSLEFS-NDK---DGI-LISGSSDRRVIMWDL 315
                I ++ I+  G+ L +M GH + V+ +  + NDK   D + +IS  SD+ V  W++
Sbjct: 124 SRDKTIKVWSIK--GECLATMLGHNDWVSQVRVAPNDKPEDDTVTVISAGSDKVVKSWNV 181

Query: 316 --FEIGAE------------QQPD------EADDGLPEVMMIHAGSRSAINDISTH---- 351
             F+I A+              PD         DG  E+MM     + A+  +S H    
Sbjct: 182 NQFQIDADFIGHNNYINAIVASPDGSLIASAGKDG--EIMMWDLAQKRALYTLSAHDEVF 239

Query: 352 -----PSIPWLNAS 360
                P+  WL A+
Sbjct: 240 ALAFSPNRYWLAAA 253

>TPHA0M01830 Chr13 complement(378923..380470) [1548 bp, 515 aa] {ON}
           Anc_6.340 YCR072C
          Length = 515

 Score = 50.4 bits (119), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 67/298 (22%), Positives = 112/298 (37%), Gaps = 94/298 (31%)

Query: 103 AHDGEINRARYMPQNTNIIATVNGEGTIFIYDCSRDKQSALLSTLKYHKDNAYGLAFNPN 162
            H   I  + + P  ++ + T  G+ T  I+DC  D Q+ ++ TL  H +    +A++P 
Sbjct: 141 GHGSTILCSSFAPHTSSRMVTGAGDNTARIWDC--DTQTPMV-TLSGHTNWVLCVAWSP- 196

Query: 163 AEGELIS-GSDDSTIALWDATNDK----LKQPIQEWTTS--------------------- 196
            +GELI+ GS D+TI LW+  N K      +  Q+W TS                     
Sbjct: 197 -DGELIATGSMDNTIRLWEGKNGKPFGEAMRGHQKWITSLSWEPLHLVKAGERPKLATSS 255

Query: 197 ---------------------HSDIVNDCQWHCFNTNMFGSVSEDSTLQLFDKRNGGKS- 234
                                H + V+  +W     N+  S S D T++++D   GGK  
Sbjct: 256 KDGTIKVWDTGRRVCLYTLSGHVNSVSCVKWG--GKNLLYSGSHDKTVRVWDMNLGGKCI 313

Query: 235 -------------------------------------DVKISSKGQYNSIA-FSGFSENL 256
                                                + +  +   Y  +A  +G  E L
Sbjct: 314 NILKSHAHWVNHLSLSTDYALRVGPFDHTGIMPATPEEARAKALKNYEKVAKRNGSDEEL 373

Query: 257 FAAAGTTNNIYLYDIRNTGKILHSMTGHEEPVTSLEFSNDKDGILISGSSDRRVIMWD 314
              A     ++L++   + K +  MTGH++ V  + FS D   I +S S D  + +WD
Sbjct: 374 MVTASDDFTMFLWNPSKSTKPISRMTGHQKLVNHVAFSPDGRYI-VSASFDNSIKLWD 430

 Score = 38.9 bits (89), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 36/166 (21%), Positives = 78/166 (46%), Gaps = 17/166 (10%)

Query: 158 AFNPNAEGELISGSDDSTIALWDATNDKLKQPIQEWTTSHSDIVNDCQWHCFNTNMFGSV 217
           +F P+    +++G+ D+T  +WD      + P+    + H++ V    W   +  +  + 
Sbjct: 150 SFAPHTSSRMVTGAGDNTARIWDCDT---QTPMVT-LSGHTNWVLCVAWSP-DGELIATG 204

Query: 218 SEDSTLQLFDKRNGGKSDVKISSKGQYNSIAFSGFSENLFAAAG------TTNNIYLYDI 271
           S D+T++L++ +NG       + +G    I    +       AG      T++      +
Sbjct: 205 SMDNTIRLWEGKNG--KPFGEAMRGHQKWITSLSWEPLHLVKAGERPKLATSSKDGTIKV 262

Query: 272 RNTGK--ILHSMTGHEEPVTSLEFSNDKDGILISGSSDRRVIMWDL 315
            +TG+   L++++GH   V+ +++      +L SGS D+ V +WD+
Sbjct: 263 WDTGRRVCLYTLSGHVNSVSCVKWGGKN--LLYSGSHDKTVRVWDM 306

>Kwal_23.6324 s23 complement(1531252..1532796) [1545 bp, 514 aa]
           {ON} YCR072C - Protein required for cell viability
           [contig 17] FULL
          Length = 514

 Score = 50.1 bits (118), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 55/201 (27%), Positives = 89/201 (44%), Gaps = 28/201 (13%)

Query: 121 IATVNGEGTIFIYDCSRDKQSALLSTLKYHKDNAYGLAFNPNAEGELISGSDDSTIALWD 180
           +A+ + +GTI I+D +R      + TL  H ++   + +     G L SGS D TI  WD
Sbjct: 250 LASASKDGTIKIWDTTR---RVCVLTLSGHTNSVSCVKWG--GRGILYSGSHDKTIRAWD 304

Query: 181 -ATNDKLKQPIQEWTTSHSDIVNDCQWHCFNTNMFGSVSEDSTLQL--FD---KRNGGKS 234
            A   K    ++    SH+  +N             S++ D  L++  FD   ++     
Sbjct: 305 MAAGGKCINILK----SHAHWINHL-----------SLNTDYALRVGAFDHTGEKPSSPE 349

Query: 235 DVKISSKGQYNSIAF-SGFSENLFAAAGTTNNIYLYDIRNTGKILHSMTGHEEPVTSLEF 293
           + +  +   Y  IA  +G  E L   A     +YL+D     K +  MTGH++ V  + F
Sbjct: 350 EARAKALKNYEKIAKKNGQLEELMVTASDDFTMYLWDPLKASKPITRMTGHQKLVNHVAF 409

Query: 294 SNDKDGILISGSSDRRVIMWD 314
           S D   I +S S D  + +WD
Sbjct: 410 SPDGRYI-VSASFDNSIKLWD 429

 Score = 50.1 bits (118), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 41/182 (22%), Positives = 79/182 (43%), Gaps = 15/182 (8%)

Query: 145 STLKYHKDNAYGLAFNPNAEGELISGSDDSTIALWDATNDKLKQPIQEWTTSHSDIVNDC 204
           S +  H       AF P+  G +++GS D+T  +WD   +     ++     H + V   
Sbjct: 136 SAIAGHGSTILCSAFAPHTSGRMVTGSGDNTARIWDCNTNTPMYTLK----GHFNWVLCV 191

Query: 205 QWHCFNTNMFGSVSEDSTLQLFDKRNGGKSDVKISSKGQY-NSIAFSGFS------ENLF 257
            W C +  +  + S D+T++L+D   G      +    ++  S+ +          +   
Sbjct: 192 AW-CPDGELIATGSMDNTIRLWDSNKGESYGEALRGHAKWITSLTWEPMHLVKAGDQPRL 250

Query: 258 AAAGTTNNIYLYDIRNTGKILHSMTGHEEPVTSLEFSNDKDGILISGSSDRRVIMWDLFE 317
           A+A     I ++D      +L +++GH   V+ +++     GIL SGS D+ +  WD+  
Sbjct: 251 ASASKDGTIKIWDTTRRVCVL-TLSGHTNSVSCVKWGG--RGILYSGSHDKTIRAWDMAA 307

Query: 318 IG 319
            G
Sbjct: 308 GG 309

 Score = 45.4 bits (106), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 41/156 (26%), Positives = 75/156 (48%), Gaps = 11/156 (7%)

Query: 160 NPNAEGELISGSDDSTIALWDATNDKLKQPIQEWTTSHSDIVNDCQWHCFNTNMFGSVSE 219
           N   E  +++ SDD T+ LWD    K  +PI    T H  +VN   +   +     S S 
Sbjct: 366 NGQLEELMVTASDDFTMYLWDPL--KASKPITR-MTGHQKLVNHVAFSP-DGRYIVSASF 421

Query: 220 DSTLQLFDKRNGGKSDVKISSKGQYNSIAFSGFSEN--LFAAAGTTNNIYLYDIRNTGKI 277
           D++++L+D RNG       + +G   S+    +S +  L  +      + ++D+R T K+
Sbjct: 422 DNSIKLWDGRNG---TFIATFRGHVASVYQVAWSSDCRLLVSCSKDTTLKVWDVR-TKKL 477

Query: 278 LHSMTGHEEPVTSLEFSNDKDGILISGSSDRRVIMW 313
              + GH + V ++++S D   +  +G  D+ V +W
Sbjct: 478 SVDLPGHNDEVYTVDWSVDGKRVCSAG-KDKMVRIW 512

 Score = 32.0 bits (71), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 19/84 (22%), Positives = 41/84 (48%), Gaps = 5/84 (5%)

Query: 103 AHDGEINRARYMPQNTNIIATVNGEGTIFIYDCSRDKQSALLSTLKYHKDNAYGLAFNPN 162
            H   +N   + P    I+ + + + +I ++D    +    ++T + H  + Y +A++ +
Sbjct: 399 GHQKLVNHVAFSPDGRYIV-SASFDNSIKLWD---GRNGTFIATFRGHVASVYQVAWSSD 454

Query: 163 AEGELISGSDDSTIALWDATNDKL 186
               L+S S D+T+ +WD    KL
Sbjct: 455 CR-LLVSCSKDTTLKVWDVRTKKL 477

>ZYRO0B02486g Chr2 complement(199474..201201) [1728 bp, 575 aa] {ON}
           similar to uniprot|P21304 Saccharomyces cerevisiae
           YLR196W PWP1
          Length = 575

 Score = 50.1 bits (118), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 45/178 (25%), Positives = 80/178 (44%), Gaps = 23/178 (12%)

Query: 149 YHKDNAYGLAFNPNAEGELISGSDDSTIALWDATNDKLKQPIQEWTTSHSDIVNDCQWHC 208
           +H D    LA N +    L S S D T+ LWD  N    + +    +  +  V+  +WH 
Sbjct: 286 HHTDAILSLALNKHFRAVLASTSADHTVKLWDLNNGTAARSLASIHSGKN--VSSSEWHK 343

Query: 209 FNTNMFGSVSEDSTLQLFDKRNGGKSDVKISSKGQYNS---------IAFSGFS-ENLFA 258
            N ++  +   DS + L        SDV+IS + Q +          +  S F+ EN+  
Sbjct: 344 TNGSVLLTSGYDSRVAL--------SDVRISDESQLSKYWSVLPGEEVESSTFADENIIL 395

Query: 259 AAGTTNNIYLYDIRNT--GKILHSMTGHEEPVTSLEFSNDKDGIL-ISGSSDRRVIMW 313
           +   + N+Y +DIRN    K + ++  H+  ++ L  ++   G++  S   D+ V +W
Sbjct: 396 SGTDSGNVYAFDIRNNSGSKPVWTLNAHDAGISCLCANDYIPGMMTTSAMGDKTVKLW 453

>KLLA0F11231g Chr6 complement(1034708..1036012) [1305 bp, 434 aa]
           {ON} similar to uniprot|Q12417 Saccharomyces cerevisiae
           YPL151C PRP46 Splicing factor that is found in the Cef1p
           subcomplex of the spliceosome
          Length = 434

 Score = 50.1 bits (118), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 57/204 (27%), Positives = 93/204 (45%), Gaps = 26/204 (12%)

Query: 169 SGSDDSTIALWDATNDKLKQPIQEWTTSHSDIVNDCQWHCFNTNMFGSVSEDSTLQLFD- 227
           +GS+D+TI +WD    KLK  +      H   V D      +  MF S SED  ++ +D 
Sbjct: 140 TGSNDTTIKIWDLAAGKLKITL----IGHVMSVRDIAISKRHPYMF-SASEDKLVKCWDL 194

Query: 228 KRNGGKSDVKISSKGQYNSIAFSGFSENLFAAAGTTNNIYLYDIRNTGKILHSMTGHEEP 287
           +RN    D      G +          ++ A AG    + L+DIR+  +I+  + GH+ P
Sbjct: 195 ERNTAIRDFHGHLSGVHTVDVHPSL--DIIATAGRDAVVRLWDIRSRSEIM-VLPGHKSP 251

Query: 288 VTSLEFSNDKDGILISGSSDRRVIMWDLFEIGAEQQPDEADDGLPEVMMIHAGSRSAIND 347
           +  ++     D  +IS S D  V +WD+    A +           V+  H+ +   I D
Sbjct: 252 INKVK-CLPVDPQIISCSGDATVRLWDIIAGKASK-----------VLTHHSRN---IRD 296

Query: 348 ISTHPSIPWLNASVEENNIVQVWK 371
           ++ HP+  +  ASV  N+ V+ WK
Sbjct: 297 LTLHPA-EFSFASVSTND-VRSWK 318

 Score = 43.5 bits (101), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 53/220 (24%), Positives = 90/220 (40%), Gaps = 24/220 (10%)

Query: 119 NIIATVNGEGTIFIYDCSRDKQSALLSTLKYHKDNAYGLAFNPNAEGELISGSDDSTIAL 178
           +IIAT   +  + ++D     +  +L   K   +    L  +P    ++IS S D+T+ L
Sbjct: 220 DIIATAGRDAVVRLWDIRSRSEIMVLPGHKSPINKVKCLPVDP----QIISCSGDATVRL 275

Query: 179 WDATNDKLKQPIQEWTTSHSDIVNDCQWHCFNTNMFGSVSEDSTLQLFDKRNGGKSDVKI 238
           WD    K  + +    T HS  + D   H    + F SVS +             ++ + 
Sbjct: 276 WDIIAGKASKVL----THHSRNIRDLTLHPAEFS-FASVSTNDVRSWKLPEGQLLTNFQS 330

Query: 239 SSKGQYNSIAFSGFSENLFAAAGTTNNIYLYDIRNTGKILHSMT----GHEEPVTSLEFS 294
            + G  N+++ +   +N+  A G    +  YD +   K    MT    G  E   S+  S
Sbjct: 331 QNTGILNTVSIN--HDNVLLAGGDDGTLCFYDYKTGHKYQSMMTTEVAGSLESERSILCS 388

Query: 295 N-DKDGI-LISGSSDRRVIMWDLFEIGAEQQPDEADDGLP 332
             D  G  LI+G  D+ + +W       +Q PD  +D  P
Sbjct: 389 TFDVTGTRLITGEGDKSIKIW-------KQVPDATEDTFP 421

>KAFR0F02590 Chr6 complement(504740..506842) [2103 bp, 700 aa] {ON}
           Anc_1.247 YKR036C
          Length = 700

 Score = 50.4 bits (119), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 57/187 (30%), Positives = 91/187 (48%), Gaps = 45/187 (24%)

Query: 167 LISGSDDSTIALWDA-----------TNDKLKQ-PIQEWTTSHSDIVNDCQWHCFNTNMF 214
           +ISGS D+T+ LWD              +K+KQ P      +H D V        N++  
Sbjct: 440 VISGSKDNTLRLWDLNLALDLFHCEDAEEKIKQSPCVFVFEAHIDEVTALS---INSSHL 496

Query: 215 GSVSEDSTLQLFDKRNGG-------------KSDVKISSK---GQYNSIAFSGFSE---- 254
            S S+D T++ +D   G              KS+V  SS+    + N ++F  +S     
Sbjct: 497 VSGSQDRTIRNWDLHQGRCTQTFDLNFPSLLKSNVAPSSRRSRDKQNMLSFPNYSPPVVG 556

Query: 255 -----NLFAAAGTTNNIY-LYDIRNTGKILHSMTGHEEPVTSLEFSNDKDGILISGSSDR 308
                ++  A GT + I  L+D+R +G+++ S+ GH + +TSL+F  DK  I I+GS D+
Sbjct: 557 ALQIYDVALATGTRDGIVRLWDLR-SGEVIRSLDGHTDAITSLKF--DKYNI-ITGSIDK 612

Query: 309 RVIMWDL 315
            V +WDL
Sbjct: 613 TVRIWDL 619

>ADL184W Chr4 (375530..376879) [1350 bp, 449 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YNL317W (PFS2)
          Length = 449

 Score = 50.1 bits (118), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 49/198 (24%), Positives = 88/198 (44%), Gaps = 14/198 (7%)

Query: 121 IATVNGEGTIFIYDCSRDKQSALLSTLKYHKDNAYGLAFNPNAEGELISGSDDSTIALWD 180
             T + +  + I++ S  +Q  +LS    H  +     ++P   G ++SGS D+ I LWD
Sbjct: 178 FVTCSDDNVLKIWNFSNGQQERVLSG---HHWDVKSCDWHPKM-GLIVSGSKDNLIKLWD 233

Query: 181 ATNDKLKQPIQEWTTSHSDIVNDCQWHCFNTNMFGSVSEDSTLQLFDKRNGGKSDVKISS 240
               +    I      H+ I    ++     N+   VS+D +++++D R   +    I  
Sbjct: 234 PRTGRNVSTIL--GLKHTVI--KTKFQPTQGNLLAVVSKDKSIKIYDMRQHMRELQTIRD 289

Query: 241 KGQYNSIAFSGFSENLFAAAGTTNNI----YLYDIRNTGKILHSMT-GHEEPVTSLEFSN 295
              Y S+++   +E +F+       I     L+D  N+    H++   HE+ VTSL +S 
Sbjct: 290 DMDYMSLSWHPINETIFSVGCYNGAIKHFDLLHDNSNSTPACHTIPYAHEKSVTSLAYS- 348

Query: 296 DKDGILISGSSDRRVIMW 313
               IL S + DR +  W
Sbjct: 349 PVGHILASAAKDRTIRFW 366

 Score = 42.7 bits (99), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 39/179 (21%), Positives = 81/179 (45%), Gaps = 10/179 (5%)

Query: 103 AHDGEINRARYMPQNTNIIATVNGEGTIFIYDCSRDKQSALLSTLKYHKDNAYGLAFNPN 162
           AHD  +   +Y      +I+  + +GTI I+  + +    L    + H +    ++F+  
Sbjct: 119 AHDSAVTVMQYSHAGDWLISG-DADGTIKIWQPNFNMVKVLD---RAHTECMRDISFS-Y 173

Query: 163 AEGELISGSDDSTIALWDATNDKLKQPIQEWTTSHSDIVNDCQWHCFNTNMFGSVSEDST 222
           ++ + ++ SDD+ + +W+ +N + ++ +    + H   V  C WH     +  S S+D+ 
Sbjct: 174 SDQKFVTCSDDNVLKIWNFSNGQQERVL----SGHHWDVKSCDWHP-KMGLIVSGSKDNL 228

Query: 223 LQLFDKRNGGKSDVKISSKGQYNSIAFSGFSENLFAAAGTTNNIYLYDIRNTGKILHSM 281
           ++L+D R G      +  K       F     NL A      +I +YD+R   + L ++
Sbjct: 229 IKLWDPRTGRNVSTILGLKHTVIKTKFQPTQGNLLAVVSKDKSIKIYDMRQHMRELQTI 287

 Score = 31.2 bits (69), Expect = 4.6,   Method: Compositional matrix adjust.
 Identities = 20/68 (29%), Positives = 38/68 (55%), Gaps = 3/68 (4%)

Query: 247 IAFSGFSENLFAAAGTTNNIYLYDIRNTGKILHSMTGHEEPVTSLEFSNDKDGILISGSS 306
           I+FS +S+  F      N + +++  N G+    ++GH   V S ++ + K G+++SGS 
Sbjct: 169 ISFS-YSDQKFVTCSDDNVLKIWNFSN-GQQERVLSGHHWDVKSCDW-HPKMGLIVSGSK 225

Query: 307 DRRVIMWD 314
           D  + +WD
Sbjct: 226 DNLIKLWD 233

>SAKL0A01276g Chr1 (124778..126325) [1548 bp, 515 aa] {ON} highly
           similar to uniprot|P25382 Saccharomyces cerevisiae
           YCR072C Protein required for cell viability
          Length = 515

 Score = 50.1 bits (118), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 53/203 (26%), Positives = 84/203 (41%), Gaps = 20/203 (9%)

Query: 115 PQNTNIIATVNGEGTIFIYDCSRDKQSALLSTLKYHKDNAYGLAFNPNAEGELISGSDDS 174
           P     +A+ + +GTI I+D +R      L TL  H  +   + +    +G L SGS D 
Sbjct: 245 PGQKPRLASASKDGTIKIWDTTR---RVCLITLSGHTSSVSCIKWG--GQGVLYSGSHDK 299

Query: 175 TIALWDATNDKLKQPIQEWTTSHSDIVNDCQW---HCFNTNMFGSVSEDSTLQLFDKRNG 231
           TI  WD     L         SH+  VN       +      F   SE  +     ++  
Sbjct: 300 TIRAWDMN---LGGKCINILKSHAHWVNHLSLSTDYALRIGAFDHTSEKPSTPEEAQKRA 356

Query: 232 GKSDVKISSKGQYNSIAFSGFSENLFAAAGTTNNIYLYDIRNTGKILHSMTGHEEPVTSL 291
            K+  KI+ +        +G  E L   A     +YL++   + K +  MTGH++ V  +
Sbjct: 357 LKNYEKIAKR--------NGEVEELMVTASDDFTMYLWNPLKSTKPITRMTGHQKLVNHV 408

Query: 292 EFSNDKDGILISGSSDRRVIMWD 314
            FS D   I +S S D  + +W+
Sbjct: 409 AFSPDGRHI-VSASFDNSIKLWN 430

 Score = 41.2 bits (95), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 38/179 (21%), Positives = 79/179 (44%), Gaps = 17/179 (9%)

Query: 145 STLKYHKDNAYGLAFNPNAEGELISGSDDSTIALWDATNDKLKQPIQEWTTSHSDIVNDC 204
           S +  H       AF P+    +I+G+ D+T  +WD         ++     H + V   
Sbjct: 137 SAIAGHGSTILCSAFAPHTSSRMITGAGDNTARIWDCNTQTPMSTLK----GHFNWVLCV 192

Query: 205 QWHCFNTNMFGSVSEDSTLQLFDKRNGGKSDVKISSKGQY-NSIAFSGF------SENLF 257
            W   +  +  + S D+T++L++   G      +   G++  S+++          +   
Sbjct: 193 SWSP-DGELIATGSMDNTIRLWEGNKGQPVGDALRGHGKWITSLSWEPIHLVKPGQKPRL 251

Query: 258 AAAGTTNNIYLYDIRNTGKI-LHSMTGHEEPVTSLEFSNDKDGILISGSSDRRVIMWDL 315
           A+A     I ++D   T ++ L +++GH   V+ +++     G+L SGS D+ +  WD+
Sbjct: 252 ASASKDGTIKIWD--TTRRVCLITLSGHTSSVSCIKWGG--QGVLYSGSHDKTIRAWDM 306

 Score = 32.3 bits (72), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 21/84 (25%), Positives = 44/84 (52%), Gaps = 5/84 (5%)

Query: 103 AHDGEINRARYMPQNTNIIATVNGEGTIFIYDCSRDKQSALLSTLKYHKDNAYGLAFNPN 162
            H   +N   + P   +I++  + + +I +++  RD +   +ST + H  + Y +A++ +
Sbjct: 400 GHQKLVNHVAFSPDGRHIVS-ASFDNSIKLWN-GRDGK--FISTFRGHVASVYQVAWSSD 455

Query: 163 AEGELISGSDDSTIALWDATNDKL 186
               L+S S D+T+ +WD    KL
Sbjct: 456 CR-LLVSCSKDTTLKVWDVKTKKL 478

>CAGL0D02090g Chr4 (214357..214893,215564..215860) [834 bp, 277 aa]
           {ON} highly similar to uniprot|P38011 Saccharomyces
           cerevisiae YMR116c ASC1
          Length = 277

 Score = 49.3 bits (116), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 49/179 (27%), Positives = 79/179 (44%), Gaps = 12/179 (6%)

Query: 143 LLSTLKYHKDNAYGLAFNPNAEGELISGSDDSTIALWDATND--KLKQPIQEWTTSHSDI 200
           L  TL+ H      LA +      L+S S D T+  W  T D  K   P++ +   HS I
Sbjct: 9   LRGTLEGHNGWVTSLATSAGQPNLLLSASRDKTLISWKLTGDDQKFGVPVKSF-KGHSHI 67

Query: 201 VNDCQWHCFNTNMFGSVSEDSTLQLFDKRNGGKSDVKISSKGQYNSIAFSGFSENLFAAA 260
           V DC     N     S S D TL+L+D   G      +  KG   S+A      ++  + 
Sbjct: 68  VQDCT-LTENGAYALSGSWDKTLRLWDVATGETFQTFVGHKGDVMSVAIDK-KASMIISG 125

Query: 261 GTTNNIYLYDIRNTGKILHSMTGHEEPVTSLEFSNDKDG----ILISGSSDRRV-IMWD 314
               +I ++ I+  G  L ++ GH + V+ +  +N  D      +IS  +D+ V ++W+
Sbjct: 126 SRDKSIKVWSIK--GDCLATLIGHNDWVSQVRIANSSDDDDKVTVISAGNDKMVKVLWN 182

>NDAI0H02710 Chr8 complement(668900..669322,669678..670211) [957 bp,
           318 aa] {ON} Anc_2.431 YMR116C
          Length = 318

 Score = 49.3 bits (116), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 51/187 (27%), Positives = 81/187 (43%), Gaps = 13/187 (6%)

Query: 143 LLSTLKYHKDNAYGLAFNPNAEGELISGSDDSTIALWDATND--KLKQPIQEWTTSHSDI 200
           L  TL+ H      LA +      L+S S D T+  W  T D  K   P++ +   HS I
Sbjct: 9   LRGTLEGHNGWVTSLATSAGQPNLLLSASRDKTLISWKLTGDDQKFGVPVRSF-KGHSHI 67

Query: 201 VNDCQWHCFNTNMFGSVSEDSTLQLFDKRNGGKSDVKISSKGQYNSIAFSGFSENLFAAA 260
           V DC           S S D TL+L+D   G      +  K    S+A      ++  + 
Sbjct: 68  VQDCTLTQDGAYAL-SASWDKTLRLWDVATGETYQRFVGHKSDVMSVAIDR-KASMIISG 125

Query: 261 GTTNNIYLYDIRNTGKILHSMTGHEEPVTSLEFS----NDKDGILISGSSDRRVIMWDL- 315
                I ++ I+  G+ L ++ GH + V+ +  +    ND    +IS  +D+ V  W+L 
Sbjct: 126 SRDKTIKVWTIK--GQCLATLLGHNDWVSQVRIAPTDQNDDTVTVISAGNDKMVKAWNLN 183

Query: 316 -FEIGAE 321
            F+I A+
Sbjct: 184 QFQIEAD 190

>KLLA0E07085g Chr5 (645766..647124) [1359 bp, 452 aa] {ON} similar
           to uniprot|P42841 Saccharomyces cerevisiae YNL317W PFS2
           Integral subunit of the pre-mRNA cleavage and
           polyadenylation factor (CPF) complex plays an essential
           role in mRNA 3'-end formation by bridging different
           processing factors and thereby promoting the assembly of
           the processing complex
          Length = 452

 Score = 49.7 bits (117), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 42/183 (22%), Positives = 82/183 (44%), Gaps = 10/183 (5%)

Query: 150 HKDNAYGLAFNPNAEGELISGSDDSTIALWDATNDKLKQPIQEWTTSHSDIVNDCQWHCF 209
           H +    ++F+P  + + +S SDD+ + +W+ +N + ++ +    + H   V  C WH  
Sbjct: 164 HMECVREISFSP-TDQKFVSCSDDNVLKIWNFSNGQQERVL----SGHHWDVKSCDWHP- 217

Query: 210 NTNMFGSVSEDSTLQLFDKRNGGKSDVKISSKGQYNSIAFSGFSENLFAAAGTTNNIYLY 269
              +  S S+D+ ++ +D R+G      +  K    S  F     NL +         +Y
Sbjct: 218 KMGLIVSGSKDNLIKFWDPRSGSCVSTMLGFKHTIISTKFQPKQGNLLSVISKDKTCKVY 277

Query: 270 DIRNTGKILHSMTGHEEPVTSLEFSNDKDGILISGSSDRRVIMWDLFEIGAEQQPDEADD 329
           DIR   K L S+    + +T L++    + +   G  D  +  +DL +   E QP++   
Sbjct: 278 DIRQQAKELFSVRDDVDYMT-LQWHPIDETVFTVGCYDGSIKHFDLSQ---ENQPNKPTH 333

Query: 330 GLP 332
            +P
Sbjct: 334 NIP 336

>SAKL0F08404g Chr6 complement(640436..642367) [1932 bp, 643 aa] {ON}
           similar to uniprot|P39014 Saccharomyces cerevisiae
           YIL046W MET30 F-box protein containing five copies of
           the WD40 motif controls cell cycle function sulfur
           metabolism and methionine biosynthesis as part of the
           ubiquitin ligase complex interacts with and regulates
           Met4p localizes within the nucleus
          Length = 643

 Score = 50.1 bits (118), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 42/177 (23%), Positives = 79/177 (44%), Gaps = 16/177 (9%)

Query: 139 KQSALLSTLKYHKDNAYGLAFNPNAEGELISGSDDSTIALWDATNDKLKQPIQEWTTSHS 198
           K S ++   K H D    L FN      L +GS DST+A+WD  + KL + +    T H 
Sbjct: 320 KGSCVIQEFKGHMDGVLSLQFNHRY---LFTGSYDSTVAIWDLCSGKLIRRL----TGHH 372

Query: 199 DIVNDCQWHCFNTNMFGSVSEDSTLQLFDKRNGGKSDVKISSKGQYNSIAFSGFSENLFA 258
           D V       F+     + S D T+++++ + G       + +G  +S+      + +  
Sbjct: 373 DGVKSVY---FDDQKLITGSLDKTIRVWNYQTGACIS---TYRGHSDSVLSVDSYKKIIV 426

Query: 259 AAGTTNNIYLYDIRNTGKILHSMTGHEEPVTSLEFSNDKDGILISGSSDRRVIMWDL 315
           +      + ++ + +  +  +++ GH E V  ++  + K     SGS D  + MWD+
Sbjct: 427 SGSADKTVKVWHVES--RTCYTLRGHSEWVNCVKL-HPKSFTCFSGSDDTTIRMWDI 480

 Score = 36.2 bits (82), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 51/213 (23%), Positives = 84/213 (39%), Gaps = 52/213 (24%)

Query: 142 ALLSTLKYHKDNAYGLAFNPNAEGELISGSDDSTIALWDATNDKLKQPIQEWTTSHSDIV 201
           A +ST + H D+   +    + +  ++SGS D T+ +W   +             HS+ V
Sbjct: 403 ACISTYRGHSDSVLSV---DSYKKIIVSGSADKTVKVWHVESRTCYT-----LRGHSEWV 454

Query: 202 NDCQWHCFNTNMFGSVSEDSTLQLFDKRNGGKSDVKISSKGQYNSIAFSGFS--ENLFA- 258
           N  + H  +   F S S+D+T++++D R+     V     GQ   +        ENL   
Sbjct: 455 NCVKLHPKSFTCF-SGSDDTTIRMWDIRSNTCIKVFKGHVGQVQKVIPLKIVDVENLVVD 513

Query: 259 --------------------AAGTT----------------NNIYLYDIRNTGKILHSMT 282
                                 GT                 N I L+++R +GK + +  
Sbjct: 514 KQEEAQELIPEPNGEGAVDDVTGTMDPNLPYPTHILSCSLDNTIKLWEVR-SGKCVRTHF 572

Query: 283 GHEEPVTSLEFSNDKDGILISGSSDRRVIMWDL 315
           GH E V  +   N +   +ISG+ DR V +WDL
Sbjct: 573 GHVEGVWDIAADNFR---VISGAHDRTVKIWDL 602

>Smik_6.451 Chr6 (740074..741645) [1572 bp, 523 aa] {ON} YPL247C
           (REAL)
          Length = 523

 Score = 49.7 bits (117), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 41/169 (24%), Positives = 75/169 (44%), Gaps = 23/169 (13%)

Query: 167 LISGSDDSTIALWDATNDKLKQPIQEWTTSHSDIVNDCQWHCFNTNMFGSVSEDSTLQLF 226
           +IS S D+T  +WD  +      ++    +H   V D ++   +T +F S   D ++++F
Sbjct: 259 IISSSIDTTCIVWDLQSSHY---VKTQLIAHDSEVFDVRFLTKSTQLFASCGGDGSVRVF 315

Query: 227 DKRNGGKSDV-----------------KISSKGQYNSIAF--SGFSENLFAA-AGTTNNI 266
           D R+   S +                   +SKG    +    S +  N+ A  A  +N I
Sbjct: 316 DLRSLAHSTIIYEPPASSAPGLNADTTTPASKGSDALLRLEPSPYDPNVLATFAAESNKI 375

Query: 267 YLYDIRNTGKILHSMTGHEEPVTSLEFSNDKDGILISGSSDRRVIMWDL 315
            + D+RN    + ++ GH   V  +++   K  +L+S   D +V+ WDL
Sbjct: 376 IILDMRNPESPILNLEGHSSSVNEIKWHPTKRNVLLSCGDDCQVLYWDL 424

 Score = 40.4 bits (93), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 34/148 (22%), Positives = 63/148 (42%), Gaps = 24/148 (16%)

Query: 102 FAHDGEINRARYMPQNTNIIATVNGEGTIFIYDCSRDKQSALLSTLKYHKDNAYGLAFNP 161
            AHD E+   R++ ++T + A+  G+G++ ++D     +S   ST+ Y    +     N 
Sbjct: 284 IAHDSEVFDVRFLTKSTQLFASCGGDGSVRVFDL----RSLAHSTIIYEPPASSAPGLNA 339

Query: 162 NAEGELISGS-----------DDSTIALWDATNDKL--------KQPIQEWTTSHSDIVN 202
           +       GS           D + +A + A ++K+        + PI      HS  VN
Sbjct: 340 DTTTPASKGSDALLRLEPSPYDPNVLATFAAESNKIIILDMRNPESPILN-LEGHSSSVN 398

Query: 203 DCQWHCFNTNMFGSVSEDSTLQLFDKRN 230
           + +WH    N+  S  +D  +  +D  N
Sbjct: 399 EIKWHPTKRNVLLSCGDDCQVLYWDLNN 426

 Score = 30.8 bits (68), Expect = 6.4,   Method: Compositional matrix adjust.
 Identities = 44/187 (23%), Positives = 82/187 (43%), Gaps = 13/187 (6%)

Query: 206 WHCFNTNMFGSVSEDSTLQLFDKRNGGKSDVK-ISSKGQYNSIAFSGFSENLFAAAGTTN 264
           W+  +TN+  S S D+T  ++D ++      + I+   +   + F   S  LFA+ G   
Sbjct: 251 WNMVDTNLIISSSIDTTCIVWDLQSSHYVKTQLIAHDSEVFDVRFLTKSTQLFASCGGDG 310

Query: 265 NIYLYDIRNTGKILHSMTGHEEPVTSLEFSNDKDGILISGSSDRRVIM----WD---LFE 317
           ++ ++D+R+   + HS   +E P +S    N       S  SD  + +    +D   L  
Sbjct: 311 SVRVFDLRS---LAHSTIIYEPPASSAPGLNADTTTPASKGSDALLRLEPSPYDPNVLAT 367

Query: 318 IGAEQQPDEADDGL-PEVMMIH-AGSRSAINDISTHPSIPWLNASVEENNIVQVWKCSSK 375
             AE       D   PE  +++  G  S++N+I  HP+   +  S  ++  V  W  ++ 
Sbjct: 368 FAAESNKIIILDMRNPESPILNLEGHSSSVNEIKWHPTKRNVLLSCGDDCQVLYWDLNNS 427

Query: 376 LPRISGT 382
              I+G 
Sbjct: 428 FMEINGA 434

>Ecym_2401 Chr2 complement(781043..782323) [1281 bp, 426 aa] {ON}
           similar to Ashbya gossypii ACR137W
          Length = 426

 Score = 49.7 bits (117), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 45/174 (25%), Positives = 81/174 (46%), Gaps = 10/174 (5%)

Query: 143 LLSTLKYHKDNAYGLAFNPNAEGELISGSDDSTIALWDATNDKLKQPIQEWTTSHSDIVN 202
           L+  +  H+     +  +P       +GS+DSTI +WD  + KLK  +Q     H   V 
Sbjct: 106 LMRVINGHRGWVRCVKVDPVDNEWFATGSNDSTIKVWDLASGKLKVTLQ----GHIMTVK 161

Query: 203 DCQWHCFNTNMFGSVSEDSTLQLFD-KRNGGKSDVKISSKGQYNSIAFSGFSENLFAAAG 261
           D      +  MF S SED  ++ +D ++N    D   +  G Y+         +L  +AG
Sbjct: 162 DIAISTRHPYMF-SASEDKLVKCWDLEKNMVIRDFYGTLSGVYSVDVHPTL--DLIVSAG 218

Query: 262 TTNNIYLYDIRNTGKILHSMTGHEEPVTSLEFSNDKDGILISGSSDRRVIMWDL 315
             + + ++DIR+   ++ ++ GH+ P+         D  ++S S+D  V +WD+
Sbjct: 219 RDSVVRIWDIRSRTCVM-TLAGHKGPINKARCLA-VDPQVVSCSTDATVRLWDI 270

>SAKL0H06666g Chr8 complement(586110..587435) [1326 bp, 441 aa] {ON}
           highly similar to uniprot|Q75BY3 Ashbya gossypii ACR137W
           PRP46 Pre-mRNA-splicing factor PRP46 and similar to
           YPL151C uniprot|Q12417 Saccharomyces cerevisiae YPL151C
           PRP46 Splicing factor that is found in the Cef1p
           subcomplex of the spliceosome
          Length = 441

 Score = 49.7 bits (117), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 47/175 (26%), Positives = 80/175 (45%), Gaps = 12/175 (6%)

Query: 143 LLSTLKYHKDNAYGLAFNPNAEGELISGSDDSTIALWDATNDKLKQPIQEWTTSHSDIVN 202
           L+  +  H      +A +P       +GS+D+TI +WD    KLK  +    + H   V 
Sbjct: 121 LMRVINGHNGWVRTVAVDPIDNEWFATGSNDTTIKIWDLATGKLKLTL----SGHIMTVK 176

Query: 203 DCQWHCFNTNMFGSVSEDSTLQLFDKRNGGKSDVKISSKGQYNSIAFSGF--SENLFAAA 260
           D      +  MF S SED  ++ +D     K+ V     G  + +       + NL A A
Sbjct: 177 DICISKRHPYMF-SASEDKLVKCWDLE---KNRVIRDYHGHLSGVHTVDIHPTLNLIATA 232

Query: 261 GTTNNIYLYDIRNTGKILHSMTGHEEPVTSLEFSNDKDGILISGSSDRRVIMWDL 315
           G  + + L+DIR    ++ +M GH+ P+  ++     D  ++S S+D  V +WD+
Sbjct: 233 GRDSVVRLWDIRTKLPVM-TMAGHKSPINRVK-CLPVDPQVVSCSADATVRLWDI 285

 Score = 30.4 bits (67), Expect = 9.1,   Method: Compositional matrix adjust.
 Identities = 47/202 (23%), Positives = 88/202 (43%), Gaps = 19/202 (9%)

Query: 119 NIIATVNGEGTIFIYDCSRDKQSALLSTLKYHKDNAYGLAFNPNAEGELISGSDDSTIAL 178
           N+IAT   +  + ++D  R K   +  T+  HK     +   P  + +++S S D+T+ L
Sbjct: 227 NLIATAGRDSVVRLWDI-RTKLPVM--TMAGHKSPINRVKCLP-VDPQVVSCSADATVRL 282

Query: 179 WDATNDKLKQPIQEWTTSHSDIVNDCQWHCFNTNMFGSVSED------STLQLFDKRNGG 232
           WD T  K  + +    T H   V D   H    ++  + ++D         QL       
Sbjct: 283 WDITAGKTLKVL----THHKRSVRDIGIHPGEFSISSACTDDIRSWKLPEGQLLTNFQSE 338

Query: 233 KSDVKISSKGQYNSIAFSGFSENLFAAAGTTNNIYLYDIRNTGKILHSMTGHEEPVTSLE 292
           K+ +  +     + + F+G S+N   +       + Y   +T +I  S+      +TS  
Sbjct: 339 KTGIINTLSINQDDVLFAG-SDNGVLSFYDYKTGHKYQQLDTTEIPGSLESERGILTS-- 395

Query: 293 FSNDKDGI-LISGSSDRRVIMW 313
            + D+ G+ LI+G SD+ + +W
Sbjct: 396 -TFDQTGLRLITGESDKSIKIW 416

>NCAS0E03750 Chr5 complement(736672..740502) [3831 bp, 1276 aa] {ON}
           Anc_7.310
          Length = 1276

 Score = 50.1 bits (118), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 38/153 (24%), Positives = 71/153 (46%), Gaps = 25/153 (16%)

Query: 171 SDDSTIALWDATNDKLKQPIQEWTTSHSDIVNDCQWHCFNTNMFGSVSEDSTLQLFDKRN 230
           S+DST+ LW   +D  K P    + +      D  W   N  + G++ ++  ++LF K  
Sbjct: 37  SNDSTLELWSLLSDPKKDPTPVASITTDARFKDLDWSFDNKFIAGALDDNGKIELFSKE- 95

Query: 231 GGKSDVKISSK--GQY-------NSIAFSGFSENLFAAAGTTNNIYLYDIRNTGKILHSM 281
             ++D KIS K  G++       N++ F+   +N+ A+AG    I ++DI  T       
Sbjct: 96  --ENDTKISLKSLGKFKKHTTAVNTLRFNPKQQNVLASAGNNGEILIWDINKT------- 146

Query: 282 TGHEEPVTSLEFSNDKDGILISGSSDRRVIMWD 314
                 ++S ++S    GI +S   + + + W+
Sbjct: 147 ------LSSTDYSPSAPGIAMSTQDEIKSVSWN 173

 Score = 35.8 bits (81), Expect = 0.23,   Method: Compositional matrix adjust.
 Identities = 42/193 (21%), Positives = 78/193 (40%), Gaps = 29/193 (15%)

Query: 144 LSTLKYHKDNAYGLAFNPNAEGELISGSDDSTIALWD------ATNDKLKQPIQEWTTSH 197
           L   K H      L FNP  +  L S  ++  I +WD      +T+     P    +T  
Sbjct: 106 LGKFKKHTTAVNTLRFNPKQQNVLASAGNNGEILIWDINKTLSSTDYSPSAPGIAMST-- 163

Query: 198 SDIVNDCQWHCFNTNMFGSVSEDSTLQLFDKRNGGKSDVKISSKGQYNSIAFSGFSENLF 257
            D +    W+    ++F S  + +T          K  + ++    Y S   +G   NL 
Sbjct: 164 QDEIKSVSWNKSLAHVFASAGDTTTYASIWDLKAKKEVIHLN----YTSPK-TGLKPNLA 218

Query: 258 A-------------AAGTTNN--IYLYDIRNTGKILHSMTG-HEEPVTSLEFSNDKDGIL 301
                         A+G+ ++  I ++D+RN+   + ++ G H + + SL++    + +L
Sbjct: 219 VVEWHPKVTTYVATASGSDSDPVILIWDLRNSNMPMTTLEGPHTKGIMSLDWCTKDESLL 278

Query: 302 ISGSSDRRVIMWD 314
           +S   D  V +WD
Sbjct: 279 LSSGRDGIVALWD 291

>YPL247C Chr16 complement(82625..84196) [1572 bp, 523 aa] {ON}
           Putative protein of unknown function; green fluorescent
           protein (GFP)-fusion protein localizes to the cytoplasm
           and nucleus; similar to the petunia WD repeat protein
           an11; overexpression causes a cell cycle delay or arrest
          Length = 523

 Score = 49.7 bits (117), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 42/169 (24%), Positives = 75/169 (44%), Gaps = 23/169 (13%)

Query: 167 LISGSDDSTIALWDATNDKLKQPIQEWTTSHSDIVNDCQWHCFNTNMFGSVSEDSTLQLF 226
           +IS S D+T  +WD  +      ++    +H   V D ++   +T +F S   D ++++F
Sbjct: 259 IISSSIDTTCIVWDLQSSHY---VKTQLIAHDSEVFDVRFLTKSTQLFASCGGDGSVRVF 315

Query: 227 DKRNGGKSDV-----------------KISSKGQYNSIAF--SGFSENLFAA-AGTTNNI 266
           D R+   S +                   SSKG    +    S +  N+ A  A  +N I
Sbjct: 316 DLRSLAHSTIIYEPPSSSVSGATAGTITPSSKGSDALLRLEPSPYDPNVLATFAADSNKI 375

Query: 267 YLYDIRNTGKILHSMTGHEEPVTSLEFSNDKDGILISGSSDRRVIMWDL 315
            + D+RN    + ++ GH   V  +++   K  +L+S   D +V+ WDL
Sbjct: 376 IILDMRNPESPILNLQGHGSSVNGIKWHPTKRNVLLSCGDDCQVLYWDL 424

 Score = 35.4 bits (80), Expect = 0.22,   Method: Compositional matrix adjust.
 Identities = 34/145 (23%), Positives = 64/145 (44%), Gaps = 24/145 (16%)

Query: 102 FAHDGEINRARYMPQNTNIIATVNGEGTIFIYDCSRDKQSALLSTLKYHK-----DNAYG 156
            AHD E+   R++ ++T + A+  G+G++ ++D     +S   ST+ Y         A  
Sbjct: 284 IAHDSEVFDVRFLTKSTQLFASCGGDGSVRVFDL----RSLAHSTIIYEPPSSSVSGATA 339

Query: 157 LAFNPNAEGE--LI----SGSDDSTIALWDATNDKL--------KQPIQEWTTSHSDIVN 202
               P+++G   L+    S  D + +A + A ++K+        + PI      H   VN
Sbjct: 340 GTITPSSKGSDALLRLEPSPYDPNVLATFAADSNKIIILDMRNPESPILN-LQGHGSSVN 398

Query: 203 DCQWHCFNTNMFGSVSEDSTLQLFD 227
             +WH    N+  S  +D  +  +D
Sbjct: 399 GIKWHPTKRNVLLSCGDDCQVLYWD 423

>Skud_12.261 Chr12 (490588..492330) [1743 bp, 580 aa] {ON} YLR196W
           (REAL)
          Length = 580

 Score = 49.7 bits (117), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 42/173 (24%), Positives = 82/173 (47%), Gaps = 13/173 (7%)

Query: 149 YHKDNAYGLAFNPNAEGELISGSDDSTIALWDATNDKLKQPIQEWTTSHSDI-VNDCQWH 207
           +H D    +A N +    L S S D T+ LWD  +    + +    + HS+  V+  +WH
Sbjct: 288 HHTDAVLSMAHNKHFRSVLASTSADHTVKLWDLNSGNAARSL---ASIHSNKNVSSSEWH 344

Query: 208 CFNTNMFGSVSEDSTLQLFDKRNGGKSDV----KISSKGQYNSIAFSGFSENLFAAAGTT 263
             N ++  +   DS + L D R   +S +     + S  +  ++ F+  +EN+      +
Sbjct: 345 MLNGSVLLTGGYDSRVALTDVRISDESQMSKYWSVMSGEEIETVTFA--NENIILCGTDS 402

Query: 264 NNIYLYDIRN--TGKILHSMTGHEEPVTSLEFSNDKDGILISGSSDRRVI-MW 313
            N+Y +DIRN    K + ++  H+  +++L  S    G++ +G+   + I +W
Sbjct: 403 GNVYSFDIRNNENRKPVWTLKAHDAGISTLCSSKFIPGMMNTGAMGEKTIKLW 455

 Score = 31.2 bits (69), Expect = 4.7,   Method: Compositional matrix adjust.
 Identities = 31/132 (23%), Positives = 58/132 (43%), Gaps = 11/132 (8%)

Query: 191 QEWTTSHSDIVNDCQWHCFNTNMFGSVSEDSTLQLFD--KRNGGKSDVKISSKGQYNSIA 248
           Q  TT H+D V     +    ++  S S D T++L+D    N  +S   I S    +S  
Sbjct: 283 QHITTHHTDAVLSMAHNKHFRSVLASTSADHTVKLWDLNSGNAARSLASIHSNKNVSSSE 342

Query: 249 FSGFSENLFAAAGTTNNIYLYDIR-----NTGKILHSMTGHEEPVTSLEFSNDKDGILIS 303
           +   + ++    G  + + L D+R        K    M+G E  + ++ F+N+   I++ 
Sbjct: 343 WHMLNGSVLLTGGYDSRVALTDVRISDESQMSKYWSVMSGEE--IETVTFANEN--IILC 398

Query: 304 GSSDRRVIMWDL 315
           G+    V  +D+
Sbjct: 399 GTDSGNVYSFDI 410

>Kwal_23.6429 s23 complement(1577398..1579650) [2253 bp, 750 aa]
           {ON} YCR084C (TUP1) - glucose repression regulatory
           protein, exhibits similarity to beta subunits of G
           proteins [contig 17] FULL
          Length = 750

 Score = 49.7 bits (117), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 42/166 (25%), Positives = 80/166 (48%), Gaps = 16/166 (9%)

Query: 157 LAFNPNAEGELISGSDDSTIALWDATNDKLKQPIQEWTTSHSDIVNDCQWHCFNTNMFGS 216
           + F+P+ +  L +G++D  I +WD    ++   +Q     H   +    +      +  S
Sbjct: 476 VCFSPDGK-FLATGAEDKLIRIWDLATRRIVMTLQ----GHEQDIYSLDYFPSGDKLV-S 529

Query: 217 VSEDSTLQLFDKRNGGKSDVKISSKGQYNSIAFSGFSENLFAAAGTTNNIYLYDIRNTGK 276
            S D T++++D R G +  + +S +    ++A S     L AA      + ++D   TG 
Sbjct: 530 GSGDRTVRIWDLRTG-QCSLTLSIEDGVTTVAVSPGDGKLIAAGSLDRTVRIWD-SETGF 587

Query: 277 ILHSM-------TGHEEPVTSLEFSNDKDGILISGSSDRRVIMWDL 315
           ++  +       TGH++ V S+ F+ D  G+ +SGS DR V +W+L
Sbjct: 588 LVERLDSENELGTGHKDSVYSVVFTRDGHGV-VSGSLDRSVKLWNL 632

 Score = 49.3 bits (116), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 50/214 (23%), Positives = 98/214 (45%), Gaps = 29/214 (13%)

Query: 119 NIIATVNGEGTIFIYDCSRDKQSALLSTLKYHKDNAYGLAFNPNAEGELISGSDDSTIAL 178
             +AT   +  I I+D +  +   ++ TL+ H+ + Y L + P+ + +L+SGS D T+ +
Sbjct: 483 KFLATGAEDKLIRIWDLATRR---IVMTLQGHEQDIYSLDYFPSGD-KLVSGSGDRTVRI 538

Query: 179 WDATNDKLKQPIQEWTTSHSDIVNDCQWHCFNTNMFGSVSEDSTLQLFDKRNG------- 231
           WD     L+      T S  D V        +  +  + S D T++++D   G       
Sbjct: 539 WD-----LRTGQCSLTLSIEDGVTTVAVSPGDGKLIAAGSLDRTVRIWDSETGFLVERLD 593

Query: 232 GKSDVKISSKGQYNSIAFSGFSENLFAAAGTTNNIYLYDIR-----------NTGKILHS 280
            ++++    K    S+ F+     + + +    ++ L+++R           NT     +
Sbjct: 594 SENELGTGHKDSVYSVVFTRDGHGVVSGS-LDRSVKLWNLRSANGGTAEGKANTAASEVT 652

Query: 281 MTGHEEPVTSLEFSNDKDGILISGSSDRRVIMWD 314
            TGH++ V S+  + + D  ++SGS DR V+ WD
Sbjct: 653 YTGHKDFVLSVATTQN-DEFILSGSKDRGVLFWD 685

 Score = 40.4 bits (93), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 28/74 (37%), Positives = 44/74 (59%), Gaps = 9/74 (12%)

Query: 245 NSIAFSGFSENLFAAAGTTNN-IYLYDIRNTGKILHSMTGHEEPVTSLEF--SNDKDGIL 301
            S+ FS   +  F A G  +  I ++D+  T +I+ ++ GHE+ + SL++  S DK   L
Sbjct: 474 RSVCFS--PDGKFLATGAEDKLIRIWDL-ATRRIVMTLQGHEQDIYSLDYFPSGDK---L 527

Query: 302 ISGSSDRRVIMWDL 315
           +SGS DR V +WDL
Sbjct: 528 VSGSGDRTVRIWDL 541

>KLTH0G13068g Chr7 complement(1118964..1122269) [3306 bp, 1101 aa]
           {ON} similar to uniprot|Q03897 Saccharomyces cerevisiae
           YDR128W Hypothetical ORF
          Length = 1101

 Score = 50.1 bits (118), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 30/118 (25%), Positives = 55/118 (46%)

Query: 197 HSDIVNDCQWHCFNTNMFGSVSEDSTLQLFDKRNGGKSDVKISSKGQYNSIAFSGFSENL 256
           HS  + D  +H  N  +  + S D+ +  +D R+  ++    S      +     F    
Sbjct: 113 HSRAITDINFHPTNPEILATCSIDAYVHAWDMRSSRRAFYSASVWSAGAAQVKWNFKNPN 172

Query: 257 FAAAGTTNNIYLYDIRNTGKILHSMTGHEEPVTSLEFSNDKDGILISGSSDRRVIMWD 314
             A+  +N+I+++D+R     LH + GH   V S++FS   +  ++S S+D  V  WD
Sbjct: 173 VMASAHSNDIFIWDLRKGCMPLHILKGHANSVNSIDFSRFNETEIMSSSNDGTVKFWD 230

 Score = 37.0 bits (84), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 26/81 (32%), Positives = 44/81 (54%), Gaps = 6/81 (7%)

Query: 116 QNTNIIATVNGEGTIFIYDCSRDKQSALLSTLKYHKDNAYGLAFNPNAEGELISGSDDST 175
           +N N++A+ +    IFI+D    K    L  LK H ++   + F+   E E++S S+D T
Sbjct: 169 KNPNVMASAHS-NDIFIWDLR--KGCMPLHILKGHANSVNSIDFSRFNETEIMSSSNDGT 225

Query: 176 IALWD-ATNDKLKQPIQEWTT 195
           +  WD + ND  K+P++   T
Sbjct: 226 VKFWDYSVND--KEPLRTVVT 244

>CAGL0G09845g Chr7 (940598..942100) [1503 bp, 500 aa] {ON} similar
           to uniprot|P20053 Saccharomyces cerevisiae YPR178w PRP4
           U4/U6 snRNP
          Length = 500

 Score = 49.7 bits (117), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 56/213 (26%), Positives = 89/213 (41%), Gaps = 16/213 (7%)

Query: 103 AHDGEINRARYMPQNTNIIATVNGEGTIFIYDCSRDKQSALLSTLKYHKDNAYGLAFNPN 162
            H+G I   +  P     I T + + T  ++D  + KQ  L      H    Y LAF   
Sbjct: 296 GHEGRITDLQVHPSG-KFIGTSSFDSTWRLWDIEKQKQLLLQEG---HSKELYCLAFQ-- 349

Query: 163 AEGELIS-GSDDSTIALWDATNDKLKQPIQEWTTSHSDIVNDCQWHCFNTNMFGSVSEDS 221
           A+G L+S    D T  +WD  + K    +Q     H+  +    W   + +   +   D 
Sbjct: 350 ADGALVSTAGTDKTAIIWDLRSGKAVSQLQ----GHAKTIYCMDW-SIDGHTLATGGGDG 404

Query: 222 TLQLFDKRNGGKSDVKISSKGQYNSIAFSGFSENLFAAAGTTNNIYLYDIRNTGKILHSM 281
            + ++D R   K       K    S+ F   +++   ++G   +I++Y   N  K+  S+
Sbjct: 405 VITIWDLRKSDKLTKITEHKSIVTSLKFDKANDHNLISSGYDRSIFVYSKDNYLKV-SSL 463

Query: 282 TGHEEPVTSLEFSNDKDGI-LISGSSDRRVIMW 313
            GH + V  L F  DK+   LISG  DR V  W
Sbjct: 464 IGHADKV--LTFDIDKNNKNLISGGWDRSVKHW 494

 Score = 37.4 bits (85), Expect = 0.052,   Method: Compositional matrix adjust.
 Identities = 54/213 (25%), Positives = 96/213 (45%), Gaps = 16/213 (7%)

Query: 104 HDGEINRARYMPQNTNIIATVNGEGTIFIYDCSRDKQSALLSTLKYHKDNAYGLAFNPNA 163
           HDG++    +   ++ +I    GE  +       D +    +++  H+     L  +P+ 
Sbjct: 253 HDGKVGGIAWTSNDSVLI--TGGEDHLITVSNRSDGEFITSNSIGGHEGRITDLQVHPS- 309

Query: 164 EGELISGSD-DSTIALWDATNDKLKQPIQEWTTSHSDIVNDCQWHCFNTNMFGSVSEDST 222
            G+ I  S  DST  LWD   +K KQ + +    HS  +  C     +  +  +   D T
Sbjct: 310 -GKFIGTSSFDSTWRLWDI--EKQKQLLLQ--EGHSKELY-CLAFQADGALVSTAGTDKT 363

Query: 223 LQLFDKRNGGKSDVKISSKGQYNSIAFSGFS--ENLFAAAGTTNNIYLYDIRNTGKILHS 280
             ++D R+G K+  ++  +G   +I    +S   +  A  G    I ++D+R + K L  
Sbjct: 364 AIIWDLRSG-KAVSQL--QGHAKTIYCMDWSIDGHTLATGGGDGVITIWDLRKSDK-LTK 419

Query: 281 MTGHEEPVTSLEFSNDKDGILISGSSDRRVIMW 313
           +T H+  VTSL+F    D  LIS   DR + ++
Sbjct: 420 ITEHKSIVTSLKFDKANDHNLISSGYDRSIFVY 452

>Suva_4.53 Chr4 (95619..99434) [3816 bp, 1271 aa] {ON} YDL195W
           (REAL)
          Length = 1271

 Score = 49.7 bits (117), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 50/219 (22%), Positives = 97/219 (44%), Gaps = 24/219 (10%)

Query: 116 QNTNIIATVNGEGTIFIYDCSRDKQSALLSTLKY--HKDNAYGLAFNPNAEGELISGSDD 173
            N   IA     GT+ +Y    D    ++ST K+  H  +   + FN   +  L SG ++
Sbjct: 72  HNNKTIAGALDNGTLELYSIG-DAHDTIVSTAKFSNHSSSVKTVKFNSKQDNVLASGGNN 130

Query: 174 STIALWDATNDKLKQPIQEWTT-------SHSDIVNDCQWHCFNTNMFGSVSEDSTLQLF 226
             I +WD   +K  +    +T        S  D VN   W+    ++F S    +   ++
Sbjct: 131 GEIFIWDM--NKCTESPSSYTPLTPGQSMSSVDEVNSLAWNQSLAHVFASAGSSNFASIW 188

Query: 227 DKRNGGKSDVKISS-------KGQYNSIAFSGFSENLFAAAGTTNN---IYLYDIRNTGK 276
           D +   K  + +S        K Q + + +   +    A A  ++N   I ++D+RN   
Sbjct: 189 DLK-AKKEVIHLSYTSPNSGIKQQLSVVEWHPKNSTRVATATGSDNDPSILVWDLRNANT 247

Query: 277 ILHSMT-GHEEPVTSLEFSNDKDGILISGSSDRRVIMWD 314
            L +++ GH++ + SL++ +  + +L+S   D  V++W+
Sbjct: 248 PLQTLSQGHQKGILSLDWCHQDENLLLSSGRDNTVLLWN 286

>KAFR0A00510 Chr1 (93452..93988,94240..94662) [960 bp, 319 aa] {ON}
           Anc_2.431 YMR116C
          Length = 319

 Score = 48.9 bits (115), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 63/244 (25%), Positives = 103/244 (42%), Gaps = 31/244 (12%)

Query: 143 LLSTLKYHKDNAYGLAFNPNAEGELISGSDDSTIALWDATND--KLKQPIQEWTTSHSDI 200
           L  TL+ H      LA +      L+S S D T+  W  T D  K+  P++ +   HS I
Sbjct: 9   LRGTLEGHNGWVTSLATSAGQPNLLVSASRDKTLISWKLTGDDQKVGVPVRSF-KGHSHI 67

Query: 201 VNDCQWHCFNTNMFGSVSEDSTLQLFDKRNGGKSDVKISSKGQYNSIAFSGFSENLFAAA 260
           V D            S S D TL+L++   G      +  K    S+A      ++  + 
Sbjct: 68  VQDVTLTPDGAYAL-SASWDKTLRLWEVATGETFQRFVGHKSDVMSVAID-RKASMIISG 125

Query: 261 GTTNNIYLYDIRNTGKILHSMTGHEEPVTSLEFS-NDKDG----ILISGSSDRRVIMWDL 315
               +I ++ I+  G+ L ++ GH + V+ +  + NDKD      +IS  +D+ V  W+L
Sbjct: 126 SRDKSIKVWTIK--GQCLATLLGHNDWVSQVRVAPNDKDDDETVTVISAGNDKMVKAWNL 183

Query: 316 --FEIGAEQQPDEADDGLPEVMMIHAGSRSAINDISTHPSIPWLNASVEENNIVQVWKCS 373
             F+I       EAD           G    +N I+  P    L AS  ++  + +W  +
Sbjct: 184 NQFQI-------EAD---------FVGHNGNVNTITASPDGS-LIASAGKDGEIMLWNLA 226

Query: 374 SKLP 377
            K+P
Sbjct: 227 DKVP 230

>TBLA0A02310 Chr1 (557822..559417) [1596 bp, 531 aa] {ON} Anc_6.276
           YPL247C
          Length = 531

 Score = 49.3 bits (116), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 45/193 (23%), Positives = 84/193 (43%), Gaps = 39/193 (20%)

Query: 159 FNPNAEGELISGSDDSTIALWDATNDKLKQPIQEWTTSHSDIVNDCQWHCFNTNMFGSVS 218
           +NP     LIS S D+T  +WD  ++     ++    +H   V D ++   +T +F S  
Sbjct: 251 WNPIDTNFLISSSIDTTCIVWDLQSNNY---VKTQLIAHDSEVFDVRFLTQSTQLFASCG 307

Query: 219 EDSTLQLFDKRNGGKSDV-----------KISSKG------------QYNSIAFSGFSE- 254
            D ++++FD R+   S +            +SS G            +  S+  S  S  
Sbjct: 308 GDGSVRVFDLRSLAHSTIIYESAANTSMSNLSSGGMVDHPGSLNTSSRVGSVDLSSKSNA 367

Query: 255 -----------NLFAAAGT-TNNIYLYDIRNTGKILHSMTGHEEPVTSLEFSNDKDGILI 302
                      N+ A  G  +N++ + D+RN G  + ++ GH  P+  +++   K   ++
Sbjct: 368 LLRLEPSPTDPNVIATFGADSNSVLILDMRNPGTPVLTLDGHSAPINQIKWHPTKKNTIL 427

Query: 303 SGSSDRRVIMWDL 315
           S S D +V+ W+L
Sbjct: 428 SSSDDCQVLYWNL 440

 Score = 33.9 bits (76), Expect = 0.80,   Method: Compositional matrix adjust.
 Identities = 12/42 (28%), Positives = 25/42 (59%)

Query: 103 AHDGEINRARYMPQNTNIIATVNGEGTIFIYDCSRDKQSALL 144
           AHD E+   R++ Q+T + A+  G+G++ ++D      S ++
Sbjct: 285 AHDSEVFDVRFLTQSTQLFASCGGDGSVRVFDLRSLAHSTII 326

>ADL186C Chr4 complement(369320..373405) [4086 bp, 1361 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YOL138C
          Length = 1361

 Score = 49.7 bits (117), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 51/201 (25%), Positives = 79/201 (39%), Gaps = 31/201 (15%)

Query: 116 QNTNIIATVNGEGTIFIYDCSRD--KQSALLSTLKYHKDNAYGLAFNPNAEGELISGSDD 173
            + N IA      ++ IYD +R   K S L++TL  H  +   + FN      LISG  D
Sbjct: 194 HHKNYIAICGTSTSVSIYDINRASAKDSPLITTLSEHSRSINSVDFNMGQTHLLISGGQD 253

Query: 174 STIALWDATNDKLKQPIQEWT-TSHSDIVNDCQWHCFNTNMFGSVSEDSTLQLFDKRNGG 232
             I +WD  +   K    +    S SD V D +W    T  F S+  D++L         
Sbjct: 254 GCIKVWDLRSHSYKVNRSDLNFNSGSDSVRDVKW--MPTYDFASLGADTSL--------- 302

Query: 233 KSDVKISSKGQYNSIAFSGFSENLFAAAGTTNNIYLYDIRNTGKILHSMTGHEEPVTSLE 292
                  S G+           N FA+   +  +  +D+R   ++   +  H  P   + 
Sbjct: 303 ------CSSGR----------SNKFASVHDSGLLLTFDMRQPNQVERKINAHSGPGLCMH 346

Query: 293 FSNDKDGILISGSSDRRVIMW 313
           +    D I ISG  D +  +W
Sbjct: 347 WHPHMDYI-ISGGRDGKCALW 366

 Score = 38.5 bits (88), Expect = 0.035,   Method: Compositional matrix adjust.
 Identities = 20/66 (30%), Positives = 39/66 (59%), Gaps = 4/66 (6%)

Query: 254 ENLFAAAGTTNNIYLYDI-RNTGK---ILHSMTGHEEPVTSLEFSNDKDGILISGSSDRR 309
           +N  A  GT+ ++ +YDI R + K   ++ +++ H   + S++F+  +  +LISG  D  
Sbjct: 196 KNYIAICGTSTSVSIYDINRASAKDSPLITTLSEHSRSINSVDFNMGQTHLLISGGQDGC 255

Query: 310 VIMWDL 315
           + +WDL
Sbjct: 256 IKVWDL 261

>Skud_16.32 Chr16 complement(56168..57736) [1569 bp, 522 aa] {ON}
           YPL247C (REAL)
          Length = 522

 Score = 49.3 bits (116), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 39/169 (23%), Positives = 72/169 (42%), Gaps = 23/169 (13%)

Query: 167 LISGSDDSTIALWDATNDKLKQPIQEWTTSHSDIVNDCQWHCFNTNMFGSVSEDSTLQLF 226
           +IS S D+T  +WD  +      ++    +H   V D ++   +T +F S   D ++++F
Sbjct: 259 IISSSIDTTCIVWDLQSSHY---VKTQLIAHDSEVFDVRFLTKSTQLFASCGGDGSVRVF 315

Query: 227 DKR-------------------NGGKSDVKISSKGQYNSIAFSGFSENLFAA-AGTTNNI 266
           D R                   N G +   +        +  S +  N+ A  A  +N I
Sbjct: 316 DLRSLAHSTIIYEPPSSPASGPNAGATTPSLKGSDALLRLEPSPYDPNVLATFAADSNKI 375

Query: 267 YLYDIRNTGKILHSMTGHEEPVTSLEFSNDKDGILISGSSDRRVIMWDL 315
            + D+RN    + ++ GH   V  +++   K  +L+S S D + + WDL
Sbjct: 376 IILDMRNPESPILNLEGHTCSVNEIKWHPTKRNVLLSCSDDCQALYWDL 424

 Score = 40.4 bits (93), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 35/148 (23%), Positives = 65/148 (43%), Gaps = 24/148 (16%)

Query: 102 FAHDGEINRARYMPQNTNIIATVNGEGTIFIYDCSRDKQSALLSTLKYHKDNAYGLAFNP 161
            AHD E+   R++ ++T + A+  G+G++ ++D     +S   ST+ Y   ++     N 
Sbjct: 284 IAHDSEVFDVRFLTKSTQLFASCGGDGSVRVFDL----RSLAHSTIIYEPPSSPASGPNA 339

Query: 162 NAEGELISGS-----------DDSTIALWDATNDKL--------KQPIQEWTTSHSDIVN 202
            A    + GS           D + +A + A ++K+        + PI      H+  VN
Sbjct: 340 GATTPSLKGSDALLRLEPSPYDPNVLATFAADSNKIIILDMRNPESPILN-LEGHTCSVN 398

Query: 203 DCQWHCFNTNMFGSVSEDSTLQLFDKRN 230
           + +WH    N+  S S+D     +D  N
Sbjct: 399 EIKWHPTKRNVLLSCSDDCQALYWDLNN 426

>Ecym_4717 Chr4 (1407391..1409202) [1812 bp, 603 aa] {ON} similar to
           Ashbya gossypii AAR078W
          Length = 603

 Score = 49.3 bits (116), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 44/181 (24%), Positives = 85/181 (46%), Gaps = 12/181 (6%)

Query: 149 YHKDNAYGLAFNPNAEGELISGSDDSTIALWDATNDKLKQPIQEWTTSHSDIVNDCQWHC 208
           +H D    L+ N      L S S D TI LWD       + I   +  +   V+  QWH 
Sbjct: 308 HHTDAVLSLSHNKQYRVVLASTSADQTIKLWDLNQGTAVRSIA--SIHNGTTVSSSQWHP 365

Query: 209 FNTNMFGSVSEDSTLQLFDKRNGGKSDV----KISSKGQYNSIAFSGFSENLFAAAGTTN 264
            + ++  + + DS + L D R    S++     + +  +   ++F   ++N F A   + 
Sbjct: 366 SDGSIILTGAYDSRVALSDVRISNDSEMSKYWSVMTGEEVECVSF--VNDNEFLAGTDSG 423

Query: 265 NIYLYDIRNTGKI--LHSMTGHEEPVTSLEFSNDKDGILISGSSDRRVIMWDLFEIGAEQ 322
           NIY +D+RN  K   L ++  H+  ++S+  ++    +++S +   +VI   L++I  +Q
Sbjct: 424 NIYSFDLRNGEKSSPLWTLKAHDSGISSMNVNSFIPNMMVSSAMGEKVIK--LWKIPTDQ 481

Query: 323 Q 323
           +
Sbjct: 482 E 482

>TDEL0E04280 Chr5 complement(799966..801411) [1446 bp, 481 aa] {ON}
           Anc_5.201 YLL011W
          Length = 481

 Score = 49.3 bits (116), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 42/180 (23%), Positives = 85/180 (47%), Gaps = 10/180 (5%)

Query: 134 DCSRDKQSALLSTLKYHKDNAYGLAFNPNAEGELISGSDDSTIALWDATNDKLKQPIQEW 193
           D + + Q  LL T  ++ ++A+    +   +   ++G    TI LWD    K   P+   
Sbjct: 157 DQNLNSQDGLLKT--FYGEHAFQGIDHHKVKTTFVTGG--PTIQLWDTARSK---PLSNL 209

Query: 194 TTSHSDIVNDCQWHCFNTNMFGSVSEDSTLQLFDKRNGGKSDVKISSKGQYNSIAFSGFS 253
           +   +D +   +++   T++  S   D+++ L+D R    +  KI  + + N+I ++   
Sbjct: 210 SWG-ADNITSVKFNQTETDILASTGSDNSIVLYDVRTNSPTQ-KIVQRLRTNAICWNPME 267

Query: 254 ENLFAAAGTTNNIYLYDIRNTGKILHSMTGHEEPVTSLEFSNDKDGILISGSSDRRVIMW 313
              F  A   +N Y YD+RN  + L+    H   V  ++F+   D I ++GS D+ + ++
Sbjct: 268 AFNFVTANEDHNAYYYDMRNMSRALNVFKDHVSAVMDVDFAPTGDEI-VTGSYDKTIRIF 326

 Score = 33.5 bits (75), Expect = 0.83,   Method: Compositional matrix adjust.
 Identities = 45/184 (24%), Positives = 81/184 (44%), Gaps = 24/184 (13%)

Query: 150 HKDNAYGLAFNPNAEGELISGSDDSTIALWDATNDKLKQPIQEWTTSHSDIVNDC---QW 206
           H+D  Y +A + +   ++ SGS D  I  W+ ++   +  I  +   +  I   C   Q 
Sbjct: 66  HRDGVYVIAKDYHDLNKVASGSGDGVIKYWNMSS---RDEICSFKAHYGLITGLCVSPQR 122

Query: 207 HCFNTN--MFGSVSEDSTLQLF----DKRNGGKSDVKISS-----KGQYNSIAFSGFSEN 255
              N +     S  +D T++L+    D     K D  ++S     K  Y   AF G   +
Sbjct: 123 SPLNRDQHFMLSCGDDKTVKLWSMNGDDFANVKDDQNLNSQDGLLKTFYGEHAFQGIDHH 182

Query: 256 ----LFAAAGTTNNIYLYDIRNTGKILHSMTGHEEPVTSLEFSNDKDGILISGSSDRRVI 311
                F   G T  I L+D   + K L +++   + +TS++F+  +  IL S  SD  ++
Sbjct: 183 KVKTTFVTGGPT--IQLWDTARS-KPLSNLSWGADNITSVKFNQTETDILASTGSDNSIV 239

Query: 312 MWDL 315
           ++D+
Sbjct: 240 LYDV 243

>Smik_16.442 Chr16 (754983..756395) [1413 bp, 470 aa] {ON} YPR178W
           (REAL)
          Length = 470

 Score = 48.9 bits (115), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 55/203 (27%), Positives = 94/203 (46%), Gaps = 17/203 (8%)

Query: 103 AHDGEINRARYMPQNTNIIATVNGEGTI--FIYDCSRDKQSALLSTLKYHKDNAYGLAFN 160
           +H G+I    + P + N + +   +G I  F Y  +++ +  LL     H+     + ++
Sbjct: 221 SHVGKIGAVEWHPSSNNQMVSCAEDGLIKNFQY-LNKEGELRLLGDFVGHERRVSDVKYH 279

Query: 161 PNAEGELI-SGSDDSTIALWDATNDKLKQPIQEWTTSHSDIVNDCQWHCFNTNMFGSVSE 219
           P+  G+ I S S D T  LWDA+  + +  +QE    HS  V    + C + ++  S   
Sbjct: 280 PS--GKFIGSASHDMTWRLWDASTHQ-ELLLQE---GHSKGVFSLSFQC-DGSLVCSGGM 332

Query: 220 DSTLQLFDKRNGGKSDVKISSKGQYNSIAFSGFSENLF--AAAGTTNNIYLYDIRNTGK- 276
           DS   L+D R+G K    ++  G    +    +S N +  A  G    I ++DIR   + 
Sbjct: 333 DSLTMLWDIRSGSKV---MTLAGHSKPVYTVAWSPNGYQVATGGGDGLINVWDIRQRDEG 389

Query: 277 ILHSMTGHEEPVTSLEFSNDKDG 299
            L+ +  H   VT ++FSND  G
Sbjct: 390 QLNQILAHRNIVTQVKFSNDDGG 412

 Score = 40.8 bits (94), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 40/174 (22%), Positives = 85/174 (48%), Gaps = 6/174 (3%)

Query: 143 LLSTLKYHKDNAYGLAFNPNAEGELISGSDDSTIALWDATNDKLKQPIQEWTTSHSDIVN 202
           L   L  H      + ++P++  +++S ++D  I  +   N + +  +      H   V+
Sbjct: 215 LSQKLDSHVGKIGAVEWHPSSNNQMVSCAEDGLIKNFQYLNKEGELRLLGDFVGHERRVS 274

Query: 203 DCQWHCFNTNMFGSVSEDSTLQLFDKRNGGKSDVKIS-SKGQYNSIAFSGFSENLFAAAG 261
           D ++H  +    GS S D T +L+D     +  ++   SKG + S++F     +L  + G
Sbjct: 275 DVKYHP-SGKFIGSASHDMTWRLWDASTHQELLLQEGHSKGVF-SLSFQ-CDGSLVCSGG 331

Query: 262 TTNNIYLYDIRNTGKILHSMTGHEEPVTSLEFSNDKDGILISGSSDRRVIMWDL 315
             +   L+DIR+  K++ ++ GH +PV ++ +S +   +  +G  D  + +WD+
Sbjct: 332 MDSLTMLWDIRSGSKVM-TLAGHSKPVYTVAWSPNGYQV-ATGGGDGLINVWDI 383

 Score = 33.1 bits (74), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 34/143 (23%), Positives = 55/143 (38%), Gaps = 29/143 (20%)

Query: 188 QPIQEWTTSHSDIVNDCQWHCFNTNMFGSVSEDSTLQLFDKRNGGK-------------- 233
           QP+ +   SH   +   +WH  + N   S +ED  ++ F   N                 
Sbjct: 213 QPLSQKLDSHVGKIGAVEWHPSSNNQMVSCAEDGLIKNFQYLNKEGELRLLGDFVGHERR 272

Query: 234 -SDVKISSKGQYNSIAFSGFSENLFAAAGTTNNIYLYDIRNTGKILHSMTGHEEPVTSLE 292
            SDVK    G++   A    +  L+ A+ T   + L +            GH + V SL 
Sbjct: 273 VSDVKYHPSGKFIGSASHDMTWRLWDAS-THQELLLQE------------GHSKGVFSLS 319

Query: 293 FSNDKDGILISGSSDRRVIMWDL 315
           F  D   ++ SG  D   ++WD+
Sbjct: 320 FQCD-GSLVCSGGMDSLTMLWDI 341

>KNAG0D00740 Chr4 complement(115399..116913) [1515 bp, 504 aa] {ON}
           Anc_6.276 YPL247C
          Length = 504

 Score = 49.3 bits (116), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 55/229 (24%), Positives = 99/229 (43%), Gaps = 31/229 (13%)

Query: 167 LISGSDDSTIALWDATNDKLKQP--IQEWTTSHSDIVNDCQWHCFNTNMFGSVSEDSTLQ 224
           L+S S D+T  +WD     L+ P  ++    +H   V D ++   +T++F S   D +++
Sbjct: 262 LVSSSIDTTCIVWD-----LQSPNYVKTQLIAHDSEVYDVRFLSQSTHLFASCGGDGSVR 316

Query: 225 LFDKRNGGKSDVKI---SSKGQYNSIAF----------SGFSENLFAA-AGTTNNIYLYD 270
           +FD R+   S +     + +G  N +            S    N+ A     + +I + D
Sbjct: 317 VFDLRSLAHSTIVYEPPAGEGTVNDVTAQNNALLRLEPSLMDPNIIATLVADSKDILILD 376

Query: 271 IRNTGKILHSMTGHEEPVTSLEFSNDKDGILISGSSDRRVIMWDL---FEIGAEQQPDEA 327
           +RN      ++ GH   V  +++   K  +L+S S D +V+ WDL    +         +
Sbjct: 377 MRNPESPALTLKGHSSLVNQIKWHPTKRNVLLSCSDDCQVLYWDLNTALDGSTPTSSSTS 436

Query: 328 DDGLPEVMMIHAGSRSAIND-----ISTHPSIPWLNASVEENNIVQVWK 371
             G  ++ M   G   AI D     +   P++ + N S E NNI   W+
Sbjct: 437 ITGDTDISMAGTGYEHAIADDTRGKVLDTPNLFYANESQEINNI--AWR 483

 Score = 43.1 bits (100), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 35/145 (24%), Positives = 60/145 (41%), Gaps = 30/145 (20%)

Query: 102 FAHDGEINRARYMPQNTNIIATVNGEGTIFIYDCSRDKQSALLSTLKYHKDNAYGLA--- 158
            AHD E+   R++ Q+T++ A+  G+G++ ++D     +S   ST+ Y      G     
Sbjct: 287 IAHDSEVYDVRFLSQSTHLFASCGGDGSVRVFDL----RSLAHSTIVYEPPAGEGTVNDV 342

Query: 159 --------------FNPNAEGELISGSDDSTIALWDATNDKLKQPIQEWTT--SHSDIVN 202
                          +PN    L++ S D  I         ++ P     T   HS +VN
Sbjct: 343 TAQNNALLRLEPSLMDPNIIATLVADSKDILIL-------DMRNPESPALTLKGHSSLVN 395

Query: 203 DCQWHCFNTNMFGSVSEDSTLQLFD 227
             +WH    N+  S S+D  +  +D
Sbjct: 396 QIKWHPTKRNVLLSCSDDCQVLYWD 420

 Score = 32.0 bits (71), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 22/89 (24%), Positives = 44/89 (49%), Gaps = 4/89 (4%)

Query: 201 VNDCQWHCFNTNMFGSVSEDSTLQLFDKRNGGKSDVK-ISSKGQYNSIAFSGFSENLFAA 259
           V    W+  +TN+  S S D+T  ++D ++      + I+   +   + F   S +LFA+
Sbjct: 249 VTSFDWNTVDTNLLVSSSIDTTCIVWDLQSPNYVKTQLIAHDSEVYDVRFLSQSTHLFAS 308

Query: 260 AGTTNNIYLYDIRNTGKILHSMTGHEEPV 288
            G   ++ ++D+R+   + HS   +E P 
Sbjct: 309 CGGDGSVRVFDLRS---LAHSTIVYEPPA 334

 Score = 31.2 bits (69), Expect = 5.6,   Method: Compositional matrix adjust.
 Identities = 27/75 (36%), Positives = 34/75 (45%), Gaps = 13/75 (17%)

Query: 241 KGQYNSIAFSGFSENLFAAAGTTNNIYLYDIRNTGKILHSMTGHEEPVTSLEFSNDKDGI 300
           K Q N+ A  G   NL AA G   N        T  IL    G   PVTS +++     +
Sbjct: 215 KKQRNNTA--GNKVNLAAAGGCLKNT-------TTAIL----GELPPVTSFDWNTVDTNL 261

Query: 301 LISGSSDRRVIMWDL 315
           L+S S D   I+WDL
Sbjct: 262 LVSSSIDTTCIVWDL 276

>AEL246C Chr5 complement(172849..175296) [2448 bp, 815 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YBR198C
           (TAF5)
          Length = 815

 Score = 49.3 bits (116), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 57/216 (26%), Positives = 100/216 (46%), Gaps = 16/216 (7%)

Query: 102 FAHDGEINRARYMPQNTNIIATVNGEGTIFIYDCSRDKQSALLSTLKYHKDNAYGLAFNP 161
             H G +    + P N  ++ + + + T+ ++  S D  + L+S  K H    + + F+P
Sbjct: 539 IGHSGPVYSVSFSPDNRYLV-SASEDKTVRLW--SLDTYTCLVS-YKGHNHPVWDVKFSP 594

Query: 162 NAEGELISGSDDSTIALWDATNDKLKQPIQEWTTSHSDIVNDCQWHCFNTNMFGSVSEDS 221
                  +GS D T  LW    D +  P++ +    +D+  DC     N     + S D 
Sbjct: 595 LGH-YFATGSHDQTARLWSC--DHI-YPLRIFAGHLNDV--DCVTFHPNGTYVLTGSSDK 648

Query: 222 TLQLFDKRNGGKSDVKISSKGQYNSIAFSGFSENLFAAAGTTNN-IYLYDIRNTGKILHS 280
           T +++D + G    + +       S+A S   +  +   G+ +  I ++DI  TGK +  
Sbjct: 649 TCRMWDIQTGDSVRLFLGHTASVVSVAVS--PDGRWLTTGSEDGVIIVWDI-GTGKRIKQ 705

Query: 281 MTGH-EEPVTSLEFSNDKDGILISGSSDRRVIMWDL 315
           M GH +  V SL F N +  IL+SG +D+ V +WDL
Sbjct: 706 MRGHGKSAVYSLSF-NKEGNILVSGGADQSVRVWDL 740

>Smik_12.256 Chr12 (490929..492659) [1731 bp, 576 aa] {ON} YLR196W
           (REAL)
          Length = 576

 Score = 49.3 bits (116), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 40/172 (23%), Positives = 82/172 (47%), Gaps = 11/172 (6%)

Query: 149 YHKDNAYGLAFNPNAEGELISGSDDSTIALWDATNDKLKQPIQEWTTSHSDIVNDCQWHC 208
           +H D    +A N +    L S S D T+ LWD  +    + +    ++ +  V+  +WH 
Sbjct: 284 HHTDAVLSMAHNKHFRSVLASTSADHTVKLWDLNSGNAARSLASIHSNKN--VSSSEWHM 341

Query: 209 FNTNMFGSVSEDSTLQLFDKRNGGKSDV----KISSKGQYNSIAFSGFSENLFAAAGTTN 264
            N ++  +   DS + L D R   +S +     + S  +  +  F+  SEN+      + 
Sbjct: 342 LNGSVLLTGGYDSRVALTDVRISDESQMSKYWSVMSGEEIETATFA--SENIILCGTDSG 399

Query: 265 NIYLYDIRNT--GKILHSMTGHEEPVTSLEFSNDKDGILISGS-SDRRVIMW 313
           N+Y +DIRN+   K + ++  H+  +++L  +    G++ +G+  ++ V +W
Sbjct: 400 NVYSFDIRNSENCKPVWTLKAHDAGISTLCSNKFIPGMMSTGAMGEKTVKLW 451

>Skud_16.482 Chr16 (834842..836239) [1398 bp, 465 aa] {ON} YPR178W
           (REAL)
          Length = 465

 Score = 48.9 bits (115), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 53/217 (24%), Positives = 97/217 (44%), Gaps = 17/217 (7%)

Query: 102 FAHDGEINRARYMPQNTNIIATVNGEGTIFIYDCSRDKQSALLSTLKYHKDNAYGLAFNP 161
             H+  ++  +Y P    +I + + + T  ++D S   Q  LL   + H +  + L+F  
Sbjct: 262 VGHERRVSDVKYHPSG-KLIGSASHDMTWRLWDAS-TYQELLLQ--EGHTEGVFSLSFQ- 316

Query: 162 NAEGELI-SGSDDSTIALWDATNDKLKQPIQEWTTSHSDIVNDCQWHCFNTNMFGSVSED 220
             +G L+ SG  D+   +WD  +      +    T HS  V    W   N     +   D
Sbjct: 317 -CDGSLVCSGGMDTLSMIWDIRSGNKVMTL----TGHSKPVYTVAWST-NGYQVATGGGD 370

Query: 221 STLQLFD--KRNGGKSDVKISSKGQYNSIAFS-GFSENLFAAAGTTNNIYLYDIRNTGKI 277
             + ++D  +R+GG+    ++ +     + FS G       ++G  N I +Y   +T   
Sbjct: 371 GLINVWDIRQRDGGQVSQILAHRNIVTQVQFSKGDGGKKLVSSGYDNLINVYS-SDTWLK 429

Query: 278 LHSMTGHEEPVTSLEFSNDKDGILISGSSDRRVIMWD 314
           + S+ GH + + SL+ SND    L+SG  DR + +W+
Sbjct: 430 VASLEGHTDKIISLDVSNDSQ-FLVSGGWDRSIKLWN 465

 Score = 44.3 bits (103), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 38/175 (21%), Positives = 84/175 (48%), Gaps = 4/175 (2%)

Query: 143 LLSTLKYHKDNAYGLAFNPNAEGELISGSDDSTIALWDATNDKLKQPIQEWTTSHSDIVN 202
           L   L  HK     + ++P +  ++IS ++D  I  +  + ++ +  +      H   V+
Sbjct: 210 LAQKLDPHKGKIGAVQWHPESNNQIISCAEDGHIKNFQYSKEEGEIKLLGDLVGHERRVS 269

Query: 203 DCQWHCFNTNMFGSVSEDSTLQLFDKRNGGKSDVKISSKGQYNSIAFSGFSENLFAAAGT 262
           D ++H  +  + GS S D T +L+D     +  ++        S++F     +L  + G 
Sbjct: 270 DVKYHP-SGKLIGSASHDMTWRLWDASTYQELLLQEGHTEGVFSLSFQ-CDGSLVCSGGM 327

Query: 263 TNNIYLYDIRNTGKILHSMTGHEEPVTSLEFSNDKDGILISGSSDRRVIMWDLFE 317
                ++DIR+  K++ ++TGH +PV ++ +S +   +  +G  D  + +WD+ +
Sbjct: 328 DTLSMIWDIRSGNKVM-TLTGHSKPVYTVAWSTNGYQV-ATGGGDGLINVWDIRQ 380

 Score = 33.5 bits (75), Expect = 0.96,   Method: Compositional matrix adjust.
 Identities = 38/153 (24%), Positives = 62/153 (40%), Gaps = 11/153 (7%)

Query: 172 DDSTIAL--W----DATNDKLKQPIQEWTTSHSDIVNDCQWHCFNTNMFGSVSEDSTLQL 225
           DD T+A   W       N +  QP+ +    H   +   QWH  + N   S +ED  ++ 
Sbjct: 186 DDMTVATGSWAGDIRVLNSQTLQPLAQKLDPHKGKIGAVQWHPESNNQIISCAEDGHIKN 245

Query: 226 FD-KRNGGKSDVKISSKGQYNSIAFSGF--SENLFAAAGTTNNIYLYDIRNTGKILHSMT 282
           F   +  G+  +     G    ++   +  S  L  +A       L+D     ++L    
Sbjct: 246 FQYSKEEGEIKLLGDLVGHERRVSDVKYHPSGKLIGSASHDMTWRLWDASTYQELL-LQE 304

Query: 283 GHEEPVTSLEFSNDKDGILISGSSDRRVIMWDL 315
           GH E V SL F  D   ++ SG  D   ++WD+
Sbjct: 305 GHTEGVFSLSFQCD-GSLVCSGGMDTLSMIWDI 336

>TBLA0F04130 Chr6 complement(1021035..1022579) [1545 bp, 514 aa]
           {ON} Anc_6.340 YCR072C
          Length = 514

 Score = 48.9 bits (115), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 64/297 (21%), Positives = 115/297 (38%), Gaps = 92/297 (30%)

Query: 103 AHDGEINRARYMPQNTNIIATVNGEGTIFIYDCSRDKQSALLSTLKYHKDNAYGLAFNPN 162
            H   I  + + P +++ + T  G+ T  ++DC  D Q+ + +TL  H +    +A++P+
Sbjct: 140 GHGSTILCSAFAPNSSSRMVTGAGDNTARLWDC--DTQTPM-ATLSGHSNWVLCVAWSPD 196

Query: 163 AEGELISGSDDSTIALWDATNDKL--------------------------KQP------- 189
           AE  + +GS D+TI LW+  N K                           ++P       
Sbjct: 197 AE-VIATGSMDNTIRLWNGINGKPIGDSLRGHSKWITSLAWEPLHLVKVGQKPRLASASK 255

Query: 190 ---IQEWTTS----------HSDIVNDCQWHCFNTNMFGSVSEDSTLQLFDKRNGGKSDV 236
              I+ W T+          H+  V+  +W     NM  + S D T++++D  + G+   
Sbjct: 256 DGTIKVWDTTGRVCLYTLSGHTSSVSCVRWG--GQNMLYTGSHDKTIRVWDMNSNGRCIN 313

Query: 237 KISSKGQY-NSIAFS--------------------------------------GFSENLF 257
            + S   + N ++ S                                      G +E L 
Sbjct: 314 ILKSHAHWVNHLSLSTDYALRIGPFDHSGAKPAIAEEARDKALKNYEKIVKKNGHTEELM 373

Query: 258 AAAGTTNNIYLYDIRNTGKILHSMTGHEEPVTSLEFSNDKDGILISGSSDRRVIMWD 314
             A     ++L++   + K L  MTGH++ V  + FS D   I +S S D  + +WD
Sbjct: 374 VTASDDFTMFLWNPLKSTKPLARMTGHQKLVNHVAFSPDGRHI-VSASFDNSIKLWD 429

 Score = 47.0 bits (110), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 41/179 (22%), Positives = 84/179 (46%), Gaps = 17/179 (9%)

Query: 145 STLKYHKDNAYGLAFNPNAEGELISGSDDSTIALWDATNDKLKQPIQEWTTSHSDIVNDC 204
           S +  H       AF PN+   +++G+ D+T  LWD      + P+    + HS+ V   
Sbjct: 136 SAIAGHGSTILCSAFAPNSSSRMVTGAGDNTARLWDCDT---QTPMAT-LSGHSNWVLCV 191

Query: 205 QWHCFNTNMFGSVSEDSTLQLFDKRNGGKSDVKISSKGQY-NSIAFSGF------SENLF 257
            W   +  +  + S D+T++L++  NG      +    ++  S+A+          +   
Sbjct: 192 AW-SPDAEVIATGSMDNTIRLWNGINGKPIGDSLRGHSKWITSLAWEPLHLVKVGQKPRL 250

Query: 258 AAAGTTNNIYLYDIRNTGKI-LHSMTGHEEPVTSLEFSNDKDGILISGSSDRRVIMWDL 315
           A+A     I ++D   TG++ L++++GH   V+ + +      +L +GS D+ + +WD+
Sbjct: 251 ASASKDGTIKVWD--TTGRVCLYTLSGHTSSVSCVRWGGQN--MLYTGSHDKTIRVWDM 305

 Score = 34.3 bits (77), Expect = 0.63,   Method: Compositional matrix adjust.
 Identities = 22/84 (26%), Positives = 44/84 (52%), Gaps = 5/84 (5%)

Query: 103 AHDGEINRARYMPQNTNIIATVNGEGTIFIYDCSRDKQSALLSTLKYHKDNAYGLAFNPN 162
            H   +N   + P   +I++  + + +I ++D  RD +   +ST + H  + Y +A++ +
Sbjct: 399 GHQKLVNHVAFSPDGRHIVS-ASFDNSIKLWD-GRDGK--FISTFRGHVASVYQVAWSSD 454

Query: 163 AEGELISGSDDSTIALWDATNDKL 186
               L+S S D+T+ +WD    KL
Sbjct: 455 CR-LLVSCSKDTTLKVWDVRTKKL 477

>YLR429W Chr12 (990777..992732) [1956 bp, 651 aa] {ON}  CRN1Coronin,
           cortical actin cytoskeletal component that associates
           with the Arp2p/Arp3p complex to regulate its activity;
           plays a role in regulation of actin patch assembly
          Length = 651

 Score = 49.3 bits (116), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 47/176 (26%), Positives = 77/176 (43%), Gaps = 19/176 (10%)

Query: 159 FNPNAEGELISGSDDSTIALWDATN--------DKLKQPIQ----EWTTSHSDIVNDCQW 206
           F+P  +  + SGSDDS I +WD           D+  +PI     ++ T H+  V    +
Sbjct: 89  FDPFNDHRIASGSDDSKIGIWDIPENYKFHDHVDEDGEPIDIKPVKFLTGHARKVGHVLY 148

Query: 207 HCFNTNMFGSVSEDSTLQLFDKRNGGKSDVKISSKGQYNSIAFSGFSENLFAAAGTTNNI 266
           H    N+  S S D T++L++    GK  + +       S++FS +  N  A       +
Sbjct: 149 HPVAENVLASSSGDYTVKLWNVET-GKDMITLKHPDMVTSMSFS-YDGNYLATVARDKKL 206

Query: 267 YLYDIRNTGKILHSMTGH----EEPVTSLEFSNDKDGILISGSSDRRVIMWDLFEI 318
            +++IR   KI+     H     + V  L  S+       S  SDR++ +WD F I
Sbjct: 207 RVWNIREE-KIVSEGPAHTGAKNQRVVWLGNSDRLATTGFSKLSDRQIGIWDAFNI 261

 Score = 33.1 bits (74), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 31/137 (22%), Positives = 65/137 (47%), Gaps = 19/137 (13%)

Query: 197 HSDIVNDCQWHCFNTNMFGSVSEDSTLQLFD-----------KRNGGKSDVK-----ISS 240
           H+  V D  +  FN +   S S+DS + ++D             +G   D+K        
Sbjct: 80  HTAQVLDTDFDPFNDHRIASGSDDSKIGIWDIPENYKFHDHVDEDGEPIDIKPVKFLTGH 139

Query: 241 KGQYNSIAFSGFSENLFAAAGTTNNIYLYDIRNTGKILHSMTGHEEPVTSLEFSNDKDGI 300
             +   + +   +EN+ A++     + L+++  TGK + ++  H + VTS+ FS D +  
Sbjct: 140 ARKVGHVLYHPVAENVLASSSGDYTVKLWNV-ETGKDMITLK-HPDMVTSMSFSYDGN-Y 196

Query: 301 LISGSSDRRVIMWDLFE 317
           L + + D+++ +W++ E
Sbjct: 197 LATVARDKKLRVWNIRE 213

>CAGL0E00561g Chr5 (49987..52497) [2511 bp, 836 aa] {ON} some
           similarities with uniprot|P16649 Saccharomyces
           cerevisiae YCR084c TUP1
          Length = 836

 Score = 49.3 bits (116), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 53/213 (24%), Positives = 95/213 (44%), Gaps = 29/213 (13%)

Query: 120 IIATVNGEGTIFIYDCSRDKQSALLSTLKYHKDNAYGLAFNPNAEGELISGSDDSTIALW 179
            +AT   +  I I+D  + K   ++  LK H+ + Y L + P+ + +L+SGS D T+ +W
Sbjct: 569 FLATGAEDKLIRIWDIEQKK---IVMVLKGHEQDIYSLDYFPSGD-KLVSGSGDRTVRIW 624

Query: 180 DATNDKLKQPIQEWTTSHSDIVNDCQWHCFNTNMFGSVSEDSTLQLFDKRNG-------G 232
           D     LK      T S  D V        +     + S D  ++++D   G        
Sbjct: 625 D-----LKTGQCTLTLSIEDGVTTVAVSPGDGKFIAAGSLDRAVRVWDSDTGFLVERLDS 679

Query: 233 KSDVKISSKGQYNSIAFSGFSENLFAAAGTTNNIYLYDIRN-----------TGKILHSM 281
           ++++    K    S+ F+    N   +     ++ L+++RN           +G    + 
Sbjct: 680 ENELGTGHKDSVYSVVFT-RDGNGVVSGSLDRSVKLWNLRNVNHNNADGKPTSGTCEVTY 738

Query: 282 TGHEEPVTSLEFSNDKDGILISGSSDRRVIMWD 314
           TGH++ V S+  + D D  ++SGS DR V+ WD
Sbjct: 739 TGHKDFVLSVATTED-DEYILSGSKDRGVLFWD 770

 Score = 45.1 bits (105), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 53/219 (24%), Positives = 92/219 (42%), Gaps = 40/219 (18%)

Query: 129 TIFIYDCSRDKQSALLSTLKYHKDNAYGLAFNPNAEGE---------------------- 166
           T  IY  S  +  A  S    H D A G   N NAE E                      
Sbjct: 513 TTQIYRVSDGELVARFSDENAHTDKADG---NDNAEAETSAGATTDLYIRSVCFSPDGKF 569

Query: 167 LISGSDDSTIALWDATNDKLKQPIQEWTTSHSDIVNDCQWHCFNTNMFGSVSEDSTLQLF 226
           L +G++D  I +WD    K+   ++     H   +    +      +  S S D T++++
Sbjct: 570 LATGAEDKLIRIWDIEQKKIVMVLK----GHEQDIYSLDYFPSGDKLV-SGSGDRTVRIW 624

Query: 227 DKRNGGKSDVKISSKGQYNSIAFSGFSENLFAAAGTTNNIYLYDIRNTGKILHSM----- 281
           D + G +  + +S +    ++A S       AA      + ++D  +TG ++  +     
Sbjct: 625 DLKTG-QCTLTLSIEDGVTTVAVSPGDGKFIAAGSLDRAVRVWD-SDTGFLVERLDSENE 682

Query: 282 --TGHEEPVTSLEFSNDKDGILISGSSDRRVIMWDLFEI 318
             TGH++ V S+ F+ D +G+ +SGS DR V +W+L  +
Sbjct: 683 LGTGHKDSVYSVVFTRDGNGV-VSGSLDRSVKLWNLRNV 720

>ZYRO0D03828g Chr4 (310049..312229) [2181 bp, 726 aa] {ON} similar
           to uniprot|P47025 Saccharomyces cerevisiae YJL112W MDV1
           WD repeat protein that regulates steps in the
           Dnm1p-dependent process of mitochondrial fission
          Length = 726

 Score = 48.9 bits (115), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 53/181 (29%), Positives = 81/181 (44%), Gaps = 40/181 (22%)

Query: 167 LISGSDDSTIALWDATNDKLKQPIQEWTTSHSDIVNDCQWH-----------CFNTNMFG 215
           LISG  D+ + LWD +     Q  QE T   S+    C +             F++    
Sbjct: 472 LISGGRDAVLKLWDLS--LAYQLYQEDTEFASNSEEACVYTFDSHLDEITALSFDSGHLV 529

Query: 216 SVSEDSTLQLFDKRNGG---KSDVKISSKGQYNSI-----------------AFSGFSEN 255
           S S+D TL+ +D   G      D+  +S+GQ  S                  A   F   
Sbjct: 530 SGSQDRTLRQWDLSTGKCVQTIDISFASRGQSTSSLASSSLLSPVVEAPVVGALQCFDAA 589

Query: 256 LFAAAGTTNNIY-LYDIRNTGKILHSMTGHEEPVTSLEFSNDKDGILISGSSDRRVIMWD 314
           L  A GT + I  L+D+R +GK + S+ GH + +T+L+F +     L++GS DR + +WD
Sbjct: 590 L--ATGTKDGIVRLWDMR-SGKTIRSLEGHTDAITTLKFDSRN---LVTGSLDRSIRIWD 643

Query: 315 L 315
           L
Sbjct: 644 L 644

 Score = 32.0 bits (71), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 35/150 (23%), Positives = 68/150 (45%), Gaps = 12/150 (8%)

Query: 164 EGELISGSDDSTIALWDATNDKLKQPIQEWTTSHSDIVNDCQWHCFNTNMFGSVSEDSTL 223
           +  L +G+ D  + LWD  + K  + ++     H+D +   +   F++    + S D ++
Sbjct: 587 DAALATGTKDGIVRLWDMRSGKTIRSLE----GHTDAITTLK---FDSRNLVTGSLDRSI 639

Query: 224 QLFDKRNGGKSDVKISSKGQYNSIAFSGFSENLFAAAGTTNNIYLYDIRNTGKILHSMTG 283
           +++D R G  +D   + +     + F    +++ AA G  N + ++D R   K       
Sbjct: 640 RIWDLRTGTLADA-FAYESPVLELDFD--LQDIVAAVGE-NGVKVFD-RENDKHWVCAQS 694

Query: 284 HEEPVTSLEFSNDKDGILISGSSDRRVIMW 313
            EE  +  +F   K+G LI G S+  V  W
Sbjct: 695 EEEDASISQFVKYKNGYLIEGRSNGDVNAW 724

>Kpol_1019.30 s1019 (56367..60125) [3759 bp, 1252 aa] {ON}
           (56367..60125) [3759 nt, 1253 aa]
          Length = 1252

 Score = 49.3 bits (116), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 58/231 (25%), Positives = 102/231 (44%), Gaps = 24/231 (10%)

Query: 105 DGEINRARYMPQNTNIIATV-NGEGTIFIYDCSRDKQSAL--LSTLKYHKDNAYGLAFNP 161
           D + N   +   N NI   + NG   +F +D       +L  LS    HK +   L FN 
Sbjct: 62  DSKFNDLDWSVDNINIAGALDNGNIELFNFDNKSQTIKSLGNLSDSNKHKGSVKTLKFNT 121

Query: 162 NAEGELISGSD-DSTIALWDATNDKLKQPIQE-WTTSHSDIVNDCQWHCFNTNMFGSVSE 219
                L+SGSD +  I +WD  N+  K P+      + ++ +    W+   +++F   S 
Sbjct: 122 KQSNLLVSGSDKNGEILIWD-LNNLDKTPLTPGMPMTPTNEITSLAWNKSLSHVFSCSSN 180

Query: 220 DSTLQLFDKRNGGKSDVKISSKGQYNSIAFSGFS-------ENLFAAAGTTNN------- 265
            S + +FD +   K  + ++     N++  S FS        +   A  T NN       
Sbjct: 181 TSNVSIFDLK-AKKEVIHLNYTNPVNNVK-SLFSVVEWHPKNSTRIATATLNNDSTESDS 238

Query: 266 IYLYDIRNTGKILH--SMTGHEEPVTSLEFSNDKDGILISGSSDRRVIMWD 314
           I+++D+RN+   L   S  GH   + SL++ +  + +L+S   D  V++W+
Sbjct: 239 IFIWDLRNSHTPLQILSKDGHSNGILSLDWCSTDENLLLSSGRDNSVMLWN 289

>ZYRO0D16742g Chr4 complement(1385330..1387156) [1827 bp, 608 aa]
           {ON} similar to uniprot|P39014 Saccharomyces cerevisiae
           YIL046W MET30 F-box protein containing five copies of
           the WD40 motif controls cell cycle function sulfur
           metabolism and methionine biosynthesis as part of the
           ubiquitin ligase complex interacts with and regulates
           Met4p localizes within the nucleus
          Length = 608

 Score = 48.9 bits (115), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 42/177 (23%), Positives = 80/177 (45%), Gaps = 16/177 (9%)

Query: 139 KQSALLSTLKYHKDNAYGLAFNPNAEGELISGSDDSTIALWDATNDKLKQPIQEWTTSHS 198
           K + L+   K H D    L FN      L +GS DSTIA+WD    +L + +    +SH+
Sbjct: 273 KGTCLIKEFKGHMDGVLALQFNTRY---LFTGSYDSTIAIWDLCTGRLVRRL----SSHT 325

Query: 199 DIVNDCQWHCFNTNMFGSVSEDSTLQLFDKRNGGKSDVKISSKGQYNSIAFSGFSENLFA 258
           D V       F+     + S D T+++++   G   +   + +G  +S+      + +  
Sbjct: 326 DGVKALY---FDDQKLITGSLDKTIRVWNYLTG---ECISTYRGHTDSVLSVDSYKKIIV 379

Query: 259 AAGTTNNIYLYDIRNTGKILHSMTGHEEPVTSLEFSNDKDGILISGSSDRRVIMWDL 315
           +      + ++ + +  +  +S+ GH E V  ++  + K  +  S S D  + MWD+
Sbjct: 380 SGSADKTVKVWHVES--RTCYSLRGHTEWVNCVKL-HPKSFLCFSCSDDTTIRMWDI 433

 Score = 37.4 bits (85), Expect = 0.055,   Method: Compositional matrix adjust.
 Identities = 64/284 (22%), Positives = 104/284 (36%), Gaps = 90/284 (31%)

Query: 106 GEINRARYMPQNTNIIATVNGEGTIFIYDCSRDKQSALLSTLKYHKDNAYGLAFNPNAEG 165
           G ++    +  NT  + T + + TI I+D    +   L+  L  H D    L F+   + 
Sbjct: 283 GHMDGVLALQFNTRYLFTGSYDSTIAIWDLCTGR---LVRRLSSHTDGVKALYFD---DQ 336

Query: 166 ELISGSDDSTIALWDATN-----------------DKLKQ---------PIQEWTT---- 195
           +LI+GS D TI +W+                    D  K+          ++ W      
Sbjct: 337 KLITGSLDKTIRVWNYLTGECISTYRGHTDSVLSVDSYKKIIVSGSADKTVKVWHVESRT 396

Query: 196 -----SHSDIVNDCQWH-----CFNTNMFGSVSEDSTLQLFDKRNGGKSDVKISSKGQYN 245
                 H++ VN  + H     CF      S S+D+T++++D R      V     GQ  
Sbjct: 397 CYSLRGHTEWVNCVKLHPKSFLCF------SCSDDTTIRMWDIRTNVCLKVFRGHLGQVQ 450

Query: 246 SI-----------------------------AFSGFSENL-----FAAAGTTNNIYLYDI 271
            +                             A    +ENL       +    N I L+DI
Sbjct: 451 KVVPLTIIDSENLVVDDKAEDDGEEQGDDENAQDVLTENLPYPTHLLSCSLDNTIKLWDI 510

Query: 272 RNTGKILHSMTGHEEPVTSLEFSNDKDGILISGSSDRRVIMWDL 315
           +  G+ + +  GH E V  L   N +   ++SGS D +V +WDL
Sbjct: 511 KK-GRCIRTQFGHVEGVWDLAADNFR---IVSGSHDGKVKVWDL 550

>NDAI0D02250 Chr4 complement(526907..529294) [2388 bp, 795 aa] {ON}
           Anc_5.139 YGR200C
          Length = 795

 Score = 48.9 bits (115), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 62/252 (24%), Positives = 110/252 (43%), Gaps = 36/252 (14%)

Query: 109 NRARYMPQNTNIIATVNGEGTIFIYDCSRDKQSALLSTLKYHKDNAYGLAFNPNAEGELI 168
           N+     ++ NI+A      TI ++D        ++ TLK H+ +   + F  +    +I
Sbjct: 16  NQVSSYNKSLNIVA-FGACNTIALWDPLDPSNHGVIQTLKGHEADVTCVKF-IHGTPFMI 73

Query: 169 SGSDDSTIALWDATND--KLKQPIQEW--TTSHSDIVNDCQWHCFNTNMFGSVSEDSTLQ 224
           S S+D  + +W  T++     Q IQ +  T    D++ D         +F     D  + 
Sbjct: 74  SASEDHHVKVWKVTDNVWNCVQTIQHYQNTIVALDVLED---------LFVVGCADGNVS 124

Query: 225 LFDKRNGGKSDVK----ISSKGQYN-SIAFSGFSEN--LFAAAGTTNNIYLYDI---RNT 274
           ++ + N   + V     I  +G    S A S  ++N  L A  GT  N+++Y     R  
Sbjct: 125 IWVRENELDTFVMSQEFIVQQGVLPLSFALSNVTDNKYLLAIGGTNVNVFIYSFVFSRTQ 184

Query: 275 G-------KILHSMTGHEEPVTSLEFSNDK---DGILISGSSDRRVIMWDL-FEIGAEQQ 323
           G       K+   + GHE+ + S+ F + +   D +L SGS DR + +W +      E+Q
Sbjct: 185 GVDAIHDCKLAAKLEGHEDWIKSMAFRHQETPGDYLLCSGSQDRYIRLWRIRINDLIEEQ 244

Query: 324 PDEADDGLPEVM 335
            DE D+   E++
Sbjct: 245 DDENDENKLELL 256

>TBLA0C01840 Chr3 (435021..436292) [1272 bp, 423 aa] {ON} Anc_8.672
           YPL151C
          Length = 423

 Score = 48.5 bits (114), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 52/212 (24%), Positives = 92/212 (43%), Gaps = 24/212 (11%)

Query: 143 LLSTLKYHKDNAYGLAFNPNAEGELISGSDDSTIALWDATNDKLKQPIQEWTTSHSDIVN 202
           L+  +K H      +  +P       +GS+D+TI +WD  + KLK  +    + H+  V 
Sbjct: 103 LMRVIKGHNGWVRCVQIDPVDNEWFATGSNDTTIKIWDLASGKLKITL----SGHAMTVR 158

Query: 203 DCQWHCFNTNMFGSVSEDSTLQLFD-KRNGGKSDVKISSKGQYNSIAFSGFSENLFAAAG 261
           D      +  +F S SED   + +D ++N    D      G +          +L A AG
Sbjct: 159 DIAISNRHPYLF-SASEDKLAKCWDLEKNTAIRDYHGHLSGVHTVDIHPTL--DLIATAG 215

Query: 262 TTNNIYLYDIRNTGKILHSMTGHEEPVTSLEFSNDKDGILISGSSDRRVIMWDLFEIGAE 321
             + + L+DIR+   ++ ++ GH+ P+  +        + IS S D  + +WD+    A 
Sbjct: 216 RDSVVKLWDIRSRVPVV-TLIGHKSPINKVHCLPVNPQV-ISSSVDATIRLWDIVAGKAS 273

Query: 322 QQPDEADDGLPEVMMIHAGSRSAINDISTHPS 353
           +           V+  H   + +I DI+ HPS
Sbjct: 274 K-----------VLTHH---KRSIRDIAFHPS 291

 Score = 31.6 bits (70), Expect = 3.3,   Method: Compositional matrix adjust.
 Identities = 48/215 (22%), Positives = 86/215 (40%), Gaps = 13/215 (6%)

Query: 103 AHDGEINRARYMPQNTNIIATVNGEGTIFIYDCSRDKQSALLSTLKYHKDNAYGLAFNPN 162
            H+G +   +  P +    AT + + TI I+D +  K   L  TL  H      +A + N
Sbjct: 109 GHNGWVRCVQIDPVDNEWFATGSNDTTIKIWDLASGK---LKITLSGHAMTVRDIAIS-N 164

Query: 163 AEGELISGSDDSTIALWDATNDKLKQPIQEWTTSHSDIVNDCQWHCFNTNMFGSVSEDST 222
               L S S+D     WD   +     I+++   H   V+    H    ++  +   DS 
Sbjct: 165 RHPYLFSASEDKLAKCWDLEKN---TAIRDY-HGHLSGVHTVDIHP-TLDLIATAGRDSV 219

Query: 223 LQLFDKRNGGKSDVKISSKGQYNSIAFSGFSENLFAAAGTTNNIYLYDIRNTGKILHSMT 282
           ++L+D R+       I  K   N +     +  + +++     I L+DI   GK    +T
Sbjct: 220 VKLWDIRSRVPVVTLIGHKSPINKVHCLPVNPQVISSS-VDATIRLWDIV-AGKASKVLT 277

Query: 283 GHEEPVTSLEFSNDKDGILISGSSDRRVIMWDLFE 317
            H+  +  + F   +  +  + + D R   W L E
Sbjct: 278 HHKRSIRDIAFHPSEFSMATACTDDIR--SWKLPE 310

>ZYRO0A09636g Chr1 (779501..781927) [2427 bp, 808 aa] {ON} highly
           similar to uniprot|Q05946 Saccharomyces cerevisiae
           YLR222C UTP13 Nucleolar protein component of the small
           subunit (SSU) processome containing the U3 snoRNA that
           is involved in processing of pre-18S rRNA
          Length = 808

 Score = 48.9 bits (115), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 45/161 (27%), Positives = 75/161 (46%), Gaps = 28/161 (17%)

Query: 203 DCQWHCFNTNMFGSVSEDSTLQLFDKRNGG-KSDVKISSKGQYNSIAFSGFSENLFAAAG 261
           D ++ CF        S+   L++FD R G     +KISS    + +  S  +  L A  G
Sbjct: 71  DGRYLCF-------ASQAQLLKIFDLREGKIVRSMKISSP---SYVVDSDSTSTLLAIGG 120

Query: 262 TTNNIYLYDIRNTGKILHSMTGHEEPVTSLEFSNDKDG---ILISGSSDRRVIMWDLFE- 317
           T  +I + D+ N G + HS+ GH   ++S++F  +++G   +L SG ++  V +WDL + 
Sbjct: 121 TDGSITVVDVEN-GYVTHSLKGHGGTISSVKFYGEQNGEVWLLASGDTNGMVKIWDLVKR 179

Query: 318 --IGAEQQPDEADDGL----------PEVMMIHAGSRSAIN 346
             I   Q+   A  G+           E+ +I  G    IN
Sbjct: 180 KCIHTVQEHTAAVRGIDFHESKNNDESELFLISGGRDDVIN 220

>AER263C Chr5 complement(1118228..1119769) [1542 bp, 513 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YCR072C
          Length = 513

 Score = 48.9 bits (115), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 69/298 (23%), Positives = 111/298 (37%), Gaps = 94/298 (31%)

Query: 103 AHDGEINRARYMPQNTNIIATVNGEGTIFIYDCSRDKQSALLSTLKYHKDNAYGLAFNPN 162
            H   I  + + P  ++ + T  G+ T  I+DC  D Q+ L  TLK H +    +A++  
Sbjct: 139 GHGATILCSAFAPHTSSRMVTGAGDNTARIWDC--DTQTPLC-TLKGHSNWVLCVAWS-- 193

Query: 163 AEGELIS-GSDDSTIALWDATNDK----------------------LKQP---------- 189
           A+GE+I+ GS D+TI LWD+   +                      L +P          
Sbjct: 194 ADGEVIATGSMDATIRLWDSEKGQSLGDALRGHTKWITSLSWEPIHLVKPGEKPRLASAS 253

Query: 190 ----IQEWTTS----------HSDIVNDCQWHCFNTNMFGSVSEDSTLQLFDKRNGGKS- 234
               I+ W T+          H+  V+  +W     N+  S S D T++ +D   GGK  
Sbjct: 254 KDGTIKIWDTTRRVCIYTLSGHTSSVSCIKWG--GRNVLYSASHDRTVRCWDMAAGGKCI 311

Query: 235 -------------------------------------DVKISSKGQYNSIAF-SGFSENL 256
                                                D +  +   Y  +A  +G  E L
Sbjct: 312 NILKSHAHWVNHLSLSTDYALRMGPFDHTGTKPASPEDAQARALRNYEKVAKKNGTMEEL 371

Query: 257 FAAAGTTNNIYLYDIRNTGKILHSMTGHEEPVTSLEFSNDKDGILISGSSDRRVIMWD 314
                    +YL++     K +  MTGH++ V  + FS D   I +S S D  + +WD
Sbjct: 372 MVTGSDDFTMYLWNPLKGSKPILRMTGHQKLVNHVAFSPDGRYI-VSASFDNSIKLWD 428

 Score = 40.8 bits (94), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 41/183 (22%), Positives = 78/183 (42%), Gaps = 17/183 (9%)

Query: 145 STLKYHKDNAYGLAFNPNAEGELISGSDDSTIALWDATNDKLKQPIQEWTTSHSDIVNDC 204
           S +  H       AF P+    +++G+ D+T  +WD      + P+      HS+ V   
Sbjct: 135 SAIAGHGATILCSAFAPHTSSRMVTGAGDNTARIWDCDT---QTPLCT-LKGHSNWVLCV 190

Query: 205 QWHCFNTNMFGSVSEDSTLQLFDKRNGG------KSDVKISSKGQYNSIAFSGFSEN-LF 257
            W   +  +  + S D+T++L+D   G       +   K  +   +  I      E    
Sbjct: 191 AWSA-DGEVIATGSMDATIRLWDSEKGQSLGDALRGHTKWITSLSWEPIHLVKPGEKPRL 249

Query: 258 AAAGTTNNIYLYDIRNTGKI-LHSMTGHEEPVTSLEFSNDKDGILISGSSDRRVIMWDLF 316
           A+A     I ++D   T ++ +++++GH   V+ +++      +L S S DR V  WD+ 
Sbjct: 250 ASASKDGTIKIWD--TTRRVCIYTLSGHTSSVSCIKWGGRN--VLYSASHDRTVRCWDMA 305

Query: 317 EIG 319
             G
Sbjct: 306 AGG 308

 Score = 32.0 bits (71), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 21/84 (25%), Positives = 43/84 (51%), Gaps = 5/84 (5%)

Query: 103 AHDGEINRARYMPQNTNIIATVNGEGTIFIYDCSRDKQSALLSTLKYHKDNAYGLAFNPN 162
            H   +N   + P    I+ + + + +I ++D  RD +   ++T + H  + Y +A++ +
Sbjct: 398 GHQKLVNHVAFSPDGRYIV-SASFDNSIKLWD-GRDGK--FIATFRGHVASVYQVAWSSD 453

Query: 163 AEGELISGSDDSTIALWDATNDKL 186
               L+S S D+T+ +WD    KL
Sbjct: 454 CR-LLVSCSKDTTLKVWDVKTRKL 476

>KNAG0B01610 Chr2 (294433..296457) [2025 bp, 674 aa] {ON} Anc_1.247
           YKR036C
          Length = 674

 Score = 48.9 bits (115), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 49/207 (23%), Positives = 95/207 (45%), Gaps = 31/207 (14%)

Query: 114 MPQNTNIIATVNGEGTIFIYDCSRDKQS----------ALLSTLKYHKDNAYGLAFNPNA 163
           M  N N++AT + + T+ I++ S+  QS          + + + + H D    L+ N N 
Sbjct: 425 MDNNYNMLATGSRDATLKIWNVSQAVQSYGIDPDTVADSCIFSFQEHSDEVTALSINFN- 483

Query: 164 EGELISGSDDSTIALWDATNDKLKQPIQEWTTSHSDIVNDCQWHCFNTNMFGSV------ 217
              L+SGS D T+  WD    K    +Q    S  + ++       +  + G++      
Sbjct: 484 --HLLSGSQDRTVRQWDMNTGKC---VQTLDVSFVNALSHSLVTTLDPPVVGALKSYDVA 538

Query: 218 ----SEDSTLQLFDKRNGGKSDVKISSKGQYNSIAFSGFSENLFAAAGTTNNIYLYDIRN 273
               ++D  ++L+D R G   ++  + KG   +I+   F  +        N++ ++D+R 
Sbjct: 539 LATGTKDGMVRLWDLRTG---EIVRTLKGHTGAISCLKFDLHNLITGSLDNSVRVWDLR- 594

Query: 274 TGKILHSMTGHEEPVTSLEFSNDKDGI 300
           +G  L +   ++ PVTSL+F ++K  I
Sbjct: 595 SGSTLDAFR-YQSPVTSLDFDDEKVAI 620

 Score = 47.4 bits (111), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 56/211 (26%), Positives = 97/211 (45%), Gaps = 39/211 (18%)

Query: 129 TIFIYDCSRDKQSALLSTLKYHKDNAYGLAFNPNAEGELISGSDDSTIALWDATNDKLKQ 188
            + ++D S++KQ  LLS    H    + +  + N    L +GS D+T+ +W+ +     Q
Sbjct: 398 VVKVWDLSKNKQIGLLSG---HLATVHCMEMDNNY-NMLATGSRDATLKIWNVS-----Q 448

Query: 189 PIQEWTTSHSDIVNDC----QWHC-------FNTNMFGSVSEDSTLQLFDKRNGGKSDVK 237
            +Q +      + + C    Q H         N N   S S+D T++ +D  N GK  V+
Sbjct: 449 AVQSYGIDPDTVADSCIFSFQEHSDEVTALSINFNHLLSGSQDRTVRQWD-MNTGKC-VQ 506

Query: 238 ISSKGQYNSIAFSGF------------SENLFAAAGTTNN-IYLYDIRNTGKILHSMTGH 284
                  N+++ S              S ++  A GT +  + L+D+R TG+I+ ++ GH
Sbjct: 507 TLDVSFVNALSHSLVTTLDPPVVGALKSYDVALATGTKDGMVRLWDLR-TGEIVRTLKGH 565

Query: 285 EEPVTSLEFSNDKDGILISGSSDRRVIMWDL 315
              ++ L+F       LI+GS D  V +WDL
Sbjct: 566 TGAISCLKFDLHN---LITGSLDNSVRVWDL 593

>KLTH0D11132g Chr4 (910259..911572) [1314 bp, 437 aa] {ON} similar
           to uniprot|Q12417 Saccharomyces cerevisiae YPL151C PRP46
           Splicing factor that is found in the Cef1p subcomplex of
           the spliceosome
          Length = 437

 Score = 48.5 bits (114), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 45/176 (25%), Positives = 81/176 (46%), Gaps = 14/176 (7%)

Query: 143 LLSTLKYHKDNAYGLAFNPNAEGELISGSDDSTIALWDATNDKLKQPIQEWTTSHSDIVN 202
           L+  +  H      +  +P       +GS+D+TI +WD  + KLK  +      H   V 
Sbjct: 117 LMRVINGHNGWVRCVCVDPVDNEWFATGSNDTTIKVWDLASGKLKLTL----AGHVMTVR 172

Query: 203 DCQWHCFNTNMFGSVSEDSTLQLFDKRNGGKSDVKISSKGQYNSIAFSGF--SENLFAAA 260
                  +  MF S SED  ++ +D     K+ V     G ++ +       + +L A+A
Sbjct: 173 SIAISQRHPLMF-SASEDKLVKCWDLE---KNTVVRDYHGHFSGVHTVDVHPTLDLIASA 228

Query: 261 GTTNNIYLYDIRNTGKILHSMTGHEEPVTSLE-FSNDKDGILISGSSDRRVIMWDL 315
           G    + L+DIR    ++ ++ GH+ P+  ++ F  D    ++SGS+D  V +WD+
Sbjct: 229 GRDAVVRLWDIRTRVPVM-TLAGHKGPINQVKCFPVDPQ--IMSGSADSTVRLWDI 281

 Score = 31.6 bits (70), Expect = 4.1,   Method: Compositional matrix adjust.
 Identities = 52/245 (21%), Positives = 98/245 (40%), Gaps = 46/245 (18%)

Query: 119 NIIATVNGEGTIFIYDCSRDKQSALLSTLKYHKDNAYGLAFNPNAEGELISGSDDSTIAL 178
           ++IA+   +  + ++D    +    + TL  HK     +   P  + +++SGS DST+ L
Sbjct: 223 DLIASAGRDAVVRLWDI---RTRVPVMTLAGHKGPINQVKCFP-VDPQIMSGSADSTVRL 278

Query: 179 WDATNDKLKQPIQEWTTSHSDIVNDCQWHCFNTNMFGSVSEDSTLQLFDKRNGGKSDVKI 238
           WD    K  + +   + S   I  +       T    S S+  + +L D +    ++ + 
Sbjct: 279 WDIRAGKAMKILTHHSKSVRAIAGNPSESSVAT---ASTSDIRSWRLQDGQL--LTNFRS 333

Query: 239 SSKGQYNSIAFSGFSENLFAAAGTTNNIYLYDIRNTGKILHSMTGHEEPVT------SLE 292
              G  N ++ +   + +  A G   ++  YD + TG     +   + P +       L 
Sbjct: 334 EDTGIINCLSVN--PDGVLFAGGDDGHLSFYDYK-TGHKFQDLPTIKVPGSLESERGILS 390

Query: 293 FSNDKDGI-LISGSSDRRVIMWDLFEIGAEQQPDEADDGLPEVMMIHAGSRSAINDISTH 351
            S D+ G+ LI+G SD+ + +W     GA Q+                          TH
Sbjct: 391 ASFDQTGLRLITGESDKSIKVWKQIP-GATQE--------------------------TH 423

Query: 352 PSIPW 356
           P++PW
Sbjct: 424 PNLPW 428

>Smik_3.172 Chr3 complement(240515..242062) [1548 bp, 515 aa] {ON}
           YCR072C (REAL)
          Length = 515

 Score = 48.5 bits (114), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 56/207 (27%), Positives = 91/207 (43%), Gaps = 28/207 (13%)

Query: 115 PQNTNIIATVNGEGTIFIYD-CSRDKQSALLSTLKYHKDNAYGLAFNPNAEGELISGSDD 173
           P +   +A+ + +GTI I+D  SR  Q     T+  H ++   + +    +G L SGS D
Sbjct: 245 PGSKPRLASSSKDGTIKIWDTVSRVCQY----TMSGHTNSVSCVKWG--GQGLLYSGSHD 298

Query: 174 STIALWDATNDKLKQPIQEWTTSHSDIVNDCQWHCFNTNMFGSVSEDSTLQL--FD---K 228
            T+ +WD               S    +N  + H    N   S+S D  L++  FD   K
Sbjct: 299 RTVRVWD-------------INSQGRCINILKSHAHWVNHL-SLSTDYALRVGAFDHTGK 344

Query: 229 RNGGKSDVKISSKGQYNSIAF-SGFSENLFAAAGTTNNIYLYDIRNTGKILHSMTGHEEP 287
           R     D +  +   Y  I   +G SE +   A     ++L++   + K +  MTGH++ 
Sbjct: 345 RPSTPEDAQKKALENYEKICKKNGNSEEMMVTASDDFTMFLWNPLKSTKPVARMTGHQKL 404

Query: 288 VTSLEFSNDKDGILISGSSDRRVIMWD 314
           V  + FS D   I +S S D  + +WD
Sbjct: 405 VNHVAFSPDGRYI-VSASFDNSIKLWD 430

 Score = 42.7 bits (99), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 42/184 (22%), Positives = 80/184 (43%), Gaps = 19/184 (10%)

Query: 145 STLKYHKDNAYGLAFNPNAEGELISGSDDSTIALWDATNDKLKQPIQEWTTSHSDIVNDC 204
           S +  H       AF P+    +++G+ D+T  +WD         ++     H + V   
Sbjct: 137 SAIAGHGSTILCSAFAPHTSSRMVTGAGDNTARIWDCDTQTPMHTLK----GHYNWVLCV 192

Query: 205 QWHCFNTNMFGSVSEDSTLQLFDKRNG--------GKSDVKISSKGQYNSIAFSGFSENL 256
            W   +  +  + S D+T++L+D + G        G S    S   +   +   G S+  
Sbjct: 193 SWS-PDGEVIATGSMDNTIRLWDPKTGECLGDALRGHSKWITSLSWEPIHLVKPG-SKPR 250

Query: 257 FAAAGTTNNIYLYDIRNTGKIL-HSMTGHEEPVTSLEFSNDKDGILISGSSDRRVIMWDL 315
            A++     I ++D     ++  ++M+GH   V+ +++     G+L SGS DR V +WD+
Sbjct: 251 LASSSKDGTIKIWD--TVSRVCQYTMSGHTNSVSCVKWGG--QGLLYSGSHDRTVRVWDI 306

Query: 316 FEIG 319
              G
Sbjct: 307 NSQG 310

 Score = 33.1 bits (74), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 22/84 (26%), Positives = 43/84 (51%), Gaps = 5/84 (5%)

Query: 103 AHDGEINRARYMPQNTNIIATVNGEGTIFIYDCSRDKQSALLSTLKYHKDNAYGLAFNPN 162
            H   +N   + P    I++  + + +I ++D  RD +   +ST + H  + Y +A++ +
Sbjct: 400 GHQKLVNHVAFSPDGRYIVS-ASFDNSIKLWD-GRDGK--FISTFRGHVASVYQVAWSSD 455

Query: 163 AEGELISGSDDSTIALWDATNDKL 186
               L+S S D+T+ +WD    KL
Sbjct: 456 CR-LLVSCSKDTTLKVWDVRTRKL 478

>NCAS0E02840 Chr5 (558336..560159) [1824 bp, 607 aa] {ON} Anc_7.356
           YLR196W
          Length = 607

 Score = 48.5 bits (114), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 46/186 (24%), Positives = 83/186 (44%), Gaps = 24/186 (12%)

Query: 149 YHKDNAYGLAFNPNAEGELISGSDDSTIALWDATNDKLKQPIQEWTTSHSDIVNDCQWHC 208
           +H D    L+ N      L S S D T+ LWD       + +   +  ++  V+  +WH 
Sbjct: 321 HHTDAVLSLSHNKQFRAVLASTSADHTVKLWDLNTATAARSLA--SIHNNKNVSSSEWHV 378

Query: 209 FNTNMFGSVSEDSTLQLFDKRNGGKSDVKISSKGQYNS---------IAFSGFS-ENLFA 258
            N ++  +   DS + L        SDV+IS + Q +          I  + F+ EN+  
Sbjct: 379 SNGSILLTGGYDSRIAL--------SDVRISDEKQMSKYWSVMPGEEIECTTFADENIIL 430

Query: 259 AAGTTNNIYLYDIRN--TGKILHSMTGHEEPVTSLEFSNDKDGILISGS-SDRRVIMWDL 315
                 NIY +DIRN    K + ++  H+  ++SL  +    G++ +G+  ++ V +W  
Sbjct: 431 CGTDAGNIYSFDIRNNENSKPVWTLKAHDAGISSLSCNKFIPGLMSTGAMGEKTVKLWK- 489

Query: 316 FEIGAE 321
           F +G +
Sbjct: 490 FPLGGD 495

>Suva_10.292 Chr10 (516694..518436) [1743 bp, 580 aa] {ON} YLR196W
           (REAL)
          Length = 580

 Score = 48.5 bits (114), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 39/172 (22%), Positives = 82/172 (47%), Gaps = 11/172 (6%)

Query: 149 YHKDNAYGLAFNPNAEGELISGSDDSTIALWDATNDKLKQPIQEWTTSHSDIVNDCQWHC 208
           +H D    +A N +    L S S D T+ LWD  +    + +    ++ +  V+  +WH 
Sbjct: 288 HHTDAVLSMAHNRHFRSVLASTSADHTVKLWDLNSGSAARSLDSIHSNKN--VSSSEWHM 345

Query: 209 FNTNMFGSVSEDSTLQLFDKRNGGKSDV----KISSKGQYNSIAFSGFSENLFAAAGTTN 264
            N ++  +   DS + L D R   +S +     + S  +  ++ F+   EN+      + 
Sbjct: 346 LNGSVLLTGGYDSRVALTDVRISDESQMSKHWSVMSGEEIETVTFA--DENIILCGTDSG 403

Query: 265 NIYLYDIRN--TGKILHSMTGHEEPVTSLEFSNDKDGILISGS-SDRRVIMW 313
           N+Y +DIRN  + K + ++  H+  +++L  +    G++ +G+  ++ V +W
Sbjct: 404 NVYSFDIRNNESRKPVWTLKAHDAGISTLCSNKFIPGMMSTGAMGEKTVKLW 455

>Suva_13.295 Chr13 complement(480518..480940,481217..481753) [960
           bp, 319 aa] {ON} YMR116C (REAL)
          Length = 319

 Score = 47.8 bits (112), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 62/242 (25%), Positives = 100/242 (41%), Gaps = 31/242 (12%)

Query: 143 LLSTLKYHKDNAYGLAFNPNAEGELISGSDDSTIALWDATND--KLKQPIQEWTTSHSDI 200
           L  TL+ H      LA +      L+S S D T+  W  T D  K   P++ +   HS I
Sbjct: 9   LRGTLEGHNGWVTSLATSAGQPNLLLSASRDKTLISWKLTGDDQKFGVPVRSF-KGHSHI 67

Query: 201 VNDCQWHCFNTNMFGSVSEDSTLQLFDKRNGGKSDVKISSKGQYNSIAFSGFSENLFAAA 260
           V DC           S S D TL+L+D   G      +  K    S+       ++  + 
Sbjct: 68  VQDCTLTADGAYAL-SASWDKTLRLWDVATGETYQRFVGHKSDVMSVDIDK-KASMIISG 125

Query: 261 GTTNNIYLYDIRNTGKILHSMTGHEEPVTSL-----EFSNDKDGILISGSSDRRVIMWDL 315
                I ++ I+  G+ L ++ GH + V+ +     E ++D    +IS  +D+ V  W+L
Sbjct: 126 SRDKTIKVWTIK--GQCLATLLGHNDWVSQVRVVPNEKADDDSVTIISAGNDKMVKAWNL 183

Query: 316 --FEIGAEQQPDEADDGLPEVMMIHAGSRSAINDISTHPSIPWLNASVEENNIVQVWKCS 373
             F+I       EAD           G  S IN ++  P    L AS  ++  + +W  +
Sbjct: 184 NQFQI-------EAD---------FIGHNSNINTLTASPDGT-LIASAGKDGEIMLWNLA 226

Query: 374 SK 375
           +K
Sbjct: 227 AK 228

>Skud_13.275 Chr13 complement(474770..475192,475471..476007) [960
           bp, 319 aa] {ON} YMR116C (REAL)
          Length = 319

 Score = 47.8 bits (112), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 62/242 (25%), Positives = 100/242 (41%), Gaps = 31/242 (12%)

Query: 143 LLSTLKYHKDNAYGLAFNPNAEGELISGSDDSTIALWDATND--KLKQPIQEWTTSHSDI 200
           L  TL+ H      LA +      L+S S D T+  W  T D  K   P++ +   HS I
Sbjct: 9   LRGTLEGHNGWVTSLATSAGQPNLLLSASRDKTLISWKLTGDDQKFGVPVRSF-KGHSHI 67

Query: 201 VNDCQWHCFNTNMFGSVSEDSTLQLFDKRNGGKSDVKISSKGQYNSIAFSGFSENLFAAA 260
           V DC           S S D TL+L+D   G      +  K    S+       ++  + 
Sbjct: 68  VQDCTLTADGAYAL-SASWDKTLRLWDVATGETYQRFVGHKSDVMSVDIDK-KASMIISG 125

Query: 261 GTTNNIYLYDIRNTGKILHSMTGHEEPVTSL-----EFSNDKDGILISGSSDRRVIMWDL 315
                I ++ I+  G+ L ++ GH + V+ +     E ++D    +IS  +D+ V  W+L
Sbjct: 126 SRDKTIKVWTIK--GQCLATLLGHNDWVSQVRVVPNEKADDDSVTIISAGNDKMVKAWNL 183

Query: 316 --FEIGAEQQPDEADDGLPEVMMIHAGSRSAINDISTHPSIPWLNASVEENNIVQVWKCS 373
             F+I       EAD           G  S IN ++  P    L AS  ++  + +W  +
Sbjct: 184 NQFQI-------EAD---------FIGHNSNINTLTASPDGT-LIASAGKDGEIMLWNLA 226

Query: 374 SK 375
           +K
Sbjct: 227 AK 228

>Smik_13.305 Chr13 complement(482912..483334,483612..484148) [960
           bp, 319 aa] {ON} YMR116C (REAL)
          Length = 319

 Score = 47.8 bits (112), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 62/242 (25%), Positives = 100/242 (41%), Gaps = 31/242 (12%)

Query: 143 LLSTLKYHKDNAYGLAFNPNAEGELISGSDDSTIALWDATND--KLKQPIQEWTTSHSDI 200
           L  TL+ H      LA +      L+S S D T+  W  T D  K   P++ +   HS I
Sbjct: 9   LRGTLEGHNGWVTSLATSAGQPNLLLSASRDKTLISWKLTGDDQKFGVPVRSF-KGHSHI 67

Query: 201 VNDCQWHCFNTNMFGSVSEDSTLQLFDKRNGGKSDVKISSKGQYNSIAFSGFSENLFAAA 260
           V DC           S S D TL+L+D   G      +  K    S+       ++  + 
Sbjct: 68  VQDCTLTADGAYAL-SASWDKTLRLWDVATGETYQRFVGHKSDVMSVDIDK-KASMIISG 125

Query: 261 GTTNNIYLYDIRNTGKILHSMTGHEEPVTSL-----EFSNDKDGILISGSSDRRVIMWDL 315
                I ++ I+  G+ L ++ GH + V+ +     E ++D    +IS  +D+ V  W+L
Sbjct: 126 SRDKTIKVWTIK--GQCLATLLGHNDWVSQVRVVPNEKADDDSVTIISAGNDKMVKAWNL 183

Query: 316 --FEIGAEQQPDEADDGLPEVMMIHAGSRSAINDISTHPSIPWLNASVEENNIVQVWKCS 373
             F+I       EAD           G  S IN ++  P    L AS  ++  + +W  +
Sbjct: 184 NQFQI-------EAD---------FIGHNSNINTLTASPDGT-LIASAGKDGEIMLWNLA 226

Query: 374 SK 375
           +K
Sbjct: 227 AK 228

>YMR116C Chr13 complement(499456..499878,500152..500688) [960 bp,
           319 aa] {ON}  ASC1G-protein beta subunit and guanine
           nucleotide dissociation inhibitor for Gpa2p; ortholog of
           RACK1 that inhibits translation; core component of the
           small (40S) ribosomal subunit; represses Gcn4p in the
           absence of amino acid starvation
          Length = 319

 Score = 47.8 bits (112), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 62/242 (25%), Positives = 100/242 (41%), Gaps = 31/242 (12%)

Query: 143 LLSTLKYHKDNAYGLAFNPNAEGELISGSDDSTIALWDATND--KLKQPIQEWTTSHSDI 200
           L  TL+ H      LA +      L+S S D T+  W  T D  K   P++ +   HS I
Sbjct: 9   LRGTLEGHNGWVTSLATSAGQPNLLLSASRDKTLISWKLTGDDQKFGVPVRSF-KGHSHI 67

Query: 201 VNDCQWHCFNTNMFGSVSEDSTLQLFDKRNGGKSDVKISSKGQYNSIAFSGFSENLFAAA 260
           V DC           S S D TL+L+D   G      +  K    S+       ++  + 
Sbjct: 68  VQDCTLTADGAYAL-SASWDKTLRLWDVATGETYQRFVGHKSDVMSVDIDK-KASMIISG 125

Query: 261 GTTNNIYLYDIRNTGKILHSMTGHEEPVTSL-----EFSNDKDGILISGSSDRRVIMWDL 315
                I ++ I+  G+ L ++ GH + V+ +     E ++D    +IS  +D+ V  W+L
Sbjct: 126 SRDKTIKVWTIK--GQCLATLLGHNDWVSQVRVVPNEKADDDSVTIISAGNDKMVKAWNL 183

Query: 316 --FEIGAEQQPDEADDGLPEVMMIHAGSRSAINDISTHPSIPWLNASVEENNIVQVWKCS 373
             F+I       EAD           G  S IN ++  P    L AS  ++  + +W  +
Sbjct: 184 NQFQI-------EAD---------FIGHNSNINTLTASPDGT-LIASAGKDGEIMLWNLA 226

Query: 374 SK 375
           +K
Sbjct: 227 AK 228

>Kpol_1028.23 s1028 (63032..65266) [2235 bp, 744 aa] {ON}
           (63032..65266) [2235 nt, 745 aa]
          Length = 744

 Score = 48.5 bits (114), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 49/212 (23%), Positives = 96/212 (45%), Gaps = 28/212 (13%)

Query: 120 IIATVNGEGTIFIYDCSRDKQSALLSTLKYHKDNAYGLAFNPNAEGELISGSDDSTIALW 179
            +AT   +  I I+D ++ K   ++  L+ H+ + Y L + P+ + +L+SGS D T+ +W
Sbjct: 476 FLATGAEDRLIRIWDIAQKK---IVMVLQGHEQDIYSLDYFPSGD-KLVSGSGDRTVRIW 531

Query: 180 DATNDKLKQPIQEWTTSHSDIVNDCQWHCFNTNMFGSVSEDSTLQLFDKRNG-------G 232
           D  N +        T S  D V        +     + S D  ++++D   G        
Sbjct: 532 DLRNGQCS-----LTLSIEDGVTTVAVSPGDGKYIAAGSLDRAVRVWDSETGFLVERLDS 586

Query: 233 KSDVKISSKGQYNSIAFSGFSENLFAAAGTTNNIYLYDIRN----------TGKILHSMT 282
           ++++    K    S+ F+    N+ + +    ++ L+++R            G    + T
Sbjct: 587 ENELGTGHKDSVYSVVFTRDGNNVVSGS-LDRSVKLWNLRGDNNQDVKPNVPGTCEVTYT 645

Query: 283 GHEEPVTSLEFSNDKDGILISGSSDRRVIMWD 314
           GH++ V S+  + + D  ++SGS DR V+ WD
Sbjct: 646 GHKDFVLSVATTQN-DEYILSGSKDRGVLFWD 676

 Score = 47.8 bits (112), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 42/166 (25%), Positives = 80/166 (48%), Gaps = 16/166 (9%)

Query: 157 LAFNPNAEGELISGSDDSTIALWDATNDKLKQPIQEWTTSHSDIVNDCQWHCFNTNMFGS 216
           + F+P+ +  L +G++D  I +WD    K+   +Q     H   +    +      +  S
Sbjct: 468 VCFSPDGKF-LATGAEDRLIRIWDIAQKKIVMVLQ----GHEQDIYSLDYFPSGDKLV-S 521

Query: 217 VSEDSTLQLFDKRNGGKSDVKISSKGQYNSIAFSGFSENLFAAAGTTNNIYLYDIRNTGK 276
            S D T++++D RNG +  + +S +    ++A S       AA      + ++D   TG 
Sbjct: 522 GSGDRTVRIWDLRNG-QCSLTLSIEDGVTTVAVSPGDGKYIAAGSLDRAVRVWD-SETGF 579

Query: 277 ILHSM-------TGHEEPVTSLEFSNDKDGILISGSSDRRVIMWDL 315
           ++  +       TGH++ V S+ F+ D + + +SGS DR V +W+L
Sbjct: 580 LVERLDSENELGTGHKDSVYSVVFTRDGNNV-VSGSLDRSVKLWNL 624

 Score = 40.0 bits (92), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 29/73 (39%), Positives = 42/73 (57%), Gaps = 9/73 (12%)

Query: 246 SIAFSGFSENLFAAAGTTNN-IYLYDIRNTGKILHSMTGHEEPVTSLEF--SNDKDGILI 302
           S+ FS   +  F A G  +  I ++DI    KI+  + GHE+ + SL++  S DK   L+
Sbjct: 467 SVCFS--PDGKFLATGAEDRLIRIWDIAQK-KIVMVLQGHEQDIYSLDYFPSGDK---LV 520

Query: 303 SGSSDRRVIMWDL 315
           SGS DR V +WDL
Sbjct: 521 SGSGDRTVRIWDL 533

>NDAI0E02400 Chr5 (499223..500527) [1305 bp, 434 aa] {ON} Anc_8.672
          Length = 434

 Score = 48.1 bits (113), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 47/197 (23%), Positives = 87/197 (44%), Gaps = 24/197 (12%)

Query: 157 LAFNPNAEGELISGSDDSTIALWDATNDKLKQPIQEWTTSHSDIVNDCQWHCFNTNMFGS 216
           +A +P      ++GS+D+TI +WD     LK  +      H+  V D      +  MF S
Sbjct: 128 VAVDPIDNEWFVTGSNDATIKIWDLAKGHLKLTL----AGHAMTVRDIAISERHPYMF-S 182

Query: 217 VSEDSTLQLFD-KRNGGKSDVKISSKGQYNSIAFSGFSENLFAAAGTTNNIYLYDIRNTG 275
            SED  ++ +D ++N    D      G ++         +L A AG  + + L+DIR   
Sbjct: 183 ASEDKLVKCWDLEKNTAIRDYHGHLSGVHSVDIHPTL--DLIATAGRDSVVRLWDIRARV 240

Query: 276 KILHSMTGHEEPVTSLEFSNDKDGILISGSSDRRVIMWDLFEIGAEQQPDEADDGLPEVM 335
            ++ ++ GH+ P+  +      D  ++S S+D  + +WD+              G    +
Sbjct: 241 SVM-TLIGHKSPINKVH-CLPVDPQIVSCSTDATIRLWDIIA------------GKSRKV 286

Query: 336 MIHAGSRSAINDISTHP 352
           + H   + ++ D+S HP
Sbjct: 287 LTH--HKKSVRDMSFHP 301

>Kpol_1028.41 s1028 (100720..102258) [1539 bp, 512 aa] {ON}
           (100720..102258) [1539 nt, 513 aa]
          Length = 512

 Score = 48.1 bits (113), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 53/200 (26%), Positives = 84/200 (42%), Gaps = 26/200 (13%)

Query: 121 IATVNGEGTIFIYDCSRDKQSALLSTLKYHKDNAYGLAFNPNAEGELISGSDDSTIALWD 180
           +AT + +GTI I+D +R        TL  H  +   + +    +  L SGS D T+ +WD
Sbjct: 248 LATSSKDGTIKIWDTTR---RVCTMTLSGHTSSVSCVKWG--GQNFLYSGSHDKTVRVWD 302

Query: 181 ATNDKLKQPIQEWTTSHSDIVNDCQWHCFNTNMFGSVSEDSTLQL--FD---KRNGGKSD 235
             N                 +N  + H    N   S+S D  L++  FD   ++      
Sbjct: 303 MKNS-------------GRCINILKNHAHWVNHL-SLSTDYALRVGPFDYTGEQPATPEI 348

Query: 236 VKISSKGQYNSIA-FSGFSENLFAAAGTTNNIYLYDIRNTGKILHSMTGHEEPVTSLEFS 294
            K  +   Y  +A  +G    L   A     ++L+D   T K +  MTGH++ V  + FS
Sbjct: 349 AKAKALKNYEKVAKRNGKETELMVTASDDFTMFLWDPLRTTKPIARMTGHQKLVNHVAFS 408

Query: 295 NDKDGILISGSSDRRVIMWD 314
            D   I +S S D  + +WD
Sbjct: 409 PDGRHI-VSASFDNSIKLWD 427

 Score = 39.3 bits (90), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 39/184 (21%), Positives = 80/184 (43%), Gaps = 19/184 (10%)

Query: 145 STLKYHKDNAYGLAFNPNAEGELISGSDDSTIALWDATNDKLKQPIQEWTTSHSDIVNDC 204
           S +  H       AF P+    +++G+ D+T  +WD      + P+   T  H+ ++  C
Sbjct: 134 SAIAGHGSTILCSAFAPHTSSRMVTGAGDNTARIWDCDT---QTPMATLTGHHNWVL--C 188

Query: 205 QWHCFNTNMFGSVSEDSTLQLFDKRNGGKSDVKISSKGQY-NSIAFSGF------SENLF 257
                +  +  + S D+T++L++ + G      +   G++  S+++              
Sbjct: 189 VSWSPDGELIATGSMDNTVRLWESKTGKPFGDALRGHGKWITSLSWEPIHLVTPGERPRL 248

Query: 258 AAAGTTNNIYLYDIRNTGKILHSMT--GHEEPVTSLEFSNDKDGILISGSSDRRVIMWDL 315
           A +     I ++D   T + + +MT  GH   V+ +++       L SGS D+ V +WD+
Sbjct: 249 ATSSKDGTIKIWD---TTRRVCTMTLSGHTSSVSCVKWGGQN--FLYSGSHDKTVRVWDM 303

Query: 316 FEIG 319
              G
Sbjct: 304 KNSG 307

 Score = 33.9 bits (76), Expect = 0.71,   Method: Compositional matrix adjust.
 Identities = 22/84 (26%), Positives = 45/84 (53%), Gaps = 5/84 (5%)

Query: 103 AHDGEINRARYMPQNTNIIATVNGEGTIFIYDCSRDKQSALLSTLKYHKDNAYGLAFNPN 162
            H   +N   + P   +I++  + + +I ++D SRD +   ++T + H  + Y +A++ +
Sbjct: 397 GHQKLVNHVAFSPDGRHIVS-ASFDNSIKLWD-SRDGK--FITTFRGHVASVYQVAWSSD 452

Query: 163 AEGELISGSDDSTIALWDATNDKL 186
               L+S S D+T+ +WD    KL
Sbjct: 453 CR-LLVSCSKDTTLKVWDIRTRKL 475

>KLTH0E09394g Chr5 complement(853592..855160) [1569 bp, 522 aa] {ON}
           highly similar to uniprot|Q04225 Saccharomyces
           cerevisiae YMR131C RRB1 RiboSome Assembly 2
          Length = 522

 Score = 48.1 bits (113), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 80/400 (20%), Positives = 152/400 (38%), Gaps = 54/400 (13%)

Query: 25  PLLYDFVSETRLTWPSLTLQWLPGDKTSTR----QHLILGTLTSGA---ETDYLKIAALD 77
           P +Y+ +    L WP L+L  +P    S R    Q L+L T T  +   + + L +    
Sbjct: 126 PTVYEMLHNVNLPWPCLSLDIVPDKLGSERRNYPQSLLLTTATQASKKKDNELLLLKMSQ 185

Query: 78  LPDEIIIGXXXXXXXXXXXXXXXXFAHDGE-------INRARYMP----QNTNIIATVNG 126
           L   ++                     + E        NR +  P        + AT++ 
Sbjct: 186 LAKTLVKDDNNEEEDDDDEDEDQDPIVENENIPLKDTTNRLKVSPFASESPEKLTATMSE 245

Query: 127 EGTIFIYDCSRDKQS-------------ALLSTLKYHKD-NAYGLAFNP-NAEGELISGS 171
            G ++I+D     ++               + T++ H +   Y L ++P N  G L++G 
Sbjct: 246 NGEVYIFDLGPQVKAFEIPGYQLPKTAKKPIHTVRSHGNVEGYALDWSPLNKSGSLLTGD 305

Query: 172 DDSTIALWDATNDKLKQPIQEWTTSHSDIVNDCQWHCFNTNMFGSVSEDSTLQLFDKRNG 231
               + L      K       ++  ++  + D Q+      +F S   D  ++++D R+ 
Sbjct: 306 CSGRVYLTQRHTSKWITDKTAFSAGNNQSIEDIQFSRTEATVFASCGCDGYIRIWDTRSK 365

Query: 232 GKSDVKISSKGQYNSIAFSGFSENL--FAAAGTTNNIY-LYDIRNTGKILHSMTG----- 283
            K    IS K     +    ++E +    A+G  N  + ++D+R       + T      
Sbjct: 366 -KHKPAISVKASATDVNVISWNEKIGYLLASGDDNGSWGVWDLRQFSPNTAASTSPVAQY 424

Query: 284 --HEEPVTSLEFSNDKDGILISGSSDRRVIMWDL-FEIGAEQQPDEADDGL------PEV 334
             H+  +TS+ F+   D I+   S D  V +WDL  E   E+   +A +        P++
Sbjct: 425 NFHKGAITSISFNPLDDSIIAVASEDNTVSLWDLSVEADDEEIKQQAAETRELQEIPPQL 484

Query: 335 MMIHAGSRSAINDISTHPSIPWLNASVEENNIVQVWKCSS 374
           + +H   +  + D+  H  IP    S   + +  +WK  S
Sbjct: 485 LFVHW--QKEVKDVKWHKQIPGCLVSTGTDGL-NIWKTIS 521

>TPHA0B00590 Chr2 complement(134906..136672) [1767 bp, 588 aa] {ON}
           Anc_4.309 YLR429W
          Length = 588

 Score = 48.1 bits (113), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 45/177 (25%), Positives = 80/177 (45%), Gaps = 21/177 (11%)

Query: 159 FNPNAEGELISGSDDSTIALWDATND-------------KLKQPIQEWTTSHSDIVNDCQ 205
           F+P  + +L S +DDS IA+W+   D             K+ +P++   + H   V    
Sbjct: 89  FDPFDDKKLASSADDSKIAIWEIPEDYTLKSYVDEDGEPKVIKPVK-ILSGHKRKVGHIL 147

Query: 206 WHCFNTNMFGSVSEDSTLQLFDKRNGGKSDVKISSKGQYNSIAFSGFSENLFAAAGTTNN 265
           +H    N+  S S D T++++D  N  K  + ++      S++FS ++ N  A       
Sbjct: 148 YHPVAQNVLASSSLDYTVKIWDIEN-EKDMLTLTHPDMVTSMSFS-YNGNFLATVARDKK 205

Query: 266 IYLYDIRNTGKILHSMTGH----EEPVTSLEFSNDKDGILISGSSDRRVIMWDLFEI 318
           + ++D+R  GKI+     H     + V  L  S+       S  SDR++ +WD F +
Sbjct: 206 LRVWDVRE-GKIVSEGPAHTGAKNQRVVWLGNSDRLATTGFSRLSDRQLGVWDAFNL 261

 Score = 45.4 bits (106), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 32/120 (26%), Positives = 55/120 (45%), Gaps = 16/120 (13%)

Query: 144 LSTLKYHKDNAYGLAFNPNAEGELISGSDDSTIALWDATNDKLKQPIQEWTTSHSDIVND 203
           +  L  HK     + ++P A+  L S S D T+ +WD  N+K        T +H D+V  
Sbjct: 133 VKILSGHKRKVGHILYHPVAQNVLASSSLDYTVKIWDIENEK-----DMLTLTHPDMVTS 187

Query: 204 CQWHCFNTNMFGSVSEDSTLQLFDKRNG----------GKSDVKISSKGQYNSIAFSGFS 253
             +  +N N   +V+ D  L+++D R G          G  + ++   G  + +A +GFS
Sbjct: 188 MSF-SYNGNFLATVARDKKLRVWDVREGKIVSEGPAHTGAKNQRVVWLGNSDRLATTGFS 246

>Kpol_1072.17 s1072 complement(40550..41851) [1302 bp, 433 aa] {ON}
           complement(40550..41851) [1302 nt, 434 aa]
          Length = 433

 Score = 48.1 bits (113), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 48/176 (27%), Positives = 83/176 (47%), Gaps = 12/176 (6%)

Query: 143 LLSTLKYHKDNAYGLAFNPNAEGELISGSDDSTIALWDATNDKLKQPIQEWTTSHSDI-V 201
           L+  +  H      +A  P       +GS D+T+ +WD  +  LK  +        DI V
Sbjct: 113 LMRVINGHMGWVNCVASEPVENTWFATGSTDTTVKVWDLVSGHLKLTLSGHVMPVRDITV 172

Query: 202 NDCQWHCFNTNMFGSVSEDSTLQLFD-KRNGGKSDVKISSKGQYNSIAFSGFSENLFAAA 260
           +D   + F      S SED  ++ +D ++N    D      G Y S+A    + +L A A
Sbjct: 173 SDRHPYLF------SASEDKLVKCWDLEKNMAIRDYHGHLSGVY-SVAIHP-TLDLIATA 224

Query: 261 GTTNNIYLYDIRNTGKILHSMTGHEEPVTSLEFSNDKDGILISGSSDRRVIMWDLF 316
           G  + + L+DIR+  +++ ++ GH+ P+  +  S   D  +IS S+D  V +WD+ 
Sbjct: 225 GRDSVVRLWDIRSRMEVM-TLIGHKGPINKVR-SLPVDPQIISCSTDATVHLWDIV 278

 Score = 36.2 bits (82), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 32/132 (24%), Positives = 59/132 (44%), Gaps = 11/132 (8%)

Query: 102 FAHDGEINRARYMPQNTNIIATVNGEGTIFIYDCSRDKQSALLSTLKYHKDNAYGLAFNP 161
             H G IN+ R +P +  II + + + T+ ++D    K + +L+   +HK +   +A NP
Sbjct: 245 IGHKGPINKVRSLPVDPQII-SCSTDATVHLWDIVAGKSAKVLT---HHKRSVRDIALNP 300

Query: 162 NAEGELISGSDDSTIALWDATNDKLKQPIQEWTTSHSDIVNDCQWHCFNTNMFGSVSEDS 221
            +E  L S   D  I  W      L   +  + +  S I+N          +  +  ++ 
Sbjct: 301 -SEFSLASACTDD-IRSWRLPEGSL---LTNFESESSGIINSLS--INQDGVLAAGCDNG 353

Query: 222 TLQLFDKRNGGK 233
           TL  +D ++G K
Sbjct: 354 TLAFYDFKSGHK 365

 Score = 31.2 bits (69), Expect = 5.4,   Method: Compositional matrix adjust.
 Identities = 49/229 (21%), Positives = 90/229 (39%), Gaps = 39/229 (17%)

Query: 119 NIIATVNGEGTIFIYDCSRDKQSALLSTLKYHKDNAYGLAFNPNAEGELISGSDDSTIAL 178
           ++IAT   +  + ++D     +   L   K   +    L  +P    ++IS S D+T+ L
Sbjct: 219 DLIATAGRDSVVRLWDIRSRMEVMTLIGHKGPINKVRSLPVDP----QIISCSTDATVHL 274

Query: 179 WDATNDKLKQPIQEWTTSHSDI-VNDCQWH----CFNTNMFGSVSEDSTLQLFDKRNGGK 233
           WD    K  + +     S  DI +N  ++     C +      + E S L  F+      
Sbjct: 275 WDIVAGKSAKVLTHHKRSVRDIALNPSEFSLASACTDDIRSWRLPEGSLLTNFESE---- 330

Query: 234 SDVKISSKGQYNSIAFSGFSENLFAAAGTTNNIYLYDIRNTGKILHSMTGHEEPVTS--- 290
                 S G  NS++ +   + + AA      +  YD ++     H     E P  +   
Sbjct: 331 ------SSGIINSLSIN--QDGVLAAGCDNGTLAFYDFKSG----HKYQSLESPAVAGSL 378

Query: 291 ------LEFSNDKDGI-LISGSSDRRVIMWDLFEIGAEQQPDEADDGLP 332
                 L  + D+ G+ LI+G  D+ + +W   ++  E     ++ GLP
Sbjct: 379 ESERGILSSTFDQSGLRLITGGVDKSIKIWKQDDLATEV----SNPGLP 423

>KLLA0E08449g Chr5 (759718..760986) [1269 bp, 422 aa] {ON} similar
           to uniprot|P53962 Saccharomyces cerevisiae YNL035C
           Hypothetical ORF
          Length = 422

 Score = 47.8 bits (112), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 55/197 (27%), Positives = 98/197 (49%), Gaps = 24/197 (12%)

Query: 148 KYHKDNAYGLAFNPNAEGELISGSDDSTIALWDATNDKLKQPIQEWTTSHSD--IVNDCQ 205
           +Y ++N + L   P  +  L++   D ++ L D  N K    IQ  TTS +D  ++N   
Sbjct: 9   RYFEENNWCLKLQPLYQHGLMTSISDGSVHLLDWGNLKTISSIQCHTTSINDMKVINSD- 67

Query: 206 WHCFNTN-MFGSVSEDSTLQLFDKRNGGKSDVKISSKGQYNSIAFSGFSENLFAAAGTT- 263
              F+T  +F + +ED  ++++D R   +++V  S +    S  FS  S +   A GT  
Sbjct: 68  ---FDTGAVFATAAEDG-VKVWDIR--ARNNVA-SLQNDKASPFFSLDSRHNMLACGTEL 120

Query: 264 ----NNIYLYDIRNTGKILHSMT-GHEEPVTSLEFSNDKDGILISGSSDRRVIMWDLFEI 318
                 +++YDIRN  K + S    H + +T ++F      +L+SGS+D  V ++DL + 
Sbjct: 121 KDYDAELHIYDIRNWTKPVRSFVDSHHDDITDIKFHPCDSNLLMSGSTDGYVNIYDLTQ- 179

Query: 319 GAEQQPDEADDGLPEVM 335
                 D+ +D L +V+
Sbjct: 180 ------DDEEDALHQVI 190

>NDAI0E04440 Chr5 (1002113..1003858) [1746 bp, 581 aa] {ON}
           Anc_7.356 YLR196W
          Length = 581

 Score = 48.1 bits (113), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 43/178 (24%), Positives = 80/178 (44%), Gaps = 12/178 (6%)

Query: 149 YHKDNAYGLAFNPNAEGELISGSDDSTIALWDATNDKLKQPIQEWTTSHSDI-VNDCQWH 207
           +H D    L+ N      L S S D T+ LWD  N    Q  +   + HS   V+  +WH
Sbjct: 289 HHTDAILSLSHNKQFRAVLASTSADHTVKLWDLNN---GQTARSLASVHSGKNVSASEWH 345

Query: 208 CFNTNMFGSVSEDSTLQLFDKRNGGKSDV----KISSKGQYNSIAFSGFSENLFAAAGTT 263
             N ++  +   DS + L D R   + ++     + S  +     F+  +EN+      +
Sbjct: 346 PTNGSILLTGGYDSRVALSDVRISNEKEMSKYWSVMSGEEIECTTFA--NENIILCGTDS 403

Query: 264 NNIYLYDIRN--TGKILHSMTGHEEPVTSLEFSNDKDGILISGSSDRRVIMWDLFEIG 319
            NIY +DIRN    K + ++  H+  +++L  ++   G++ +G+   + +    F +G
Sbjct: 404 GNIYSFDIRNNENSKPVWTLKAHDAGISTLSTNSFIPGLMSTGAMGEKAVKLWKFPLG 461

>CAGL0M02277g Chr13 complement(271836..273119) [1284 bp, 427 aa]
           {ON} highly similar to uniprot|Q12417 Saccharomyces
           cerevisiae YPL151c PRP46 Pre-mRNA splicing factor PRP46
          Length = 427

 Score = 47.8 bits (112), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 47/187 (25%), Positives = 84/187 (44%), Gaps = 26/187 (13%)

Query: 169 SGSDDSTIALWDATNDKLKQPIQEWTTSHSDIVNDCQWHCFNTNMFGSVSEDSTLQLFDK 228
           +GS+D TI +W+  + KLK  ++    +H   V D      +  MF SVSED T++ +D 
Sbjct: 133 TGSNDKTIKIWNLASGKLKVTLK----AHDMTVRDLAISNRHPYMF-SVSEDKTVKCWDL 187

Query: 229 RNGGKSDVKISSKGQYNSIAFSGF--SENLFAAAGTTNNIYLYDIRNTGKILHSMTGHEE 286
               K+    +  G  + +       + ++   AG  + + ++DIR    ++ ++ GH+ 
Sbjct: 188 E---KNTAIRNYHGHLSGVHTVDIHPTVDVVVTAGRDSVVKVWDIRTRLPVM-TLPGHKG 243

Query: 287 PVTSLEFSNDKDGILISGSSDRRVIMWDLFEIGAEQQPDEADDGLPEVMMIHAGSRSAIN 346
           P+T +      D  +IS S D  + +WDL                 + M +    +  + 
Sbjct: 244 PITKVRCL-PVDPQVISSSVDASIRLWDLVA--------------GKSMKVLTHHQRTVR 288

Query: 347 DISTHPS 353
           DIS HPS
Sbjct: 289 DISVHPS 295

>AGL196C Chr7 complement(328838..331645) [2808 bp, 935 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YLR129W
           (DIP2)
          Length = 935

 Score = 48.1 bits (113), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 58/221 (26%), Positives = 99/221 (44%), Gaps = 25/221 (11%)

Query: 116 QNTNIIATVNGEGTIFIYDCSRDKQSALLSTLKYHKDNAYGLAFNPNAEGELISGSDDST 175
           + T I+A    +GTI I+D    +   +L     H      L F+      LISGS D+T
Sbjct: 85  EETFILAVGYADGTIKIWDM---QTQTVLIVFHSHSSAITILRFDQTGT-RLISGSRDAT 140

Query: 176 IALWDATNDKLKQPIQEWTTSHSDIVNDCQWHCFNTNMFGSVSEDSTLQLFDKRNGGKSD 235
           I LWD   +     ++    SH D +    W C N +   SVS+D  ++L+D +     +
Sbjct: 141 IILWDLVAETGLCKLR----SHKDAITGI-W-CENDDWLISVSKDGLIKLWDMKVHQCVE 194

Query: 236 VKISSKGQYNSIAFSGFSENLFAAAGTTNNIYLYDI---RNTGKILHSMTGHE----EPV 288
             ++  G+  S+A     +N+   A   + I L+++   R  G +L     +E    +  
Sbjct: 195 THMAHTGECWSLA---VKDNMVITANAESEIKLWELDLERPNGSMLLEKGSYEKQSKQRC 251

Query: 289 TSLEFSNDKDG--ILISGSSDRRVIMWDLFEIGAEQQPDEA 327
           T L F+   DG     S +SD+ +   ++F I +E +  +A
Sbjct: 252 TELSFTTVADGTTFFYSLNSDKTM---EIFRIRSETEIAKA 289

 Score = 35.0 bits (79), Expect = 0.37,   Method: Compositional matrix adjust.
 Identities = 18/62 (29%), Positives = 34/62 (54%), Gaps = 1/62 (1%)

Query: 254 ENLFAAAGTTNNIYLYDIRNTGKILHSMTGHEEPVTSLEFSNDKDGILISGSSDRRVIMW 313
           E+ F A    +N       ++ K   S+ GH+ PV S++ S+D   ++I+ S+D+ + +W
Sbjct: 536 EDRFLAVSLLDNTVKVFFLDSMKFFLSLYGHKLPVLSMDISHDSK-LIITSSADKNIKIW 594

Query: 314 DL 315
            L
Sbjct: 595 GL 596

 Score = 33.9 bits (76), Expect = 0.87,   Method: Compositional matrix adjust.
 Identities = 20/85 (23%), Positives = 43/85 (50%), Gaps = 5/85 (5%)

Query: 102 FAHDGEINRARYMPQNTNIIATVNGEGTIFIYDCSRDKQSALLSTLKYHKDNAYGLAFNP 161
           FAH   I   +++P++ N   + + +GT+  +D         +  L  H+   + LA + 
Sbjct: 606 FAHQDSIMNVKFLPESHNFF-SCSKDGTVKYWD---GNSFDCIQKLYGHQGEVWALAVSS 661

Query: 162 NAEGELISGSDDSTIALWDATNDKL 186
           + +  ++S S D +I +W+ T D++
Sbjct: 662 DGQA-VVSVSHDRSIRVWEETEDQV 685

>KAFR0J00980 Chr10 (176984..178426) [1443 bp, 480 aa] {ON} Anc_5.201
           YLL011W
          Length = 480

 Score = 47.8 bits (112), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 55/252 (21%), Positives = 92/252 (36%), Gaps = 60/252 (23%)

Query: 117 NTNIIATVNGEGTIFIYDCSRDKQSALLSTLKYHKDNAYGLAFNP------NAEGELISG 170
           N N +A+ + +G I  ++ S  ++     + K H     GL   P        E  ++S 
Sbjct: 79  NLNKLASGSADGIIKYWNMSTREE---FVSFKAHYGLVTGLCVTPEHTSKNKNENFMLSC 135

Query: 171 SDDSTIALWDATNDKLKQ---------------------------------------PIQ 191
            DD T+ LW   ND                                            I 
Sbjct: 136 GDDKTVKLWSVNNDDFSNVKSDAELNTEGLLKTFYGEHAFQGIDHHREASTFVTGGAQIH 195

Query: 192 EWTTSHSDIVNDCQWHC-------FNTN---MFGSVSEDSTLQLFDKRNGGKSDVKISSK 241
            W ++ S  +++  W         FN N   +  S   D+ + L+D R    +  KI   
Sbjct: 196 LWDSNRSKPISNLSWGADNITSVKFNQNEVDILASTGSDNAIVLYDLRTNSPTQ-KIIQT 254

Query: 242 GQYNSIAFSGFSENLFAAAGTTNNIYLYDIRNTGKILHSMTGHEEPVTSLEFSNDKDGIL 301
            + N+I ++      F  A   +N Y YD+RN  + LH    H   V  ++FS   D I 
Sbjct: 255 MRTNAICWNPMEAFNFVIANEDHNAYYYDMRNMSRALHVFKDHVSAVMDVDFSPTGDEI- 313

Query: 302 ISGSSDRRVIMW 313
           ++GS D+ + ++
Sbjct: 314 VTGSYDKTIRIF 325

 Score = 47.4 bits (111), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 46/181 (25%), Positives = 84/181 (46%), Gaps = 19/181 (10%)

Query: 150 HKDNAYGLAFNPNAEGELISGSDDSTIALWDATNDKLKQPIQEWTTSHSDIVNDC----- 204
           H+D  Y +A N N   +L SGS D  I  W+ +    ++    +   +  +   C     
Sbjct: 66  HRDGVYTIAKNYNNLNKLASGSADGIIKYWNMST---REEFVSFKAHYGLVTGLCVTPEH 122

Query: 205 QWHCFNTNMFGSVSEDSTLQLFDKRNGG----KSDVKISSKGQ----YNSIAFSGFSENL 256
                N N   S  +D T++L+   N      KSD +++++G     Y   AF G   + 
Sbjct: 123 TSKNKNENFMLSCGDDKTVKLWSVNNDDFSNVKSDAELNTEGLLKTFYGEHAFQGIDHHR 182

Query: 257 FAAAGTTN--NIYLYDIRNTGKILHSMTGHEEPVTSLEFSNDKDGILISGSSDRRVIMWD 314
            A+   T    I+L+D  N  K + +++   + +TS++F+ ++  IL S  SD  ++++D
Sbjct: 183 EASTFVTGGAQIHLWD-SNRSKPISNLSWGADNITSVKFNQNEVDILASTGSDNAIVLYD 241

Query: 315 L 315
           L
Sbjct: 242 L 242

>Skud_4.63 Chr4 (104587..108408) [3822 bp, 1273 aa] {ON} YDL195W
           (REAL)
          Length = 1273

 Score = 48.1 bits (113), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 49/219 (22%), Positives = 97/219 (44%), Gaps = 24/219 (10%)

Query: 116 QNTNIIATVNGEGTIFIYDCSRDKQSALLSTLKY--HKDNAYGLAFNPNAEGELISGSDD 173
            N  IIA     GT+ +Y  + +    + ST K+  H  +   + FN   +  L SG ++
Sbjct: 72  HNNEIIAGALDNGTLELY-STNEANDTISSTAKFGSHSSSVKTVKFNARQDNVLASGGNN 130

Query: 174 STIALWDATNDKLKQPIQEWTT-------SHSDIVNDCQWHCFNTNMFGSVSEDSTLQLF 226
             I +WD   +K  +    +T        S  D VN   W+    ++F S    +   ++
Sbjct: 131 GEIFIWDM--NKCTESPSTYTPLTPGQSMSSVDEVNSLAWNQSLAHVFASAGSSNFASIW 188

Query: 227 DKRNGGKSDVKISS-------KGQYNSIAFSGFSENLFAAAGTTNN---IYLYDIRNTGK 276
           D +   K  + +S        K Q + + +   +    A A  ++N   I ++D+RN   
Sbjct: 189 DLK-AKKEVIHLSYTSPSSGIKQQLSVVEWHPKNSTRVATATGSDNDPSILVWDLRNANT 247

Query: 277 ILHSMT-GHEEPVTSLEFSNDKDGILISGSSDRRVIMWD 314
            + ++  GH++ + SL++ +  + +L+S   D  V++W+
Sbjct: 248 PMQTLNQGHQKGILSLDWCDQDENLLLSSGRDNTVLLWN 286

>KLTH0H02508g Chr8 complement(225069..225998) [930 bp, 309 aa] {ON}
           conserved hypothetical protein
          Length = 309

 Score = 47.4 bits (111), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 39/148 (26%), Positives = 67/148 (45%), Gaps = 8/148 (5%)

Query: 149 YHKDNAYGLAFNPNAEGELISGSDDSTIALWDATNDKLKQPIQEWTTSHSDIVNDCQWHC 208
           YH  NA   A +   +   ++GS D+ +AL D    +L + +      H  +VN  Q   
Sbjct: 55  YHHGNAAITALDALGDRCAVTGSSDTRLALCDLETGQLLRGL----AGHRRVVN--QVRA 108

Query: 209 FNTNMFGSVSEDSTLQLFDKRNGGKSDVKISSKGQYNSIAFSGFSENLFAAAGTTNNIYL 268
              + F SV +D  L+++D     +   + +S+    ++A    +E+L  A+G    I  
Sbjct: 109 LGESRFASVGDDGALKVWDASGAKRPVWQAASEFPLFAVAQDPQNEHLVYASGLEPVIRA 168

Query: 269 YDIRNTGKILHSM--TGHEEPVTSLEFS 294
           YD+R +     S     H + VTSL+ S
Sbjct: 169 YDLRRSADHAFSSWPAAHSDAVTSLDVS 196

>CAGL0D05588g Chr4 (533235..534668) [1434 bp, 477 aa] {ON} highly
           similar to uniprot|P33750 Saccharomyces cerevisiae
           YLL011w SOF1
          Length = 477

 Score = 47.8 bits (112), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 51/235 (21%), Positives = 84/235 (35%), Gaps = 63/235 (26%)

Query: 119 NIIATVNGEGTIFIYDCSRDKQSALLSTLKYHKDNAYGLAFNPNA---------EGELIS 169
           N IA+ +G+G I  +D S  +Q   +++ K H     GL   P           +  ++S
Sbjct: 81  NKIASGSGDGVIKYWDMSSREQ---IASFKAHYGTITGLCITPKVNIDSASSGNQNFVLS 137

Query: 170 GSDDSTIALWDATNDKLKQ----------------------------------------P 189
            SDD T+ LW   ++                                             
Sbjct: 138 SSDDKTVKLWSVNHEDFAHVDNDQVINTDNGLIKHYYGEHAFQGLDHSRMTSNFVTGGPR 197

Query: 190 IQEWTTSHSDIVNDCQWHC-------FN---TNMFGSVSEDSTLQLFDKRNGGKSDVKIS 239
           I  W  + S  ++D  W         FN    N+ GS   D+++ L+D R    +  KI 
Sbjct: 198 INLWDINRSKPLSDLSWGADNINTVKFNQNDANVLGSAGSDNSIVLYDLRTNSATQ-KIV 256

Query: 240 SKGQYNSIAFSGFSENLFAAAGTTNNIYLYDIRNTGKILHSMTGHEEPVTSLEFS 294
              + NS+ ++      F  A   +N Y YD+RN  + L+    H   V  ++ S
Sbjct: 257 QTMRVNSMCWNPMEAFNFVVASEDHNAYYYDMRNMSRALNVFKDHVSAVMDVDIS 311

 Score = 42.4 bits (98), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 54/202 (26%), Positives = 81/202 (40%), Gaps = 33/202 (16%)

Query: 124 VNGEGTIFIYDCSRDKQSALLSTLKYHKDNAYGLAFNPNAEGELISGSDDSTIALWDATN 183
           V G   I ++D +R K    LS L +  DN   + FN N    L S   D++I L+D   
Sbjct: 192 VTGGPRINLWDINRSKP---LSDLSWGADNINTVKFNQNDANVLGSAGSDNSIVLYDLRT 248

Query: 184 DKLKQPIQEWTTSHSDIVNDCQWHCFNTNMFGSVSEDSTLQLFDKRNGGKS--------- 234
           +   Q I +        VN   W+      F   SED     +D RN  ++         
Sbjct: 249 NSATQKIVQTMR-----VNSMCWNPMEAFNFVVASEDHNAYYYDMRNMSRALNVFKDHVS 303

Query: 235 ---DVKISSKGQYNSIAFSGFSENLFAAAGTTNNIYLYDIRNTGKILHSMTGHEEPVTSL 291
              DV IS  G+          E + A+   T  I+  +  ++ +I H  T   + V   
Sbjct: 304 AVMDVDISPTGE----------EVVTASYDKTIRIFPINKGHSREIYH--TKRMQHVFQA 351

Query: 292 EFSNDKDGILISGSSDRRVIMW 313
           +FS D   ++ SGS D  V +W
Sbjct: 352 KFSMDSKYVM-SGSDDGNVRLW 372

 Score = 41.2 bits (95), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 46/193 (23%), Positives = 80/193 (41%), Gaps = 23/193 (11%)

Query: 150 HKDNAYGLAFNPNAEGELISGSDDSTIALWDATNDKLKQPIQEWTTSHSDIVNDC----- 204
           H+D  Y LA + N   ++ SGS D  I  WD ++   ++ I  +   +  I   C     
Sbjct: 66  HQDGVYVLAKHYNDLNKIASGSGDGVIKYWDMSS---REQIASFKAHYGTITGLCITPKV 122

Query: 205 ---QWHCFNTNMFGSVSEDSTLQLFDKRNGGKSDVKISS---------KGQYNSIAFSGF 252
                   N N   S S+D T++L+   +   + V             K  Y   AF G 
Sbjct: 123 NIDSASSGNQNFVLSSSDDKTVKLWSVNHEDFAHVDNDQVINTDNGLIKHYYGEHAFQGL 182

Query: 253 SENLFAAAGTTN--NIYLYDIRNTGKILHSMTGHEEPVTSLEFSNDKDGILISGSSDRRV 310
             +   +   T    I L+DI N  K L  ++   + + +++F+ +   +L S  SD  +
Sbjct: 183 DHSRMTSNFVTGGPRINLWDI-NRSKPLSDLSWGADNINTVKFNQNDANVLGSAGSDNSI 241

Query: 311 IMWDLFEIGAEQQ 323
           +++DL    A Q+
Sbjct: 242 VLYDLRTNSATQK 254

>TBLA0D04130 Chr4 (1027726..1029450) [1725 bp, 574 aa] {ON}
           Anc_7.231 YIL046W
          Length = 574

 Score = 47.8 bits (112), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 48/173 (27%), Positives = 79/173 (45%), Gaps = 18/173 (10%)

Query: 144 LSTLKYHKDNAYGLAFNPNAEGELISGSDDSTIALWDATNDKLKQPIQEWTTSHSDIVND 203
           +   K H D    L FN      L +GS DSTIA+WD  + KL + +      HSD +  
Sbjct: 233 IREFKGHMDGVLTLQFNYRL---LFTGSYDSTIAIWDLYSGKLIRRL----NGHSDGIKT 285

Query: 204 CQWHCFNTNMFGSVSEDSTLQLFDKRNGGKSDVKISS-KGQYNSIAFSGFSENLFAAAGT 262
                F+ N   + S D T++++D + GG+    IS+ KG  +SI      + L  +   
Sbjct: 286 LY---FDENKLITGSLDKTIRVWDYK-GGRC---ISTYKGHSDSILSVDCYKKLIVSGSA 338

Query: 263 TNNIYLYDIRNTGKILHSMTGHEEPVTSLEFSNDKDGILISGSSDRRVIMWDL 315
             ++ ++ I    +  +++ GH E V  ++  +       S S D  + MWDL
Sbjct: 339 DCSVKVWHIER--RTCYTLKGHTEWVNCVKL-HPTSFSCFSASDDCTIRMWDL 388

 Score = 34.3 bits (77), Expect = 0.57,   Method: Compositional matrix adjust.
 Identities = 56/238 (23%), Positives = 96/238 (40%), Gaps = 53/238 (22%)

Query: 113 YMPQNTNIIATVNGEGTIFIYDCSRDKQSALLSTLKYHKDNAYGLAFNPNAEGELISGSD 172
           Y  +N  I  ++  + TI ++D    K    +ST K H D+   +         ++SGS 
Sbjct: 287 YFDENKLITGSL--DKTIRVWD---YKGGRCISTYKGHSDSILSVDCYKKL---IVSGSA 338

Query: 173 DSTIALWDATNDKLKQPIQEWTTSHSDIVNDCQWHCFNTNMFGSVSEDSTLQLFDKRNGG 232
           D ++ +W      +++        H++ VN  + H  + + F S S+D T++++D R+  
Sbjct: 339 DCSVKVW-----HIERRTCYTLKGHTEWVNCVKLHPTSFSCF-SASDDCTIRMWDLRSNK 392

Query: 233 KSDVKISSKGQYNSIAFSGFS--ENLF--------AAAGTT------------------- 263
              V     GQ   +        E L         A+A +T                   
Sbjct: 393 CLKVFKGHVGQVQKVIPLSIKDIEGLVVDDEVQSSASAQSTADEPCDDPLDTSIPYPTHL 452

Query: 264 ------NNIYLYDIRNTGKILHSMTGHEEPVTSLEFSNDKDGILISGSSDRRVIMWDL 315
                 N I L+D+  TGK + +  GH E V  +   N +   ++SGS D  V +WDL
Sbjct: 453 LSCSLDNTIKLWDVY-TGKCVRTQFGHVEGVWDIAADNFR---IVSGSHDGCVKVWDL 506

>KAFR0I02840 Chr9 complement(570039..571409) [1371 bp, 456 aa] {ON}
           Anc_3.25 YNL317W
          Length = 456

 Score = 47.4 bits (111), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 32/129 (24%), Positives = 62/129 (48%), Gaps = 6/129 (4%)

Query: 150 HKDNAYGLAFNPNAEGELISGSDDSTIALWDATNDKLKQPIQEWTTSHSDIVNDCQWHCF 209
           H +    ++FN NA+ + ++ SDD+ + +W+ +N + ++ +    + H   V  C WH  
Sbjct: 164 HTECIRDISFN-NADSKFVTCSDDNILKIWNFSNGQQERVL----SGHHWDVKSCDWHP- 217

Query: 210 NTNMFGSVSEDSTLQLFDKRNGGKSDVKISSKGQYNSIAFSGFSENLFAAAGTTNNIYLY 269
              +  S S+D+ ++L+D R+G      +  K       F     NL  A     +  ++
Sbjct: 218 TMGLIASASKDNLIKLWDPRSGNCVSTILKFKHTVLKTRFQPTKGNLLVAISKDKSCRVF 277

Query: 270 DIRNTGKIL 278
           DIR++ K L
Sbjct: 278 DIRHSMKEL 286

>ZYRO0F06776g Chr6 (555965..557263) [1299 bp, 432 aa] {ON} similar
           to uniprot|Q12206 Saccharomyces cerevisiae YOR229W WTM2
           WD repeat containing transcriptional modulator 2
           Transcriptional modulator
          Length = 432

 Score = 47.4 bits (111), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 51/214 (23%), Positives = 95/214 (44%), Gaps = 24/214 (11%)

Query: 174 STIALWDATNDKLKQPIQEWTTSHSDIVNDCQWHCFNTNMFGSVSEDSTLQLFDKRNGGK 233
           STI + D  +DK+  P++ +    S +++   +   + N++ + S+++ +  +DKR    
Sbjct: 210 STIKIVD-NSDKVGTPLRRFNVEAS-VIHSVSF--LDNNLYVTCSDENVVSFWDKR---- 261

Query: 234 SDVKI-----SSKGQYNSIAFSGFSENLFAAAGTTNNIYLYDIRNTGKILHSMTG----H 284
           SD ++     S  G   S++ S   +  FA       I L+D+R        M      +
Sbjct: 262 SDSQLWSFTDSQDGNITSLSSSSQLDGFFATGTDAGVIKLWDLRAIMSQQQEMVSFYHSN 321

Query: 285 EEPVTSLEFSNDKDGILISGSSDRRVIMWDLFEIGAEQQPDEADDGLPEVMMIH-AGSRS 343
           E+PV  L+FS       +S      V  WD       ++ DE D  L  +  +H  GSR 
Sbjct: 322 EDPVVDLQFSPTNSTEFLSVGKSGNVYQWDTDFFFTNEEVDEEDLHLQCLKFLHTGGSRR 381

Query: 344 AI------NDISTHPSIPWLNASVEENNIVQVWK 371
           +I      N ++ HP+I  L  +++ +  +  +K
Sbjct: 382 SIGANDKRNMVNWHPAIDQLVGTIDNDCSIAAYK 415

>SAKL0G16962g Chr7 (1463359..1463363,1463442..1465290) [1854 bp, 617
           aa] {ON} similar to uniprot|Q06440 Saccharomyces
           cerevisiae YLR429W CRN1 Coronin cortical actin
           cytoskeletal component that associates with the
           Arp2p/Arp3p complex to regulate its activity
          Length = 617

 Score = 47.8 bits (112), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 45/188 (23%), Positives = 78/188 (41%), Gaps = 19/188 (10%)

Query: 147 LKYHKDNAYGLAFNPNAEGELISGSDDSTIALWDATND-------------KLKQPIQEW 193
            + H        FNP  +  ++S SDD+ I +W+   D             K  +P++ +
Sbjct: 77  FRGHTAQVLDTEFNPFNDRIIVSSSDDAKIGVWEIPEDYSFHSYVDEDGNPKDIKPLK-F 135

Query: 194 TTSHSDIVNDCQWHCFNTNMFGSVSEDSTLQLFDKRNGGKSDVKISSKGQYNSIAFSGFS 253
            T HS  V    +H    N+  S S D T++L+D  +G K    +       S++FS + 
Sbjct: 136 LTGHSRKVGHVLFHPTANNVLASSSLDYTVKLWDIESG-KEIFTLEHPNMVTSMSFS-YD 193

Query: 254 ENLFAAAGTTNNIYLYDIRNTGKILHSMTGHEEPVTSLEFSNDKDGILISGSS---DRRV 310
            N  A       + ++DIR    +   +         + +  + D I  +G S   DR++
Sbjct: 194 GNHLATVCRDKKLRVWDIRAKKVVSEGLAHSSAKNQRVVWLGNSDRIATTGFSRLSDRQI 253

Query: 311 IMWDLFEI 318
            +WD F I
Sbjct: 254 GIWDAFNI 261

 Score = 38.1 bits (87), Expect = 0.032,   Method: Compositional matrix adjust.
 Identities = 38/174 (21%), Positives = 68/174 (39%), Gaps = 29/174 (16%)

Query: 103 AHDGEINRARYMPQNTNIIATVNGEGTIFIYDCSRD-------------KQSALLSTLKY 149
            H  ++    + P N  II + + +  I +++   D             K    L  L  
Sbjct: 79  GHTAQVLDTEFNPFNDRIIVSSSDDAKIGVWEIPEDYSFHSYVDEDGNPKDIKPLKFLTG 138

Query: 150 HKDNAYGLAFNPNAEGELISGSDDSTIALWDATNDKLKQPIQEWTTSHSDIVNDCQWHCF 209
           H      + F+P A   L S S D T+ LWD  + K     + +T  H ++V    +  +
Sbjct: 139 HSRKVGHVLFHPTANNVLASSSLDYTVKLWDIESGK-----EIFTLEHPNMVTSMSF-SY 192

Query: 210 NTNMFGSVSEDSTLQLFDKR----------NGGKSDVKISSKGQYNSIAFSGFS 253
           + N   +V  D  L+++D R          +    + ++   G  + IA +GFS
Sbjct: 193 DGNHLATVCRDKKLRVWDIRAKKVVSEGLAHSSAKNQRVVWLGNSDRIATTGFS 246

>TDEL0A07780 Chr1 complement(1352017..1353990) [1974 bp, 657 aa]
           {ON} Anc_6.363 YCR084C
          Length = 657

 Score = 47.8 bits (112), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 41/166 (24%), Positives = 80/166 (48%), Gaps = 16/166 (9%)

Query: 157 LAFNPNAEGELISGSDDSTIALWDATNDKLKQPIQEWTTSHSDIVNDCQWHCFNTNMFGS 216
           + F+P+ +  L +G++D  I +WD    ++   +Q     H   +    +      +  S
Sbjct: 381 VCFSPDGKF-LATGAEDRLIRIWDIAKKQIVMVLQ----GHEQDIYSLDYFPSGDKLV-S 434

Query: 217 VSEDSTLQLFDKRNGGKSDVKISSKGQYNSIAFSGFSENLFAAAGTTNNIYLYDIRNTGK 276
            S D T++++D R G +  + +S +    ++A S       AA      + ++D   TG 
Sbjct: 435 GSGDRTVRIWDLRTG-QCSLTLSIEDGVTTVAVSPGDGKFIAAGSLDRAVRVWD-SETGF 492

Query: 277 ILHSM-------TGHEEPVTSLEFSNDKDGILISGSSDRRVIMWDL 315
           ++  +       TGH++ V S+ F+ D +G+ +SGS DR V +W+L
Sbjct: 493 LVERLDSENELGTGHKDSVYSVVFTRDGNGV-VSGSLDRSVKLWNL 537

 Score = 43.9 bits (102), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 48/213 (22%), Positives = 94/213 (44%), Gaps = 29/213 (13%)

Query: 120 IIATVNGEGTIFIYDCSRDKQSALLSTLKYHKDNAYGLAFNPNAEGELISGSDDSTIALW 179
            +AT   +  I I+D ++ +   ++  L+ H+ + Y L + P+ + +L+SGS D T+ +W
Sbjct: 389 FLATGAEDRLIRIWDIAKKQ---IVMVLQGHEQDIYSLDYFPSGD-KLVSGSGDRTVRIW 444

Query: 180 DATNDKLKQPIQEWTTSHSDIVNDCQWHCFNTNMFGSVSEDSTLQLFDKRNG-------G 232
           D     L+      T S  D V        +     + S D  ++++D   G        
Sbjct: 445 D-----LRTGQCSLTLSIEDGVTTVAVSPGDGKFIAAGSLDRAVRVWDSETGFLVERLDS 499

Query: 233 KSDVKISSKGQYNSIAFSGFSENLFAAAGTTNNIYLYDIRN-----------TGKILHSM 281
           ++++    K    S+ F+    N   +     ++ L+++R             G    + 
Sbjct: 500 ENELGTGHKDSVYSVVFT-RDGNGVVSGSLDRSVKLWNLRGDKNNSSSGKPTPGTCEVTY 558

Query: 282 TGHEEPVTSLEFSNDKDGILISGSSDRRVIMWD 314
           TGH++ V S+  + + D  ++SGS DR V+ WD
Sbjct: 559 TGHKDFVLSVATTQN-DQYILSGSKDRGVLFWD 590

 Score = 38.5 bits (88), Expect = 0.027,   Method: Compositional matrix adjust.
 Identities = 28/73 (38%), Positives = 42/73 (57%), Gaps = 9/73 (12%)

Query: 246 SIAFSGFSENLFAAAGTTNN-IYLYDIRNTGKILHSMTGHEEPVTSLEF--SNDKDGILI 302
           S+ FS   +  F A G  +  I ++DI    +I+  + GHE+ + SL++  S DK   L+
Sbjct: 380 SVCFS--PDGKFLATGAEDRLIRIWDIAKK-QIVMVLQGHEQDIYSLDYFPSGDK---LV 433

Query: 303 SGSSDRRVIMWDL 315
           SGS DR V +WDL
Sbjct: 434 SGSGDRTVRIWDL 446

>Kwal_27.12667 s27 complement(1325822..1327987) [2166 bp, 721 aa]
           {ON} YJL112W (MDV1) - Involved in mitochondrial division
           [contig 260] FULL
          Length = 721

 Score = 47.8 bits (112), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 51/174 (29%), Positives = 78/174 (44%), Gaps = 37/174 (21%)

Query: 146 TLKYHKDNAYGLAFNPNAEGELISGSDDSTIALWDATNDKLKQPIQEWTTSHSDIVNDCQ 205
           T   H D    L F  N+   L+SGS D TI  WD T  K  Q I        DI     
Sbjct: 497 TFDAHVDEITALHFEGNS---LVSGSQDRTIRQWDLTTGKCLQTI--------DI----- 540

Query: 206 WHCFNTNMFGSVSEDSTLQLFDKRNGGKSDVKISSKGQYNSIAFSGFSENLFAAAGTTNN 265
            +  N    G  S+ S+       N  +S + ++    +N     G  +   AA  T   
Sbjct: 541 -NFANRGTSGGFSKISS-------NNPRSSILLT----HNDPPVIGALQCYDAAMATGTK 588

Query: 266 ---IYLYDIRNTGKILHSMTGHEEPVTSLEFSNDKDGI-LISGSSDRRVIMWDL 315
              + L+D+R +G+++ ++ GH + VT L+F    D + L++GS DR + +WDL
Sbjct: 589 DGLVRLWDLR-SGQVIRTLEGHTDAVTGLQF----DSVNLVTGSLDRSIRIWDL 637

 Score = 32.0 bits (71), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 14/38 (36%), Positives = 22/38 (57%), Gaps = 3/38 (7%)

Query: 278 LHSMTGHEEPVTSLEFSNDKDGILISGSSDRRVIMWDL 315
           +H+   H + +T+L F  +    L+SGS DR +  WDL
Sbjct: 495 VHTFDAHVDEITALHFEGNS---LVSGSQDRTIRQWDL 529

>TPHA0G02380 Chr7 (484477..485010,485373..485795) [957 bp, 318 aa]
           {ON} Anc_2.431 YMR116C
          Length = 318

 Score = 47.0 bits (110), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 66/252 (26%), Positives = 101/252 (40%), Gaps = 47/252 (18%)

Query: 143 LLSTLKYHKDNAYGLAFNPNAEGELISGSDDSTIALWDATND--KLKQPIQEWTTSHSDI 200
           L  TL+ H      LA +      L+S S D T+  W  T D  +   P++ +   H+ I
Sbjct: 8   LRGTLEGHNGWVTSLATSAGQPNLLVSASRDKTLISWKLTGDDQQYGVPVRSF-KGHNHI 66

Query: 201 VNDCQWHCFNTNMFGSVSEDSTLQL--------FDKRNGGKSDVKISSKGQYNSIAFSGF 252
           V DC           S S D TL+L        + +  G KSDV   +  +  S+  SG 
Sbjct: 67  VQDCALTADGAYAL-SASWDKTLRLWNVATGETYQRFTGHKSDVMSVAIDRKASMIISGS 125

Query: 253 SENLFAAAGTTNNIYLYDIRNTGKILHSMTGHEEPVTSL-----EFSNDKDGILISGSSD 307
            +           I ++ I+  G  L ++ GH + V+ +     E   D +  LIS  SD
Sbjct: 126 RD---------KTIKVWSIK--GDCLATLLGHNDWVSQVRVAPNEKQEDDNVTLISAGSD 174

Query: 308 RRVIMWDL--FEIGAEQQPDEADDGLPEVMMIHAGSRSAINDISTHPSIPWLNASVEENN 365
           + V  W++  F+I       EAD           G  + IN I+  P    L AS  ++ 
Sbjct: 175 KMVKAWNINQFQI-------EAD---------FVGHNNYINSITASPDGS-LVASAGKDG 217

Query: 366 IVQVWKCSSKLP 377
            + +W    K P
Sbjct: 218 DIMLWNLKQKTP 229

>KNAG0M01750 Chr13 complement(323446..324903) [1458 bp, 485 aa] {ON}
           Anc_5.201 YLL011W
          Length = 485

 Score = 47.4 bits (111), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 57/260 (21%), Positives = 97/260 (37%), Gaps = 67/260 (25%)

Query: 116 QNTNIIATVNGEGTIFIYDCSRDKQSALLSTLKYHKDNAYGLAFNPNA--------EGEL 167
            N N +AT +G+G I  ++ S  ++     + K H     GL   P          +  +
Sbjct: 78  HNLNKLATASGDGVIKYWNMSTREEYV---SFKGHYGLVTGLCVTPEGLSVGGLSNQNHM 134

Query: 168 ISGSDDSTIALWDATNDKL------------------------------------KQP-- 189
           +S  DD TI LW   ND                                      ++P  
Sbjct: 135 LSCGDDKTIKLWSINNDDFANIKSDEELITKTNGSGALLKTFYGEHAFQGIDHHREKPLF 194

Query: 190 ------IQEWTTSHSDIVNDCQWHC-------FN---TNMFGSVSEDSTLQLFDKRNGGK 233
                 I+ W  + S  + +  W         FN   T++  S   D+++ L+D R    
Sbjct: 195 VTGGAKIELWDNNRSTPLTNLSWGADNITSLKFNQSETDIVASAGSDNSVVLYDLRTNSP 254

Query: 234 SDVKISSKGQYNSIAFSGFSENLFAAAGTTNNIYLYDIRNTGKILHSMTGHEEPVTSLEF 293
           +  KI    + N+I ++      F  A   +N Y YD+RN  + L+    H   V  ++F
Sbjct: 255 TQ-KIVQSMRTNAICWNPMEPFNFVVANEDHNAYYYDMRNMSRSLNVFKDHVSAVMDVDF 313

Query: 294 SNDKDGILISGSSDRRVIMW 313
           S   D I ++GS D+ + ++
Sbjct: 314 SPTGDEI-VTGSYDKTIRIF 332

 Score = 40.0 bits (92), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 62/250 (24%), Positives = 100/250 (40%), Gaps = 26/250 (10%)

Query: 124 VNGEGTIFIYDCSRDKQSALLSTLKYHKDNAYGLAFNPNAEGELISGSDDSTIALWD-AT 182
           V G   I ++D +R   S  L+ L +  DN   L FN +    + S   D+++ L+D  T
Sbjct: 195 VTGGAKIELWDNNR---STPLTNLSWGADNITSLKFNQSETDIVASAGSDNSVVLYDLRT 251

Query: 183 NDKLKQPIQEWTTSHSDIVNDCQWHCFNTNMFGSVSEDSTLQLFDKRNGGKS-DVKISSK 241
           N   ++ +Q   T      N   W+      F   +ED     +D RN  +S +V     
Sbjct: 252 NSPTQKIVQSMRT------NAICWNPMEPFNFVVANEDHNAYYYDMRNMSRSLNVFKDHV 305

Query: 242 GQYNSIAFSGFSENLFAAA-GTTNNIYLYDIRNTGKILHSMTGHEEPVTSLEFSNDKDGI 300
                + FS   + +   +   T  I+  +  ++ +I H  T   + V  +++S D    
Sbjct: 306 SAVMDVDFSPTGDEIVTGSYDKTIRIFKTNQGHSREIYH--TKRMQHVMQVKYSMDSK-Y 362

Query: 301 LISGSSDRRVIM-----WDLFEIGAEQQPD--EADDGLPEVMMIHAGSRSAINDISTHPS 353
           LISGS D  V M     WD   +   +Q    E D+ L E           I  IS H  
Sbjct: 363 LISGSDDGNVRMWRSVAWDRSNVKTTKQRSKLEYDEKLKERFKYMP----EIRRISRHRH 418

Query: 354 IPWLNASVEE 363
           +P +    +E
Sbjct: 419 VPQVIKKAKE 428

>TDEL0A00440 Chr1 (78820..80175) [1356 bp, 451 aa] {ON} Anc_3.25
           YNL317W
          Length = 451

 Score = 47.4 bits (111), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 43/199 (21%), Positives = 95/199 (47%), Gaps = 11/199 (5%)

Query: 117 NTNIIATVNGEGTIFIYDCSRDKQSALLSTLKYHKDNAYGLAFNPNAEGELISGSDDSTI 176
           N +   T + +  + I++ S  +Q  +LS    H  +     ++P   G + S S D+ +
Sbjct: 176 NDSKFVTCSDDNILKIWNFSNGQQERVLSG---HHWDVKSCDWHPEM-GLIASASKDNLV 231

Query: 177 ALWDATNDKLKQPIQEWTTSHSDIVNDCQWHCFNTNMFGSVSEDSTLQLFDKRNGGKSDV 236
            LWD    +    I ++  +    V   ++     N+  ++S+D + ++FD R+  K  +
Sbjct: 232 KLWDPRVGQCISTILKFKHT----VLKTRFQPTGGNLLAAISKDKSCRVFDIRHSLKELM 287

Query: 237 KISSKGQYNSIAFSGFSENLFAAAGTTNNIYLYD-IRNTGKILHSMT-GHEEPVTSLEFS 294
            +  +  Y ++ ++  +E++   A    ++  +D +++  K +H++   H++ +TSL + 
Sbjct: 288 VVRDEVDYMTLLWNPINESMLTVACYDGSLKDFDVVQDLKKPVHTIPYAHDKCITSLSY- 346

Query: 295 NDKDGILISGSSDRRVIMW 313
           N    IL S S DR +  W
Sbjct: 347 NPVGHILASASKDRTIRFW 365

 Score = 44.7 bits (104), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 41/176 (23%), Positives = 80/176 (45%), Gaps = 10/176 (5%)

Query: 103 AHDGEINRARYMPQNTNIIATVNGEGTIFIYDCSRDKQSALLSTLKYHKDNAYGLAFNPN 162
           AHD  +    Y     + + + + +GTI I+  + +    L    + H +    +AF+ N
Sbjct: 121 AHDSAVTTMEYS-HAGDWMVSGDSDGTIKIWQPNFNMVKELD---RAHTECIRDVAFSGN 176

Query: 163 AEGELISGSDDSTIALWDATNDKLKQPIQEWTTSHSDIVNDCQWHCFNTNMFGSVSEDST 222
            + + ++ SDD+ + +W+ +N + ++ +    + H   V  C WH     +  S S+D+ 
Sbjct: 177 -DSKFVTCSDDNILKIWNFSNGQQERVL----SGHHWDVKSCDWHP-EMGLIASASKDNL 230

Query: 223 LQLFDKRNGGKSDVKISSKGQYNSIAFSGFSENLFAAAGTTNNIYLYDIRNTGKIL 278
           ++L+D R G      +  K       F     NL AA     +  ++DIR++ K L
Sbjct: 231 VKLWDPRVGQCISTILKFKHTVLKTRFQPTGGNLLAAISKDKSCRVFDIRHSLKEL 286

>KLTH0H02772g Chr8 complement(248747..250009) [1263 bp, 420 aa] {ON}
           similar to uniprot|Q12523 Saccharomyces cerevisiae
           YPL247C Hypothetical ORF
          Length = 420

 Score = 47.4 bits (111), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 56/254 (22%), Positives = 105/254 (41%), Gaps = 51/254 (20%)

Query: 108 INRARYMPQ-NTNIIATVNGEGTIFIYDCSRDKQSALLSTLKYHKDNAYGL--------- 157
           I+R ++ P  N+  +AT +    ++ Y     ++   LS  +Y+K    G          
Sbjct: 108 ISRVQWCPNGNSQQLATCSDSLRLWDYSDFVLQERLNLSFCRYNKSGGQGTVAALGQLPP 167

Query: 158 --AFNPNA--EGELISGSDDSTIALWD--ATNDKLKQPIQEWTTSHSDIVNDCQWHCFNT 211
             +F+ NA     +IS S D+T  +WD  ATN    Q I     +H   V D ++   +T
Sbjct: 168 VSSFHWNAVDPNLIISSSIDTTCTVWDLQATNYVKTQLI-----AHDSEVFDVKFLTQST 222

Query: 212 NMFGSVSEDSTLQLFDKRNGGKSDVKISSKGQYNS------------------------- 246
            +F S   D ++++FD R+   S +      Q  +                         
Sbjct: 223 QLFASCGGDGSVRVFDLRSLAHSTIIYEPSSQPTAGSSGDSSAASGGSGSGSNSASSGSN 282

Query: 247 ----IAFSGFSENLFAA-AGTTNNIYLYDIRNTGKILHSMTGHEEPVTSLEFSNDKDGIL 301
               +  S F  N+ A  A  +N++ + D+R  G  + ++ GH   V  +++   +  +L
Sbjct: 283 ALLRLEPSPFDPNVVATFAHDSNSVLILDMRYPGAAILTLEGHVGAVNQIQWHPSRHNVL 342

Query: 302 ISGSSDRRVIMWDL 315
           ++   D + ++WDL
Sbjct: 343 LTCGDDCQALLWDL 356

 Score = 32.3 bits (72), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 10/32 (31%), Positives = 22/32 (68%)

Query: 103 AHDGEINRARYMPQNTNIIATVNGEGTIFIYD 134
           AHD E+   +++ Q+T + A+  G+G++ ++D
Sbjct: 207 AHDSEVFDVKFLTQSTQLFASCGGDGSVRVFD 238

>Kwal_47.17827 s47 complement(570622..572193) [1572 bp, 523 aa] {ON}
           YMR131C (RRB1) - RiboSome Assembly 2 [contig 204] FULL
          Length = 523

 Score = 47.4 bits (111), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 79/400 (19%), Positives = 153/400 (38%), Gaps = 54/400 (13%)

Query: 25  PLLYDFVSETRLTWPSLTLQWLPGDKTSTR----QHLILGTLTSGA---ETDYLKIAALD 77
           P +Y+ +    L WP L+L  +P    S R    Q L+L T T  +   + + L +    
Sbjct: 127 PTVYEMLHNVNLPWPCLSLDIVPDRLGSERRNYPQSLLLTTATQASKKKDNELLLLKMSQ 186

Query: 78  LPDEIIIGXXXXXXXXXXXXXXXXFAHDGE-------INRARYMP----QNTNIIATVNG 126
           L   ++                     + E        NR +  P        + A+++ 
Sbjct: 187 LTKTLVKEDEDDDEEDDDEDEDQDPIVENENIPLRDTTNRLKVSPFASESPEKLTASMSE 246

Query: 127 EGTIFIYDCSRDKQ-------------SALLSTLKYHKD-NAYGLAFNP-NAEGELISGS 171
            G ++I+D     +                + T+K H +   Y L ++P N  G L++G 
Sbjct: 247 NGEVYIFDLGPQVKGFETPGYQIPKTAKKPIHTVKAHGNVEGYALDWSPLNKSGSLLTGD 306

Query: 172 DDSTIALWDATNDKLKQPIQEWTTSHSDIVNDCQWHCFNTNMFGSVSEDSTLQLFDKRNG 231
               + L      K       ++  ++  + D Q+      +F +   D  ++++D R+ 
Sbjct: 307 CSGRVYLTQRHTSKWITDKTAFSAGNNQSIEDIQFSRTEATVFATCGCDGYIRIWDTRSK 366

Query: 232 GKSDVKISSKGQYNSIAFSGFSENL--FAAAGTTNNIY-LYDIR-----NTGKI--LHSM 281
            K    IS K     +    ++E +    A+G  N  + ++D+R     N   +  +   
Sbjct: 367 -KHKPAISVKASSTDVNVISWNEKIGYLLASGDDNGTWGVWDLRQFSPNNAASVSPVAQY 425

Query: 282 TGHEEPVTSLEFSNDKDGILISGSSDRRVIMWDL-FEIGAEQQPDEADDGL------PEV 334
           + H+  +TS+ F+   D I+   S D  V +WDL  E   E+   +A +        P++
Sbjct: 426 SFHKGAITSIAFNPLDDSIIAVASEDNTVTLWDLSVEADDEEIKQQAAETKELQQIPPQL 485

Query: 335 MMIHAGSRSAINDISTHPSIPWLNASVEENNIVQVWKCSS 374
           + +H   +  + D+  H  IP    S   + +  +WK  S
Sbjct: 486 LFVHW--QKEVKDVKWHKQIPGCLVSTGTDGL-NIWKTIS 522

>KLLA0D02530g Chr4 complement(212703..214826) [2124 bp, 707 aa] {ON}
           similar to uniprot|Q06440 Saccharomyces cerevisiae
           YLR429W CRN1 Coronin cortical actin cytoskeletal
           component that associates with the Arp2p/Arp3p complex
           to regulate its activity
          Length = 707

 Score = 47.4 bits (111), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 41/174 (23%), Positives = 75/174 (43%), Gaps = 29/174 (16%)

Query: 103 AHDGEINRARYMPQNTNIIATVNGEGTIFIYDCSRD-------------KQSALLSTLKY 149
            H  ++    + P N +I+A+ + +G I I++   D             K    +  L  
Sbjct: 91  GHTAQVLDTDFSPFNDHIVASGSDDGKIGIWEIPEDYGLHEYVDEEGNPKDLKPVRMLSG 150

Query: 150 HKDNAYGLAFNPNAEGELISGSDDSTIALWDATNDKLKQPIQEWTTSHSDIVNDCQWHCF 209
           H      L F+P AE  L S S D T+ +WD + +++K     +T  H D+V    +  +
Sbjct: 151 HSRKVGHLLFHPLAENILASSSLDYTVKIWDISQEEVK-----FTLKHPDMVTSMSF-SY 204

Query: 210 NTNMFGSVSEDSTLQLFDKR----------NGGKSDVKISSKGQYNSIAFSGFS 253
           +     +VS D  L+++D R          + G  + ++   G  + +A +GFS
Sbjct: 205 DGKHLVTVSRDKKLRVWDVRAEKIVSEGPAHSGAKNQRVVWLGDTDKVATTGFS 258

 Score = 33.5 bits (75), Expect = 0.96,   Method: Compositional matrix adjust.
 Identities = 37/142 (26%), Positives = 61/142 (42%), Gaps = 16/142 (11%)

Query: 238 ISSKGQYNSIAFSGFSENLFAAAGTTNNIYLYDIRNTGKI---LHSMTGHEEPVTSLEFS 294
           I   G+Y S+ ++      FA         +  ++  GKI   +    GH   V   +FS
Sbjct: 52  IKCNGKYISVNWNSSGGGAFA---------VIPVKEVGKIPDQVPLFRGHTAQVLDTDFS 102

Query: 295 NDKDGILISGSSDRRVIMWDLFE-IGAEQQPDEADD--GLPEVMMIHAGSRSAINDISTH 351
              D I+ SGS D ++ +W++ E  G  +  DE  +   L  V M+   SR  +  +  H
Sbjct: 103 PFNDHIVASGSDDGKIGIWEIPEDYGLHEYVDEEGNPKDLKPVRMLSGHSRK-VGHLLFH 161

Query: 352 PSIPWLNASVEENNIVQVWKCS 373
           P    + AS   +  V++W  S
Sbjct: 162 PLAENILASSSLDYTVKIWDIS 183

>KAFR0F01060 Chr6 complement(201465..203126) [1662 bp, 553 aa] {ON}
           Anc_6.276 YPL247C
          Length = 553

 Score = 47.4 bits (111), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 41/165 (24%), Positives = 76/165 (46%), Gaps = 21/165 (12%)

Query: 167 LISGSDDSTIALWDATNDKLKQPIQEWTTSHSDIVNDCQWHCFNTNMFGSVSEDSTLQLF 226
           LIS S D+T  +WD  +      ++    +H   V D ++   +T +F S   D ++++F
Sbjct: 296 LISSSIDTTCIVWDLQSSNY---VKTQLIAHDSEVYDVRFLTKSTQLFASCGGDGSVRVF 352

Query: 227 DKRNGGKSDVKISSKGQYNSIAFSGFSE---------------NLFAA-AGTTNNIYLYD 270
           D R+   S   I  +   N ++ +  S+               N+ A     +N I + D
Sbjct: 353 DLRSLAHS--TIIYEPPTNPVSNADLSQQQNALLRLEPSPTDANVIATFVSESNKILILD 410

Query: 271 IRNTGKILHSMTGHEEPVTSLEFSNDKDGILISGSSDRRVIMWDL 315
           +RN+   +  + GH+  +  +++   K  IL+S S D +V+ WDL
Sbjct: 411 MRNSESPVLVLEGHKSAINQIKWHPTKRYILLSCSDDCQVLYWDL 455

 Score = 38.9 bits (89), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 43/182 (23%), Positives = 82/182 (45%), Gaps = 11/182 (6%)

Query: 201 VNDCQWHCFNTNMFGSVSEDSTLQLFDKRNGGKSDVK-ISSKGQYNSIAFSGFSENLFAA 259
           V    W+  +TN+  S S D+T  ++D ++      + I+   +   + F   S  LFA+
Sbjct: 283 VTSFDWNQTDTNLLISSSIDTTCIVWDLQSSNYVKTQLIAHDSEVYDVRFLTKSTQLFAS 342

Query: 260 AGTTNNIYLYDIRNTGKILHSMTGHE---EPVTSLEFSNDKDGILI--SGSSDRRVIMWD 314
            G   ++ ++D+R    + HS   +E    PV++ + S  ++ +L      +D  VI   
Sbjct: 343 CGGDGSVRVFDLR---SLAHSTIIYEPPTNPVSNADLSQQQNALLRLEPSPTDANVIATF 399

Query: 315 LFEIGAEQQPDEADDGLPEVMMIHAGSRSAINDISTHPSIPWLNASVEENNIVQVWKCSS 374
           + E       D  +   P  +++  G +SAIN I  HP+  ++  S  ++  V  W  +S
Sbjct: 400 VSESNKILILDMRNSESP--VLVLEGHKSAINQIKWHPTKRYILLSCSDDCQVLYWDLNS 457

Query: 375 KL 376
             
Sbjct: 458 TF 459

 Score = 34.3 bits (77), Expect = 0.54,   Method: Compositional matrix adjust.
 Identities = 29/134 (21%), Positives = 61/134 (45%), Gaps = 10/134 (7%)

Query: 103 AHDGEINRARYMPQNTNIIATVNGEGTIFIYDCSRDKQSALLSTLKYHKDNAYGLAFNPN 162
           AHD E+   R++ ++T + A+  G+G++ ++D      S ++     +  +   L+   N
Sbjct: 322 AHDSEVYDVRFLTKSTQLFASCGGDGSVRVFDLRSLAHSTIIYEPPTNPVSNADLSQQQN 381

Query: 163 AEGEL-ISGSDDSTIALWDATNDKL--------KQPIQEWTTSHSDIVNDCQWHCFNTNM 213
           A   L  S +D + IA + + ++K+        + P+      H   +N  +WH     +
Sbjct: 382 ALLRLEPSPTDANVIATFVSESNKILILDMRNSESPVLV-LEGHKSAINQIKWHPTKRYI 440

Query: 214 FGSVSEDSTLQLFD 227
             S S+D  +  +D
Sbjct: 441 LLSCSDDCQVLYWD 454

>KNAG0A01230 Chr1 complement(17341..21306) [3966 bp, 1321 aa] {ON}
           Anc_3.22 YOL138C
          Length = 1321

 Score = 47.8 bits (112), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 48/198 (24%), Positives = 78/198 (39%), Gaps = 29/198 (14%)

Query: 119 NIIATVNGEGTIFIYDCSRDKQ--SALLSTLKYHKDNAYGLAFNPNAEGELISGSDDSTI 176
           N +A      T+ ++D +R  Q  SAL+S+L  H  +     FN      LISG  D  +
Sbjct: 205 NYVAVCTNSTTVSLFDINRANQTDSALVSSLAEHTRSVNSFDFNMMQTNLLISGGQDGCV 264

Query: 177 ALWD-ATNDKLKQPIQEWTTSHSDIVNDCQWHCFNTNMFGSVSEDSTLQLFDKRNGGKSD 235
            +WD  TN+  K            IVN C      T  FGS+ +   +  ++     ++ 
Sbjct: 265 KIWDIRTNNPTK------------IVNTCDVRINTT--FGSIRDIKWMPGYNFSGNDRNY 310

Query: 236 VKISSKGQYNSIAFSGFSENLFAAAGTTNNIYLYDIRNTGKILHSMTGHEEPVTSLEFSN 295
             + S G Y            FA+   +  +  +D+R   +    +  H  P   L +  
Sbjct: 311 TDLRSHGGYK-----------FASIHDSGALLKFDMRQPNQPEKRINAHTGPGLCLNWHP 359

Query: 296 DKDGILISGSSDRRVIMW 313
            +D I  SG  D +  +W
Sbjct: 360 HQDYI-ASGGRDGKCCLW 376

 Score = 33.1 bits (74), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 18/66 (27%), Positives = 32/66 (48%), Gaps = 4/66 (6%)

Query: 254 ENLFAAAGTTNNIYLYDIRNTGK----ILHSMTGHEEPVTSLEFSNDKDGILISGSSDRR 309
           +N  A    +  + L+DI    +    ++ S+  H   V S +F+  +  +LISG  D  
Sbjct: 204 KNYVAVCTNSTTVSLFDINRANQTDSALVSSLAEHTRSVNSFDFNMMQTNLLISGGQDGC 263

Query: 310 VIMWDL 315
           V +WD+
Sbjct: 264 VKIWDI 269

>Smik_14.14 Chr14 (25114..26514) [1401 bp, 466 aa] {ON} YNL317W
           (REAL)
          Length = 466

 Score = 47.4 bits (111), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 46/215 (21%), Positives = 96/215 (44%), Gaps = 11/215 (5%)

Query: 103 AHDGEINRARYMPQNTNIIATVNGEGTIFIYDCSRDKQSALLSTLKYHKDNAYGLAFNPN 162
           AHD  +   +Y   +++ + + + +G I I+   +   S +      H ++   +AF+ N
Sbjct: 133 AHDSAVTTMKY-SHDSDWMISGDADGMIKIW---QPNFSMVKEIDAAHTESIRDMAFSSN 188

Query: 163 AEGELISGSDDSTIALWDATNDKLKQPIQEWTTSHSDIVNDCQWHCFNTNMFGSVSEDST 222
            + + ++ SDD+ + +W+ +N K ++ +    + H   V  C WH     +  S S+D+ 
Sbjct: 189 -DSKFVTCSDDNILKIWNFSNGKEERVL----SGHHWDVKSCDWHP-EMGLIASASKDNL 242

Query: 223 LQLFDKRNGGKSDVKISSKGQYNSIAFSGFSENLFAAAGTTNNIYLYDIRNTGKILHSMT 282
           ++L+D R+G      +  K       F     NL  A     +  ++DIR + K L  + 
Sbjct: 243 VKLWDPRSGNCISSILKFKHTVLKTRFQPVKGNLLMAISKDKSCRVFDIRYSMKELMCVR 302

Query: 283 GHEEPVTSLEFSNDKDGILISGSSDRRVIMWDLFE 317
              + +T LE+    + +      D  +  +DL +
Sbjct: 303 DETDYMT-LEWHPINESMFTLACYDGSLKHFDLLQ 336

>KNAG0A03080 Chr1 complement(380346..381686) [1341 bp, 446 aa] {ON} 
          Length = 446

 Score = 47.0 bits (110), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 46/197 (23%), Positives = 82/197 (41%), Gaps = 34/197 (17%)

Query: 209 FNTNMFGSVSEDSTLQLFDKRNGGKSDVKIS--SKGQYNSIAFSGFSENLFAAAGTTNNI 266
           F+   FGS S+D+T++ +D R   K    +S    G+  +   S  +  LF    +T  I
Sbjct: 241 FDNYTFGSCSDDNTIRFWDIRTADKPIFSLSEPKNGKLTAFDASQITNELFVTGTSTGVI 300

Query: 267 YLYDIRN----TGKILHSMTGHE--------------EPVTSLEFSNDKDGILISGSSDR 308
            L+DIR+    T  + H   GH+              + V  ++FS        +     
Sbjct: 301 KLWDIRSVEFATTDLTHRQNGHDPIQTELVNLYHSGGDSVADVQFSPTSSSEFATVGGSG 360

Query: 309 RVIMWDLFEIGAEQQPDEAD--DGLPE--------VMMIHAGS----RSAINDISTHPSI 354
            V  WD+    ++   D+A     LP         +   H G+    R+  N ++ HP+I
Sbjct: 361 NVYHWDMEFFFSQNDDDDAGATAKLPAPEELQGQCLKFFHIGNNQQKRNVKNSVAWHPTI 420

Query: 355 PWLNASVEENNIVQVWK 371
             L  +V++ +++ V+K
Sbjct: 421 DDLVCTVDDTSLISVYK 437

>AFR199C Chr6 complement(799873..800295,800490..801071) [1005 bp,
           334 aa] {ON} Syntenic homolog of Saccharomyces
           cerevisiae YMR116C (ASC1); 1-intron
          Length = 334

 Score = 47.0 bits (110), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 49/194 (25%), Positives = 89/194 (45%), Gaps = 13/194 (6%)

Query: 136 SRDKQSALLSTLKYHKDNAYGLAFNPNAEGELISGSDDSTIALWDATND--KLKQPIQEW 193
           S D+   L  TL+ H      L+ +P     L+SGS D T+  W  T +  +   P++ +
Sbjct: 18  STDEILVLRGTLEGHNGWVTSLSTSPAQPNMLLSGSRDKTLITWKLTGEDQQYGVPVRSF 77

Query: 194 TTSHSDIVNDCQWHCFNTNMFGSVSEDSTLQLFDKRNGGKSDVKISSKGQYNSIAFSGFS 253
              HS IV DC     +     S S D TL+L+D ++G      +  K    S++    +
Sbjct: 78  -KGHSHIVQDCT-VTHDGKYALSASWDKTLRLWDLQSGKCIKRFVGHKSDVMSVSIDPRA 135

Query: 254 ENLFAAAGTTNNIYLYDIRNTGKILHSMTGHEEPVTSLEFS----NDKDGILISGSSDRR 309
             + +A+     + +++    G  + ++ GH + V+++  +    +D    +IS   D+ 
Sbjct: 136 TQIVSAS-RDKTVKVWN--TVGDCVVTLLGHNDWVSNVRIAPSEKSDDAVTVISAGMDKV 192

Query: 310 VIMWDL--FEIGAE 321
           V +WDL  F I A+
Sbjct: 193 VKVWDLQSFTIEAD 206

 Score = 31.6 bits (70), Expect = 3.2,   Method: Compositional matrix adjust.
 Identities = 18/44 (40%), Positives = 26/44 (59%), Gaps = 2/44 (4%)

Query: 280 SMTGHEEPVTSLEFSNDKDGILISGSSDRRVIMWDLFEIGAEQQ 323
           ++ GH   VTSL  S  +  +L+SGS D+ +I W L   G +QQ
Sbjct: 28  TLEGHNGWVTSLSTSPAQPNMLLSGSRDKTLITWKL--TGEDQQ 69

>TPHA0P01490 Chr16 complement(302996..304375) [1380 bp, 459 aa] {ON}
           Anc_3.25 YNL317W
          Length = 459

 Score = 47.0 bits (110), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 46/171 (26%), Positives = 78/171 (45%), Gaps = 12/171 (7%)

Query: 103 AHDGEINRARYMPQNTNIIATVNGEGTIFIYDCSRDKQSALLSTLKYHKDNAYGLAFNPN 162
           AHD  +    Y      +I+  + +GTI I+  + +    L    K H +    +AF+ N
Sbjct: 126 AHDTSVTAMEYSHAGDWMISG-DADGTIKIWQPNFNMVKELD---KAHTECIRDIAFSKN 181

Query: 163 AEGELISGSDDSTIALWDATNDKLKQPIQEWTTS-HSDIVNDCQWHCFNTNMFGSVSEDS 221
            + + ++ SDD+ + +W+ +N K     QE T S H   V  C WH     +  S S+D+
Sbjct: 182 -DSKFVTCSDDNILKIWNFSNGK-----QERTLSGHHWDVKSCDWHP-EMGLIVSASKDN 234

Query: 222 TLQLFDKRNGGKSDVKISSKGQYNSIAFSGFSENLFAAAGTTNNIYLYDIR 272
            ++L+D R+G      ++ K       F     NL AA     +  ++DIR
Sbjct: 235 LIKLWDPRSGQCVSTLLNFKHTVLKTKFQPTKGNLLAAISKDKSCRVFDIR 285

 Score = 45.1 bits (105), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 45/200 (22%), Positives = 88/200 (44%), Gaps = 11/200 (5%)

Query: 116 QNTNIIATVNGEGTIFIYDCSRDKQSALLSTLKYHKDNAYGLAFNPNAEGELISGSDDST 175
           +N +   T + +  + I++ S  KQ   LS    H  +     ++P   G ++S S D+ 
Sbjct: 180 KNDSKFVTCSDDNILKIWNFSNGKQERTLSG---HHWDVKSCDWHPEM-GLIVSASKDNL 235

Query: 176 IALWDATNDKLKQPIQEWTTSHSDIVNDCQWHCFNTNMFGSVSEDSTLQLFDKRNGGKSD 235
           I LWD  + +    +  +  +    V   ++     N+  ++S+D + ++FD R   K  
Sbjct: 236 IKLWDPRSGQCVSTLLNFKHT----VLKTKFQPTKGNLLAAISKDKSCRVFDIRYHMKEL 291

Query: 236 VKISSKGQYNSIAFSGFSENLFAAAGTTNNIYLYDIRNTGKILHSMT--GHEEPVTSLEF 293
             I  +  Y ++ +   +E++F  A     I  +DI    +    +    H++ +TSL +
Sbjct: 292 TVIRDEVDYMTLLWHPTNESMFTIASYDGAIKHFDILQNLEEPQQVIPYAHDKCITSLSY 351

Query: 294 SNDKDGILISGSSDRRVIMW 313
            N    IL S + DR +  W
Sbjct: 352 -NPVGHILASAAKDRTIRFW 370

>Kpol_1031.36 s1031 complement(87105..89225) [2121 bp, 706 aa] {ON}
           complement(87105..89225) [2121 nt, 707 aa]
          Length = 706

 Score = 47.4 bits (111), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 52/179 (29%), Positives = 72/179 (40%), Gaps = 44/179 (24%)

Query: 141 SALLSTLKYHKDNAYGLAFNPNAEGELISGSDDSTIALWDATNDKLKQPIQEWTTSHSDI 200
           ++ + T   H      L+F+      L+S S D TI  WD  N K  Q I       S +
Sbjct: 487 NSCIHTFDSHSGGITALSFDS---VHLVSASQDKTIRQWDLVNGKCIQTID-----LSSV 538

Query: 201 VNDCQWHCFNTNMFGSVSE---DSTLQLFDKRNGGKSDVKISSKGQYNSIAFSGFSENLF 257
           V   Q    N   F S SE     +LQ FD                              
Sbjct: 539 VKQNQTDIVNIPDFYSSSEPFVTGSLQCFDAA---------------------------- 570

Query: 258 AAAGTTNN-IYLYDIRNTGKILHSMTGHEEPVTSLEFSNDKDGILISGSSDRRVIMWDL 315
            A GT +  + L+D+R +GK++ +  GH   VTSL+F +     LISGS D+ +  WDL
Sbjct: 571 LATGTRDGLVRLWDMR-SGKVVRTFMGHTNAVTSLKFDSYN---LISGSLDKSIRTWDL 625

>KAFR0B05700 Chr2 complement(1176020..1177138) [1119 bp, 372 aa]
           {ON} Anc_8.316 YDR142C
          Length = 372

 Score = 47.0 bits (110), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 52/235 (22%), Positives = 95/235 (40%), Gaps = 38/235 (16%)

Query: 151 KDNAYGLAFNPNAEGELISGSDDSTIALWDATNDKLKQPIQEWTTSHSDIVNDCQWHCFN 210
           +D  + +A+N   E +++    D ++ L+D T   LK    E    H   V  C W+   
Sbjct: 60  QDCLFDVAWNELHENQVLVAQGDGSLRLFDTT---LKDYPIEIFNEHEREVFSCSWNLIT 116

Query: 211 TNMFGSVSEDSTLQLFDK-----------------RNGGKSDVKISSKGQYNSIA----- 248
            N F S S D T++++                   +N  + D+ IS++  + +I+     
Sbjct: 117 KNTFTSSSWDGTVKIWSPLRKASLLTLVPHPLKVMKNFDQVDIPISNQKAHTAISKNKNC 176

Query: 249 -----FSGFSENLFAAAGTTNNIYLYDIR-----NTGKILHSMTGHEEPVTSLEFSNDKD 298
                FS    NL       +   L+D+R     N  +   S +G E    + +F+  + 
Sbjct: 177 IYQAQFSPHDPNLVICCAGNSYTTLFDLRQPSTSNNQQNFFSHSGLE--ALTCDFNKYRP 234

Query: 299 GILISGSSDRRVIMWDLFEIGAE-QQPDEADDGLPEVMMIHAGSRSAINDISTHP 352
            I+ +G  D  + +WDL  +  + Q   + D+ +  V  I  G   A+  +S  P
Sbjct: 235 NIVATGGVDNTIRIWDLRMLSKQFQAGTQRDNSIMCVNEIKKGHELAVRKVSWSP 289

>ZYRO0C03124g Chr3 complement(240321..241658) [1338 bp, 445 aa] {ON}
           highly similar to uniprot|Q75AV4 Ashbya gossypii ADL184W
           PSF2 Polyadenylation factor subunit 2 and similar to
           YNL317W uniprot|P42841 Saccharomyces cerevisiae YNL317W
           PFS2 Integral subunit of the pre-mRNA cleavage and
           polyadenylation factor (CPF) complex plays an essential
           role in mRNA 3'-end formation by bridging different
           processing factors and thereby promoting the assembly of
           the processing complex
          Length = 445

 Score = 47.0 bits (110), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 44/200 (22%), Positives = 92/200 (46%), Gaps = 11/200 (5%)

Query: 116 QNTNIIATVNGEGTIFIYDCSRDKQSALLSTLKYHKDNAYGLAFNPNAEGELISGSDDST 175
            N +   T + +  + I++ S  +Q  +LS    H  +     ++P   G + S S D+ 
Sbjct: 175 HNDSKFVTCSDDNILKIWNFSNGQQERVLSG---HHWDVKSCDWHPQM-GLIASASKDNL 230

Query: 176 IALWDATNDKLKQPIQEWTTSHSDIVNDCQWHCFNTNMFGSVSEDSTLQLFDKRNGGKSD 235
           + LWD  + +    + ++  +    V   ++     N+  ++S+D + ++FD R   K  
Sbjct: 231 VKLWDPRSGQCVSTLLKFKHT----VLKTKFQPTQGNLMAAISKDKSCRVFDLRQSMKEL 286

Query: 236 VKISSKGQYNSIAFSGFSENLFAAAGTTNNIYLYDI-RNTGKILHSMT-GHEEPVTSLEF 293
           +    +  Y ++ +   +E +F  A    ++  +DI ++T    H++   H++ +TSL +
Sbjct: 287 MVTRDEVDYMTLLWHPINETMFTVACYDGSLKNFDILQDTEGPTHTIPYAHDKCITSLSY 346

Query: 294 SNDKDGILISGSSDRRVIMW 313
            N    IL S S DR +  W
Sbjct: 347 -NPVGHILASASKDRTIRFW 365

 Score = 45.1 bits (105), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 41/176 (23%), Positives = 80/176 (45%), Gaps = 10/176 (5%)

Query: 103 AHDGEINRARYMPQNTNIIATVNGEGTIFIYDCSRDKQSALLSTLKYHKDNAYGLAFNPN 162
           AHD  +    Y      +I+  + +GTI I+  + +    L    + H +    +AF+ N
Sbjct: 121 AHDTAVTTMEYSRAGDWMISG-DTDGTIKIWQPNFNMVKELD---RAHTECIRDIAFSHN 176

Query: 163 AEGELISGSDDSTIALWDATNDKLKQPIQEWTTSHSDIVNDCQWHCFNTNMFGSVSEDST 222
            + + ++ SDD+ + +W+ +N + ++ +    + H   V  C WH     +  S S+D+ 
Sbjct: 177 -DSKFVTCSDDNILKIWNFSNGQQERVL----SGHHWDVKSCDWHP-QMGLIASASKDNL 230

Query: 223 LQLFDKRNGGKSDVKISSKGQYNSIAFSGFSENLFAAAGTTNNIYLYDIRNTGKIL 278
           ++L+D R+G      +  K       F     NL AA     +  ++D+R + K L
Sbjct: 231 VKLWDPRSGQCVSTLLKFKHTVLKTKFQPTQGNLMAAISKDKSCRVFDLRQSMKEL 286

>KLTH0H06160g Chr8 complement(538741..540465) [1725 bp, 574 aa] {ON}
           similar to uniprot|P26309 Saccharomyces cerevisiae
           YGL116W CDC20 Cell-cycle regulated activator of
           anaphase- promoting complex/cyclosome (APC/C) which is
           required for metaphase/anaphase transition directs
           ubiquitination of mitotic cyclins Pds1p and other
           anaphase inhibitors potential Cdc28p substrate
          Length = 574

 Score = 47.4 bits (111), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 54/233 (23%), Positives = 104/233 (44%), Gaps = 25/233 (10%)

Query: 120 IIATVNGEGTIFIYDCSRDKQSALLSTLKYHKDNAYGLAFNPNAEGELISGSDDSTIALW 179
           +IAT    G I I D     ++ ++ST + H+    G+++ P+   ++ SGS+D+T+ +W
Sbjct: 333 LIATGAKSGEIHINDVR--IKNHIVSTWEEHRGEVCGISYRPDGL-QVASGSNDNTVVIW 389

Query: 180 DATNDKLKQPIQEWTTSHSDIVNDCQWHCFNTNMF--GSVSEDSTLQLFDKRNGGKSDVK 237
           D T   L Q I+     H+  V    W     N+   G    D  +  ++   G ++   
Sbjct: 390 D-TRTSLPQHIKR---QHTAAVKALAWSPDINNLLATGGGQTDKHIHFWNTTTGARTG-S 444

Query: 238 ISSKGQYNSIAF------SGFSENLFAAAGTTNN---IYLYDIR-NTGKILHSMTGHEEP 287
           I++  Q +S+ +      +     + A  G   N   +Y YD +    +I+H+   HE  
Sbjct: 445 INTGSQVSSLHWGQSYNANTIQREIVATGGNPENAVSVYNYDTKFKVAEIVHA---HEAR 501

Query: 288 VTSLEFSNDKDGILISGSSDRRVIMWDLFEIGAEQQPDEADDGLPEVMMIHAG 340
           + S + S D   +L +   D  +  + +FE    ++P    DG   + +++ G
Sbjct: 502 ICSSQLSPDGT-VLATVGGDENLKFYKVFE-PRRKRPQGVCDGESLLGLLNVG 552

>ZYRO0F07282g Chr6 (590095..591378) [1284 bp, 427 aa] {ON} similar
           to uniprot|Q12417 Saccharomyces cerevisiae YPL151C PRP46
           Splicing factor that is found in the Cef1p subcomplex of
           the spliceosome
          Length = 427

 Score = 47.0 bits (110), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 49/213 (23%), Positives = 91/213 (42%), Gaps = 26/213 (12%)

Query: 143 LLSTLKYHKDNAYGLAFNPNAEGELISGSDDSTIALWDATNDKLKQPIQEWTTSHSDIVN 202
           L+  +  H      L  +P       +GS+D+T+ +WD  + KLK  +      H   V 
Sbjct: 107 LIRVINGHVGWVRCLKVDPVDNEWFATGSNDTTVKIWDLASGKLKLTL----AGHVMTVR 162

Query: 203 DCQWHCFNTNMFGSVSEDSTLQLFDKRNGGKSDVKISSKGQYNSIAFSGF--SENLFAAA 260
           D      +  +F S SED  ++ +D     K+ +     G  + +       + +L A+A
Sbjct: 163 DVAISQRHPYLF-SASEDKMVKCWDLE---KNQIIRDYHGHLSGVHTVDIHPTLDLIASA 218

Query: 261 GTTNNIYLYDIRNTGKILHSMTGHEEPVTSLEFSNDKDGILISGSSDRRVIMWDLFEIGA 320
           G    + L+DIR+   ++ ++ GH+ P+T +        + +S S+D  V +WD+     
Sbjct: 219 GRDGVVKLWDIRSRTAVM-TLIGHKSPITKVHCLPVNPQV-VSSSTDATVRLWDVTA--- 273

Query: 321 EQQPDEADDGLPEVMMIHAGSRSAINDISTHPS 353
                    G    ++ H   + ++ D S HPS
Sbjct: 274 ---------GKSYKILTH--HKRSVRDFSLHPS 295

 Score = 41.6 bits (96), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 59/250 (23%), Positives = 106/250 (42%), Gaps = 56/250 (22%)

Query: 119 NIIATVNGEGTIFIYDCSRDKQSALLSTLKYHKD---NAYGLAFNPNAEGELISGSDDST 175
           ++IA+   +G + ++D  R + + +  TL  HK      + L  NP    +++S S D+T
Sbjct: 213 DLIASAGRDGVVKLWDI-RSRTAVM--TLIGHKSPITKVHCLPVNP----QVVSSSTDAT 265

Query: 176 IALWDATNDKLKQPIQEWTTSHSDIVNDCQWHCFNTNMFGSVSEDSTLQLFDKRNGG-KS 234
           + LWD T  K  + +    T H   V D   H    +M  + ++D  ++ +    G   +
Sbjct: 266 VRLWDVTAGKSYKIL----THHKRSVRDFSLHPSEFSMVSACTDD--IRSWKLPEGALLT 319

Query: 235 DVKISSKGQYNSIAFSGFSENLFAAAGTTNNIYLYDIRNTGKILHSMTGHEEPVTSLEFS 294
           +    S G  N+++ +   +++  A G    +  YD + +G    +M   E P  SLE  
Sbjct: 320 NFASESTGIINTLSVN--QDDVLFAGGDDGMLSFYDYK-SGHKYQTMATQEVP-GSLESE 375

Query: 295 N-------DKDGI-LISGSSDRRVIMWDLFEIGAEQQPDEADDGLPEVMMIHAGSRSAIN 346
                   D+ G+ LI+G +D+ + +W       +Q P       PE             
Sbjct: 376 RAILTSAFDRTGLRLITGEADKSIKVW-------KQIPHST----PE------------- 411

Query: 347 DISTHPSIPW 356
              THP +PW
Sbjct: 412 ---THPGLPW 418

>TBLA0F04240 Chr6 (1043577..1045760) [2184 bp, 727 aa] {ON}
           Anc_6.363 YCR084C
          Length = 727

 Score = 47.4 bits (111), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 47/180 (26%), Positives = 85/180 (47%), Gaps = 20/180 (11%)

Query: 147 LKYHKDNAYGLAFNPNAEGELISGSDDSTIALWDATNDKLKQPIQEWTTSHSDIVNDCQW 206
           LK H+ + Y L + P+ E +L+SGS D T+ +WD     L+      T S  D V     
Sbjct: 495 LKGHEQDIYSLDYFPSGE-KLVSGSGDKTVRIWD-----LRTGQCSLTLSIEDGVTTVSS 548

Query: 207 HCFNTNMFGSVSEDSTLQLFD-------KRNGGKSDVKISSKGQYNSIAFSGFSENLFAA 259
              N     + S D + +++D       KR   ++D++   K    S++F+   + L + 
Sbjct: 549 SPNNGKFIAAGSLDRSARIWDTETGFLLKRLDSQTDLQNGHKDSIYSVSFTKDGKKLVSG 608

Query: 260 AGTTNNIYLYDIRNTGKILH-----SMTGHEEPVTSLEFSNDKDGILISGSSDRRVIMWD 314
           +    ++ L+++  T    +     +  GH++ V S+  S + D  ++SGS DR V+ WD
Sbjct: 609 S-LDRSVKLWNLDTTNNNSNESCEVTFIGHKDFVLSVTTSQN-DEYVLSGSKDRGVLFWD 666

 Score = 40.4 bits (93), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 41/167 (24%), Positives = 81/167 (48%), Gaps = 18/167 (10%)

Query: 157 LAFNPNAEGELISGSDDSTIALWDATNDKLKQPIQEWTTSHSDIVNDCQWHCFNTNMFGS 216
           + F+P+ +  L +G++D  I +WD T  ++   ++     H   +    +      +  S
Sbjct: 463 VCFSPDGKF-LAAGAEDKLIRIWDITTKQIVMILK----GHEQDIYSLDYFPSGEKLV-S 516

Query: 217 VSEDSTLQLFDKRNGGKSDVKISSKGQYNSIAFSGFSENLFAAAGTTNNIYLYDIRNTGK 276
            S D T++++D R G +  + +S +    +++ S  +    AA     +  ++D   TG 
Sbjct: 517 GSGDKTVRIWDLRTG-QCSLTLSIEDGVTTVSSSPNNGKFIAAGSLDRSARIWDTE-TGF 574

Query: 277 ILHSM-------TGHEEPVTSLEFSNDKDGI-LISGSSDRRVIMWDL 315
           +L  +        GH++ + S+ F+  KDG  L+SGS DR V +W+L
Sbjct: 575 LLKRLDSQTDLQNGHKDSIYSVSFT--KDGKKLVSGSLDRSVKLWNL 619

 Score = 38.1 bits (87), Expect = 0.034,   Method: Compositional matrix adjust.
 Identities = 28/73 (38%), Positives = 44/73 (60%), Gaps = 9/73 (12%)

Query: 246 SIAFSGFSENLFAAAGTTNN-IYLYDIRNTGKILHSMTGHEEPVTSLEF--SNDKDGILI 302
           S+ FS   +  F AAG  +  I ++DI  T +I+  + GHE+ + SL++  S +K   L+
Sbjct: 462 SVCFS--PDGKFLAAGAEDKLIRIWDI-TTKQIVMILKGHEQDIYSLDYFPSGEK---LV 515

Query: 303 SGSSDRRVIMWDL 315
           SGS D+ V +WDL
Sbjct: 516 SGSGDKTVRIWDL 528

 Score = 33.9 bits (76), Expect = 0.78,   Method: Compositional matrix adjust.
 Identities = 47/228 (20%), Positives = 96/228 (42%), Gaps = 18/228 (7%)

Query: 103 AHDGEINRARYMPQNTNIIATVNGEGTIFIYDCSRDKQSALLSTLKYHKDNAYGLAFNPN 162
            H+ +I    Y P    +++  +G+ T+ I+D    + S  LS     +D    ++ +PN
Sbjct: 497 GHEQDIYSLDYFPSGEKLVSG-SGDKTVRIWDLRTGQCSLTLSI----EDGVTTVSSSPN 551

Query: 163 AEGELISGSDDSTIALWDATNDKLKQPIQEWT---TSHSDIVNDCQWHCFNTNMFGSVSE 219
               + +GS D +  +WD     L + +   T     H D +    +      +  S S 
Sbjct: 552 NGKFIAAGSLDRSARIWDTETGFLLKRLDSQTDLQNGHKDSIYSVSFTKDGKKLV-SGSL 610

Query: 220 DSTLQLFD---KRNGGKSDVKISSKGQYNSIAFSGFSEN-LFAAAGTTNNIYLYDIRNTG 275
           D +++L++     N      +++  G  + +     S+N  +  +G+ +   L+   N+G
Sbjct: 611 DRSVKLWNLDTTNNNSNESCEVTFIGHKDFVLSVTTSQNDEYVLSGSKDRGVLFWDTNSG 670

Query: 276 KILHSMTGHEEPVTSLEFSNDKD-----GILISGSSDRRVIMWDLFEI 318
             L  + GH+  V S+  +N +      G+  +GS D    +W   +I
Sbjct: 671 NPLLMLQGHKNSVISVAVANGQPLGPEFGVFSTGSGDFTAKIWRYRKI 718

>Suva_10.545 Chr10 (945641..947569) [1929 bp, 642 aa] {ON} YLR429W
           (REAL)
          Length = 642

 Score = 47.4 bits (111), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 46/176 (26%), Positives = 76/176 (43%), Gaps = 19/176 (10%)

Query: 159 FNPNAEGELISGSDDSTIALWDATN--------DKLKQPIQ----EWTTSHSDIVNDCQW 206
           F+P  +  + S SDDS I +WD           D+   PI     ++ T H+  V    +
Sbjct: 89  FDPFNDRRIASSSDDSKIGIWDVPENYKFHDHVDENGDPIDIKPVKFLTGHARKVGHVLY 148

Query: 207 HCFNTNMFGSVSEDSTLQLFDKRNGGKSDVKISSKGQYNSIAFSGFSENLFAAAGTTNNI 266
           H    N+  S S D T++L+D    GK  + +       S++FS +  N  A       +
Sbjct: 149 HPVAKNVLASSSGDYTVKLWDVET-GKDVITLKHPDMVTSMSFS-YDGNHLATVARDKKL 206

Query: 267 YLYDIRNTGKILHSMTGHE----EPVTSLEFSNDKDGILISGSSDRRVIMWDLFEI 318
            +++IR+  KI+     H     + V  L  S+       S  SDR++ +WD F +
Sbjct: 207 RVWNIRDE-KIVSEGPAHSGAKNQRVVWLGNSDRLATTGFSKLSDRQIGIWDAFNL 261

 Score = 33.5 bits (75), Expect = 0.91,   Method: Compositional matrix adjust.
 Identities = 31/135 (22%), Positives = 63/135 (46%), Gaps = 19/135 (14%)

Query: 197 HSDIVNDCQWHCFNTNMFGSVSEDSTLQLFD-----------KRNGGKSDVK-----ISS 240
           H+  V D  +  FN     S S+DS + ++D             NG   D+K        
Sbjct: 80  HTAQVLDTDFDPFNDRRIASSSDDSKIGIWDVPENYKFHDHVDENGDPIDIKPVKFLTGH 139

Query: 241 KGQYNSIAFSGFSENLFAAAGTTNNIYLYDIRNTGKILHSMTGHEEPVTSLEFSNDKDGI 300
             +   + +   ++N+ A++     + L+D+  TGK + ++  H + VTS+ FS D +  
Sbjct: 140 ARKVGHVLYHPVAKNVLASSSGDYTVKLWDVE-TGKDVITLK-HPDMVTSMSFSYDGNH- 196

Query: 301 LISGSSDRRVIMWDL 315
           L + + D+++ +W++
Sbjct: 197 LATVARDKKLRVWNI 211

>TDEL0A00410 Chr1 complement(70940..74728) [3789 bp, 1262 aa] {ON}
           Anc_3.22 YOL138C
          Length = 1262

 Score = 47.4 bits (111), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 50/213 (23%), Positives = 84/213 (39%), Gaps = 35/213 (16%)

Query: 119 NIIATVNGEGTIFIYDCSR--DKQSALLSTLKYHKDNAYGLAFNPNAEGELISGSDDSTI 176
           N +A  +    I ++D +R    +S+ ++ L  H  +     FN      +ISG  DS I
Sbjct: 189 NYVAVCSSSTAISVFDMNRTGSSESSFVTALSEHTRSINSFDFNTVQTNLIISGGQDSCI 248

Query: 177 ALWD--ATNDKLKQPIQEWTTSHSDIVNDCQWHCFNTNMFGSVSEDSTLQLFDKRNGGKS 234
            +WD  ++N K  +       + SD + D +W  F    F    E         +NG  +
Sbjct: 249 KVWDLRSSNAKNSKNCDLSINTASDSIRDVKWMPFQNYAFNHQQE--------FKNGSNA 300

Query: 235 DVKISSKGQYNSIAFSGFSENLFAAAGTTNNIYLYDIRNTGKILHSMTGHEEPVTSLEFS 294
             K      + SI +SG   N             +D+R  G+I   +  H  P   L + 
Sbjct: 301 GFK------FASIHYSGLLLN-------------FDLRQPGQIEKRINAHSGPGLCLSWH 341

Query: 295 NDKDGILISGSSDRRVIMWDLFEIGAEQQPDEA 327
            + + I  +G  D +  +W    +G  QQ + A
Sbjct: 342 PNLEYI-ATGGRDGKCGLW---YVGDRQQYENA 370

>CAGL0M05335g Chr13 complement(569132..571552) [2421 bp, 806 aa]
           {ON} similar to uniprot|P38129 Saccharomyces cerevisiae
           YBR198c Transcription initiation factor TFIID 90
          Length = 806

 Score = 47.4 bits (111), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 59/225 (26%), Positives = 103/225 (45%), Gaps = 16/225 (7%)

Query: 103 AHDGEINRARYMPQNTNIIATVNGEGTIFIYDCSRDKQSALLSTLKYHKDNAYGLAFNPN 162
            H G +    + P N  +++  + + T+ ++  S D  +AL++  K H    + + F+P 
Sbjct: 531 GHSGTVYSTSFSPDNMYLVSG-SEDKTVKLW--SMDTHTALVN-YKGHNHPVWDVKFSPL 586

Query: 163 AEGELISGSDDSTIALWDATNDKLKQPIQEWTTSHSDIVNDCQWHCFNTNMFGSVSEDST 222
                 S S D T  LW   +     P++ +   H++ V+   +H     +F + S D T
Sbjct: 587 GH-YFASASHDQTARLWACDH---IYPLRIFA-GHTNDVDTVSFHPNGCYVF-TGSSDKT 640

Query: 223 LQLFDKRNGGKSDVKISSKGQYNSIAFSGFSENLFAAAGTTNN-IYLYDIRNTGKILHSM 281
            +++D   G    + +       S   S   +  + A G+ +  I L+DI  TGK +  M
Sbjct: 641 CRMWDVSTGDSVRLFLGHTAPVLSTQVS--PDGRWLATGSEDGVICLWDI-GTGKRIKQM 697

Query: 282 TGH-EEPVTSLEFSNDKDGILISGSSDRRVIMWDLFEIGAEQQPD 325
            GH +  V SL F N +  +LISG +D  V +WD+     EQ P+
Sbjct: 698 RGHGKNAVHSLSF-NKEGNVLISGGADHSVRVWDVKHGTTEQGPE 741

>TPHA0G01610 Chr7 complement(332529..333773) [1245 bp, 414 aa] {ON}
           Anc_8.672 YPL151C
          Length = 414

 Score = 46.6 bits (109), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 41/147 (27%), Positives = 72/147 (48%), Gaps = 8/147 (5%)

Query: 169 SGSDDSTIALWDATNDKLKQPIQEWTTSHSDIVNDCQWHCFNTNMFGSVSEDSTLQLFDK 228
           +GS D+TI +WD  + KLK  +    + H   V D      +  +F S SED  ++ +D 
Sbjct: 120 TGSSDTTIKIWDLESGKLKITL----SGHVMPVRDIAISKRSPYLF-SASEDKLIKCWDL 174

Query: 229 RNGGKSDVKISSKGQYNSIAFSGFSENLFAAAGTTNNIYLYDIRNTGKILHSMTGHEEPV 288
                           N++     + +L A AG  + I L+DIR+   ++ ++ GH+ PV
Sbjct: 175 EKNMAIREYFGHLSGVNTVDVHP-TLDLIATAGRDSTIRLWDIRSRTAVM-TLIGHKAPV 232

Query: 289 TSLEFSNDKDGILISGSSDRRVIMWDL 315
           T+++     D  ++S S+D  V +WD+
Sbjct: 233 TTVKCI-PVDPQVVSASNDATVKLWDI 258

 Score = 39.7 bits (91), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 59/243 (24%), Positives = 103/243 (42%), Gaps = 36/243 (14%)

Query: 102 FAHDGEINRARYMPQNTNIIATVNGEGTIFIYDCSRDKQSALLSTLKYHKDNAYGLAFNP 161
           F H   +N     P   ++IAT   + TI ++D    +    + TL  HK     +   P
Sbjct: 184 FGHLSGVNTVDVHP-TLDLIATAGRDSTIRLWDI---RSRTAVMTLIGHKAPVTTVKCIP 239

Query: 162 NAEGELISGSDDSTIALWDATNDKLKQPIQEWTTSHSDI-VNDCQWH----CFNTNMFGS 216
             + +++S S+D+T+ LWD    K  + +     +  DI VN  ++     C +      
Sbjct: 240 -VDPQVVSASNDATVKLWDIVAGKAIKTLTHHKRTVRDIAVNPTEFSIASACTDDIRSWR 298

Query: 217 VSEDSTLQLFDKRNGGKSDVKISSKGQYNSIAFSGFSENLFAAAGTTNNIYLYDIRNTGK 276
           + E S L  F+            + G  NSI+ +   +N+ AA G    +  +D ++  K
Sbjct: 299 LPEGSLLTNFES----------DTLGIVNSISIN--QDNIMAACGDNGVLSFFDYKSGHK 346

Query: 277 ILH----SMTG---HEEPVTSLEFSNDKDG-ILISGSSDRRVIMWDLFEIGAEQQPDEAD 328
                  +M+G    E+ + S  F  D  G I I+G +D+ + MW    I  ++   E+ 
Sbjct: 347 YQKIATTAMSGSLESEKGILSGTF--DATGQIFITGETDKSIKMW----IKIKRATKESH 400

Query: 329 DGL 331
            GL
Sbjct: 401 PGL 403

 Score = 38.9 bits (89), Expect = 0.019,   Method: Compositional matrix adjust.
 Identities = 29/119 (24%), Positives = 56/119 (47%), Gaps = 17/119 (14%)

Query: 257 FAAAGTTNNIYLYDIRNTGKILHSMTGHEEPVTSLEFSNDKDGILISGSSDRRVIMWDLF 316
           FA   +   I ++D+  +GK+  +++GH  PV  +  S  +   L S S D+ +  WDL 
Sbjct: 118 FATGSSDTTIKIWDLE-SGKLKITLSGHVMPVRDIAISK-RSPYLFSASEDKLIKCWDL- 174

Query: 317 EIGAEQQPDEADDGLPEVMMIHAGSRSAINDISTHPSIPWLNASVEENNIVQVWKCSSK 375
                    E +  + E    + G  S +N +  HP++  L A+   ++ +++W   S+
Sbjct: 175 ---------EKNMAIRE----YFGHLSGVNTVDVHPTLD-LIATAGRDSTIRLWDIRSR 219

>KLLA0E21187g Chr5 (1892524..1893813) [1290 bp, 429 aa] {ON} similar
           to uniprot|P40968 Saccharomyces cerevisiae YDR364C CDC40
           Pre-mRNA splicing factor important for catalytic step II
           of pre-mRNA splicing and plays a role in cell cycle
           progression required for DNA synthesis during mitosis
           and meiosis has WD repeats
          Length = 429

 Score = 47.0 bits (110), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 54/214 (25%), Positives = 93/214 (43%), Gaps = 15/214 (7%)

Query: 150 HKDNAYGLAFNPNAEGELISGSDDSTIALWDATNDKLKQPIQEWTTSHSDIVNDCQWHCF 209
           HK+    L F P     L+SG +D+ I LWD  +++      E    HS  + D  +   
Sbjct: 134 HKNGTTSLRFIPKTGHLLLSGGNDNIIKLWDFYHERELLRTYE---GHSMTIKDLNF-TD 189

Query: 210 NTNMFGSVSEDSTLQLFDKRNGGKSDVKISSKGQYNSIAFSGFSENLFAAAGTTNNIYLY 269
           N + F S S D  +++++    G  D ++      N I F    +N      + + I  Y
Sbjct: 190 NGHSFASASFDKWVKIWNTEK-GIIDKRLRFNSVPNCITFHPKDKNQLVVGLSNSEIRHY 248

Query: 270 DIR---NTGKILHSMTGHEEPVTSLEFSNDKDGILISGSSDRRVIMWD-LFEIGAEQQPD 325
           D+R   N G++      H+  + +L++  D    LIS S D+ V +W+    I  +Q   
Sbjct: 249 DLRLSENHGEV-QKYDHHQGSILALKYFPDGKK-LISSSEDKTVRIWENRINIPIKQISG 306

Query: 326 EADDGLPEVMMIHAG----SRSAINDISTHPSIP 355
            A   +P + +   G    ++S  N I T+  +P
Sbjct: 307 TAQHSMPWIDINPQGQSFCTQSMDNTIYTYSMLP 340

>Skud_3.145 Chr3 complement(225459..227006) [1548 bp, 515 aa] {ON}
           YCR072C (REAL)
          Length = 515

 Score = 47.0 bits (110), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 52/206 (25%), Positives = 88/206 (42%), Gaps = 26/206 (12%)

Query: 115 PQNTNIIATVNGEGTIFIYDCSRDKQSALLSTLKYHKDNAYGLAFNPNAEGELISGSDDS 174
           P +   +A+ + +GTI I+D           TL  H ++   + +    +G L SGS D 
Sbjct: 245 PGSKPRLASSSKDGTIKIWD---SVNRVCQYTLSGHTNSVSCVKWG--GQGLLYSGSHDR 299

Query: 175 TIALWDATNDKLKQPIQEWTTSHSDIVNDCQWHCFNTNMFGSVSEDSTLQL--FD---KR 229
           T+ +WD               S    +N  + H    N   S+S D  L++  FD   K+
Sbjct: 300 TVRVWDMN-------------SQGRCINILKSHAHWVNHL-SLSTDYALRVGAFDHTGKK 345

Query: 230 NGGKSDVKISSKGQYNSIAF-SGFSENLFAAAGTTNNIYLYDIRNTGKILHSMTGHEEPV 288
                + +  +   Y  I   +G SE +   A     ++L++   + K +  MTGH++ V
Sbjct: 346 PATSEEAQKKALENYEKICKKNGSSEEMMVTASDDFTMFLWNPLKSTKPIARMTGHQKLV 405

Query: 289 TSLEFSNDKDGILISGSSDRRVIMWD 314
             + FS D   I +S S D  + +WD
Sbjct: 406 NHVAFSPDGRYI-VSASFDNSIKLWD 430

 Score = 39.3 bits (90), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 40/183 (21%), Positives = 78/183 (42%), Gaps = 17/183 (9%)

Query: 145 STLKYHKDNAYGLAFNPNAEGELISGSDDSTIALWDATNDKLKQPIQEWTTSHSDIVNDC 204
           S +  H       AF P+    +++G+ D+T  +WD         ++     H + V   
Sbjct: 137 SAIAGHGSTILCSAFAPHTSSRMVTGAGDNTARIWDCDTQTPMHTLK----GHFNWVLCV 192

Query: 205 QWHCFNTNMFGSVSEDSTLQLFDKRNG--------GKSDVKISSKGQYNSIAFSGFSENL 256
            W   +  +  + S D+T++L++ + G        G S        +   +   G S+  
Sbjct: 193 SWS-PDGEVIATGSMDNTIRLWNPKTGECLGDALRGHSKWITCLSWEPIHLVKPG-SKPR 250

Query: 257 FAAAGTTNNIYLYDIRNTGKILHSMTGHEEPVTSLEFSNDKDGILISGSSDRRVIMWDLF 316
            A++     I ++D  N     ++++GH   V+ +++     G+L SGS DR V +WD+ 
Sbjct: 251 LASSSKDGTIKIWDSVNR-VCQYTLSGHTNSVSCVKWGG--QGLLYSGSHDRTVRVWDMN 307

Query: 317 EIG 319
             G
Sbjct: 308 SQG 310

 Score = 33.1 bits (74), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 22/84 (26%), Positives = 43/84 (51%), Gaps = 5/84 (5%)

Query: 103 AHDGEINRARYMPQNTNIIATVNGEGTIFIYDCSRDKQSALLSTLKYHKDNAYGLAFNPN 162
            H   +N   + P    I++  + + +I ++D  RD +   +ST + H  + Y +A++ +
Sbjct: 400 GHQKLVNHVAFSPDGRYIVS-ASFDNSIKLWD-GRDGK--FISTFRGHVASVYQVAWSSD 455

Query: 163 AEGELISGSDDSTIALWDATNDKL 186
               L+S S D+T+ +WD    KL
Sbjct: 456 CR-LLVSCSKDTTLKVWDVRTRKL 478

>TDEL0A02070 Chr1 (372046..372582,372798..373220) [960 bp, 319 aa]
           {ON} Anc_2.431 YMR116C
          Length = 319

 Score = 46.6 bits (109), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 50/188 (26%), Positives = 80/188 (42%), Gaps = 14/188 (7%)

Query: 143 LLSTLKYHKDNAYGLAFNPNAEGELISGSDDSTIALWDATND--KLKQPIQEWTTSHSDI 200
           L  TL+ H      LA +      L+S S D T+  W  T D  +   P++ +   HS I
Sbjct: 9   LRGTLEGHNGWVTSLATSAGQPNLLLSASRDKTLISWKLTGDDQQYGVPVRSF-KGHSHI 67

Query: 201 VNDCQWHCFNTNMFGSVSEDSTLQLFDKRNGGKSDVKISSKGQYNSIAFSGFSENLFAAA 260
           V DC           S S D TL+L+D   G      +  K    S+A      ++  + 
Sbjct: 68  VQDCALTADGAYAL-SASWDKTLRLWDVATGETYQRFVGHKSDVMSVAIDR-KASMIISG 125

Query: 261 GTTNNIYLYDIRNTGKILHSMTGHEEPVTSL-----EFSNDKDGILISGSSDRRVIMWDL 315
                + ++ I+  G+ L +M GH + V+ +     E  ND    +IS   D+ V  W++
Sbjct: 126 SRDKTVKVWTIK--GQCLATMLGHNDWVSQVRIVPTEDVNDDTVTVISAGMDKMVKAWNV 183

Query: 316 --FEIGAE 321
             F+I A+
Sbjct: 184 NQFQIEAD 191

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.314    0.131    0.391 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 43,779,990
Number of extensions: 1966136
Number of successful extensions: 9094
Number of sequences better than 10.0: 1092
Number of HSP's gapped: 7572
Number of HSP's successfully gapped: 1960
Length of query: 391
Length of database: 53,481,399
Length adjustment: 112
Effective length of query: 279
Effective length of database: 40,638,807
Effective search space: 11338227153
Effective search space used: 11338227153
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.9 bits)
S2: 67 (30.4 bits)