Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
TPHA0M001806.8ON50350326760.0
TDEL0G046306.8ON50351712511e-168
NDAI0G00860singletonON52352711701e-156
SAKL0E00792g6.8ON51151311361e-151
Kpol_1045.796.8ON50851710971e-145
CAGL0A01089g6.8ON53554310981e-145
KNAG0E027706.8ON50851410691e-141
Skud_16.56.8ON51552210471e-137
Smik_6.4806.8ON51651710351e-135
YPL272C6.8ON51751810321e-135
Suva_16.336.8ON51851910221e-133
TPHA0J002606.8ON51551610121e-132
KAFR0B065106.8ON5085249301e-120
TBLA0A072206.8ON5095278011e-100
NCAS0D021806.8ON5155237351e-90
KLTH0C11572g6.8ON5185216993e-85
Kwal_56.223416.8ON5195256095e-72
Ecym_30116.8ON5095195931e-69
ACR018C6.8ON4785195482e-63
Kpol_1032.1singletonON2462284123e-46
Kpol_191.16.8ON1391411593e-12
TDEL0E051105.119ON4694861171e-05
Kwal_27.98985.119ON4602991152e-05
TPHA0H009605.119ON4765001143e-05
CAGL0K00737g5.119ON4574601133e-05
Suva_7.5065.119ON4663211036e-04
YGR212W (SLI1)5.119ON468122980.003
Ecym_24835.119ON461171940.007
Skud_7.5485.119ON475477920.013
NDAI0D023605.119ON470469830.14
KNAG0G007005.119ON456127770.80
SAKL0E12650g2.82ON1673149751.7
Kpol_1010.495.119ON481179713.7
Kpol_520.27.463ON137881705.7
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= TPHA0M00180
         (503 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

TPHA0M00180 Chr13 (36974..38485) [1512 bp, 503 aa] {ON} Anc_6.8 ...  1035   0.0  
TDEL0G04630 Chr7 complement(843474..844985) [1512 bp, 503 aa] {O...   486   e-168
NDAI0G00860 Chr7 (181464..183035) [1572 bp, 523 aa] {ON}              455   e-156
SAKL0E00792g Chr5 (58155..59690) [1536 bp, 511 aa] {ON} similar ...   442   e-151
Kpol_1045.79 s1045 complement(184348..185874) [1527 bp, 508 aa] ...   427   e-145
CAGL0A01089g Chr1 complement(109009..110616) [1608 bp, 535 aa] {...   427   e-145
KNAG0E02770 Chr5 (557579..559105) [1527 bp, 508 aa] {ON} Anc_6.8...   416   e-141
Skud_16.5 Chr16 complement(5816..7363) [1548 bp, 515 aa] {ON} YP...   407   e-137
Smik_6.480 Chr6 (793043..794593) [1551 bp, 516 aa] {ON} YPL272C ...   403   e-135
YPL272C Chr16 complement(26611..28164) [1554 bp, 517 aa] {ON} Pu...   402   e-135
Suva_16.33 Chr16 complement(42245..43801) [1557 bp, 518 aa] {ON}...   398   e-133
TPHA0J00260 Chr10 (59857..61404) [1548 bp, 515 aa] {ON} Anc_6.8 ...   394   e-132
KAFR0B06510 Chr2 complement(1349540..1351066) [1527 bp, 508 aa] ...   362   e-120
TBLA0A07220 Chr1 (1800531..1802060) [1530 bp, 509 aa] {ON} Anc_6...   313   e-100
NCAS0D02180 Chr4 (406396..407943) [1548 bp, 515 aa] {ON} Anc_6.8      287   1e-90
KLTH0C11572g Chr3 complement(950297..951853) [1557 bp, 518 aa] {...   273   3e-85
Kwal_56.22341 s56 (56939..58498) [1560 bp, 519 aa] {ON} YPL272C ...   239   5e-72
Ecym_3011 Chr3 (22943..24472) [1530 bp, 509 aa] {ON} similar to ...   233   1e-69
ACR018C Chr3 complement(388482..389918) [1437 bp, 478 aa] {ON} S...   215   2e-63
Kpol_1032.1 s1032 (25..765) [741 bp, 246 aa] {ON} (25..765) [741...   163   3e-46
Kpol_191.1 s191 complement(429..848) [420 bp, 139 aa] {ON} compl...    66   3e-12
TDEL0E05110 Chr5 (941876..943285) [1410 bp, 469 aa] {ON} Anc_5.1...    50   1e-05
Kwal_27.9898 s27 (112396..113778) [1383 bp, 460 aa] {ON} YGR212W...    49   2e-05
TPHA0H00960 Chr8 (201187..202617) [1431 bp, 476 aa] {ON} Anc_5.1...    49   3e-05
CAGL0K00737g Chr11 complement(81263..82636) [1374 bp, 457 aa] {O...    48   3e-05
Suva_7.506 Chr7 (873531..874931) [1401 bp, 466 aa] {ON} YGR212W ...    44   6e-04
YGR212W Chr7 (917040..918446) [1407 bp, 468 aa] {ON}  SLI1N-acet...    42   0.003
Ecym_2483 Chr2 (946645..948030) [1386 bp, 461 aa] {ON} similar t...    41   0.007
Skud_7.548 Chr7 (891732..893159) [1428 bp, 475 aa] {ON} YGR212W ...    40   0.013
NDAI0D02360 Chr4 (545485..546897) [1413 bp, 470 aa] {ON} Anc_5.1...    37   0.14 
KNAG0G00700 Chr7 complement(132337..133707) [1371 bp, 456 aa] {O...    34   0.80 
SAKL0E12650g Chr5 complement(1042706..1047727) [5022 bp, 1673 aa...    33   1.7  
Kpol_1010.49 s1010 (113037..114482) [1446 bp, 481 aa] {ON} (1130...    32   3.7  
Kpol_520.2 s520 complement(641..4777) [4137 bp, 1378 aa] {ON} co...    32   5.7  

>TPHA0M00180 Chr13 (36974..38485) [1512 bp, 503 aa] {ON} Anc_6.8
           YPL272C
          Length = 503

 Score = 1035 bits (2676), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 503/503 (100%), Positives = 503/503 (100%)

Query: 1   MPFRALGGYEKKVLAQTIEGRRNGVVFSSQITFNKKSDEFADDNATLYTGRSVNEVSLKS 60
           MPFRALGGYEKKVLAQTIEGRRNGVVFSSQITFNKKSDEFADDNATLYTGRSVNEVSLKS
Sbjct: 1   MPFRALGGYEKKVLAQTIEGRRNGVVFSSQITFNKKSDEFADDNATLYTGRSVNEVSLKS 60

Query: 61  VLCAALQNIICNHVELYTTINDRLYFTPVLQIETNDVIKTISYDKSKDKALMKDQISDKL 120
           VLCAALQNIICNHVELYTTINDRLYFTPVLQIETNDVIKTISYDKSKDKALMKDQISDKL
Sbjct: 61  VLCAALQNIICNHVELYTTINDRLYFTPVLQIETNDVIKTISYDKSKDKALMKDQISDKL 120

Query: 121 LRHIFNKCDFKPNNGKPLWQFSIANDSTMIFHGHDVLFDIFSTANFEKYLLKEMNDVLNS 180
           LRHIFNKCDFKPNNGKPLWQFSIANDSTMIFHGHDVLFDIFSTANFEKYLLKEMNDVLNS
Sbjct: 121 LRHIFNKCDFKPNNGKPLWQFSIANDSTMIFHGHDVLFDIFSTANFEKYLLKEMNDVLNS 180

Query: 181 NQKLKTVKTLFKFDAERSLTNYPRSIYENPKLHLPALTSDLLNLQTQSFFKTIYQNTLKK 240
           NQKLKTVKTLFKFDAERSLTNYPRSIYENPKLHLPALTSDLLNLQTQSFFKTIYQNTLKK
Sbjct: 181 NQKLKTVKTLFKFDAERSLTNYPRSIYENPKLHLPALTSDLLNLQTQSFFKTIYQNTLKK 240

Query: 241 PIDLITSANSNNNNQLSEYRTRNTDILSGANSLCGRTVLGEISLERYQHLKMLVEQENIS 300
           PIDLITSANSNNNNQLSEYRTRNTDILSGANSLCGRTVLGEISLERYQHLKMLVEQENIS
Sbjct: 241 PIDLITSANSNNNNQLSEYRTRNTDILSGANSLCGRTVLGEISLERYQHLKMLVEQENIS 300

Query: 301 LRSFISAITMVCLKPIVKNFDGSIIFSIPVNLRSLIADSSDFGLFYKNIKVECPLELIND 360
           LRSFISAITMVCLKPIVKNFDGSIIFSIPVNLRSLIADSSDFGLFYKNIKVECPLELIND
Sbjct: 301 LRSFISAITMVCLKPIVKNFDGSIIFSIPVNLRSLIADSSDFGLFYKNIKVECPLELIND 360

Query: 361 EKYYTNPEVLHSMQNNSLLEIQFERISRHVSDVISQRMKAWEKFGFNDDDIKRMKFSNDE 420
           EKYYTNPEVLHSMQNNSLLEIQFERISRHVSDVISQRMKAWEKFGFNDDDIKRMKFSNDE
Sbjct: 361 EKYYTNPEVLHSMQNNSLLEIQFERISRHVSDVISQRMKAWEKFGFNDDDIKRMKFSNDE 420

Query: 421 KTGIAPIIQINDVTEISFDFGNDNISYSFSVNNLNFTKSLSCNEFMSLFYSHNAQGGLNI 480
           KTGIAPIIQINDVTEISFDFGNDNISYSFSVNNLNFTKSLSCNEFMSLFYSHNAQGGLNI
Sbjct: 421 KTGIAPIIQINDVTEISFDFGNDNISYSFSVNNLNFTKSLSCNEFMSLFYSHNAQGGLNI 480

Query: 481 CIHYPDGYNMEAFVECFQSFIEN 503
           CIHYPDGYNMEAFVECFQSFIEN
Sbjct: 481 CIHYPDGYNMEAFVECFQSFIEN 503

>TDEL0G04630 Chr7 complement(843474..844985) [1512 bp, 503 aa] {ON}
           Anc_6.8 YPL272C
          Length = 503

 Score =  486 bits (1251), Expect = e-168,   Method: Compositional matrix adjust.
 Identities = 254/517 (49%), Positives = 354/517 (68%), Gaps = 29/517 (5%)

Query: 1   MPFRALGGYEKKVLAQTIEGRRNGVVFSSQITFNKKSDEFADDNATLYTGRSVNEVSLKS 60
           M FR+LGG+EKK+L+Q++EG RNGVVF +   ++   +E++DD ATL T +  + ++L S
Sbjct: 1   MSFRSLGGFEKKILSQSLEGHRNGVVFGAM--YSTTPEEWSDD-ATLLTYKD-SRLNL-S 55

Query: 61  VLCAALQNIICNHVELYTTINDRLYFTPVLQIETNDVIKTISYDKSKDKAL-MKDQISDK 119
           +L   L  +I +HVEL+TTIN++L F PV +I+  +VI  +++   KD+ +  +      
Sbjct: 56  LLSRTLAKMISDHVELFTTINEKLEFAPVKEIKAEEVINAVTFGSYKDEFVNCRFGAPPY 115

Query: 120 LLRHIFNKCDFKPNNGKPLWQFSIANDSTMIFHGHDVLFDIFSTANFEKYLLKEMNDVLN 179
           LLRHIFN+  F+P +G  LWQ  + +++ ++FHGHDVLFDIFS ANF K  L+ +N +  
Sbjct: 116 LLRHIFNQTTFQPGSGNVLWQIYVVDETLVVFHGHDVLFDIFSAANFHKIFLQTLNSISK 175

Query: 180 SNQKLKTVKTLFKFDAERS-LTNYPRSIYENPKLHLPALTSDLLNLQTQSFFKTIYQNTL 238
           S  KL T+     F  E++ L  +P+SIY+N KL LPA  +DL NLQTQSFFK++Y N +
Sbjct: 176 SGSKLSTI-----FKLEKAVLPPFPKSIYDNAKLRLPAKAADLFNLQTQSFFKSLYFNAV 230

Query: 239 KKPIDLITSANSNNNNQLSEYRTRNTDILSGANSLCGRTVLGEISLERYQHLKMLVEQEN 298
           KKP+D I   NSN   QL EYRTR  DIL   N+LCG T+ G I  +R + L  + +Q+N
Sbjct: 231 KKPLDYI---NSNPPQQLKEYRTRYADILRTDNNLCGTTIFGRILPKRLESLDCIFKQQN 287

Query: 299 ISLRSFISAITMVCLKPIVKNFDGSIIFSIPVNLRSLIADSSDFGLFYKNIKVECPLELI 358
           I L+SF+  ITM+CLKPIVKN+ GSI F +PV+LRS +  SS+FG+FYK+I+VECPL LI
Sbjct: 288 ICLKSFVCGITMLCLKPIVKNYTGSITFCVPVDLRSSLEASSEFGMFYKDIRVECPLSLI 347

Query: 359 NDEKY--------YTNPEVLHSMQN----NSLLEIQFERISRHVSDVISQRMKAWEKFGF 406
           +D+ +        Y +  V    ++      LLE QF++++ HV   + QRMKAWEKFGF
Sbjct: 348 DDKNFNSLTVYNGYDSSAVKMPEKDPGYKEQLLEYQFKQVTDHVVAALRQRMKAWEKFGF 407

Query: 407 NDDDIKRMKFSNDEKTGIAPIIQINDVTEISFDFGNDNISYSFSVNNLNFTKSLSCNEFM 466
           NDDDIKRMKF +D+      +IQINDV++I  D  +++IS  F +  LN T+SL   + M
Sbjct: 408 NDDDIKRMKFGSDDTATNTKLIQINDVSDIPVD-AHEDISGKFHMRELNMTQSLKPGQLM 466

Query: 467 SLFYSHNAQGGLNICIHYPDGYNMEAFVECFQSFIEN 503
           SL Y+H ++ GL+ICIHYPDGYNME+FVECFQSFIE+
Sbjct: 467 SLSYTH-SEKGLDICIHYPDGYNMESFVECFQSFIED 502

>NDAI0G00860 Chr7 (181464..183035) [1572 bp, 523 aa] {ON} 
          Length = 523

 Score =  455 bits (1170), Expect = e-156,   Method: Compositional matrix adjust.
 Identities = 247/527 (46%), Positives = 344/527 (65%), Gaps = 30/527 (5%)

Query: 1   MPFRALGGYEKKVLAQTIEGRRNGVVFSSQIT--FNKKSDEFADDNATLYTGRSVNEVSL 58
           M  RAL  +EKKVL+QT++ +RNG+ ++++        SD    D ATL   + +  +++
Sbjct: 1   MSIRALSSFEKKVLSQTLDSKRNGISYTARYVSKVGSSSDSTLSDAATLLATKDI-RLNI 59

Query: 59  KSVLCAALQNIICNHVELYTTINDRLYFTPVLQIETNDVIKTISYDKSKDKAL-MKDQIS 117
             ++   L+ +I  H+ELY+TIN+   F  + +I+  DVI  I++D  KD+ +       
Sbjct: 60  -GIVTRVLERLIKKHIELYSTINENYEFQILTKIKPEDVISVITFDTYKDEQINCHSGAP 118

Query: 118 DKLLRHIFNKCDFKPNNGKPLWQFSIANDSTMIFHGHDVLFDIFSTANFEKYLLKEMNDV 177
             LLRHIFNK  F+ N  KPLW+  I +++ +IFHG D+LFDIFS ANF K    E+ND 
Sbjct: 119 PYLLRHIFNKEKFELN--KPLWKLYIIDETMIIFHGFDMLFDIFSAANFHKLFFDELNDY 176

Query: 178 LNSN----QKLKTVKTLFKFDAE-----RSLTNYPRSIYENPKLHLPALTSDLLNLQTQS 228
             +N       K +  +FK +        +   +PRSI++NPKLHLPA+T DL NLQT+S
Sbjct: 177 FLTNTFSKSNSKPLDVVFKINVSDKNFVPNFEEFPRSIFDNPKLHLPAMTPDLFNLQTKS 236

Query: 229 FFKTIYQNTLKKPIDLITSANSNNNN----QLSEYRTRN-TDILSGANSLCGRTVLGEIS 283
           FFKTIY NT+KKPIDL   +NS+  N    QL EY+T N  D+L   +SLCG TV G +S
Sbjct: 237 FFKTIYSNTIKKPIDLFNGSNSHTKNDITSQLKEYQTHNYLDMLGITSSLCGTTVFGTVS 296

Query: 284 LERYQHLKMLVEQENISLRSFISAITMVCLKPIVKNFDGSIIFSIPVNLRSLIADSSDFG 343
             RY +LK +++Q+ I LRSFI  I M+CLKP +KN+ G+IIFSIP+NLR+ I  + +FG
Sbjct: 297 PTRYNYLKGMMKQDEICLRSFICGIVMICLKPSIKNYSGNIIFSIPINLRNYIDGAKNFG 356

Query: 344 LFYKNIKVECPLELINDEKYYTN-------PEVLHSMQNNSLLEIQFERISRHVSDVISQ 396
           LFYK++K++CPL LI+D  +  N       P+      N  LLE QF++++  + +VI +
Sbjct: 357 LFYKDVKIDCPLSLIDDRNFKYNGYKDSSIPDENDLEFNEKLLEYQFKQVTEFIENVILE 416

Query: 397 RMKAWEKFGFNDDDIKRMKFSNDEKTGI-APIIQINDVTEISFDFGNDNISYSFSVNNLN 455
           R+K WEKF FNDDDIKRMKF +DE  G  + IIQIND TEI     NDN + +F++ N N
Sbjct: 417 RLKIWEKFNFNDDDIKRMKFDHDEVLGQNSKIIQINDTTEIMLG-ENDNNNKAFTLTNPN 475

Query: 456 FTKSLSCNEFMSLFYSHNAQGGLNICIHYPDGYNMEAFVECFQSFIE 502
           FT++LS NEFMS+ ++   + GLN+CIHYPDGY+ME FVECFQ+FIE
Sbjct: 476 FTRTLSGNEFMSVSFAICEETGLNVCIHYPDGYSMETFVECFQTFIE 522

>SAKL0E00792g Chr5 (58155..59690) [1536 bp, 511 aa] {ON} similar to
           uniprot|Q08984 Saccharomyces cerevisiae YPL272C
           Hypothetical ORF
          Length = 511

 Score =  442 bits (1136), Expect = e-151,   Method: Compositional matrix adjust.
 Identities = 241/513 (46%), Positives = 334/513 (65%), Gaps = 26/513 (5%)

Query: 3   FRALGGYEKKVLAQTIEGRRNGVVFSSQITFNKKSDEFADDNATLYTGRSVNEVSLKSVL 62
           FR+L   EKK+ +Q +  +RNG++F++  +     +E   DNATL T +  ++    S++
Sbjct: 7   FRSLSSVEKKLFSQNLNNKRNGLMFAAVYSTCFDKEETWSDNATLLTVK--DQRLSNSLV 64

Query: 63  CAALQNIICNHVELYTTINDRLYFTPVLQIETNDVIKTISYDKSKDKAL-MKDQISDKLL 121
             AL+ +I N+VELYTTIND L F PV  I  +DV++ + +D  KD+ +   D +   LL
Sbjct: 65  SRALKKVINNNVELYTTINDNLEFQPVKTIMFDDVVQKVEFDSYKDELVNCHDGVPPYLL 124

Query: 122 RHIFNKCDFKPNNGKPLWQFSIANDSTMIFHGHDVLFDIFSTANFEKYLLKEMNDVLNSN 181
           RHIF+K  F+    KPLWQ  I +++ +IFHGHDVLFDIF+ ANF K   + +N +    
Sbjct: 125 RHIFDKNKFETAKHKPLWQILIVDETMVIFHGHDVLFDIFAAANFHKLFQQALNQLPKDG 184

Query: 182 QKLKTVKTLFKFDAERSLTNYPRSIYENPKLHLPALTSDLLNLQTQSFFKTIYQNTLKKP 241
               T++ LFK D++ S   +P+SIYEN KL LPA+ +DL  LQTQSFFK++Y  T+KKP
Sbjct: 185 ---PTLECLFKNDSKASF--FPKSIYENHKLRLPAIATDLFQLQTQSFFKSVYNWTIKKP 239

Query: 242 IDLITSANSNNNNQLSEYRTRNTDILSGANSLCGRTVLGEISLERYQHLKMLVEQENISL 301
           +D I   N+N N+ L  Y++  TDIL GAN+LCG TV G IS ER   LK +++QENI L
Sbjct: 240 LDFI---NTNPNSGLKYYQSCYTDILLGANNLCGTTVFGNISAERVCALKKIMKQENICL 296

Query: 302 RSFISAITMVCLKPIVKNFDGSIIFSIPVNLRSLIADSSDFGLFYKNIKVECPLELINDE 361
            SF+ AI ++CLKP+V NF  S+ FSIPV+LRS I  +S FGL YKN+ VECPL LI+D+
Sbjct: 297 SSFVCAIALLCLKPLVNNFGSSVTFSIPVDLRSTIPQASRFGLCYKNVLVECPLTLIDDK 356

Query: 362 KY-----YTNPEVLHSMQNN-------SLLEIQFERISRHVSDVISQRMKAWEKFGFNDD 409
            +     Y   ++ ++   N       SLLE QF     HV + + QR +AWE+ GFNDD
Sbjct: 357 VFQGLNVYNGYDIRNTKPTNKDPNYEESLLEYQFREACTHVDNTLKQRWRAWERSGFNDD 416

Query: 410 DIKRMKFSNDEKTGIAPIIQINDVTEISFDFGNDNISYSFSVNNLNFTKSLSCNEFMSLF 469
           DIKRMKF   E+     II++N+VTE  F   +DN   +F++ ++ FTKS +   FMSL 
Sbjct: 417 DIKRMKFGKTEQGKSKRIIEVNNVTEFQFHV-DDNA--TFNIKDVCFTKSQNLETFMSLS 473

Query: 470 YSHNAQGGLNICIHYPDGYNMEAFVECFQSFIE 502
            + + + GLN+CIHYPDGYNM+ FVECFQSF+E
Sbjct: 474 CAFSERSGLNVCIHYPDGYNMDVFVECFQSFME 506

>Kpol_1045.79 s1045 complement(184348..185874) [1527 bp, 508 aa]
           {ON} complement(184350..185876) [1527 nt, 509 aa]
          Length = 508

 Score =  427 bits (1097), Expect = e-145,   Method: Compositional matrix adjust.
 Identities = 233/517 (45%), Positives = 333/517 (64%), Gaps = 30/517 (5%)

Query: 3   FRALGGYEKKVLAQTIEGRRNGVVFSSQITFNKKSDEFADDNATLYTGRSVNEVSLKSVL 62
           FR LG YEKK++ Q + G+ NG++FS++   N + D   DD ATL T      + L S L
Sbjct: 4   FRQLGTYEKKLVGQALAGQSNGIIFSAKYISNAQ-DGLTDD-ATLLTNSE--PLLLDSRL 59

Query: 63  CAALQNIICNHVELYTTINDRLYFTPVLQIETNDVIKTISYDKSKDKAL-MKDQISDKLL 121
             ALQ ++  H EL TT+N++L F  V +I+T+D+I ++ +D  KD+ +         LL
Sbjct: 60  VNALQKMVLKHPELRTTVNEKLEFEEVKEIKTSDIITSVKFDSLKDEFVNCHLGAPPYLL 119

Query: 122 RHIFNKCDFKPNNGKPLWQFSIANDSTMIFHGHDVLFDIFSTANFEKYLLKEMNDVLNSN 181
           RHIFN+  F P +GKPLW+  + +DS ++FHG DVLFDIF+ ANF K  L+ +N +   +
Sbjct: 120 RHIFNRNKFTPGSGKPLWELCVIDDSLVMFHGQDVLFDIFAAANFHKLFLETLNSM--DD 177

Query: 182 QKLKTVKTLFKFDAERS--LTNYPRSIYENPKLHLPALTSDLLNLQTQSFFKTIYQNTLK 239
           + +  ++ ++++DA +S    ++PR+IYENPKL +P  T DL+NLQTQSFFK+ Y N +K
Sbjct: 178 EHITDLEYIYRYDATKSNRSISFPRTIYENPKLRIPGKTIDLVNLQTQSFFKSFYVNAIK 237

Query: 240 KPIDLITSANSNNNNQLSEYRTRNTDILSGANSLCGRTVLGEISLERYQHLKMLVEQENI 299
           KP+D+IT     N+  +   +    D ++ A++LCG TV G I+ +R+++L  +   EN+
Sbjct: 238 KPLDIITF----NSEPMKYIKPNEIDFMNEASALCGTTVFGHITTDRFEYLNSIARHENV 293

Query: 300 SLRSFISAITMVCLKPIVKNFDGSIIFSIPVNLRSLIADSSDFGLFYKNIKVECPLELIN 359
            +RSFI  I ++CLK ++K+F GSI FSIPVNLR  I   SDFGLFYK I VECPL LI+
Sbjct: 294 CIRSFICGIALLCLKSMIKDFTGSITFSIPVNLRESIEGPSDFGLFYKTILVECPLSLID 353

Query: 360 DEKY--------YTN-----PEVLHSMQNNSLLEIQFERISRHVSDVISQRMKAWEKFGF 406
           D+ Y        Y N     PE   + +    LE QF++IS  VS  + +RM+AW + GF
Sbjct: 354 DQVYNNINVYNGYDNSNVKVPETDPTFEEKK-LEYQFKQISDLVSTTMKERMRAWRRNGF 412

Query: 407 NDDDIKRMKFSNDEKTGIAPIIQINDVTEISFDFGNDNISYSFSVNNLNFTKSLSCNEFM 466
           NDDDIK+MKF++D+K     IIQINDV+E      N + S   S+  LNFT S+S ++FM
Sbjct: 413 NDDDIKKMKFTSDDKASNTKIIQINDVSEFK---INSSKSSKVSIKELNFTHSISNSDFM 469

Query: 467 SLFYSHNAQGGLNICIHYPDGYNMEAFVECFQSFIEN 503
           SL Y++  + G NICIHYPD Y+ME FVE FQSF+ +
Sbjct: 470 SLSYTYCKETGSNICIHYPDAYDMEKFVERFQSFVAD 506

>CAGL0A01089g Chr1 complement(109009..110616) [1608 bp, 535 aa] {ON}
           similar to uniprot|Q08984 Saccharomyces cerevisiae
           YPL272c
          Length = 535

 Score =  427 bits (1098), Expect = e-145,   Method: Compositional matrix adjust.
 Identities = 241/543 (44%), Positives = 343/543 (63%), Gaps = 56/543 (10%)

Query: 4   RALGGYEKKVLAQTIEGRRNGVVFSSQITFNKK--SDE--FADDNATLYTGRSVNEVSLK 59
           R+L  YE+K+L++ +E  +NG VF +   F+    +DE  + DDN TL   R  +  + K
Sbjct: 3   RSLSSYERKLLSEILENNKNGTVFGASYIFDDSVTADEHIWDDDNDTLAATRVESRSTKK 62

Query: 60  SVL-------CAALQNIICNHVELYTTINDRLYFTPVLQIETNDVIKTISYDKSKDKAL- 111
             L         AL+++I  + E+YTT+ND L F P+ +I T DVI  +++D  KD+ + 
Sbjct: 63  PALSLTLPLVTRALKSLIEKNPEMYTTVNDLLEFAPLKEIRTPDVISVVTFDNEKDEKVN 122

Query: 112 -MKDQISDKLLRHIFNKCDFKPNNGKPLWQFSIANDSTMIFHGHDVLFDIFSTANFEKYL 170
                    L+RHI     F+P + KPLW   + ++S ++FH  D+LFDIFS ANF K  
Sbjct: 123 CHSGGPPPYLIRHILKNDVFQPGSNKPLWNLYLIDESQLVFHCQDILFDIFSAANFHKLF 182

Query: 171 LKEMNDVLNSNQKL-KTVKTLFKFDAERSLTN---YPRSIYENPKLHLPALTSDLLNLQT 226
           LKE+  V    Q   K ++ LFK   ++S  N    P+SIY+N KLHLPA   +LLNLQT
Sbjct: 183 LKELIAVCRPQQSYEKPLEYLFKL--QKSFENNYSVPKSIYDNLKLHLPATRPELLNLQT 240

Query: 227 QSFFKTIYQNTLKKPIDLITSAN-----------------SNNNNQLSEYRTRNTDILSG 269
           QSFFK+I+ N +KKP+D I                     S   NQL  +RTR T+IL+ 
Sbjct: 241 QSFFKSIFCNAVKKPLDFIQMPITSITNSSSNSDNSTTVISQEGNQLKLFRTRYTNILTS 300

Query: 270 ANSLCGRTVLGEISLERYQHLKMLVEQENISLRSFISAITMVCLKPIVKNFDGSIIFSIP 329
           A S CG T+ G +S ER+ +L  +V+ E I LRSFI+AITM+CLKP+VK+F+G++IFS+P
Sbjct: 301 ATSNCGHTIFGSVSNERFNYLNSVVKNEKICLRSFIAAITMLCLKPMVKSFNGTLIFSMP 360

Query: 330 VNLRSLIADSSDFGLFYKNIKVECPLELINDEKYY------TNPEVLHSMQNNSLLEIQF 383
           +NLR  + +  DFGL YK+I+VECPL +I+D++        ++PE      N  LLEIQF
Sbjct: 361 MNLRDSMNEKRDFGLVYKDIRVECPLSMIDDKQCSVPGLNESDPEY-----NEKLLEIQF 415

Query: 384 ERISRHVSDVISQRMKAWEKFGFNDDDIKRMKFSN-DEKTGIAP---IIQINDVTEISFD 439
           ++I+ +V++ I QRM  W+K+G+ND+D+KRMKF+  DEK   AP   +I+INDV+E+SFD
Sbjct: 416 QQIATYVTESIEQRMSTWKKYGYNDNDMKRMKFTKYDEK--FAPNTRLIKINDVSEVSFD 473

Query: 440 FGNDNISYSFSVNNLNFTKSLSCNEFMSLFYSHNAQGGLNICIHYPDGYNMEAFVECFQS 499
             +++I +   + +  FT SLS N  MSL Y+H  + GLNICIHYPDGYNME FV+CF+S
Sbjct: 474 --DNDIRFP-HIKSPGFTTSLSQNTLMSLSYTHCEEDGLNICIHYPDGYNMENFVDCFES 530

Query: 500 FIE 502
           F+E
Sbjct: 531 FME 533

>KNAG0E02770 Chr5 (557579..559105) [1527 bp, 508 aa] {ON} Anc_6.8
           YPL272C
          Length = 508

 Score =  416 bits (1069), Expect = e-141,   Method: Compositional matrix adjust.
 Identities = 231/514 (44%), Positives = 330/514 (64%), Gaps = 28/514 (5%)

Query: 4   RALGGYEKKVLAQTIEGRRNGVVFSSQITFNKKSDEFADDNATLYTGRSVNEVSLKSVLC 63
           RAL  +EKK+L Q+++G +NG  F ++ +  K+   ++D+ ATL T +  + + L  +L 
Sbjct: 5   RALSSFEKKLLLQSVDGLKNGTTFGAEYSTFKEG--WSDEEATLLTVKD-SRLCL-GLLT 60

Query: 64  AALQNIICNHVELYTTINDRLYFTPVLQIETNDVIKTISYDKSKDKAL-MKDQISDKLLR 122
            AL+N+I  H+EL+ TIN++  F  + +I+T+DVI TI +D  KD+ +  +      LLR
Sbjct: 61  KALENLIKKHIELFLTINEQFEFEVLKKIKTSDVISTIQFDSFKDEKINCQLGAPPYLLR 120

Query: 123 HIFNKCDFKPNNGKPLWQFSIANDSTMIFHGHDVLFDIFSTANFEKYLLKEMNDVLNSNQ 182
           HIFN   F P +GKPLW+  + +DS   FHG D LFD+FSTANF + LLKE+N + +  Q
Sbjct: 121 HIFNHDRFVPGSGKPLWKLYLLDDSLAFFHGQDCLFDVFSTANFHRLLLKEVNLLSSRPQ 180

Query: 183 KLKTVKTLFKF--DAERSLTNYPRSIYENPKLHLPALTSDLLNLQTQSFFKTIYQNTLKK 240
           K K +  +FKF  D+   +   P+SIY+NPKL++P L  DL NLQTQSFFK+IY NT+KK
Sbjct: 181 KWKKLDYVFKFGPDSMSEVKQLPKSIYDNPKLYIPTLNPDLFNLQTQSFFKSIYVNTVKK 240

Query: 241 PIDLITSAN----SNNNNQLSEYRTRNTDILSGANSLCGRTVLGEISLERYQHLKMLVEQ 296
           PI+ +T+ +    S N+N       +  DIL   + LCG TV G +S ER+++L  ++ Q
Sbjct: 241 PIEFLTNTDVSFLSLNSNM------KYNDILDINSKLCGNTVFGCVSNERFKYLNTIINQ 294

Query: 297 ENISLRSFISAITMVCLKPIVKNFDGSIIFSIPVNLRSLIADSSDFGLFYKNIKVECPLE 356
           E + L+SFI  I M+CLKP+VKN  G++ FSIPV+LRS + +  DFGL+YK+I+VECPL 
Sbjct: 295 EGLCLKSFIVGIAMLCLKPMVKNLSGTVTFSIPVDLRSFVDEPRDFGLYYKDIRVECPLS 354

Query: 357 LINDEK---YYTNPEVLHSMQNNSLLEIQFERISRHVSDVISQRMKAWEKFGFNDDDIKR 413
           LI+D+K         V     +  L+E QF+ I+  V + + QR+  + K GFNDDDI+R
Sbjct: 355 LIDDDKSKDCMKGASVSEEDFDEKLMEYQFKNITGFVRNHLEQRLTRFSKTGFNDDDIRR 414

Query: 414 MKFSNDEKTGIAP----IIQINDVTEISF-DFGNDNISYSFSVNNLNFTKSLSCNEFMSL 468
           MKF +    G +      IQI D + I+  +FG  N   SF +   N TKSL+  E MSL
Sbjct: 415 MKFDDKNTLGGSSNNGTFIQIYDTSLINVNEFGEPN---SFMIRACNLTKSLNSEELMSL 471

Query: 469 FYSHNAQGGLNICIHYPDGYNMEAFVECFQSFIE 502
            Y++  + GLNICIHYP+ Y ME+FVECFQSF+E
Sbjct: 472 SYTYCEENGLNICIHYPENYKMESFVECFQSFLE 505

>Skud_16.5 Chr16 complement(5816..7363) [1548 bp, 515 aa] {ON}
           YPL272C (REAL)
          Length = 515

 Score =  407 bits (1047), Expect = e-137,   Method: Compositional matrix adjust.
 Identities = 224/522 (42%), Positives = 326/522 (62%), Gaps = 32/522 (6%)

Query: 3   FRALGGYEKKVLAQTIEGRRNGVVFSSQITFNKKSDEFAD---DNATLYTGRSVNEVSLK 59
           FR L  +EKK+L Q++  +RNG +FSS  + +      AD   D  TL T  S ++  L 
Sbjct: 4   FRPLSSFEKKLLTQSLNDQRNGTIFSSTYSKSPNRGNDADWNSDEVTLGTNSSKDDSRLT 63

Query: 60  -SVLCAALQNIICNHVELYTTINDRLYFTPVLQIETNDVIKTISYDKSKDKAL--MKDQI 116
              + A L+ +I +   L+ T+N+   F P+ Q++T+D++  I ++  KDK +       
Sbjct: 64  LPSIAATLKRLIKSQPALFATVNEEWEFEPLKQLKTSDIVNVIEFETIKDKEVNCHWGVP 123

Query: 117 SDKLLRHIFNKCDFKPNNGKPLWQFSIANDSTMIFHGHDVLFDIFSTANFEKYLLKEMND 176
              LLRH FNK  F P + KPLW   + +++ ++FHGHDVLFDIFS ANF K  LKE+N+
Sbjct: 124 PPYLLRHAFNKTRFVPGSNKPLWTLYVIDEALLVFHGHDVLFDIFSAANFHKLFLKELNN 183

Query: 177 VLNSNQKLKTVKTLFKF-DAERSLTNYPRSIYENPKLHLPALTSDLLNLQTQSFFKTIYQ 235
           +  S +     + LF   D   S  N+P+SIY++ KLHLPA+T  + + QTQSFFK+I+ 
Sbjct: 184 I--SLEAHSDDRVLFDISDVNISNLNFPKSIYDSAKLHLPAMTPQIFHKQTQSFFKSIFY 241

Query: 236 NTLKKPIDLITS----ANSNNNNQLSEYRTRNTDILSGANSLCGRTVLGEISLERYQHLK 291
           NTLK+P   +T+      S +  QL +Y     DIL+  +SLCG TV G ++ +R+ +LK
Sbjct: 242 NTLKRPFGYLTNQTSLGPSTSTTQLKKY----NDILNAHSSLCGTTVFGIVNNQRFNYLK 297

Query: 292 MLVEQENISLRSFISAITMVCLKPIVKNFDGSIIFSIPVNLRSLIADSSDFGLFYKNIKV 351
            +V QE+I LRSFI  I M+CLKP+VK+F G+I+FSIP++LR  +      GLF+K +++
Sbjct: 298 SIVNQEHICLRSFICGIAMICLKPLVKDFTGAIVFSIPIDLRKNLDLGESLGLFFKELRI 357

Query: 352 ECPLELINDEKYYTNPEVLHSMQ--------NNSLLEIQFERISRHVSDVISQRMKAWEK 403
           ECPL LI+DE   +  E L +          N  L+E QF ++++HVSD I  ++K+WEK
Sbjct: 358 ECPLSLIDDE--LSADEFLANRNDKEDDDEFNEKLMEYQFNKVTKHVSDFIMAKLKSWEK 415

Query: 404 FGFNDDDIKRMKFSNDE---KTGIAPIIQINDVTEISFDFGNDNISYSFSVNNLNFTKSL 460
            GFNDDDI+RMK+ ND+   +     +IQINDV++IS    ND    +F + +  FT S+
Sbjct: 416 NGFNDDDIRRMKYDNDDCHIQNSKTKLIQINDVSDISLSMNND--EKAFKIISSGFTSSI 473

Query: 461 SCNEFMSLFYSHNAQGGLNICIHYPDGYNMEAFVECFQSFIE 502
           +    MSL Y++  + GLNICIHYPD YN+E+FVECF+SFIE
Sbjct: 474 NRPTLMSLSYTYCEEMGLNICIHYPDSYNLESFVECFESFIE 515

>Smik_6.480 Chr6 (793043..794593) [1551 bp, 516 aa] {ON} YPL272C
           (REAL)
          Length = 516

 Score =  403 bits (1035), Expect = e-135,   Method: Compositional matrix adjust.
 Identities = 218/517 (42%), Positives = 326/517 (63%), Gaps = 21/517 (4%)

Query: 3   FRALGGYEKKVLAQTIEGRRNGVVFSSQIT--FNKKSD-EFADDNATLYTGRSVNEVSLK 59
           FR L  +EKK+L Q++  +RNG +FSS  +    K++D ++  D  TL T  S ++  L 
Sbjct: 4   FRPLSSFEKKLLTQSLNDQRNGTIFSSTYSKSLGKENDADWHSDEVTLGTNSSKDDSRLT 63

Query: 60  SVLCAA-LQNIICNHVELYTTINDRLYFTPVLQIETNDVIKTISYDKSKDKAL--MKDQI 116
             L A  L+ +I +   L+ TIN+   F P+ Q++T+D++  I ++  KDK +       
Sbjct: 64  LPLIATTLKRLIKSQPALFATINEEWEFEPLEQLKTSDIVNVIEFETLKDKEVNCHWGVP 123

Query: 117 SDKLLRHIFNKCDFKPNNGKPLWQFSIANDSTMIFHGHDVLFDIFSTANFEKYLLKEMND 176
              LLRH FNK  F P + +PLW   + +++ ++FHGHDVLFDIFS ANF K  LKE+N+
Sbjct: 124 PPYLLRHAFNKTRFIPGSNRPLWTLYVIDETLLVFHGHDVLFDIFSAANFHKLFLKELNN 183

Query: 177 VLNSNQKLKTVKTLFKFD-AERSLTNYPRSIYENPKLHLPALTSDLLNLQTQSFFKTIYQ 235
           +  S+      + LF  +    S  N+P+SIY++ KLHLPA+T  + + QTQSFFK+I+ 
Sbjct: 184 I--SSVTHYEDRILFDINNVSISDLNFPKSIYDSAKLHLPAMTPQIFHKQTQSFFKSIFY 241

Query: 236 NTLKKPIDLITSANSNNNNQLSEYRTRNTDILSGANSLCGRTVLGEISLERYQHLKMLVE 295
           NTLK+P   +T+  S ++   +    +  DIL+  +SLCG TV G +S +R+ +LK +V 
Sbjct: 242 NTLKRPFGYLTNQTSISSPASATQLKKYNDILNAHSSLCGTTVFGIVSNQRFNYLKSIVN 301

Query: 296 QENISLRSFISAITMVCLKPIVKNFDGSIIFSIPVNLRSLIADSSDFGLFYKNIKVECPL 355
           QE+I LRSFI  I M+CLKP+VK+F G+I+FSIP++LR  +      GLF+K +++ CPL
Sbjct: 302 QEHICLRSFICGIAMICLKPLVKDFSGTIVFSIPIDLRKHLGLGESLGLFFKELRIACPL 361

Query: 356 ELINDE----KYYTNP--EVLHSMQNNSLLEIQFERISRHVSDVISQRMKAWEKFGFNDD 409
            LI+DE    ++  N          +  L+E QF  +++HVS  I  ++K+WEK GFNDD
Sbjct: 362 SLIDDELSVNEFLANSNDNEEDEEFDEKLMEYQFNNVTKHVSSFIMAKLKSWEKNGFNDD 421

Query: 410 DIKRMKFSNDEKTGI----APIIQINDVTEISFDFGNDNISYSFSVNNLNFTKSLSCNEF 465
           DI+RMK+ ND++  I      ++QINDV++IS    ND+   SF + +  FT S++    
Sbjct: 422 DIRRMKYDNDDEFHIQNSKTKLVQINDVSDISLSMNNDD--KSFKIVSSGFTSSINRPTL 479

Query: 466 MSLFYSHNAQGGLNICIHYPDGYNMEAFVECFQSFIE 502
           +SL Y++  + GLNICIHYPD YN+E+FVECF+SFIE
Sbjct: 480 LSLSYTYCQEMGLNICIHYPDSYNLESFVECFESFIE 516

>YPL272C Chr16 complement(26611..28164) [1554 bp, 517 aa] {ON}
           Putative protein of unknown function; gene expression
           induced in response to ketoconazole; YPL272C is not an
           essential gene
          Length = 517

 Score =  402 bits (1032), Expect = e-135,   Method: Compositional matrix adjust.
 Identities = 220/518 (42%), Positives = 327/518 (63%), Gaps = 22/518 (4%)

Query: 3   FRALGGYEKKVLAQTIEGRRNGVVFSSQIT--FNKKSD-EFADDNATLYTGRSVNEVSLK 59
           FR L  +EKK+L Q++  +RNG +FSS  +   ++++D ++  D  TL T  S ++  L 
Sbjct: 4   FRPLSSFEKKILTQSLNDQRNGTIFSSTYSKSLSRENDADWHSDEVTLGTNSSKDDSRLT 63

Query: 60  SVLCAA-LQNIICNHVELYTTINDRLYFTPVLQIETNDVIKTISYDKSKDKAL--MKDQI 116
             L A  L+ +I +   L+ T+N+   F P+ Q++T+D++  I ++  KDK +       
Sbjct: 64  LPLIATTLKRLIKSQPALFATVNEEWEFEPLKQLKTSDIVNVIEFETIKDKEVNCHWGVP 123

Query: 117 SDKLLRHIFNKCDFKPNNGKPLWQFSIANDSTMIFHGHDVLFDIFSTANFEKYLLKEMND 176
              LLRH FNK  F P + KPLW   + +++ ++FHGHDVLFDIFS ANF K  LKE+N+
Sbjct: 124 PPYLLRHAFNKTRFVPGSNKPLWTLYVIDEALLVFHGHDVLFDIFSAANFHKLFLKELNE 183

Query: 177 VLNSNQKLKTVKTLFKF-DAERSLTNYPRSIYENPKLHLPALTSDLLNLQTQSFFKTIYQ 235
           +  S       + LF   D   S   +P+SIY++ KLHLPA+T  + + QTQSFFK+IY 
Sbjct: 184 I--STVTHSEDRILFDVNDINLSELKFPKSIYDSAKLHLPAMTPQIFHKQTQSFFKSIYY 241

Query: 236 NTLKKPIDLITSANSNNNNQLSEYRTRNTDILSGANSLCGRTVLGEISLERYQHLKMLVE 295
           NTLK+P   +T+  S +++  +    +  DIL+   SLCG TV G ++ +R+ +LK +V 
Sbjct: 242 NTLKRPFGYLTNQTSLSSSVSATQLKKYNDILNAHTSLCGTTVFGIVNNQRFNYLKSIVN 301

Query: 296 QENISLRSFISAITMVCLKPIVKNFDGSIIFSIPVNLRSLIADSSDFGLFYKNIKVECPL 355
           QE+I LRSFI  I M+CLKP+VK+F G+I+F+IP+NLR+ +      GLF+K ++VECPL
Sbjct: 302 QEHICLRSFICGIAMICLKPLVKDFSGTIVFTIPINLRNHLGLGGSLGLFFKELRVECPL 361

Query: 356 ELINDE----KYYTNPEVLHSMQNNS---LLEIQFERISRHVSDVISQRMKAWEKFGFND 408
            LI+DE    ++ TN        +     L+E QF ++++HVS  I  ++++WEK GFND
Sbjct: 362 SLIDDELSANEFLTNSNDNEDNDDEFNERLMEYQFNKVTKHVSGFIMAKLRSWEKNGFND 421

Query: 409 DDIKRMKFSNDEKTGI----APIIQINDVTEISFDFGNDNISYSFSVNNLNFTKSLSCNE 464
           DDI+RMK+ ND+   I      +IQINDV++IS     D+   SF + +  FT S++   
Sbjct: 422 DDIRRMKYDNDDDFHIQNSRTKLIQINDVSDISLSMNGDD--KSFKIVSTGFTSSINRPT 479

Query: 465 FMSLFYSHNAQGGLNICIHYPDGYNMEAFVECFQSFIE 502
            MSL Y++  + GLNICIHYPD YN+E+FVECF+SFIE
Sbjct: 480 LMSLSYTYCEEMGLNICIHYPDSYNLESFVECFESFIE 517

>Suva_16.33 Chr16 complement(42245..43801) [1557 bp, 518 aa] {ON}
           YPL272C (REAL)
          Length = 518

 Score =  398 bits (1022), Expect = e-133,   Method: Compositional matrix adjust.
 Identities = 218/519 (42%), Positives = 325/519 (62%), Gaps = 23/519 (4%)

Query: 3   FRALGGYEKKVLAQTIEGRRNGVVFSSQITFNKKSDEFAD---DNATLYTGRSVNEVSLK 59
           FR L  +EKK+L Q++  +RNG +FSS  + +   +  AD   D  TL T  S ++  L 
Sbjct: 4   FRPLSSFEKKLLTQSLNDQRNGTIFSSTYSKSSSKEADADWHSDEVTLGTNSSKDDSRLT 63

Query: 60  SVLCAA-LQNIICNHVELYTTINDRLYFTPVLQIETNDVIKTISYDKSKDKAL--MKDQI 116
             L A  L+ +I +   L+ T+N+   + P+ Q++T+D++  I ++ +KDK +       
Sbjct: 64  LPLIATTLKKLIKSQPALFATVNEDWEYAPLKQLKTSDIVNVIEFETTKDKEVNCHWGVP 123

Query: 117 SDKLLRHIFNKCDFKPNNGKPLWQFSIANDSTMIFHGHDVLFDIFSTANFEKYLLKEMND 176
              LLRH FNK  F P + KPLW   + +++ ++FHGHDVLFDIFS ANF K  LKE+N 
Sbjct: 124 PPYLLRHAFNKTRFVPGSNKPLWTLYVIDETLLVFHGHDVLFDIFSAANFHKLFLKELNS 183

Query: 177 VLNSNQKLKTVKTLFKF-DAERSLTNYPRSIYENPKLHLPALTSDLLNLQTQSFFKTIYQ 235
           + + ++    V  LF   D   +  ++P+SIY++ KL LPA+T  +L+ QTQSFFK+I+ 
Sbjct: 184 ITSVSRSDDRV--LFDINDVNFAELSFPKSIYDSAKLRLPAMTPQILHKQTQSFFKSIFY 241

Query: 236 NTLKKPIDLITSANSNNNNQLSEYRTRNTDILSGANSLCGRTVLGEISLERYQHLKMLVE 295
           NTLK+P   +T+  S ++   +    R  DIL+  +SLCG TV G ++ +R+ +LK +V 
Sbjct: 242 NTLKRPFGYLTNQTSFSSPAPTSQLKRYNDILNTNSSLCGTTVFGIVNNQRFSYLKSIVN 301

Query: 296 QENISLRSFISAITMVCLKPIVKNFDGSIIFSIPVNLRSLIADSSDFGLFYKNIKVECPL 355
           QE+I LRSFI  I M+CLKP+VK+F G+I+FSIP++LR  +      GLF+K +++ECPL
Sbjct: 302 QEHICLRSFICGIAMICLKPLVKDFSGTIVFSIPIDLRKHLNLGESLGLFFKELRIECPL 361

Query: 356 ELINDE--------KYYTNPEVLHSMQNNSLLEIQFERISRHVSDVISQRMKAWEKFGFN 407
            LI+DE            N    +   N  L+E QF ++++HVS+ I  ++K+WE+ GFN
Sbjct: 362 SLIDDELSINEFLVNSNDNENNDNDEFNEKLMEYQFNKVTKHVSNYIMTKLKSWERNGFN 421

Query: 408 DDDIKRMKFSNDEKTGI----APIIQINDVTEISFDFGNDNISYSFSVNNLNFTKSLSCN 463
           DDDI+RMK+ ND+   +      +IQINDV++IS    ND+   SF + +  FT S++  
Sbjct: 422 DDDIRRMKYDNDDDFHVQNSKTKLIQINDVSDISLSMSNDD--KSFKIVSSGFTNSINRP 479

Query: 464 EFMSLFYSHNAQGGLNICIHYPDGYNMEAFVECFQSFIE 502
             MSL Y++    GLNICIHYPD YN+E+FVECF+SFIE
Sbjct: 480 TLMSLSYTYCEDMGLNICIHYPDSYNLESFVECFESFIE 518

>TPHA0J00260 Chr10 (59857..61404) [1548 bp, 515 aa] {ON} Anc_6.8
           YPL272C
          Length = 515

 Score =  394 bits (1012), Expect = e-132,   Method: Compositional matrix adjust.
 Identities = 216/516 (41%), Positives = 318/516 (61%), Gaps = 19/516 (3%)

Query: 1   MPFRALGGYEKKVLAQTIEGRRNGVVFSSQITFNKKSDEFADDNATLYTGRSVNEVSLKS 60
           MPFR L  YE+ VL ++ E + NG +FS++ T  + +    DD ATL T    N  ++ S
Sbjct: 1   MPFRPLASYERNVLIESYENQTNGTIFSAKYTDMQTNSTINDDAATLLTQNEEN--NMFS 58

Query: 61  VLCAALQNIICNHVELYTTINDRLYFTPVLQIETNDVIKTISYDKSKDKAL-MKDQISDK 119
               AL  +I  + ELYTTIN +L F P+ +I+T+DVI +I ++ +KD+ +  K+     
Sbjct: 59  RFINALATVITENPELYTTINTKLEFEPITEIKTDDVISSIKFNSTKDEFVNCKNGAPPY 118

Query: 120 LLRHIFNKCDFKPNNGKPLWQFSIANDSTMIFHGHDVLFDIFSTANFEKYLLKEMNDVLN 179
           LLRHIFNK  F P +GKPLW   I +DS +IFHG DVLFDI+S A+F +     +     
Sbjct: 119 LLRHIFNKDKFVPGSGKPLWNLYIVDDSIVIFHGQDVLFDIYSAASFHRKFFAALEGATP 178

Query: 180 SNQKLKTVKTLFKFDAERSLTNYPRSIYENPKLHLPALTSDLLNLQTQSFFKTIYQNTLK 239
           +++KL T+  L           +P+SIY++P L LPA T DL++LQT+ F K++   T+ 
Sbjct: 179 TSEKLTTIFRLSDLSKSALTYPFPKSIYDSPLLMLPAKTIDLVSLQTRFFLKSVVSKTIV 238

Query: 240 KPIDLITSANSNNNNQLSEYRTRNTDILSGANSLCGRTVLGEISLERYQHLKMLVEQENI 299
           KP+++I     N+    S   +   DIL   +SLCG TV G IS ER+ +L+ + E+EN+
Sbjct: 239 KPLNIIM---FNDEPMKSFTNSDPMDILEKTSSLCGTTVFGNISNERFDYLQSIAEEENV 295

Query: 300 SLRSFISAITMVCLKPIVKNFDGSIIFSIPVNLRSLIADSSDFGLFYKNIKVECPLELIN 359
             +S +  ITM+CLKP++K+F  +I FSI +NLR  I +S++FGLFYKN+++E PL  I+
Sbjct: 296 CTKSLVCGITMLCLKPLIKDFSSNITFSIAMNLRDSIEESTEFGLFYKNVRIEVPLSFID 355

Query: 360 DEKY----------YTNPEVLHSMQN--NSLLEIQFERISRHVSDVISQRMKAWEKFGFN 407
           D  +           +N  +  +  N    L+  QF +I+  +S  + QRM+AW + GFN
Sbjct: 356 DNVFKLKTSYNGYDASNSNIKETNPNYEEQLIAYQFNQIATFISRNLKQRMRAWRRNGFN 415

Query: 408 DDDIKRMKFSNDEKTGIAPIIQINDVTEISFDFGNDNISY-SFSVNNLNFTKSLSCNEFM 466
           DDDIK MKF + +K   A IIQIND++++SF   N N    S S+ +L+FT SL  ++FM
Sbjct: 416 DDDIKMMKFGSKDKNTSAKIIQINDISDLSFCPMNKNGELNSVSLKDLSFTHSLVPDQFM 475

Query: 467 SLFYSHNAQGGLNICIHYPDGYNMEAFVECFQSFIE 502
           SL Y+H    G NICIH+P+ Y++E FVE FQ+FI+
Sbjct: 476 SLSYTHCKSTGSNICIHFPEVYDLELFVEKFQNFID 511

>KAFR0B06510 Chr2 complement(1349540..1351066) [1527 bp, 508 aa]
           {ON} Anc_6.8 YPL272C
          Length = 508

 Score =  362 bits (930), Expect = e-120,   Method: Compositional matrix adjust.
 Identities = 208/524 (39%), Positives = 317/524 (60%), Gaps = 38/524 (7%)

Query: 1   MPFRALGGYEKKVLAQTIEGRRNGVVFSSQITFNKKSDEFADDNATLYTGRSVNEVSLKS 60
           M  R L  YE+K+L +TI   RNGV+F++  +++  S+E+ DD   L    S   ++   
Sbjct: 1   MTLRTLSSYERKILDETIRRERNGVIFTA--SYSASSEEWGDDTTLLTLKDSRPTIA--- 55

Query: 61  VLCAALQNIICNHVELYTTINDRLYFTPVLQIETNDVIKTISYDKSKDKAL-MKDQISDK 119
           +L  A+Q +I  HVEL+TTIN+   F  +  I+ +D++  + +D  KD+ +   +     
Sbjct: 56  ILTKAIQRLISRHVELFTTINENYEFEILKSIKKDDILNILEFDSYKDEKINCHNGCPPY 115

Query: 120 LLRHIFNKCDFKPNNGKPLWQFSIANDSTMIFHGHDVLFDIFSTANFEKYLLKEMNDVLN 179
           LLRHIF+   F P + KPLW   I ++S +IFHG D+LFDIFS ANF K LLKE N V  
Sbjct: 116 LLRHIFDNNRFVPGSKKPLWSLHIIDESLVIFHGQDMLFDIFSAANFHKLLLKETNIV-- 173

Query: 180 SNQKLKTVKTLFKFDAERSLT-----NYPRSIYENPKLHLPALTSDLLNLQTQSFFKTIY 234
           +N+ L + ++   F  E S+         +SIY+NP++HLPA + DL NLQTQSFFK+++
Sbjct: 174 ANEPLDSSESDIIFSLENSIKKINNLKLSKSIYDNPRIHLPATSPDLFNLQTQSFFKSVF 233

Query: 235 QNTLKKPIDL----ITSANSNNNNQLSEYRT--RNTDILSGANSLCGRTVLGEISLERYQ 288
            +T+KKPI      + +    ++N LS   T  + TDI     +L   TV G+I+ +RY+
Sbjct: 234 HSTVKKPIHYLVANVRTKEVTSDNTLSRVTTVQKYTDIFDYNTTLNNTTVFGKITRQRYE 293

Query: 289 HLKMLVEQENISLRSFISAITMVCLKPIVKNFDGSIIFSIPVNLRSLIADSS-DFGLFYK 347
           +L  L+  + I  +SF+  I M+CLKP ++NF+GS+ FSI +NLR  + +S+ +FGLFYK
Sbjct: 294 YLNSLITNQRICFKSFMVGIIMLCLKPSIENFEGSMKFSIVINLRPFLKESNIEFGLFYK 353

Query: 348 NIKVECPLELINDEKYYTNPEVLHSMQNNS---------LLEIQFERISRHVSDVISQRM 398
           ++ ++ PL LI+D     N  +L   ++ S         +LE QF+R++  V D+I +R+
Sbjct: 354 DVLIDVPLSLIDD-----NAVMLSGYRDFSDNDPDLTEKILEFQFKRVTSLVKDLIERRI 408

Query: 399 KAWEKFGFNDDDIKRMKFSNDEKTGIAPIIQINDVTEISFDFGNDNISYSFSVNNLNFTK 458
             +   GFNDDDI++MK+    +     II++ D +E+S   G  +  Y   ++N NFTK
Sbjct: 409 SKFSTMGFNDDDIRQMKYGKPAED--TKIIRLFDTSEVSLGSGKRDGKY--ILHNTNFTK 464

Query: 459 SLSCNEFMSLFYSHNAQGGLNICIHYPDGYNMEAFVECFQSFIE 502
           SL  N+F S+ Y+     GLN+C+ +PD  +MEAFVECFQSFIE
Sbjct: 465 SLRKNDFFSVSYTLCDNSGLNLCLQFPDDCDMEAFVECFQSFIE 508

>TBLA0A07220 Chr1 (1800531..1802060) [1530 bp, 509 aa] {ON} Anc_6.8
           YPL272C
          Length = 509

 Score =  313 bits (801), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 196/527 (37%), Positives = 305/527 (57%), Gaps = 55/527 (10%)

Query: 3   FRALGGYEKKVLAQTIEGR-RNGVVFSSQITFNKKSDEFADDNATLYTGRSVNEVSLKSV 61
            R L   EK+ L  ++E   R+G V S +   N  S + +DD ATL + +  ++    S+
Sbjct: 12  LRPLSSVEKRFLGNSLESETRHGSVCSGKWVSN--SLDISDD-ATLLSSK--DKPLTISL 66

Query: 62  LCAALQNIICNHVELYTTINDRLYFTPVLQIETNDVIKTISYDKSKDKAL-MKDQISDKL 120
           +  AL+ +I NH+E++TTIN    F  + +I T+DV+ +I ++  KD+ +         L
Sbjct: 67  VSRALKILISNHIEMFTTINKNSEFQLLDKINTSDVLHSICFENKKDELVNCHSGAPPYL 126

Query: 121 LRHIFNKCDFKPNNGKPLWQFSIANDSTMIFHGHDVLFDIFSTANFEKYLLKEMNDVLNS 180
           + +IF+   F+P++ KPLWQ  I N S ++F+G D LFDIF+ ANF K L + +N +   
Sbjct: 127 INYIFSLPYFQPDSKKPLWQLFIVNSSLVVFYGDDTLFDIFAVANFIKLLFEIINSLPYE 186

Query: 181 NQKLKTVKTLFKFDAERSLT--NYPRSIYENPKLHLPALTSDLLNLQTQSFFKTIYQNTL 238
           N++++    +FK    R+++  N+P+SIY+NP LHLPA   +L NLQTQSFFK+IY NT 
Sbjct: 187 NKEIQD-DIIFKLPNIRNISKINFPKSIYDNPMLHLPATKPELFNLQTQSFFKSIYLNTF 245

Query: 239 KKPIDLITSANSNNNNQLSEYRTRNTDILSGANSLC-------GRTVLGEISLERYQHLK 291
           KK  D +     N   Q      RN +I    N +           V G +S+ERY  L 
Sbjct: 246 KKSFDYL-----NFTQQTPIILARNHNISKNYNEILHLNSIVKSELVTGNVSMERYLQLL 300

Query: 292 MLVEQENISLRSFISAITMVCLKPIVKNFDGSIIFSIPVNLRSL--IAD----------- 338
            L++ E I L+SF  +I ++CLK ++  FDGSIIF IP NLRS+  + D           
Sbjct: 301 KLIDAEKIDLKSFFCSIIIMCLKFMITCFDGSIIFKIPYNLRSMQNLRDKENHNSSSGPE 360

Query: 339 --SSDFGLFYKNIKVECPLELINDEKYYTNPEVLHSMQNNSLLEIQFERISRHVSDVISQ 396
             +++ G+ YK+I VE PL+LI              + N  ++E QF+ +  ++++ I +
Sbjct: 361 DSANELGIIYKDIYVEVPLKLI------------EKIGNEDVVEEQFKIVCNYINESIQK 408

Query: 397 RMKAWEKFGFNDDDIKRMKFSNDEKTGIAPIIQINDVTEISFDFGNDNISYSFSVNNLNF 456
           R+KAWEK GFNDDDIKRMKF  ++   +  II++ND+T +      D++   F + +L+ 
Sbjct: 409 RIKAWEKNGFNDDDIKRMKFGYEQ---VGNIIEVNDLTSLDLSCSKDSL---FHIEDLSL 462

Query: 457 TKSLSCNEFMSLFYSHNAQGGLNICIHYPDGYNMEAFVECFQSFIEN 503
           T++L  N+ +SL ++ N   GLN+CI+Y   Y M+ F++CFQSF+EN
Sbjct: 463 TRNLKKNQILSLSFASNNYNGLNLCINYSTEYKMKDFIDCFQSFMEN 509

>NCAS0D02180 Chr4 (406396..407943) [1548 bp, 515 aa] {ON} Anc_6.8
          Length = 515

 Score =  287 bits (735), Expect = 1e-90,   Method: Compositional matrix adjust.
 Identities = 191/523 (36%), Positives = 293/523 (56%), Gaps = 30/523 (5%)

Query: 1   MPFRALGGYEKKVLAQTIEGRRNGVVFSSQITFNKKSDEFADDNATLYTGRSVNEVSLKS 60
           M  R L  YE K+L QT++G+RNGV F+++   N      +  + +         ++L S
Sbjct: 1   MCSRQLSEYEVKLLEQTLQGKRNGVAFAAKYGRNYDDSSLSSSDESTLVSLKDRRLTL-S 59

Query: 61  VLCAALQNIICNHVELYTTINDRLYFTPVLQIETNDVIKTISYDKSKDKAL-MKDQISDK 119
           V+   LQ +I  H+ELYT I++   ++ V +I   DVI  I++D  KD+ +         
Sbjct: 60  VITRVLQILIPKHIELYTAISEDHRYSLVTEIRAKDVIDIITFDSEKDERINCHLGPPPY 119

Query: 120 LLRHIFNKCDFKPNNGKPLWQFSIANDSTMIFHGHDVLFDIFSTANFEKYLLKE----MN 175
           LLRHIFNK DFK    KPLW+  I +++T+IFHG D+LFD FS A F K  L E    M+
Sbjct: 120 LLRHIFNKSDFKLGQQKPLWKLYIIDETTIIFHGFDMLFDSFSAAYFHKCFLAEVNSYMS 179

Query: 176 DVLNSNQKLKTVKTLFKFDAERSLTNY----PRSIYENPKLHLPALTSDLLNLQTQSFFK 231
            +++S QK K +  LF+  +   L       PRSIY+        LT+ + N QT+SFFK
Sbjct: 180 SIVSSKQK-KPLDYLFQLSSSADLIKIYDEIPRSIYDYDSSPFAPLTAVMFNDQTKSFFK 238

Query: 232 TIYQNTLKKPIDLITSANSN--NNNQLSEYRTRN-TDILSGANSLCGRTVLGEISLERYQ 288
           ++Y N +KKPI+ IT+ +S      Q+ E  T    + +    SLCG T+ G IS  R+ 
Sbjct: 239 SLYLNAVKKPIEFITNTSSQVKTYQQIKEAETEGYLNPMGIHRSLCGNTIFGTISSCRFN 298

Query: 289 HLKMLVEQENISLRSFISAITMVCLKPIVKNFDGSIIFSIPVNLRSLIADSSDFGLFYKN 348
            L     +E ISL+S I  + M+ LKP + +F  +++FSI VNLR  ++ S  FGL+Y++
Sbjct: 299 ELTEKATREQISLKSLICGLIMMSLKPTLNDFSKNMVFSIRVNLRDDVSKSKTFGLYYRD 358

Query: 349 IKVECPLELINDEKY----YTNPEVLHSMQNNS---LLEIQFERISRHVSDVISQRMKAW 401
           I +ECPL LI+D       Y +   + + +  +   + E QF+ ++ ++ +V+++++  W
Sbjct: 359 IIIECPLSLIDDRAIQFSGYRDHVGITAQELETYEKVYEQQFKDVTTYIQNVMNEKIGYW 418

Query: 402 EKFGFNDDDIKRMKFSNDEKTGIAPIIQINDVTEISFDFGNDNISYS--FSVNNLNFTKS 459
           +     D+DIK MK  +D       IIQIND+TEI     N+N+S +  + V + +   S
Sbjct: 419 K----TDNDIKMMKMMDDMHQSKDEIIQINDLTEIDI---NENLSQNDPYCVKSSSMVTS 471

Query: 460 LSCNEFMSLFYSHNAQGGLNICIHYPDGYNMEAFVECFQSFIE 502
           LS  E  S+ Y+H    GL I IH P   +ME+FVE FQ+F++
Sbjct: 472 LSKKEMFSVSYTHCEASGLTISIHIPKMRSMESFVENFQAFLD 514

>KLTH0C11572g Chr3 complement(950297..951853) [1557 bp, 518 aa] {ON}
           similar to uniprot|Q08984 Saccharomyces cerevisiae
           YPL272C Hypothetical ORF
          Length = 518

 Score =  273 bits (699), Expect = 3e-85,   Method: Compositional matrix adjust.
 Identities = 173/521 (33%), Positives = 280/521 (53%), Gaps = 36/521 (6%)

Query: 3   FRALGGYEKKVLAQTIEGRRNGVVFSSQITFNKKSDEFADDNATLYTGRSVNEVSLKSVL 62
           +R L   EK +L +T  G +NGV+FS+    N  + + +D N TL +   +N+    S++
Sbjct: 8   YRNLTPTEKTILCETATGVKNGVLFSATYYKNFPNKDLSD-NETLRS--DMNQRLSDSMI 64

Query: 63  CAALQNIICNHVELYTTINDRLYFTPVLQIETNDVIKTISYDKSKDKAL-MKDQISDKLL 121
             AL  +I  H EL   ++  L F PV +I+  DV++ I +D   D+ +   + +   LL
Sbjct: 65  WKALLKVIKEHAELRCAVSRNLEFEPVDKIDFEDVVRKIEFDCYADEQVNCYNGVPPYLL 124

Query: 122 RHIFNKCDFKPNNGKPLWQFSIANDSTMIFHGHDVLFDIFSTANFEKYLLKEMNDVLNSN 181
           RHIF+KC F     +PLWQ  + + + ++FHGHDVLFD F+ ANF K  L+ +N +  S 
Sbjct: 125 RHIFDKCHFTLGQKQPLWQLFVIDGTMVVFHGHDVLFDTFAAANFHKLFLQALNSLSESC 184

Query: 182 QKLKTVKTLFKFDAERSLTNYPRSIYENPKLHLPALTSDLLNLQTQSFFKTIYQNTLKKP 241
              + V     F   + L   PR++++  +    +  +D    Q+Q+  +++Y   +KKP
Sbjct: 185 TSPRPV-----FKGGKILPTLPRALFQKQEPQAASSITDAFYSQSQAILRSLYNLAIKKP 239

Query: 242 IDLITSANSNNNNQLSEYRTRNTDILSGANSLCGRTVLGEISLERYQHLKMLVEQENISL 301
           +  I S    ++   +E  +   + L+  N LCG  V G IS  R++ LK ++    IS+
Sbjct: 240 LRFIESGRIEHS---TEQHSGTPEPLNYPNHLCGTVVFGTISTPRFKILKGILNDHKISM 296

Query: 302 RSFISAITMVCLKPIVKNFDGSIIFSIPVNLRSLIADSSDFGLFYKNIKVECPLEL---- 357
           ++FI + T+ CL+P++ + +  I FS+P+NLR LI  SS  G++++N+ +ECPL      
Sbjct: 297 KTFIISATLFCLQPVLDSSEDKITFSLPINLRDLIPWSSPLGIYHRNVLIECPLGTAGRN 356

Query: 358 --INDEKYYTNPEVLHSM---------QNNSLLEIQFERISRHVSDVISQRMKAWEKFGF 406
              +   Y +NPE+L  M          + +  E  FER   HVS+ + + ++  E   F
Sbjct: 357 SNCSAGSYVSNPELLEGMTLSDANQTNADQADPESLFERTVTHVSNELKKALQDLETGKF 416

Query: 407 NDDDIKRMKFSNDEKTGIAP----IIQINDVTEISFDFGNDNISYSFSVNNLNFTKSLSC 462
            D D+  MK   + K   A     II+IND++EI  D  N N S  + V ++  TKS   
Sbjct: 417 KDMDM--MKMEQEAKFYAAASGSKIIEINDLSEI--DLSNVNPS-QYVVEDICATKSRCN 471

Query: 463 NEFMSLFYSHNAQGGLNICIHYPDGYNMEAFVECFQSFIEN 503
           N FMS+ YS ++  GLN+ IHY +   M  FVE F++F+EN
Sbjct: 472 NTFMSISYSFSSTCGLNLGIHYSEDCEMNYFVESFEAFLEN 512

>Kwal_56.22341 s56 (56939..58498) [1560 bp, 519 aa] {ON} YPL272C -
           Hypothetical ORF [contig 186] FULL
          Length = 519

 Score =  239 bits (609), Expect = 5e-72,   Method: Compositional matrix adjust.
 Identities = 163/525 (31%), Positives = 263/525 (50%), Gaps = 43/525 (8%)

Query: 3   FRALGGYEKKVLAQTIEGRRNGVVFSSQITFNKKSDEFADDNATLYTGRSVNEVSLKSVL 62
           +R L   EK ++ +T  G +NGV+FSS  T+ +  D   D+ +   +   + +    +++
Sbjct: 8   YRNLTATEKTIICETAAGIKNGVLFSS--TYFEGPDN-VDNTSPSVSCMKMGKGLPDAIM 64

Query: 63  CAALQNIICNHVELYTTINDRLYFTPVLQIETNDVIKTISYDKSKD-KALMKDQISDKLL 121
             AL  II  + EL ++IN  + F  +  I  +DV++ I +D   D K    + +   LL
Sbjct: 65  WQALSQIIKENAELRSSINKFMQFEAIDTIAFDDVVRKIEFDNLTDEKVSCYNGVPPYLL 124

Query: 122 RHIFNKCDFKPNNGKPLWQFSIANDSTMIFHGHDVLFDIFSTANFEKYLLKEMNDVLNSN 181
           RHIF+KC F     KPLWQ  + + S ++FHGHDVLFD F+ A F K  L    + LNS 
Sbjct: 125 RHIFDKCHFSIGQQKPLWQVFVIDQSMVVFHGHDVLFDGFAAATFHKLFL----EALNSF 180

Query: 182 QKLKTVKTLFKFDAERSLTNYPRSIYENPKLHLPALTSDLLNLQTQSFFKTIYQNTLKKP 241
           + +K  K+   F     L    +S+     + L +   D +   +Q+  K +Y   +KKP
Sbjct: 181 RNVKGQKSDLIFKTREDLIPLCQSLAAEHNVSLISSVKDQVLTYSQTALKNLYSLAIKKP 240

Query: 242 IDLITSANSNNNNQLSEYRTRNTDILSGANSLCGRTVLGEISLERYQHLKMLVEQENISL 301
           +  I S    ++   +   +   D+ S A  LCG  V G ++ ER + L+ L+ +  IS 
Sbjct: 241 LRFIESGRLEHSGIPA---SNPYDLASYAGDLCGTVVFGNVNPERVRGLRALMNESKISF 297

Query: 302 RSFISAITMVCLKPIVKNFDGSIIFSIPVNLRSLIADSSDFGLFYKNIKVECPLELINDE 361
           RSFI ++TM CL P+++  +  IIFS+P+NLR  I  +SD G+F  N+  ECPL+LI   
Sbjct: 298 RSFIISVTMFCLLPVLEPSEEKIIFSVPINLRESIPWASDLGVFQNNVLFECPLDLI--- 354

Query: 362 KYYTNPEVLHSMQNNSLLE------------------IQFERISRHVSDVISQRMKAWEK 403
           K+   P    S  N   LE                    F RI  HV+  +       EK
Sbjct: 355 KHDIEPCSGISTFNQEFLEGSTLTDVGGVNEDQNDPQTVFRRILTHVTTELELAAMRLEK 414

Query: 404 FGFNDDDIKRMK-----FSNDEKTGIAPIIQINDVTEISFDFGNDNISYSFSVNNLNFTK 458
              + +D+ + +     F+   ++    I++IND+ E+     +  I   + + ++  T 
Sbjct: 415 SHSSGEDLIKAEREARYFAASSRS---KIVEINDLLEVDL---SSKIHSRYKIGDVCSTS 468

Query: 459 SLSCNEFMSLFYSHNAQGGLNICIHYPDGYNMEAFVECFQSFIEN 503
           S   + FMS+ Y  +   GLN+ IHY +G+NME FVE F+ F+++
Sbjct: 469 SRKSDTFMSISYCSSEISGLNLGIHYSEGFNMEYFVESFEGFLDS 513

>Ecym_3011 Chr3 (22943..24472) [1530 bp, 509 aa] {ON} similar to
           Ashbya gossypii ACR018C
          Length = 509

 Score =  233 bits (593), Expect = 1e-69,   Method: Compositional matrix adjust.
 Identities = 167/519 (32%), Positives = 261/519 (50%), Gaps = 41/519 (7%)

Query: 4   RALGGYEKKVLAQTIEGRRNGVVFSSQITFNKKSDEFADDNATLYTGRSVNEVSLKSVLC 63
           R L   EK    +    RRNG+VF+   + NK   E   D+ TL   R  +       + 
Sbjct: 9   RDLSSVEKIFHKEVYTSRRNGIVFAVNYSSNKCESERWSDDITLSNLR--DSRLFDGQIS 66

Query: 64  AALQNIICNHVELYTTINDRLYFTPVLQIETNDVIKTISYDKSKDKAL-MKDQISDKLLR 122
            AL+ +I  +VEL  TI D   F P   I  +DV+  I +   KD+ +  ++ I   +LR
Sbjct: 67  NALEAMIKENVELCVTITDDRKFAPTEIIRYDDVVIHIEFKTYKDELIECQNGIPPYILR 126

Query: 123 HIF--NKCDFKPNNGKPLWQFSIANDSTMIFHGHDVLFDIFSTANFEKYLLKEMNDVLNS 180
           +I   NK +F    G+PLW+  I + + +I H H+V+FD+F+ ANF     K ++     
Sbjct: 127 NILENNKFEF----GRPLWELIIVDYTMVILHCHEVMFDLFAAANFHLKFQKALSQFPKD 182

Query: 181 NQKLKTVKTLFKFDAERSLTNYP--RSIYENPKLHLPALTSDLLNLQTQSFFKTIYQNTL 238
              L  +      + + S TN+     I  +P   LP        LQ  S  K  Y+ T+
Sbjct: 183 THALDILFVYEGNELQLSKTNFDGMSQISVSPVQSLP--------LQCISVLKGAYRTTV 234

Query: 239 KKPIDLITSANSNNNNQLSEYRTRNTDILSG---ANSLCGRTVLGEISLERYQHLKMLVE 295
           KK +++I   N   NNQ++ Y +  +D+       N+LCG TV G ++ ER   L  L  
Sbjct: 235 KKSLNVIRR-NFVANNQITTYESSKSDVFKSMFNPNTLCGTTVSGSLNAERLASLLELTS 293

Query: 296 QENISLRSFISAITMVCLKPIVKNFDGSIIFSIPVNLRSLIADSSDFGLFYKNIKVECPL 355
            EN+ + S + AIT++ LKP+++ F+GSI F +P+++R  + +  D G+ Y N+ VECPL
Sbjct: 294 SENVCMTSVLCAITLLSLKPLIRKFNGSITFVVPIDIREKL-EIFDLGVSYTNLMVECPL 352

Query: 356 ELINDEKYY-----TNPEVLHSMQNNS------LLEIQFERISRHVSDVISQRMKAWEKF 404
             IND+ +       N + LH +  NS      LLE QF++++ HV + + ++ +AW+K 
Sbjct: 353 SFINDKDFQHTVSDGNIKSLHKIDPNSPDYPEMLLEYQFKQLTSHVMNSLKEKKQAWQKR 412

Query: 405 GFNDDDIKRMKFSNDEKTGIAPIIQINDVTEISFDFGNDNISYSFSVNNLNFTKSLSCNE 464
            F+   +K  K     K      I+IN V     D G       F   N+NFT SL    
Sbjct: 413 RFDMSSLKGKKLRRSNKIIRGKFIEINLV-----DMGEAQ-DGQFHTKNVNFTSSLGSKC 466

Query: 465 FMSLFYSHNAQGGLNICIHYPDGYNMEAFVECFQSFIEN 503
            +S+  +     G+NI +HYP+  +M+AFVECFQ  +E+
Sbjct: 467 LISVSCAILRGVGMNIFMHYPESNDMDAFVECFQILLED 505

>ACR018C Chr3 complement(388482..389918) [1437 bp, 478 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YPL272C
          Length = 478

 Score =  215 bits (548), Expect = 2e-63,   Method: Compositional matrix adjust.
 Identities = 161/519 (31%), Positives = 257/519 (49%), Gaps = 74/519 (14%)

Query: 14  LAQTIEGRRNGVVFSSQITFNKKSDEFADDNATLYTGRS--VNEVSLKSVLCAALQNIIC 71
           + + ++G   G    S   F+++  E   D++TL + R   + E  + S    AL+++I 
Sbjct: 1   MRRCVQGCAMGRFLRSLNGFDRREQETWSDSSTLMSSRCGCLREHQISS----ALRSMIR 56

Query: 72  NHVELYTTINDRLYFTPVLQIETNDVIKTISYDKSKDKALM-KDQISDKLLRHIFNKCDF 130
            +VE+  T+ D   F PV +IE +DV++ I +   KD+A+   D I   + RHI NK  F
Sbjct: 57  ENVEMCVTVTDGPKFAPVSRIEYDDVVRVIEFQTYKDEAIACHDGIPPYVARHILNKSKF 116

Query: 131 KPNNGKPLWQFSIANDSTMIFHGHDVLFDIFSTANFEKYLLKEMNDVLNSNQKLKTVKTL 190
           +   GKPLW+  IA+ S +IFH H+VLFD+F+  NF                        
Sbjct: 117 E--AGKPLWEVYIADGSMVIFHCHNVLFDLFAAGNFH---------------------VR 153

Query: 191 FKFDAERSLTNYPRS----IYENPKLHLP------ALTSDLLNLQTQSFFKTIYQNTLK- 239
           F+   +R   N P +    +YE   L LP      +L    +     S F +  +N  + 
Sbjct: 154 FQQALQRCEKNEPHNETLFVYEGGPLQLPIDPDACSLPGVDVPYPASSPFVSFVKNVCRY 213

Query: 240 --KPIDLITSANSNNNNQLSEYRTRNTDILS-GANSLCGRTVLGEISLERYQHLKMLVEQ 296
             KP   + SA + +         R   +L+    SL G TV G ++ ++   L  L+ +
Sbjct: 214 ALKPFGALASAVTPSLRLNRSSLGRKPFLLTLDKESLYGTTVSGYLNSKKLDSLLKLISK 273

Query: 297 ENISLRSFISAITMVCLKPIVKNFDGSIIFSIPVNLRSLIADSSDFGLFYKNIKVECPLE 356
           E + +RSF+ AIT++ LKP+++NFDGSI FSIP++LR+    ++ FG   K I V+CPL 
Sbjct: 274 EEVCVRSFLCAITLLSLKPLIRNFDGSIAFSIPLDLRTESHKTTPFGFQSKRILVDCPLA 333

Query: 357 LIND---EKYYTNPEVLHSMQ--------NNSLLEIQFERISRHV-SDVISQRMKAWE-K 403
           LI+D   E  +  P      +        +  LLE QF+R++ HV   + +Q    W  K
Sbjct: 334 LIDDRVFESLFNRPSKQRKTKLDKNSPKFSEGLLEYQFKRVTTHVMKSLTAQTSGDWTGK 393

Query: 404 FGFNDDDIKRMKFSNDEKTGIAPIIQINDVTEISFDFGNDNISYSFSVNNLNFTKSLSCN 463
             ++   +++ K           II+IN V     D G  + S  F + N+NFT SL   
Sbjct: 394 RKYSKCQLRKKK-----------IIEINVV-----DMGT-SPSARFQIKNMNFTDSLGSE 436

Query: 464 EFMSLFYSHNAQGGLNICIHYPDGYNMEAFVECFQSFIE 502
            FMSL  +     G+N+C+HY +  +M+ FV+CFQ+F++
Sbjct: 437 TFMSLSCALMRGVGMNMCMHYLERDSMDMFVDCFQTFLD 475

>Kpol_1032.1 s1032 (25..765) [741 bp, 246 aa] {ON} (25..765) [741
           nt, 247 aa]
          Length = 246

 Score =  163 bits (412), Expect = 3e-46,   Method: Compositional matrix adjust.
 Identities = 91/228 (39%), Positives = 146/228 (64%), Gaps = 4/228 (1%)

Query: 276 RTVLGEISLERYQHLKMLVEQENISLRSFISAITMVCLKPIVKNFDGSIIFSIPVNLRSL 335
           R + G I+ ER+  LK L+ +  I LRS I  I M+C KP ++NFDG+I FSI V+++ +
Sbjct: 23  RVLFGTIAAERFNRLKALIRKGRICLRSVICGIVMLCTKPNIQNFDGNIRFSIGVDMKPI 82

Query: 336 IADSSDFGLFYKNIKVECPLELINDEKYYTNPEVLHSMQNNSLLEIQFERISRHVSDVIS 395
           + DSS FG+  KNI V+CPL+LI D+K+Y + +   S++N  +LEIQF +++  V++ +S
Sbjct: 83  VDDSSQFGILKKNIIVDCPLKLI-DDKHYKDTDS-ESIKNGDILEIQFRKVTDFVTEELS 140

Query: 396 QRMKAWEKFGFNDDDIKRMKFSNDEKTGIAPIIQINDVTEISFDFGNDNISYSFSVNNLN 455
            ++++  K  F  ++      S + +   + +IQIND+T+I F     N +  +S ++L 
Sbjct: 141 NKLQSMAKH-FKRNNCPFNFSSINSQISDSKVIQINDLTDIPFTTTEQNPN-GYSFHDLK 198

Query: 456 FTKSLSCNEFMSLFYSHNAQGGLNICIHYPDGYNMEAFVECFQSFIEN 503
            T+ LS NE MSL Y  N+   ++I IHY +   M++FVECF++FIEN
Sbjct: 199 VTEGLSPNESMSLSYITNSNSAMSISIHYTETKYMDSFVECFRTFIEN 246

>Kpol_191.1 s191 complement(429..848) [420 bp, 139 aa] {ON}
           complement(429..848) [420 nt, 140 aa]
          Length = 139

 Score = 65.9 bits (159), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 49/141 (34%), Positives = 78/141 (55%), Gaps = 7/141 (4%)

Query: 3   FRALGGYEKKVLAQTIEGRRNGVVFSSQITFNKKSDEFADDNATLYT-GRSVNEVSLKSV 61
            R L   EK  L QT EG  NG++FS +I+  KK ++   D+ATL+T G S N   L   
Sbjct: 2   LRILNESEKSALKQTSEGSMNGIIFSVKIS--KKCEDNLSDDATLHTTGESGNLQLLLL- 58

Query: 62  LCAALQNIICNHVELYTTINDRLYFTPVLQIETNDVIKTISYDKSK-DKALMKDQISDKL 120
              +L+ +I  + EL TT+++ L+F  + +++T DV+K I+Y + K D        S  L
Sbjct: 59  --KSLKLLIPKYKELCTTVDENLHFVHLDEVKTTDVVKIINYSRRKFDINEGLSGPSSSL 116

Query: 121 LRHIFNKCDFKPNNGKPLWQF 141
           +  I+   +F+P +GKP  + 
Sbjct: 117 INSIYYHSNFQPGSGKPYGKL 137

>TDEL0E05110 Chr5 (941876..943285) [1410 bp, 469 aa] {ON} Anc_5.119
           YGR212W
          Length = 469

 Score = 49.7 bits (117), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 104/486 (21%), Positives = 186/486 (38%), Gaps = 111/486 (22%)

Query: 44  NATLYTGRSVNEVSLKSVLCAALQNIICNHVELYTTI-----NDRLYFTPVLQIETNDVI 98
           ++  + G  +N++  K  +  AL++ I NH +L+  +     ++  Y   V  I+ +DV+
Sbjct: 23  HSCFFLGLQLNQLPDKHQIAHALRSTIANHPKLHQNVAIDPEDNIPYIKNVDTIKFDDVV 82

Query: 99  KTISYDKSKDKALMKDQISDKLLRHIFNKCDFKPNNGKPLWQFSI-ANDSTMIFHGHDVL 157
           + +S+D   D  +           HIF   +F  N  KPLW+  + A ++ ++      L
Sbjct: 83  EYVSWDGFDDNTIC----------HIFQTYNFPYNIEKPLWKVLVYAKENRLLLLLDHAL 132

Query: 158 FDIFSTANFEKYLLKEMNDVLNSNQKLKTVKTLFKFDAERS--LTNYPRS---------- 205
           FD  S   F K  +  ++     +  L    T      E S    N+P S          
Sbjct: 133 FDGMSAVIFWKSFMSSLSSDARDDFDLLYELTGDPMVQEDSHVYENWPTSWSSTLTKAIA 192

Query: 206 --IYENPKLHLPALTSDLLNLQTQSFFKTIYQNTLKKPIDLITSANSNNNNQLSEYRTRN 263
             I++     + ++  D L     SF  ++  +   KP D  +    NNN QL+      
Sbjct: 193 GVIFKFMPSVITSVGKDQLRFNGYSFPDSLLTH---KPDDDSSYEIRNNNRQLN--LQVQ 247

Query: 264 TDILSGANSLCGRTVLGEISLERYQHLKMLVEQENISLRSFISAITMVCLKPIVKNFDGS 323
            D L+G  S C                    +   +SL SFI+A+  + L+  +++ D S
Sbjct: 248 PDHLNGIISAC--------------------KSHQVSLTSFITALISMSLQLKIEDGDYS 287

Query: 324 ---IIFSIPVNLRSLIADSSD-------FGLFYKNIKVECPLELINDEKYY--------- 364
              I+  IP+N R   AD  D        G F   + VE    L   E+ +         
Sbjct: 288 GSKIMIDIPMNTRGACADVLDIPDTSVTMGNFVAGLNVE--YNLGESEELWQIARTVQAA 345

Query: 365 ----TNPEVLHSMQNNSLLEIQFERISRHVSDVISQRMKAWEKFGFNDDDIKRMKFSNDE 420
               T  ++L ++    LL++         ++ I Q++KA                    
Sbjct: 346 LNKQTKTDILETVNKVRLLDVA------DTTEFIRQKVKA-------------------- 379

Query: 421 KTGIAPIIQINDVTEISF-DFGNDNISYSFSVNNLNFTKSLSCNEFMSLFYSHNAQGGLN 479
            TG +   +   VT + F +F +   ++ + V +  F +    ++  +       +GGLN
Sbjct: 380 -TGPSGTFE---VTNLGFQEFADAQSNHGYLVEDAVFNEPQGLSDIFTCCIISTPRGGLN 435

Query: 480 ICIHYP 485
             I YP
Sbjct: 436 CSISYP 441

>Kwal_27.9898 s27 (112396..113778) [1383 bp, 460 aa] {ON} YGR212W -
           Hypothetical ORF [contig 43] FULL
          Length = 460

 Score = 48.9 bits (115), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 74/299 (24%), Positives = 129/299 (43%), Gaps = 41/299 (13%)

Query: 53  VNEVSLKSVLCAALQNIICNHVELYTTINDRLYFTPVLQIETNDVIKTISYDKSKDKALM 112
           +N+   +S +C A++  +     LY+ +  +    P L+   N+ I      +  D  L+
Sbjct: 29  LNQSPSRSEICGAIKATVEECPHLYSDVVTKGEL-PSLE-PINEQILLEQVLEYTDYGLL 86

Query: 113 KDQISDKLLRHIFNKCDFKPNNGKPLWQFSIAND-STMIFHGHDVLFDIFSTANFEKYLL 171
            + I +K    IF + +F   +GKPLW+  + ND  T++     V+ D  ST  F K  L
Sbjct: 87  DEDICNK----IFREVEFTYGSGKPLWKVLVLNDRRTLVLCTDHVILDGLSTVAFWKKFL 142

Query: 172 KEMNDVLNSNQKLKTVKTLFKFDAERSLTNYPRSIYENPKLHLPALTSDLLNLQTQSFFK 231
             +N   +++   + V        E S+ N    + ++P   +P            +FF+
Sbjct: 143 GSLNATASTSLVSEVV-------FEPSVHN--SVVPQHPYDRIPV-----------TFFE 182

Query: 232 TIYQNTLKK-------PIDLITSA-NSNNNNQLSEYR----TRNTDILSGANSLCGRTVL 279
           T+ +  ++         IDLIT+        Q  +++    TR+     G+     R + 
Sbjct: 183 TMARALVQVLVFLAFLKIDLITTLFVPPLQKQYLKFKNYQFTRDYLAADGSVRNDNRLLK 242

Query: 280 GEISLERYQHLKMLVEQENISLRSFISAITMVCLKPI-VKNFDGS-IIFSIPVNLRSLI 336
             I  ++ Q+L  L +  N+SL S I AI    LK +    FDG+    SIP+N R  I
Sbjct: 243 IVIPPQKLQNLLALCKGHNVSLSSLILAIMANSLKHVDSSQFDGTRAKISIPMNTRPFI 301

>TPHA0H00960 Chr8 (201187..202617) [1431 bp, 476 aa] {ON} Anc_5.119
           YGR212W
          Length = 476

 Score = 48.5 bits (114), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 98/500 (19%), Positives = 192/500 (38%), Gaps = 108/500 (21%)

Query: 47  LYTGRSVNEVSLKSVLCAALQNIICNHVELYTTIN---DRLYFTPVLQ----IETNDVIK 99
            Y    +N++  ++ LC++L+ +I  +  L   IN   D  Y   +++        DVI+
Sbjct: 25  FYVTVKLNKLPTENELCSSLRKVIAKNRILRCNINKNGDSAYINDIIENDNEFTVQDVIE 84

Query: 100 TISYDKSKDKALMKDQISDKLLRHIFNKCDFKPNNGKPLWQFSIAND-STMIFHGHDVLF 158
              ++K ++               +F + +FK    KPLW+  IA+  +T++       F
Sbjct: 85  YRDWNKFEEDEQ----------NSVFQEINFKYGELKPLWKLIIASKINTIVLAMDHTFF 134

Query: 159 DIFSTANFEKYLLKEMNDV--------------------------LNSNQKLKTVKTLF- 191
           D  S   F K LL E++ +                          ++SN  L      F 
Sbjct: 135 DGSSATLFWKALLLELSSIDRDQLEDTDVVFSKANIDDNYITALDISSNNLLDDCPISFA 194

Query: 192 ----KFDAERSLTNYPRSIYENPKLHLPALTSDLLNLQTQSFFKTIYQNTLKKPIDLITS 247
               +F A +    +P +I         A  S+LL     SF  +I+++   KP      
Sbjct: 195 SKIKRFIASKIFQYFPYTII--------APNSELLQFDDYSFPSSIFEDGCDKP------ 240

Query: 248 ANSNNNNQLSEYRTRNTDILSGANSLCGRTVLGEISLERYQHLKMLVEQENISLRSFISA 307
                    + Y+ +N            R  +  I   +  ++      +NI+L S++SA
Sbjct: 241 ---------ASYKLKNN----------SRRAIINIKPAQISNVLKYCRSKNIALTSYLSA 281

Query: 308 ITMVCL---KPIVKNFDGSIIFSIPVNLRSLIAD------SSDFGLFYKNIKVECPLELI 358
           +    +   K    N   +I   IP+NLR ++ +      + DFG +  +  +     +I
Sbjct: 282 LISYYVNIYKDKSVNHGSAIKVEIPINLRGILKEKLEMDIAPDFGCYISSTDL-----VI 336

Query: 359 NDEKYYTNPEVLHSMQNNSLLEIQFERISRHVSDV-ISQRMKAWEKFGFNDDDIKRMKFS 417
           + +   +  + L S     +     E +   + ++ I++ + +++ F +     K     
Sbjct: 337 DSQLNGSTIDKLASTFQKQISNSVKENVDETIENIKITEVIDSFKFFEY-----KVTPKP 391

Query: 418 NDEKTGIAPIIQINDVTEISFDFGNDNISYSFSVNNLNFTKSLSCNEFMSLFYSHNAQGG 477
           +++K       ++ ++  +SF+  NDN    F V +  F  S S     + +      GG
Sbjct: 392 SEDKIFPGATFEVTNLGRVSFETKNDN----FFVEDALFGGSQSLTTIFTCYVISTDFGG 447

Query: 478 LNICIHYPDGYN--MEAFVE 495
           +N+ I Y D     ME  +E
Sbjct: 448 MNLAITYSDSIKDFMEPVIE 467

>CAGL0K00737g Chr11 complement(81263..82636) [1374 bp, 457 aa] {ON}
           similar to uniprot|P53304 Saccharomyces cerevisiae
           YGR212w
          Length = 457

 Score = 48.1 bits (113), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 94/460 (20%), Positives = 189/460 (41%), Gaps = 68/460 (14%)

Query: 49  TGRSVNEVSLKSVLCAALQNIICNHVELYTTI---NDRLYFTPVLQ-IETNDVIKTISYD 104
            G  +N +  +S    AL+ ++ +H +LY      N+ +   P+ + I+ +DV+  + +D
Sbjct: 26  VGVELNSLPNRSDFICALRRVVNSHFQLYCNAYKSNNEVVVNPIGEPIKFDDVVDYMDWD 85

Query: 105 KSKDKALMKDQISDKLLRHIFNKCDFKPNNGKPLWQ-FSIANDSTMIFHGHDVLFDIFST 163
                        ++ +  +F K +F+    KPLW+   +   + MIF    + FD  +T
Sbjct: 86  ----------TYGEEEINSVFRKYNFEYGVDKPLWKVIVVPKANKMIFATDHLFFDGIAT 135

Query: 164 ANFEKYLLKEMNDVLNSNQKLKTVKTLFKFDAERSLTNYPRSIYENPKLHLP-------A 216
             F   LLK + + L  +  L   + +++       T+     +   KL +P        
Sbjct: 136 VLFWTELLKSLEE-LKQDNDLDVDEIIYRPGGS---TDSIDQCHPYEKLPIPFSWKVKRP 191

Query: 217 LTSDLLNLQTQSFF---KTIYQ-NTLKKPIDLITSANSNNNNQLSEYRTRNTDILSGANS 272
           +   L  +   +      +I Q +  K P D +      N+N    Y+ +NT+       
Sbjct: 192 IVKALFTIAPGAVVSQDASIIQFDEYKIPEDYL----KKNSNDDGCYQIKNTN------- 240

Query: 273 LCGRTVLGEISLERYQHLKMLVEQENISLRSFISAITMVCLKPIVK-NFDGSII-FSIPV 330
              R +  ++S  + + +    +Q ++S  ++++A+  + L  I K  + GS I + +P+
Sbjct: 241 ---RQISLKMSSNKLKVIMKDCKQHHVSFTAYLTAVLYLALGKIPKEKYSGSTIKYEVPM 297

Query: 331 NLRSLIADSSD----FGLFYKNIKVECPLELINDEKYYTNPEVLHSMQNNSLLEIQFERI 386
           N R+ I++S +    +G F    +    L+   DE      E+  S+    +     E+ 
Sbjct: 298 NTRNRISNSGEYSNSYGTFVAGGEFIETLDFERDEW-----ELAQSIHKKIV-----EKS 347

Query: 387 SRHVSDVISQRMKAWEKFGFNDDDIKRMKFSNDEKTGIAPIIQINDVTEISFDFGNDNIS 446
           +  V D I++  +  E      D  K MK   +  TG +   +   VT + F   + N  
Sbjct: 348 TTGVMDAINE-ARLLELV----DAKKFMKMKFETTTGPSSTFE---VTNLGFQNFSQNEH 399

Query: 447 YSFSVNNLNFTKSLSCNEFMSLFYSHNAQGGLNICIHYPD 486
             ++V +  F +       ++        GGLN  + YP+
Sbjct: 400 SKYTVTDAFFNEPQLFTNLITYSVISTPSGGLNCSMAYPE 439

>Suva_7.506 Chr7 (873531..874931) [1401 bp, 466 aa] {ON} YGR212W
           (REAL)
          Length = 466

 Score = 44.3 bits (103), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 73/321 (22%), Positives = 127/321 (39%), Gaps = 52/321 (16%)

Query: 44  NATLYTGRSVNEVSLKSVLCAALQNIICNHVEL-----YTTINDRLYFTPVLQIETNDVI 98
           ++  Y G  +NE+  K  L +AL+  +  H  L     Y   ++ +YF  + +    D I
Sbjct: 21  HSCFYIGIKLNELPQKHQLISALKYAVIKHERLSCNVFYEESDNEVYFKSITEPFLFDDI 80

Query: 99  KTISYDKSKDKALMKDQISDKLLRHIFNKCDFKPNNGKPLWQ-FSIANDSTMIFHGHDVL 157
             + Y +  D      Q+    + +IF   DF  N   PLW+   I + + M+     VL
Sbjct: 81  --VEYHRDWD------QLKQNEINYIFQTYDFAYNEATPLWKILIIPSQNEMLLVADHVL 132

Query: 158 FDIFSTANFEKYLLKEMNDVLNSNQKLKTVKTLFKFDAERSLTNYPRSIYENPKLHLPAL 217
            D  S  +  + L+K     L     ++  + ++      S      S +EN    +P  
Sbjct: 133 MDGMSAVHVWETLMKG----LQKEAPIEDDEAIYSPLFSSSTDTISASPFEN--WPVPWT 186

Query: 218 TSDLLNLQTQSFF---KTIYQNTLKKPIDLITSANSN---------NNNQLSEYRTRNTD 265
              +  L +  F+   KTI  N      DLI  AN +              S Y+ RNT+
Sbjct: 187 WRIIRQLASSLFYWSPKTIVTNNK----DLIQFANYSFPENFLEYEPTGDTSSYKVRNTN 242

Query: 266 ILSGANSLCG--RTVLGEISLERYQHLKMLVEQENISLRSFISAITMVCLKPIVKN-FDG 322
                  L    ++VL E             +  N+SL SF+ A+  +  K  +K  ++G
Sbjct: 243 HQWEFRLLPAHLKSVLSE------------CKAHNVSLTSFLGALVCLSFKRTLKEVYNG 290

Query: 323 SII-FSIPVNLRSLIADSSDF 342
           + +   +P+N R +  ++  F
Sbjct: 291 TYLKMELPMNTRKICRENLQF 311

>YGR212W Chr7 (917040..918446) [1407 bp, 468 aa] {ON}
           SLI1N-acetyltransferase, confers resistance to the
           sphingolipid biosynthesis inhibitor myriocin (ISP-1) by
           converting it into N-acetyl-myriocin, co-operates with
           Ypk1p in mediating resistance to myriocin
          Length = 468

 Score = 42.4 bits (98), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 34/122 (27%), Positives = 56/122 (45%), Gaps = 6/122 (4%)

Query: 44  NATLYTGRSVNEVSLKSVLCAALQNIICNHVELYTTI-NDRLYFTPVLQIETNDVIKTIS 102
           ++  Y G  +NE+  KS L AAL+  +  H  L   +  D L     LQ    ++++ + 
Sbjct: 21  HSCFYVGIKLNELPKKSQLIAALKYTVIQHERLTCNVFYDELKKENFLQ----NILEPLK 76

Query: 103 YDKSKDKALMKDQISDKLLRHIFNKCDFKPNNGKPLWQFSI-ANDSTMIFHGHDVLFDIF 161
           +    +     DQ+ +  + HIF + +F  N  KPLW+  I  N + M+     VL D  
Sbjct: 77  FCDLVEYRHDWDQLGETEINHIFQRYNFSYNENKPLWKILILPNQNQMLLLTDHVLMDGM 136

Query: 162 ST 163
           S 
Sbjct: 137 SA 138

>Ecym_2483 Chr2 (946645..948030) [1386 bp, 461 aa] {ON} similar to
           Ashbya gossypii ACL138C
          Length = 461

 Score = 40.8 bits (94), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 36/171 (21%), Positives = 70/171 (40%), Gaps = 17/171 (9%)

Query: 47  LYTGRSVNEVSLKSVLCAALQNIICNHVELYTTI----NDRLYFTPV-LQIETNDVIKTI 101
            Y G + N+   +S LC  L+ +I  H  LY  I      +    P+ ++I  +DV++  
Sbjct: 23  FYVGVTFNKPVDRSSLCCVLKELIPKHPHLYRNIFTKDGSKKLVRPLNVEIRLDDVLEET 82

Query: 102 SYDKSKDKALMKDQISDKLLRHIFNKCDFKPNNGKPLWQF-SIANDSTMIFHGHDVLFDI 160
            +D   + A             I     F+ +  +PLW+  S+   +  +F      FD 
Sbjct: 83  GFDSLDESA----------ANSILKNSTFQYDQQRPLWKLISLKAGTQFLFCFDHAFFDG 132

Query: 161 FSTANFEKYLLKEMNDVLNSNQK-LKTVKTLFKFDAERSLTNYPRSIYENP 210
            S   F    +  +N +   N++ +   + L+K  A+  +  +P  ++  P
Sbjct: 133 MSAVIFWNDFISALNSIKPENRRGMDLNEVLYKAAADPEIRVHPFDLWPIP 183

>Skud_7.548 Chr7 (891732..893159) [1428 bp, 475 aa] {ON} YGR212W
           (REAL)
          Length = 475

 Score = 40.0 bits (92), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 95/477 (19%), Positives = 184/477 (38%), Gaps = 73/477 (15%)

Query: 44  NATLYTGRSVNEVSLKSVLCAALQNIICNHVEL-YTTINDRLYFTPVLQIETNDVI--KT 100
           ++  Y G  +NE+  K  +  AL++ +  H  L +  I D+L     LQ      +    
Sbjct: 29  HSCFYVGIKLNELPEKGQIITALKSTVAKHERLTFNLIYDKLNNEHYLQNAAEPFVFGDV 88

Query: 101 ISYDKSKDKALMKDQISDKLLRHIFNKCDFKPNNGKPLWQ-FSIANDSTMIFHGHDVLFD 159
           ++Y    D       + +  + HIF + +F  +  KPLW+   I + + M+     VL D
Sbjct: 89  VAYHHDWD------HLKETEINHIFQEHNFPYSEHKPLWKILIIPSQNQMLLMTDHVLMD 142

Query: 160 IFSTANFEKYLLKEMNDVLNSNQKLKTVKTLFKFDAERSLTNYPRSIYENP-KLHL-PAL 217
             S  +  +  ++ +               L    A++ ++  P   +  P K H+   L
Sbjct: 143 GMSAVHVWETFMEGLQKQGPVGVDETIYSPLSGSSADQIISIPPYENWPIPWKWHIVRQL 202

Query: 218 TSDLLNLQTQSFF---KTIYQNTLKK-PIDLITSANSNNNNQLSEYRTRNTDILSGANSL 273
            S L     Q+     K + Q T    P DL+ +  +  N+    Y+ +NT+       L
Sbjct: 203 ASRLYYWFPQAIVTNNKNLIQFTKYSFPKDLLDAKPTEENDL---YKVKNTNRQWEFQLL 259

Query: 274 CGRTVLGEISLERYQHLKMLVEQ---ENISLRSFISAITMVCLKPIVK-NFDGSII-FSI 328
                          HL+ ++++    N SL S + A+     +   + +++G  +   +
Sbjct: 260 PA-------------HLESVIQECRTNNTSLTSLLGALVCSSFEKTARGDYNGEFLKIEL 306

Query: 329 PVNLRSLIADSSDFGLFYKNIKVECPLELINDEK-----YYTNPEVLHSMQNNSLLEIQF 383
           P+N R+   +                L+L +D++     +  N E  H +      ++  
Sbjct: 307 PMNTRNSCKEV---------------LQLQSDDELAIGNFIANIEFRHELHQ----DLGI 347

Query: 384 ERISRHVSDVISQRMKAWEKFGFNDDDIKRMKFSNDEKTGIAPIIQINDVTEISFDFGND 443
             I+  + DVI    K  +K     ++IK ++  + +K  I   + +ND    +F+  N 
Sbjct: 348 WHIASQIQDVIKTSSK--DKITDKVNEIKLLEVVSPQKF-IEDKVNLNDGPSSTFEVTNL 404

Query: 444 NI---------SYSFSVNNLNFTKSLSCNEFMSLFYSHNAQGGLNICIHYPDGYNME 491
            +         +  F + N  F +    +  ++L       GGLN CI YP+    E
Sbjct: 405 GLQAFKNACDTNLPFHIVNATFNEPQGISAIITLSVISTPAGGLNCCISYPNTLTKE 461

>NDAI0D02360 Chr4 (545485..546897) [1413 bp, 470 aa] {ON} Anc_5.119
           YGR212W
          Length = 470

 Score = 36.6 bits (83), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 92/469 (19%), Positives = 195/469 (41%), Gaps = 73/469 (15%)

Query: 59  KSVLCAALQNIICNHVELYTTI-----NDRLYFTPVLQ--IETNDVIKTISYDKSKDKAL 111
           K  L  ALQ+ I  + +L+  I     ++ LY   + +  IE  DV++ ++++K ++K +
Sbjct: 38  KKQLYKALQDTIATYPQLHQNITKNKEDEYLYVEDIKKTPIEFEDVVEFVAWEKFEEKEI 97

Query: 112 MKDQISDKLLRHIFNKCDFKPNNGKPLWQFSIAND-STMIFHGHDVLFDIFSTANFEKYL 170
                       IF   +F   N +PLW+  +    +T I      LFD  S     +  
Sbjct: 98  ----------NSIFQTYNFHYRNDRPLWKILVVPSLNTFILLLDHALFDGISAVKIWETF 147

Query: 171 LKEMN---DVLNSNQKLKTVKTLFKFDAERSLTNYPRSIYENPKLHLPALTSDLLNLQTQ 227
           ++++N   ++ N +  +         +     + +P  I+  P           +  + +
Sbjct: 148 MEKLNKSSEIENIDVTVPLYIPEENHEGTLVASQHPYDIWPVP-----------IAWKVK 196

Query: 228 SFFKTIYQNTLKKPIDLITSANSN---------NNNQLSEYRTRNTDILSGANSLCGRTV 278
           SF  T   N   +    I S NSN             LS+Y           N    + +
Sbjct: 197 SFIATKLFNWYPQ---AIISPNSNLFEFKGYKFPEGFLSQYPKDGVTSFKVRNDNTQKLI 253

Query: 279 LGEISLERYQHLKMLVEQENISLRSFISAITMVCLKPIVK-NFDGSII-FSIPVNLRSLI 336
             +++  + + +    +   +SL S+I AI ++ L+ + + ++ G+++  SIP+N R++ 
Sbjct: 254 --KMAPGKLETILKNCKTNAVSLTSYIVAIIIIALRNVTQESYTGNLLKVSIPINTRNIC 311

Query: 337 ADSSDFGLFYKNIKVECPLELINDEKYYTNPEVLHSMQNNS-LLEI-----QF--ERISR 388
           A+           +V  P E++    +  + +  H + ++S + +I     QF  +  + 
Sbjct: 312 AN-----------QVNTPEEMLQLGNFVGSMDFEHPINSDSGIWDIARDVQQFITKNTTV 360

Query: 389 HVSDVISQRMKAWEKFGFNDDDIKRMKFSNDEKTGIAPIIQINDVTEISFDFGNDNISYS 448
            +SD+I+  +K  +     +   K+++FS++   G A   ++ ++   SF  G+   S S
Sbjct: 361 GISDIIN-NIKLLDGINCEEFVKKKIEFSSN---GPASTFEVTNLGFQSFK-GSCMESSS 415

Query: 449 FSVNNLNFTKSLSCNEFMSLFYSHNAQGGLNICIHYPDGYNMEAFVECF 497
           + + +  F +    ++  +        GGL   + YP     E F  C+
Sbjct: 416 YFIKDAVFNEPQGMSDIFTCSVISTPIGGLRCSLSYPKDIAQE-FEPCW 463

>KNAG0G00700 Chr7 complement(132337..133707) [1371 bp, 456 aa] {ON}
           Anc_5.119 YGR212W
          Length = 456

 Score = 34.3 bits (77), Expect = 0.80,   Method: Compositional matrix adjust.
 Identities = 29/127 (22%), Positives = 54/127 (42%), Gaps = 6/127 (4%)

Query: 50  GRSVNEVSLKSVLCAALQNIICNHVELYTTINDRLYFTPVLQIETNDVIKTISYDKSKDK 109
           G +++    ++    A+   +    +L TT+ +    TP       ++   + YD   + 
Sbjct: 27  GVTLDRTPSQAQFAHAIHECLVKFPQLTTTVVELEQGTPTFA----NITVPLRYDDFVE- 81

Query: 110 ALMKDQISDKLLRHIFNKCDFKPNNGKPLWQ-FSIANDSTMIFHGHDVLFDIFSTANFEK 168
                Q   +L   IF + +F+    KPLW+  ++   ST +     VLFD  ST N  +
Sbjct: 82  VKQWGQWDAQLANEIFKEYNFQYTVEKPLWRILAMPKSSTFVLLVDHVLFDGMSTVNLWR 141

Query: 169 YLLKEMN 175
            LL+ + 
Sbjct: 142 CLLENLG 148

>SAKL0E12650g Chr5 complement(1042706..1047727) [5022 bp, 1673 aa]
           {ON} similar to uniprot|P53886 Saccharomyces cerevisiae
           YNL172W APC1 Largest subunit of the Anaphase-Promoting
           Complex/Cyclosome (APC/C) which is a ubiquitin-protein
           ligase required for degradation of anaphase inhibitors
           including mitotic cyclins during the metaphase/anaphase
           transition
          Length = 1673

 Score = 33.5 bits (75), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 41/149 (27%), Positives = 67/149 (44%), Gaps = 21/149 (14%)

Query: 157 LFDIFSTANFEKYLLKEMNDVLNSNQKLKTVKTLFKFDAERSLTNYPRSIYENPKLHLPA 216
           LF+IF + N+ +  L E+   LNS          F  ++E  L  YP  I+   KL L  
Sbjct: 687 LFEIFQSRNYSRGNLLEL---LNS----------FNINSEE-LETYPVGIFAPLKLALVD 732

Query: 217 LTSDLLNLQTQSFFKTIYQNTLKKPIDLITSANSNNNNQLSEYRTRNTDILSGANSLCGR 276
           L + L ++  +     I ++ LKK I ++ S NS++            DIL G       
Sbjct: 733 LENQLSSVDPKINLDLINRSDLKKNIVILKSLNSDDPEM-------KHDILVGGGPQLDF 785

Query: 277 TVLGEISLERYQHLKMLVEQENISLRSFI 305
           + L   + ER + +K +VE    + R+F+
Sbjct: 786 SKLANRTSERSKSIKTIVEDVIKNTRNFL 814

>Kpol_1010.49 s1010 (113037..114482) [1446 bp, 481 aa] {ON}
           (113037..114482) [1446 nt, 482 aa]
          Length = 481

 Score = 32.0 bits (71), Expect = 3.7,   Method: Compositional matrix adjust.
 Identities = 34/179 (18%), Positives = 78/179 (43%), Gaps = 26/179 (14%)

Query: 44  NATLYTGRSVNEVSLKSVLCAALQNIICNHVELYTTI------NDRLYFTPV--LQIETN 95
           ++  Y G ++N++  ++ +  AL+  +  + +L   +       D +YF  +   +I   
Sbjct: 22  HSCFYIGVTLNQLPTRTQIIHALRKSVAKYQQLRCNVMKAGDSEDDIYFNDIGNEKIYFA 81

Query: 96  DVIKTISYDKSKDKALMKDQISDKLLRHIFNKCDFKPNNGKPLWQFSI-ANDSTMIFHGH 154
           D+++  ++D           +S+  +  IF +  F+    KP+W+  +  N + ++    
Sbjct: 82  DIVEYKNWDS----------VSESNINSIFQEYSFEYFTDKPVWKILVLENQNQLLMLLD 131

Query: 155 DVLFDIFSTANFEKYLLKEMNDVLNSNQKLKTVKTLFKFDAERSLT----NYPRSIYEN 209
            VLFD  S  NF    +  +  + + ++     + +F F+    +     N+P   YEN
Sbjct: 132 HVLFDGMSGINFWNSFISSLPSIDSISEDANANELIFPFEEPSQIAVLGDNHP---YEN 187

>Kpol_520.2 s520 complement(641..4777) [4137 bp, 1378 aa] {ON}
            complement(641..4777) [4137 nt, 1379 aa]
          Length = 1378

 Score = 31.6 bits (70), Expect = 5.7,   Method: Compositional matrix adjust.
 Identities = 21/81 (25%), Positives = 42/81 (51%), Gaps = 6/81 (7%)

Query: 327  SIPVNLRSLIADSSDFGLFYKNI----KVECPLELINDEKYYT--NPEVLHSMQNNSLLE 380
            S+ V+L +   D+S+ G   KN      V  P +++N  K+     PE  H ++  + ++
Sbjct: 925  SVRVSLLTAETDASESGTPIKNTVKDSHVSSPFKVVNISKWKNQDGPESDHEVEEIAEIQ 984

Query: 381  IQFERISRHVSDVISQRMKAW 401
            I+ E+ S  ++D+   +MK +
Sbjct: 985  IEAEKSSESIADISPIKMKPF 1005

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.319    0.135    0.388 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 58,316,558
Number of extensions: 2834516
Number of successful extensions: 12190
Number of sequences better than 10.0: 117
Number of HSP's gapped: 12615
Number of HSP's successfully gapped: 120
Length of query: 503
Length of database: 53,481,399
Length adjustment: 114
Effective length of query: 389
Effective length of database: 40,409,475
Effective search space: 15719285775
Effective search space used: 15719285775
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 68 (30.8 bits)