Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
TPHA0L003505.525ON85985944390.0
Kpol_1028.825.525ON92591119740.0
KAFR0E033105.525ON93892618190.0
SAKL0G04884g5.525ON93092417940.0
NCAS0F010705.525ON90489917520.0
Skud_4.6955.525ON95493617520.0
YDR421W (ARO80)5.525ON95091817470.0
TDEL0A038905.525ON83186717320.0
Suva_2.5985.525ON96593017310.0
NDAI0H015805.525ON90990817220.0
Smik_4.6965.525ON94992717170.0
ZYRO0D12518g5.525ON88188717090.0
KLTH0G03718g5.525ON85787915760.0
KNAG0C032505.525ON93692315070.0
KLLA0A01804g5.525ON94577615020.0
TBLA0D016705.525ON101882914930.0
CAGL0F03025g5.525ON92892113631e-174
ADR199C5.525ON94494213461e-171
KLLA0E02663gna 1ON1109721236e-06
SAKL0G02992gna 1ON1061831211e-05
KAFR0C039002.654ON818591182e-05
TBLA0F012003.109ON1086761183e-05
Suva_10.3238.423ON813841173e-05
Kwal_27.96888.879ON841521155e-05
Ecym_53972.231ON8261191156e-05
YKL015W (PUT3)2.654ON979561146e-05
CAGL0I07755g3.109ON10531001147e-05
KLLA0E18129g2.654ON865511121e-04
SAKL0D00264g8.879ON848391121e-04
KLLA0C10923g5.235ON775611121e-04
KLTH0E16500g8.879ON833391102e-04
Skud_11.2142.654ON981561102e-04
SAKL0H13024g8.423ON754991102e-04
ZYRO0G19338gna 2ON6531891092e-04
Smik_11.2402.654ON976561102e-04
KAFR0C013203.109ON1006511102e-04
TDEL0F054708.423ON810841092e-04
Skud_12.2968.423ON814801093e-04
NDAI0E034608.423ON949931093e-04
Suva_11.2132.654ON985511093e-04
TBLA0A007302.654ON1037501093e-04
CAGL0F07865g8.423ON844691083e-04
YLR228C (ECM22)8.423ON814721084e-04
Skud_10.101.128ON833791084e-04
TBLA0E047504.344ON1283601084e-04
KAFR0J017102.231ON848781084e-04
NCAS0H002707.512ON9063211084e-04
Kwal_47.175064.113ON924701084e-04
Kpol_455.108.879ON830511074e-04
Kpol_1001.34.344ON8561341075e-04
TPHA0F008304.113ON1192571075e-04
TPHA0C049808.879ON852511075e-04
NCAS0H034202.654ON902581075e-04
SAKL0E08998g2.231ON823591075e-04
NCAS0A047502.547ON1141531075e-04
NCAS0C002208.879ON839521066e-04
Ecym_1146na 3ON6652431066e-04
TDEL0C044802.231ON852641066e-04
KNAG0A025508.423ON730641067e-04
Ecym_4635na 1ON856951067e-04
NDAI0C002602.654ON1041471058e-04
KLLA0A03421gna 4ON880521040.001
AAL175W8.879ON883391040.001
SAKL0D03586g3.264ON801581040.001
NCAS0A125802.547ON704531040.001
NDAI0K001508.879ON953391040.001
NDAI0K018002.547ON1210551040.001
SAKL0G19470g2.654ON831511040.001
Smik_2.438na 5ON469851030.001
KNAG0K008203.109ON1050671040.001
Smik_12.2898.423ON812721030.001
NCAS0I002707.17ON944511030.001
Kwal_56.226053.109ON865751030.001
Ecym_81598.879ON908461030.001
Kwal_56.230583.264ON775701030.002
TPHA0B004104.344ON945581030.002
KLTH0C00814g2.654ON834571020.002
KLLA0F04609g2.231ON916511020.002
CAGL0M12298g7.17ON9941221020.002
KLLA0C17050gna 6ON9551051020.002
ZYRO0A00440g8.879ON850481010.002
Ecym_7440na 7ON898931010.002
Smik_4.4608.423ON918581010.002
TBLA0C019105.577ON1148601010.002
NCAS0C027308.423ON775741010.002
TDEL0D051503.109ON996921010.003
AGL091W8.423ON8661551010.003
TBLA0I025408.423ON1259581010.003
Kwal_23.31228.423ON788691010.003
Kpol_538.528.879ON907351010.003
KLTH0C07480g3.264ON775661010.003
TBLA0H006808.423ON880651010.003
KAFR0L021308.879ON882481000.003
Suva_6.2851.128ON786851000.003
KNAG0J002108.879ON861561000.003
Skud_15.546na 8ON5421021000.003
ZYRO0D14080g6.61ON921701000.003
Kpol_1039.112.231ON992531000.003
Suva_2.3818.423ON918581000.003
NDAI0A069903.109ON978661000.003
NCAS0B065502.231ON906521000.004
TDEL0D036103.264ON72452990.004
ZYRO0D08316gna 9ON68054990.004
Suva_2.1873.264ON78464990.004
Skud_4.4758.423ON91358990.004
KLTH0D16456gna 3ON66161980.005
KAFR0E012503.264ON73661980.005
Skud_7.638singletonON47365980.005
CAGL0H06875g8.879ON70253980.005
KLTH0E03256gsingletonON67454980.005
Kpol_1033.158.283ON594111980.005
KAFR0C049807.17ON95153980.006
KNAG0H012603.264ON74155980.006
NDAI0D03540na 10ON110756970.007
Kpol_1061.113.264ON73362970.007
Suva_16.25singletonON14353910.007
Smik_9.392.231ON101267970.007
KLLA0D10197g8.879ON85639970.007
Smik_10.251.128ON77285970.007
YIL130W (ASG1)2.231ON96467970.007
NDAI0C048408.423ON94868970.007
Suva_9.592.231ON92667970.008
NDAI0A034204.113ON110853970.008
ZYRO0E05676g2.547ON106653970.008
TDEL0B004808.879ON83551960.008
TBLA0C062306.60ON79546960.009
TPHA0M010403.264ON77074960.009
KAFR0B063408.423ON86460960.009
CAGL0C01199g8.423ON92296960.009
KLTH0F07854g8.423ON78858960.009
NDAI0B038502.231ON93051960.009
NDAI0D00900singletonON86551960.009
YDR034C (LYS14)3.264ON79064960.009
Smik_15.561na 8ON54667960.009
Kwal_23.47542.231ON81250960.009
KNAG0H002502.654ON89660960.009
ZYRO0G10252g4.113ON103668960.010
Suva_13.498.879ON88239960.010
Smik_4.2693.264ON77864960.010
NDAI0B016802.547ON92452960.010
Skud_9.372.231ON95455960.011
NCAS0A105503.264ON74166950.011
Smik_2.1512.547ON91947960.011
Suva_8.436na 8ON545258950.011
Skud_4.2873.264ON78464950.011
KAFR0A066904.113ON99746950.012
KNAG0A044808.423ON101361950.012
KAFR0B014502.547ON108851950.012
Ecym_41448.423ON84065950.012
Kpol_495.213.109ON108553950.012
YML099C (ARG81)8.879ON88051950.012
TBLA0B062404.344ON143555950.013
TBLA0G011308.879ON113239950.013
ZYRO0E00572g2.654ON83848950.013
KNAG0A02300singletonON72949950.013
NCAS0B028608.423ON86980950.013
Kpol_1042.66.60ON78056950.014
Kpol_1002.52.547ON95857950.014
KLTH0G09108g2.231ON78250950.014
Ecym_33922.654ON84758950.014
TBLA0E007007.17ON127446950.014
Smik_13.368.879ON88054940.014
YOR380W (RDR1)na 8ON546239940.015
ABL099W3.264ON80057940.015
Skud_13.438.879ON88039940.016
SAKL0A01386gna 9ON77052940.016
SAKL0D14542gna 4ON94657940.017
KLTH0C10098g6.60ON77157940.017
NCAS0A076107.17ON102254940.018
Ecym_51313.264ON77047940.018
YDR213W (UPC2)8.423ON91358940.018
TPHA0B015854.344ON81259940.018
CAGL0K11902g3.264ON83156940.018
TBLA0G026102.231ON100050940.018
KLLA0F04213g3.264ON76845930.019
Skud_13.664.344ON93966930.019
SAKL0A00704gna 11ON718243930.019
YGR288W (MAL13)na 12ON47353930.020
NCAS0A061904.344ON89458930.020
NDAI0A03410na 10ON98059930.020
KLLA0A06039g1.199ON65793930.021
ZYRO0A10956g5.235ON85546930.021
Kpol_529.158.423ON94861930.022
KNAG0G021308.283ON63245930.022
TPHA0L010608.423ON97357930.022
KLTH0D07260g2.547ON97954930.023
ACL096W2.654ON83562930.023
YPR196WsingletonON47054920.023
YML076C (WAR1)4.344ON94466930.023
Skud_2.1452.547ON91774920.025
YLL054Cna 13ON84358920.025
ZYRO0A09350g8.423ON79365920.026
TDEL0F023304.113ON108638920.026
YOR363C (PIP2)7.17ON99650920.026
SAKL0A09856g2.547ON102054920.027
TPHA0A045403.109ON117842920.029
Kwal_23.6425na 11ON73550920.031
ADR405Cna 14ON80767920.031
TBLA0I018903.264ON82554910.032
Smik_12.775.235ON90364910.033
CAGL0J07150g7.17ON102262910.034
KNAG0E017602.231ON90251910.035
TBLA0C040504.113ON120738910.036
SAKL0C03938g1.128ON78071910.036
Smik_12.1578.283ON64448910.037
CAGL0F02519g1.128ON83253910.037
Suva_15.773.109ON102958910.037
KLLA0A10329gna 15ON63975910.037
Kwal_47.168624.344ON74351910.038
TPHA0F013802.231ON89057910.038
NCAS0A035804.113ON111342910.038
Skud_15.5327.17ON100051910.039
NDAI0D031804.344ON98961910.040
ZYRO0A03058g3.264ON73645910.040
TPHA0F025506.61ON79976910.040
SAKL0D02596gna 16ON75049900.042
KLLA0C08657gna 9ON72251900.043
NCAS0A03070singletonON65646900.044
SAKL0G17908g4.344ON80950900.045
KLLA0F14322g1.277ON71746900.045
KLTH0F18392g7.512ON873251900.045
TDEL0B074902.654ON86543900.047
Kwal_34.15751na 17ON62855900.047
ZYRO0G17512gsingletonON52347900.047
NCAS0A016304.113ON104345900.047
KLTH0H16170gna 17ON61950900.048
Smik_17.27singletonON68883900.049
Kwal_55.20674singletonOFF25241880.051
KNAG0M00120singletonON88144900.051
KLTH0G07898g5.235ON86645900.052
NDAI0F00110singletonON50839890.052
CAGL0F07909g3.109ON104943900.053
KLTH0G13200g8.283ON56645890.054
ZYRO0G12584gna 16ON68659890.055
SAKL0D14520g7.17ON98369900.055
TPHA0C010808.283ON59146890.056
Kwal_YGOB_gneas1na 18ON51954890.056
Suva_10.18na 13ON84265890.057
Smik_15.3506.61ON78456890.057
YJL206C1.128ON75848890.058
Skud_12.5447.512ON888327890.059
Ecym_5015na 14ON82761890.061
Smik_13.644.344ON94466890.061
TBLA0G00490singletonON91855890.061
TBLA0G00730singletonON80184890.062
Smik_16.20na 12ON47353880.063
NDAI0A057503.264ON75953890.064
TDEL0B063602.547ON98146890.065
Kwal_26.7095na 19ON83844890.065
TDEL0G04890singletonON58452880.066
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= TPHA0L00350
         (859 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

TPHA0L00350 Chr12 complement(47367..49946) [2580 bp, 859 aa] {ON}    1714   0.0  
Kpol_1028.82 s1028 complement(183595..186372) [2778 bp, 925 aa] ...   764   0.0  
KAFR0E03310 Chr5 complement(656129..658945) [2817 bp, 938 aa] {O...   705   0.0  
SAKL0G04884g Chr7 (400351..403143) [2793 bp, 930 aa] {ON} simila...   695   0.0  
NCAS0F01070 Chr6 (211085..213799) [2715 bp, 904 aa] {ON} Anc_5.5...   679   0.0  
Skud_4.695 Chr4 (1233000..1235864) [2865 bp, 954 aa] {ON} YDR421...   679   0.0  
YDR421W Chr4 (1312040..1314892) [2853 bp, 950 aa] {ON}  ARO80Zin...   677   0.0  
TDEL0A03890 Chr1 (695880..698375) [2496 bp, 831 aa] {ON} Anc_5.5...   671   0.0  
Suva_2.598 Chr2 (1064757..1067654) [2898 bp, 965 aa] {ON} YDR421...   671   0.0  
NDAI0H01580 Chr8 (382179..384908) [2730 bp, 909 aa] {ON} Anc_5.5...   667   0.0  
Smik_4.696 Chr4 (1232828..1235677) [2850 bp, 949 aa] {ON} YDR421...   665   0.0  
ZYRO0D12518g Chr4 (1055521..1058166) [2646 bp, 881 aa] {ON} simi...   662   0.0  
KLTH0G03718g Chr7 (292858..295431) [2574 bp, 857 aa] {ON} simila...   611   0.0  
KNAG0C03250 Chr3 complement(635995..638805) [2811 bp, 936 aa] {O...   585   0.0  
KLLA0A01804g Chr1 complement(159689..162526) [2838 bp, 945 aa] {...   583   0.0  
TBLA0D01670 Chr4 complement(413360..416416) [3057 bp, 1018 aa] {...   579   0.0  
CAGL0F03025g Chr6 (295783..298569) [2787 bp, 928 aa] {ON} simila...   529   e-174
ADR199C Chr4 complement(1048528..1051362) [2835 bp, 944 aa] {ON}...   523   e-171
KLLA0E02663g Chr5 (244696..248025) [3330 bp, 1109 aa] {ON} conse...    52   6e-06
SAKL0G02992g Chr7 (243859..247044) [3186 bp, 1061 aa] {ON} conse...    51   1e-05
KAFR0C03900 Chr3 (787524..789980) [2457 bp, 818 aa] {ON} Anc_2.6...    50   2e-05
TBLA0F01200 Chr6 (295744..299004) [3261 bp, 1086 aa] {ON} Anc_3....    50   3e-05
Suva_10.323 Chr10 complement(566314..568755) [2442 bp, 813 aa] {...    50   3e-05
Kwal_27.9688 s27 complement(21328..23853) [2526 bp, 841 aa] {ON}...    49   5e-05
Ecym_5397 Chr5 (805712..808192) [2481 bp, 826 aa] {ON} similar t...    49   6e-05
YKL015W Chr11 (408544..411483) [2940 bp, 979 aa] {ON}  PUT3Trans...    49   6e-05
CAGL0I07755g Chr9 complement(745585..748746) [3162 bp, 1053 aa] ...    49   7e-05
KLLA0E18129g Chr5 (1613115..1615712) [2598 bp, 865 aa] {ON} simi...    48   1e-04
SAKL0D00264g Chr4 complement(24754..27300) [2547 bp, 848 aa] {ON...    48   1e-04
KLLA0C10923g Chr3 complement(939148..941475) [2328 bp, 775 aa] {...    48   1e-04
KLTH0E16500g Chr5 (1460844..1463345) [2502 bp, 833 aa] {ON} simi...    47   2e-04
Skud_11.214 Chr11 (389377..389855,389895..392361) [2946 bp, 981 ...    47   2e-04
SAKL0H13024g Chr8 complement(1119585..1121849) [2265 bp, 754 aa]...    47   2e-04
ZYRO0G19338g Chr7 complement(1601895..1603856) [1962 bp, 653 aa]...    47   2e-04
Smik_11.240 Chr11 (395459..395932,395981..398437) [2931 bp, 976 ...    47   2e-04
KAFR0C01320 Chr3 (273213..276233) [3021 bp, 1006 aa] {ON} Anc_3....    47   2e-04
TDEL0F05470 Chr6 (1017743..1020175) [2433 bp, 810 aa] {ON} Anc_8...    47   2e-04
Skud_12.296 Chr12 complement(540407..542851) [2445 bp, 814 aa] {...    47   3e-04
NDAI0E03460 Chr5 (742144..744993) [2850 bp, 949 aa] {ON} Anc_8.423     47   3e-04
Suva_11.213 Chr11 (392506..392993,393045..395514) [2958 bp, 985 ...    47   3e-04
TBLA0A00730 Chr1 (156043..159156) [3114 bp, 1037 aa] {ON} Anc_2....    47   3e-04
CAGL0F07865g Chr6 complement(768270..770804) [2535 bp, 844 aa] {...    46   3e-04
YLR228C Chr12 complement(600019..602463) [2445 bp, 814 aa] {ON} ...    46   4e-04
Skud_10.10 Chr10 complement(21672..24173) [2502 bp, 833 aa] {ON}...    46   4e-04
TBLA0E04750 Chr5 (1222163..1226014) [3852 bp, 1283 aa] {ON} Anc_...    46   4e-04
KAFR0J01710 Chr10 complement(327570..330116) [2547 bp, 848 aa] {...    46   4e-04
NCAS0H00270 Chr8 complement(45600..48320) [2721 bp, 906 aa] {ON}...    46   4e-04
Kwal_47.17506 s47 (431921..434695) [2775 bp, 924 aa] {ON} YGL013...    46   4e-04
Kpol_455.10 s455 (12074..14566) [2493 bp, 830 aa] {ON} (12074..1...    46   4e-04
Kpol_1001.3 s1001 complement(9551..12121) [2571 bp, 856 aa] {ON}...    46   5e-04
TPHA0F00830 Chr6 complement(188299..191877) [3579 bp, 1192 aa] {...    46   5e-04
TPHA0C04980 Chr3 (1072547..1075105) [2559 bp, 852 aa] {ON} Anc_8...    46   5e-04
NCAS0H03420 Chr8 complement(648059..650767) [2709 bp, 902 aa] {O...    46   5e-04
SAKL0E08998g Chr5 complement(747085..749556) [2472 bp, 823 aa] {...    46   5e-04
NCAS0A04750 Chr1 (944929..948354) [3426 bp, 1141 aa] {ON} Anc_2....    46   5e-04
NCAS0C00220 Chr3 (22532..25051) [2520 bp, 839 aa] {ON} Anc_8.879       45   6e-04
Ecym_1146 Chr1 (302989..304986) [1998 bp, 665 aa] {ON} similar t...    45   6e-04
TDEL0C04480 Chr3 (799022..801580) [2559 bp, 852 aa] {ON} Anc_2.2...    45   6e-04
KNAG0A02550 Chr1 complement(262867..265059) [2193 bp, 730 aa] {O...    45   7e-04
Ecym_4635 Chr4 complement(1238691..1241261) [2571 bp, 856 aa] {O...    45   7e-04
NDAI0C00260 Chr3 (40019..43144) [3126 bp, 1041 aa] {ON} Anc_2.65...    45   8e-04
KLLA0A03421g Chr1 (308414..311056) [2643 bp, 880 aa] {ON} weakly...    45   0.001
AAL175W Chr1 (32874..35525) [2652 bp, 883 aa] {ON} Non-syntenic ...    45   0.001
SAKL0D03586g Chr4 (290224..292629) [2406 bp, 801 aa] {ON} simila...    45   0.001
NCAS0A12580 Chr1 complement(2481447..2483561) [2115 bp, 704 aa] ...    45   0.001
NDAI0K00150 Chr11 complement(20792..23653) [2862 bp, 953 aa] {ON...    45   0.001
NDAI0K01800 Chr11 (401055..404687) [3633 bp, 1210 aa] {ON} Anc_2...    45   0.001
SAKL0G19470g Chr7 complement(1677759..1680254) [2496 bp, 831 aa]...    45   0.001
Smik_2.438 Chr2 (786437..787846) [1410 bp, 469 aa] {ON} YBR297W ...    44   0.001
KNAG0K00820 Chr11 complement(153470..156622) [3153 bp, 1050 aa] ...    45   0.001
Smik_12.289 Chr12 complement(540824..543262) [2439 bp, 812 aa] {...    44   0.001
NCAS0I00270 Chr9 complement(33129..35963) [2835 bp, 944 aa] {ON}...    44   0.001
Kwal_56.22605 s56 (200072..202669) [2598 bp, 865 aa] {ON} YOL089...    44   0.001
Ecym_8159 Chr8 (330207..332933) [2727 bp, 908 aa] {ON} similar t...    44   0.001
Kwal_56.23058 s56 complement(381390..383717) [2328 bp, 775 aa] {...    44   0.002
TPHA0B00410 Chr2 complement(84722..87559) [2838 bp, 945 aa] {ON}...    44   0.002
KLTH0C00814g Chr3 (76637..79141) [2505 bp, 834 aa] {ON} similar ...    44   0.002
KLLA0F04609g Chr6 complement(451579..454329) [2751 bp, 916 aa] {...    44   0.002
CAGL0M12298g Chr13 complement(1227303..1230287) [2985 bp, 994 aa...    44   0.002
KLLA0C17050g Chr3 (1490472..1493339) [2868 bp, 955 aa] {ON} cons...    44   0.002
ZYRO0A00440g Chr1 complement(27895..30447) [2553 bp, 850 aa] {ON...    44   0.002
Ecym_7440 Chr7 complement(902108..904804) [2697 bp, 898 aa] {ON}...    44   0.002
Smik_4.460 Chr4 (833609..836365) [2757 bp, 918 aa] {ON} YDR213W ...    44   0.002
TBLA0C01910 Chr3 complement(448085..448684,448765..451611) [3447...    44   0.002
NCAS0C02730 Chr3 (513280..515607) [2328 bp, 775 aa] {ON} Anc_8.423     44   0.002
TDEL0D05150 Chr4 (932888..935878) [2991 bp, 996 aa] {ON} Anc_3.1...    44   0.003
AGL091W Chr7 (535317..537917) [2601 bp, 866 aa] {ON} Syntenic ho...    44   0.003
TBLA0I02540 Chr9 (590352..594131) [3780 bp, 1259 aa] {ON} Anc_8....    44   0.003
Kwal_23.3122 s23 complement(166388..168754) [2367 bp, 788 aa] {O...    44   0.003
Kpol_538.52 s538 (126243..128966) [2724 bp, 907 aa] {ON} (126243...    44   0.003
KLTH0C07480g Chr3 (645219..647546) [2328 bp, 775 aa] {ON} simila...    44   0.003
TBLA0H00680 Chr8 complement(144914..147556) [2643 bp, 880 aa] {O...    44   0.003
KAFR0L02130 Chr12 (403953..406601) [2649 bp, 882 aa] {ON} Anc_8....    43   0.003
Suva_6.285 Chr6 (499581..501941) [2361 bp, 786 aa] {ON} YJL206C ...    43   0.003
KNAG0J00210 Chr10 (26132..28717) [2586 bp, 861 aa] {ON} Anc_8.87...    43   0.003
Skud_15.546 Chr15 (990335..991963) [1629 bp, 542 aa] {ON} YOR380...    43   0.003
ZYRO0D14080g Chr4 (1191418..1194183) [2766 bp, 921 aa] {ON} weak...    43   0.003
Kpol_1039.11 s1039 (29727..32705) [2979 bp, 992 aa] {ON} (29727....    43   0.003
Suva_2.381 Chr2 (669136..671892) [2757 bp, 918 aa] {ON} YDR213W ...    43   0.003
NDAI0A06990 Chr1 (1593540..1596476) [2937 bp, 978 aa] {ON} Anc_3...    43   0.003
NCAS0B06550 Chr2 complement(1242371..1245091) [2721 bp, 906 aa] ...    43   0.004
TDEL0D03610 Chr4 (664819..666993) [2175 bp, 724 aa] {ON} Anc_3.2...    43   0.004
ZYRO0D08316g Chr4 (719929..721971) [2043 bp, 680 aa] {ON} conser...    43   0.004
Suva_2.187 Chr2 complement(320833..323187) [2355 bp, 784 aa] {ON...    43   0.004
Skud_4.475 Chr4 (844018..846759) [2742 bp, 913 aa] {ON} YDR213W ...    43   0.004
KLTH0D16456g Chr4 complement(1360294..1362279) [1986 bp, 661 aa]...    42   0.005
KAFR0E01250 Chr5 complement(249538..251748) [2211 bp, 736 aa] {O...    42   0.005
Skud_7.638 Chr7 (1060062..1061483) [1422 bp, 473 aa] {ON} YFL052...    42   0.005
CAGL0H06875g Chr8 complement(682518..684626) [2109 bp, 702 aa] {...    42   0.005
KLTH0E03256g Chr5 complement(294997..297021) [2025 bp, 674 aa] {...    42   0.005
Kpol_1033.15 s1033 complement(32885..34586,34699..34781) [1785 b...    42   0.005
KAFR0C04980 Chr3 (987900..990755) [2856 bp, 951 aa] {ON} Anc_7.1...    42   0.006
KNAG0H01260 Chr8 (220201..222426) [2226 bp, 741 aa] {ON} Anc_3.2...    42   0.006
NDAI0D03540 Chr4 complement(838966..842289) [3324 bp, 1107 aa] {...    42   0.007
Kpol_1061.11 s1061 complement(31679..33880) [2202 bp, 733 aa] {O...    42   0.007
Suva_16.25 Chr16 complement(31437..31868) [432 bp, 143 aa] {ON} ...    40   0.007
Smik_9.39 Chr9 (80510..83548) [3039 bp, 1012 aa] {ON} YIL130W (R...    42   0.007
KLLA0D10197g Chr4 complement(861726..864296) [2571 bp, 856 aa] {...    42   0.007
Smik_10.25 Chr10 complement(45977..48295) [2319 bp, 772 aa] {ON}...    42   0.007
YIL130W Chr9 (102782..105676) [2895 bp, 964 aa] {ON}  ASG1Zinc c...    42   0.007
NDAI0C04840 Chr3 (1117201..1120047) [2847 bp, 948 aa] {ON} Anc_8...    42   0.007
Suva_9.59 Chr9 (97521..100298) [2778 bp, 926 aa] {ON} YIL130W (R...    42   0.008
NDAI0A03420 Chr1 complement(782010..785336) [3327 bp, 1108 aa] {...    42   0.008
ZYRO0E05676g Chr5 complement(439616..442816) [3201 bp, 1066 aa] ...    42   0.008
TDEL0B00480 Chr2 (83911..86418) [2508 bp, 835 aa] {ON} Anc_8.879...    42   0.008
TBLA0C06230 Chr3 (1509702..1512089) [2388 bp, 795 aa] {ON} Anc_6...    42   0.009
TPHA0M01040 Chr13 complement(202491..204803) [2313 bp, 770 aa] {...    42   0.009
KAFR0B06340 Chr2 (1311310..1313904) [2595 bp, 864 aa] {ON} Anc_8...    42   0.009
CAGL0C01199g Chr3 complement(121944..124712) [2769 bp, 922 aa] {...    42   0.009
KLTH0F07854g Chr6 complement(677647..680013) [2367 bp, 788 aa] {...    42   0.009
NDAI0B03850 Chr2 complement(970366..973158) [2793 bp, 930 aa] {O...    42   0.009
NDAI0D00900 Chr4 (205039..207636) [2598 bp, 865 aa] {ON}               42   0.009
YDR034C Chr4 complement(509737..512109) [2373 bp, 790 aa] {ON}  ...    42   0.009
Smik_15.561 Chr15 (997239..998879) [1641 bp, 546 aa] {ON} YOR380...    42   0.009
Kwal_23.4754 s23 (845550..847988) [2439 bp, 812 aa] {ON} YIL130W...    42   0.009
KNAG0H00250 Chr8 (37360..40050) [2691 bp, 896 aa] {ON} Anc_2.654...    42   0.009
ZYRO0G10252g Chr7 (819658..822768) [3111 bp, 1036 aa] {ON} simil...    42   0.010
Suva_13.49 Chr13 complement(75704..78352) [2649 bp, 882 aa] {ON}...    42   0.010
Smik_4.269 Chr4 complement(491110..493446) [2337 bp, 778 aa] {ON...    42   0.010
NDAI0B01680 Chr2 (398598..401372) [2775 bp, 924 aa] {ON} Anc_2.547     42   0.010
Skud_9.37 Chr9 (79947..82811) [2865 bp, 954 aa] {ON} YIL130W (REAL)    42   0.011
NCAS0A10550 Chr1 (2100725..2102950) [2226 bp, 741 aa] {ON} Anc_3...    41   0.011
Smik_2.151 Chr2 (282822..285581) [2760 bp, 919 aa] {ON} YBR033W ...    42   0.011
Suva_8.436 Chr8 (788699..790336) [1638 bp, 545 aa] {ON} YOR380W ...    41   0.011
Skud_4.287 Chr4 complement(501344..503698) [2355 bp, 784 aa] {ON...    41   0.011
KAFR0A06690 Chr1 complement(1354262..1357255) [2994 bp, 997 aa] ...    41   0.012
KNAG0A04480 Chr1 complement(626229..629270) [3042 bp, 1013 aa] {...    41   0.012
KAFR0B01450 Chr2 (273614..276880) [3267 bp, 1088 aa] {ON} Anc_2....    41   0.012
Ecym_4144 Chr4 complement(306206..308728) [2523 bp, 840 aa] {ON}...    41   0.012
Kpol_495.21 s495 (71447..74704) [3258 bp, 1085 aa] {ON} (71447.....    41   0.012
YML099C Chr13 complement(74398..77040) [2643 bp, 880 aa] {ON}  A...    41   0.012
TBLA0B06240 Chr2 complement(1469510..1473817) [4308 bp, 1435 aa]...    41   0.013
TBLA0G01130 Chr7 (287952..291350) [3399 bp, 1132 aa] {ON} Anc_8....    41   0.013
ZYRO0E00572g Chr5 (35940..38456) [2517 bp, 838 aa] {ON} similar ...    41   0.013
KNAG0A02300 Chr1 (214177..216363) [2187 bp, 729 aa] {ON}  gene e...    41   0.013
NCAS0B02860 Chr2 complement(488982..491591) [2610 bp, 869 aa] {O...    41   0.013
Kpol_1042.6 s1042 (9848..11548,11550..11612,11615..12193) [2343 ...    41   0.014
Kpol_1002.5 s1002 (11943..14819) [2877 bp, 958 aa] {ON} (11943.....    41   0.014
KLTH0G09108g Chr7 (744062..746410) [2349 bp, 782 aa] {ON} weakly...    41   0.014
Ecym_3392 Chr3 (741359..743902) [2544 bp, 847 aa] {ON} similar t...    41   0.014
TBLA0E00700 Chr5 complement(138121..141945) [3825 bp, 1274 aa] {...    41   0.014
Smik_13.36 Chr13 complement(71547..74189) [2643 bp, 880 aa] {ON}...    41   0.014
YOR380W Chr15 (1051290..1052930) [1641 bp, 546 aa] {ON}  RDR1Tra...    41   0.015
ABL099W Chr2 (212830..215232) [2403 bp, 800 aa] {ON} Syntenic ho...    41   0.015
Skud_13.43 Chr13 complement(73880..76522) [2643 bp, 880 aa] {ON}...    41   0.016
SAKL0A01386g Chr1 (132287..134599) [2313 bp, 770 aa] {ON} conser...    41   0.016
SAKL0D14542g Chr4 complement(1195951..1198791) [2841 bp, 946 aa]...    41   0.017
KLTH0C10098g Chr3 complement(836528..838843) [2316 bp, 771 aa] {...    41   0.017
NCAS0A07610 Chr1 complement(1512914..1515982) [3069 bp, 1022 aa]...    41   0.018
Ecym_5131 Chr5 (278980..281292) [2313 bp, 770 aa] {ON} similar t...    41   0.018
YDR213W Chr4 (889751..892492) [2742 bp, 913 aa] {ON}  UPC2Sterol...    41   0.018
TPHA0B01585 Chr2 complement(352396..354834) [2439 bp, 812 aa] {ON}     41   0.018
CAGL0K11902g Chr11 complement(1149210..1151705) [2496 bp, 831 aa...    41   0.018
TBLA0G02610 Chr7 complement(689843..692845) [3003 bp, 1000 aa] {...    41   0.018
KLLA0F04213g Chr6 (400673..402979) [2307 bp, 768 aa] {ON} simila...    40   0.019
Skud_13.66 Chr13 complement(111847..114666) [2820 bp, 939 aa] {O...    40   0.019
SAKL0A00704g Chr1 complement(78811..80967) [2157 bp, 718 aa] {ON...    40   0.019
YGR288W Chr7 (1070293..1071714) [1422 bp, 473 aa] {ON}  MAL13MAL...    40   0.020
NCAS0A06190 Chr1 (1226184..1228868) [2685 bp, 894 aa] {ON} Anc_4...    40   0.020
NDAI0A03410 Chr1 complement(778569..781511) [2943 bp, 980 aa] {O...    40   0.020
KLLA0A06039g Chr1 (557368..559341) [1974 bp, 657 aa] {ON} weakly...    40   0.021
ZYRO0A10956g Chr1 (881429..883996) [2568 bp, 855 aa] {ON} simila...    40   0.021
Kpol_529.15 s529 complement(38664..41510) [2847 bp, 948 aa] {ON}...    40   0.022
KNAG0G02130 Chr7 complement(482333..484231) [1899 bp, 632 aa] {O...    40   0.022
TPHA0L01060 Chr12 (220857..223778) [2922 bp, 973 aa] {ON} Anc_8....    40   0.022
KLTH0D07260g Chr4 complement(635598..638537) [2940 bp, 979 aa] {...    40   0.023
ACL096W Chr3 (169508..172015) [2508 bp, 835 aa] {ON} Syntenic ho...    40   0.023
YPR196W Chr16 (931376..932788) [1413 bp, 470 aa] {ON} Putative m...    40   0.023
YML076C Chr13 complement(112513..115347) [2835 bp, 944 aa] {ON} ...    40   0.023
Skud_2.145 Chr2 (271582..274335) [2754 bp, 917 aa] {ON} YBR033W ...    40   0.025
YLL054C Chr12 complement(32673..35204) [2532 bp, 843 aa] {ON} Pu...    40   0.025
ZYRO0A09350g Chr1 (749695..752076) [2382 bp, 793 aa] {ON} simila...    40   0.026
TDEL0F02330 Chr6 complement(429974..433234) [3261 bp, 1086 aa] {...    40   0.026
YOR363C Chr15 complement(1020222..1023212) [2991 bp, 996 aa] {ON...    40   0.026
SAKL0A09856g Chr1 complement(867959..871021) [3063 bp, 1020 aa] ...    40   0.027
TPHA0A04540 Chr1 (1031790..1035326) [3537 bp, 1178 aa] {ON} Anc_...    40   0.029
Kwal_23.6425 s23 (1574518..1576725) [2208 bp, 735 aa] {ON} YKL22...    40   0.031
ADR405C Chr4 complement(1435702..1438125) [2424 bp, 807 aa] {ON}...    40   0.031
TBLA0I01890 Chr9 complement(423851..426328) [2478 bp, 825 aa] {O...    40   0.032
Smik_12.77 Chr12 complement(159125..161836) [2712 bp, 903 aa] {O...    40   0.033
CAGL0J07150g Chr10 complement(688858..691926) [3069 bp, 1022 aa]...    40   0.034
KNAG0E01760 Chr5 (350254..352962) [2709 bp, 902 aa] {ON} Anc_2.2...    40   0.035
TBLA0C04050 Chr3 complement(980010..983633) [3624 bp, 1207 aa] {...    40   0.036
SAKL0C03938g Chr3 complement(377431..379773) [2343 bp, 780 aa] {...    40   0.036
Smik_12.157 Chr12 complement(317470..319404) [1935 bp, 644 aa] {...    40   0.037
CAGL0F02519g Chr6 (245120..247618) [2499 bp, 832 aa] {ON} weakly...    40   0.037
Suva_15.77 Chr15 complement(123654..126743) [3090 bp, 1029 aa] {...    40   0.037
KLLA0A10329g Chr1 (903873..905792) [1920 bp, 639 aa] {ON} conser...    40   0.037
Kwal_47.16862 s47 complement(147009..149240) [2232 bp, 743 aa] {...    40   0.038
TPHA0F01380 Chr6 complement(318207..320879) [2673 bp, 890 aa] {O...    40   0.038
NCAS0A03580 Chr1 complement(712039..715380) [3342 bp, 1113 aa] {...    40   0.038
Skud_15.532 Chr15 complement(959437..962439) [3003 bp, 1000 aa] ...    40   0.039
NDAI0D03180 Chr4 (759984..762953) [2970 bp, 989 aa] {ON} Anc_4.3...    40   0.040
ZYRO0A03058g Chr1 (247954..250164) [2211 bp, 736 aa] {ON} simila...    40   0.040
TPHA0F02550 Chr6 (559614..562013) [2400 bp, 799 aa] {ON} Anc_6.6...    40   0.040
SAKL0D02596g Chr4 (204347..206599) [2253 bp, 750 aa] {ON} conser...    39   0.042
KLLA0C08657g Chr3 (757100..759268) [2169 bp, 722 aa] {ON} some s...    39   0.043
NCAS0A03070 Chr1 (603639..605609) [1971 bp, 656 aa] {ON}               39   0.044
SAKL0G17908g Chr7 (1552344..1554773) [2430 bp, 809 aa] {ON} simi...    39   0.045
KLLA0F14322g Chr6 (1328925..1331078) [2154 bp, 717 aa] {ON} unip...    39   0.045
KLTH0F18392g Chr6 (1484590..1487211) [2622 bp, 873 aa] {ON} simi...    39   0.045
TDEL0B07490 Chr2 complement(1314447..1317044) [2598 bp, 865 aa] ...    39   0.047
Kwal_34.15751 s34 (40148..42034) [1887 bp, 628 aa] {ON} [contig ...    39   0.047
ZYRO0G17512g Chr7 complement(1447970..1449541) [1572 bp, 523 aa]...    39   0.047
NCAS0A01630 Chr1 complement(317259..320390) [3132 bp, 1043 aa] {...    39   0.047
KLTH0H16170g Chr8 complement(1391996..1393855) [1860 bp, 619 aa]...    39   0.048
Smik_17.27 Chr17 complement(29476..31542) [2067 bp, 688 aa] {ON}...    39   0.049
Kwal_55.20674 s55 complement(515392..516147) [756 bp, 252 aa] {O...    39   0.051
KNAG0M00120 Chr13 complement(12320..14965) [2646 bp, 881 aa] {ON}      39   0.051
KLTH0G07898g Chr7 (636890..639490) [2601 bp, 866 aa] {ON} simila...    39   0.052
NDAI0F00110 Chr6 (10745..12271) [1527 bp, 508 aa] {ON}                 39   0.052
CAGL0F07909g Chr6 (776659..779808) [3150 bp, 1049 aa] {ON} some ...    39   0.053
KLTH0G13200g Chr7 (1133333..1133382,1133450..1135100) [1701 bp, ...    39   0.054
ZYRO0G12584g Chr7 complement(996642..998702) [2061 bp, 686 aa] {...    39   0.055
SAKL0D14520g Chr4 complement(1192788..1195739) [2952 bp, 983 aa]...    39   0.055
TPHA0C01080 Chr3 (246019..247794) [1776 bp, 591 aa] {ON} Anc_8.2...    39   0.056
Kwal_YGOB_gneas1 s33 complement(285483..287042) [1560 bp, 519 aa...    39   0.056
Suva_10.18 Chr10 complement(36048..38576) [2529 bp, 842 aa] {ON}...    39   0.057
Smik_15.350 Chr15 (610312..612666) [2355 bp, 784 aa] {ON} YOR172...    39   0.057
YJL206C Chr10 complement(47659..49935) [2277 bp, 758 aa] {ON} Pu...    39   0.058
Skud_12.544 Chr12 (969942..972608) [2667 bp, 888 aa] {ON} YLR451...    39   0.059
Ecym_5015 Chr5 (29616..32099) [2484 bp, 827 aa] {ON} similar to ...    39   0.061
Smik_13.64 Chr13 complement(110338..113172) [2835 bp, 944 aa] {O...    39   0.061
TBLA0G00490 Chr7 (99344..102100) [2757 bp, 918 aa] {ON}                39   0.061
TBLA0G00730 Chr7 complement(165589..167994) [2406 bp, 801 aa] {O...    39   0.062
Smik_16.20 Chr16 complement(26236..27657) [1422 bp, 473 aa] {ON}...    39   0.063
NDAI0A05750 Chr1 complement(1302180..1304459) [2280 bp, 759 aa] ...    39   0.064
TDEL0B06360 Chr2 complement(1127150..1130095) [2946 bp, 981 aa] ...    39   0.065
Kwal_26.7095 s26 (211883..214399) [2517 bp, 838 aa] {ON} YOR363C...    39   0.065
TDEL0G04890 Chr7 (903504..903581,903640..905316) [1755 bp, 584 a...    39   0.066
TBLA0B04800 Chr2 complement(1127000..1129333) [2334 bp, 777 aa] ...    39   0.067
YAL051W Chr1 (48564..51707) [3144 bp, 1047 aa] {ON}  OAF1Oleate-...    39   0.067
NCAS0D02540 Chr4 complement(484060..486732) [2673 bp, 890 aa] {O...    39   0.067
Kpol_1008.13 s1008 (21147..23855) [2709 bp, 902 aa] {ON} (21147....    39   0.068
KNAG0E04100 Chr5 (814663..817374) [2712 bp, 903 aa] {ON} Anc_4.3...    39   0.068
KAFR0C03660 Chr3 complement(745068..747611) [2544 bp, 847 aa] {O...    39   0.068
KLLA0A09119g Chr1 complement(797533..800781) [3249 bp, 1082 aa] ...    39   0.070
Skud_7.627 Chr7 (1048240..1049664) [1425 bp, 474 aa] {ON} YBR297...    39   0.070
CAGL0L09691g Chr12 complement(1041796..1044270) [2475 bp, 824 aa...    39   0.072
Suva_10.94 Chr10 complement(178366..181086) [2721 bp, 906 aa] {O...    39   0.072
KLLA0A04169g Chr1 complement(376273..378600) [2328 bp, 775 aa] {...    39   0.072
KLTH0D16852g Chr4 (1392572..1395007) [2436 bp, 811 aa] {ON} simi...    39   0.072
TBLA0E03480 Chr5 (865043..868183) [3141 bp, 1046 aa] {ON} Anc_3....    39   0.077
YKL038W Chr11 (365605..369117) [3513 bp, 1170 aa] {ON}  RGT1Gluc...    39   0.077
Kpol_1018.92 s1018 (244116..247298) [3183 bp, 1060 aa] {ON} (244...    39   0.077
KAFR0H01800 Chr8 complement(333664..336048) [2385 bp, 794 aa] {O...    39   0.078
Ecym_8404 Chr8 complement(834988..837645) [2658 bp, 885 aa] {ON}...    39   0.079
Ecym_4686 Chr4 complement(1336279..1339581) [3303 bp, 1100 aa] {...    39   0.079
Smik_23.3 Chr23 complement(4675..6111) [1437 bp, 478 aa] {ON} YB...    39   0.079
AGR369W Chr7 (1412833..1415988) [3156 bp, 1051 aa] {ON} Syntenic...    39   0.080
SAKL0H25146g Chr8 complement(2185695..2187632) [1938 bp, 645 aa]...    39   0.081
ADR403C Chr4 complement(1429115..1432027) [2913 bp, 970 aa] {ON}...    39   0.082
NCAS0D02720 Chr4 complement(520916..523189) [2274 bp, 757 aa] {O...    39   0.083
CAGL0D02904g Chr4 complement(302952..305615) [2664 bp, 887 aa] {...    39   0.084
Skud_7.274 Chr7 complement(472171..475413) [3243 bp, 1080 aa] {O...    39   0.087
AGR061C Chr7 complement(831052..832890) [1839 bp, 612 aa] {ON} S...    38   0.088
Skud_20.3 Chr20 (4504..5916) [1413 bp, 470 aa] {ON} YBR297W (REAL)     38   0.092
CAGL0H04367g Chr8 complement(410256..413093) [2838 bp, 945 aa] {...    39   0.092
TPHA0I00860 Chr9 complement(188725..190215) [1491 bp, 496 aa] {O...    38   0.096
Kwal_14.915 s14 (110216..112684) [2469 bp, 822 aa] {ON} YKL015W ...    38   0.097
ZYRO0B03278g Chr2 (269277..272996) [3720 bp, 1239 aa] {ON} simil...    39   0.098
TDEL0H04340 Chr8 complement(746566..749535) [2970 bp, 989 aa] {O...    38   0.100
NDAI0G04140 Chr7 (994071..997076) [3006 bp, 1001 aa] {ON} Anc_3....    38   0.11 
NDAI0A08790 Chr1 complement(2026171..2029350) [3180 bp, 1059 aa]...    38   0.11 
KNAG0E04150 Chr5 complement(823063..826473) [3411 bp, 1136 aa] {...    38   0.11 
NCAS0H00780 Chr8 complement(140472..143201) [2730 bp, 909 aa] {O...    38   0.11 
Suva_13.186 Chr13 (302887..305571) [2685 bp, 894 aa] {ON} YMR019...    38   0.11 
KLTH0B09262g Chr2 (758773..761235) [2463 bp, 820 aa] {ON} weakly...    38   0.12 
Smik_7.277 Chr7 complement(461108..464317) [3210 bp, 1069 aa] {O...    38   0.12 
Skud_2.106 Chr2 (200722..203754) [3033 bp, 1010 aa] {ON} YBL005W...    38   0.12 
Kwal_23.2905 s23 (69235..71880) [2646 bp, 881 aa] {ON} YLR014C (...    38   0.12 
Suva_4.265 Chr4 (467625..470438) [2814 bp, 937 aa] {ON} YBR033W ...    38   0.12 
Smik_16.15 Chr16 complement(14421..15812) [1392 bp, 463 aa] {ON}...    38   0.12 
KNAG0A07100 Chr1 complement(1113008..1116868) [3861 bp, 1286 aa]...    38   0.12 
Suva_15.425 Chr15 (750153..752087) [1935 bp, 644 aa] {ON} YLR098...    38   0.12 
YGL013C Chr7 complement(469092..472298) [3207 bp, 1068 aa] {ON} ...    38   0.12 
Skud_2.427 Chr2 (769889..771295) [1407 bp, 468 aa] {ON} YGR288W ...    38   0.12 
ACR241C Chr3 complement(784358..786745) [2388 bp, 795 aa] {ON} S...    38   0.13 
Smik_15.547 Chr15 complement(966368..969355) [2988 bp, 995 aa] {...    38   0.13 
KLTH0E06116g Chr5 complement(553784..556297) [2514 bp, 837 aa] {...    38   0.13 
KAFR0G02540 Chr7 complement(524919..527486) [2568 bp, 855 aa] {O...    38   0.14 
NDAI0I02350 Chr9 (536448..539117) [2670 bp, 889 aa] {ON} Anc_5.235     38   0.14 
ACL195C Chr3 complement(19204..19533) [330 bp, 109 aa] {ON} NOHB...    35   0.14 
KAFR0L01720 Chr12 (313720..316545) [2826 bp, 941 aa] {ON} Anc_7....    38   0.14 
KLLA0F19602g Chr6 complement(1814949..1816760) [1812 bp, 603 aa]...    38   0.14 
YLR014C Chr12 complement(172268..174982) [2715 bp, 904 aa] {ON} ...    38   0.14 
Smik_25.2 Chr25 (2105..4462) [2358 bp, 785 aa] {ON} YER184C (REAL)     38   0.15 
ZYRO0B14476g Chr2 complement(1175759..1177882) [2124 bp, 707 aa]...    38   0.15 
KAFR0A03060 Chr1 complement(626316..628898) [2583 bp, 860 aa] {O...    38   0.15 
Kpol_1061.42 s1061 complement(116430..119819) [3390 bp, 1129 aa]...    38   0.15 
Smik_1.13 Chr1 (31514..34654) [3141 bp, 1046 aa] {ON} YAL051W (R...    38   0.16 
Ecym_6141 Chr6 complement(258221..258565) [345 bp, 114 aa] {ON} ...    35   0.16 
AER370W Chr5 (1320487..1322892) [2406 bp, 801 aa] {ON} Syntenic ...    38   0.16 
YBR297W Chr2 (800523..801929) [1407 bp, 468 aa] {ON}  MAL33MAL-a...    37   0.16 
CAGL0G08844g Chr7 complement(846590..849133) [2544 bp, 847 aa] {...    38   0.16 
KLLA0A03443g Chr1 (311628..314555) [2928 bp, 975 aa] {ON} simila...    38   0.16 
Suva_11.187 Chr11 (348570..352085) [3516 bp, 1171 aa] {ON} YKL03...    38   0.17 
KAFR0B07080 Chr2 complement(1480370..1482397) [2028 bp, 675 aa] ...    37   0.17 
KLTH0D07898g Chr4 (672516..674534) [2019 bp, 672 aa] {ON} weakly...    37   0.17 
Ecym_1135 Chr1 complement(276229..278697) [2469 bp, 822 aa] {ON}...    37   0.17 
KLTH0C06776g Chr3 complement(586976..590140) [3165 bp, 1054 aa] ...    37   0.18 
KLLA0F18084g Chr6 complement(1652031..1654613) [2583 bp, 860 aa]...    37   0.18 
Skud_15.334 Chr15 (602966..605338) [2373 bp, 790 aa] {ON} YOR172...    37   0.18 
TBLA0A04280 Chr1 complement(1059254..1061932) [2679 bp, 892 aa] ...    37   0.18 
KAFR0B00100 Chr2 (2110..4137) [2028 bp, 675 aa] {ON}                   37   0.18 
NDAI0H01990 Chr8 complement(481983..485468) [3486 bp, 1161 aa] {...    37   0.18 
SAKL0H16544g Chr8 (1454826..1454875,1454943..1456692) [1800 bp, ...    37   0.18 
NCAS0G01100 Chr7 complement(193052..195859) [2808 bp, 935 aa] {O...    37   0.19 
TDEL0E03910 Chr5 (732533..735121) [2589 bp, 862 aa] {ON} Anc_5.2...    37   0.19 
Kwal_27.10852 s27 complement(526456..529596) [3141 bp, 1046 aa] ...    37   0.19 
Skud_1.10 Chr1 (24510..27632) [3123 bp, 1040 aa] {ON} YAL051W (R...    37   0.19 
Suva_13.76 Chr13 complement(113974..116811) [2838 bp, 946 aa] {O...    37   0.19 
KLTH0D02222g Chr4 (220570..223113) [2544 bp, 847 aa] {ON} weakly...    37   0.19 
SAKL0C02024g Chr3 complement(174858..177554) [2697 bp, 898 aa] {...    37   0.20 
Smik_11.210 Chr11 (352056..355565) [3510 bp, 1169 aa] {ON} YKL03...    37   0.20 
Skud_11.190 Chr11 (345221..348736) [3516 bp, 1171 aa] {ON} YKL03...    37   0.20 
KLLA0B04620g Chr2 complement(413129..415888) [2760 bp, 919 aa] {...    37   0.21 
Suva_8.421 Chr8 complement(757924..760932) [3009 bp, 1002 aa] {O...    37   0.21 
KLTH0C10032g Chr3 complement(830334..832934) [2601 bp, 866 aa] {...    37   0.21 
CAGL0L01903g Chr12 (220700..224563) [3864 bp, 1287 aa] {ON} simi...    37   0.22 
NCAS0I02410 Chr9 (451205..453964) [2760 bp, 919 aa] {ON} Anc_3.1...    37   0.22 
KLTH0E14454g Chr5 complement(1282704..1285412) [2709 bp, 902 aa]...    37   0.22 
KLTH0F03014g Chr6 (260568..262406) [1839 bp, 612 aa] {ON} simila...    37   0.23 
Suva_7.268 Chr7 complement(460629..463631) [3003 bp, 1000 aa] {O...    37   0.23 
YDL170W Chr4 (156318..157904) [1587 bp, 528 aa] {ON}  UGA3Transc...    37   0.23 
TPHA0F02540 Chr6 (556797..559178) [2382 bp, 793 aa] {ON} Anc_6.6...    37   0.23 
Skud_12.346 Chr12 complement(616734..618818) [2085 bp, 694 aa] {...    37   0.24 
NDAI0F01220 Chr6 complement(295418..298300) [2883 bp, 960 aa] {O...    37   0.24 
YMR019W Chr13 (312156..315005) [2850 bp, 949 aa] {ON}  STB4Putat...    37   0.24 
SAKL0F15444g Chr6 (1243590..1246484) [2895 bp, 964 aa] {ON} simi...    37   0.24 
KLLA0F25630g Chr6 (2378464..2381487) [3024 bp, 1007 aa] {ON} som...    37   0.24 
Smik_4.68 Chr4 (133172..134758) [1587 bp, 528 aa] {ON} YDL170W (...    37   0.25 
Skud_15.64 Chr15 complement(109746..112844) [3099 bp, 1032 aa] {...    37   0.25 
Skud_6.15 Chr6 complement(24031..25701) [1671 bp, 556 aa] {ON} Y...    37   0.25 
SAKL0B04620g Chr2 complement(406622..407710) [1089 bp, 362 aa] {...    37   0.25 
KLLA0F00572g Chr6 complement(42710..44503) [1794 bp, 597 aa] {ON...    37   0.26 
SAKL0D01100g Chr4 complement(81235..84057) [2823 bp, 940 aa] {ON...    37   0.26 
NCAS0C04780 Chr3 (974254..976998) [2745 bp, 914 aa] {ON}               37   0.26 
KAFR0J00690 Chr10 (124449..127043) [2595 bp, 864 aa] {ON} Anc_5....    37   0.26 
KLLA0D05038g Chr4 (433653..435674) [2022 bp, 673 aa] {ON} simila...    37   0.26 
TPHA0C02180 Chr3 complement(493972..496632) [2661 bp, 886 aa] {O...    37   0.27 
CAGL0L04400g Chr12 complement(513759..516722) [2964 bp, 987 aa] ...    37   0.27 
Ecym_5017 Chr5 (36647..39583) [2937 bp, 978 aa] {ON} similar to ...    37   0.27 
CAGL0D03850g Chr4 (384689..387193) [2505 bp, 834 aa] {ON} weakly...    37   0.28 
Kpol_538.42 s538 complement(89752..93018) [3267 bp, 1088 aa] {ON...    37   0.28 
KLTH0E05786g Chr5 (517896..520349) [2454 bp, 817 aa] {ON} weakly...    37   0.28 
SAKL0C09944g Chr3 complement(899127..902312) [3186 bp, 1061 aa] ...    37   0.28 
KNAG0B02380 Chr2 complement(466392..469595) [3204 bp, 1067 aa] {...    37   0.29 
ZYRO0G22550g Chr7 complement(1856064..1858238) [2175 bp, 724 aa]...    37   0.29 
TPHA0G00380 Chr7 complement(65673..68294) [2622 bp, 873 aa] {ON}       37   0.29 
KAFR0F03410 Chr6 complement(677156..680143) [2988 bp, 995 aa] {O...    37   0.30 
Smik_18.3 Chr18 complement(3105..5219) [2115 bp, 704 aa] {ON} YK...    37   0.30 
AFR096W Chr6 (606993..609551) [2559 bp, 852 aa] {ON} Syntenic ho...    37   0.30 
YLR266C Chr12 complement(675619..677724) [2106 bp, 701 aa] {ON} ...    37   0.30 
TPHA0N00230 Chr14 (39855..43553) [3699 bp, 1232 aa] {ON} Anc_7.1...    37   0.30 
Skud_12.82 Chr12 complement(164119..166818) [2700 bp, 899 aa] {O...    37   0.31 
Skud_13.173 Chr13 (298693..298722,298729..301461) [2763 bp, 920 ...    37   0.31 
NDAI0I02190 Chr9 (501867..504074) [2208 bp, 735 aa] {ON} Anc_6.6...    37   0.32 
CAGL0A00451g Chr1 (47557..50880) [3324 bp, 1107 aa] {ON} similar...    37   0.32 
AFL160C Chr6 complement(130842..132788) [1947 bp, 648 aa] {ON} S...    37   0.33 
ZYRO0E06270g Chr5 (475960..478698) [2739 bp, 912 aa] {ON} weakly...    37   0.33 
NDAI0C04790 Chr3 complement(1100952..1104053) [3102 bp, 1033 aa]...    37   0.33 
SAKL0G11902g Chr7 (1016915..1019635) [2721 bp, 906 aa] {ON} simi...    37   0.34 
Suva_1.14 Chr1 (25653..28790) [3138 bp, 1045 aa] {ON} YAL051W (R...    37   0.34 
SAKL0D13464g Chr4 (1116277..1118340) [2064 bp, 687 aa] {ON} weak...    37   0.34 
Kpol_1031.47 s1031 (125242..127926) [2685 bp, 894 aa] {ON} (1252...    37   0.34 
Sklu_YGOB_gneas1 Chr3 complement(352893..354335) [1443 bp, 480 a...    36   0.34 
KNAG0B01720 Chr2 complement(314126..315787) [1662 bp, 553 aa] {O...    36   0.35 
KAFR0B02820 Chr2 complement(576317..578311) [1995 bp, 664 aa] {O...    37   0.35 
Skud_14.399 Chr14 (715444..717267) [1824 bp, 607 aa] {ON} YNR063...    36   0.35 
Kpol_1049.19 s1049 (38439..41270) [2832 bp, 943 aa] {ON} (38439....    37   0.35 
Smik_8.127 Chr8 complement(190428..193079) [2652 bp, 883 aa] {ON...    37   0.35 
NCAS0A03570 Chr1 complement(708718..711654) [2937 bp, 978 aa] {O...    37   0.36 
NDAI0D03550 Chr4 complement(843265..846621) [3357 bp, 1118 aa] {...    37   0.36 
CAGL0F09229g Chr6 complement(908186..910693) [2508 bp, 835 aa] {...    36   0.37 
Ecym_6340 Chr6 complement(652943..655801) [2859 bp, 952 aa] {ON}...    37   0.37 
KAFR0F01490 Chr6 complement(290988..292964) [1977 bp, 658 aa] {O...    36   0.39 
NDAI0B01540 Chr2 complement(359639..362050) [2412 bp, 803 aa] {O...    36   0.39 
KAFR0I00280 Chr9 complement(57061..59871) [2811 bp, 936 aa] {ON}...    36   0.39 
Suva_10.364 Chr10 complement(637047..639170) [2124 bp, 707 aa] {...    36   0.40 
TDEL0E00300 Chr5 (64461..66374) [1914 bp, 637 aa] {ON}                 36   0.40 
KNAG0M01040 Chr13 complement(183066..185591) [2526 bp, 841 aa] {...    36   0.40 
KLTH0H16236g Chr8 (1400457..1402148) [1692 bp, 563 aa] {ON} cons...    36   0.42 
KLLA0E20307g Chr5 (1806005..1809364) [3360 bp, 1119 aa] {ON} uni...    36   0.42 
KAFR0I00230 Chr9 (48095..51232) [3138 bp, 1045 aa] {ON} Anc_7.17...    36   0.43 
ACL058W Chr3 (261723..264176) [2454 bp, 817 aa] {ON} NOHBY305; N...    36   0.43 
KLTH0E07854g Chr5 (719642..722458) [2817 bp, 938 aa] {ON} weakly...    36   0.44 
Ecym_4286 Chr4 (613587..615470) [1884 bp, 627 aa] {ON} similar t...    36   0.44 
Kwal_26.6805 s26 (71596..74430) [2835 bp, 944 aa] {ON} YAL051W (...    36   0.45 
KNAG0F02830 Chr6 (536483..538723) [2241 bp, 746 aa] {ON}               36   0.47 
YLR451W Chr12 (1036093..1038753) [2661 bp, 886 aa] {ON}  LEU3Zin...    36   0.48 
KLLA0D12650g Chr4 complement(1073580..1075535) [1956 bp, 651 aa]...    36   0.48 
ZYRO0D01650g Chr4 complement(131688..134270) [2583 bp, 860 aa] {...    36   0.48 
KLTH0B00352g Chr2 complement(31952..34756) [2805 bp, 934 aa] {ON...    36   0.50 
KLLA0A02585g Chr1 complement(226562..227674) [1113 bp, 370 aa] {...    35   0.50 
Ecym_2345 Chr2 (676841..678754) [1914 bp, 637 aa] {ON} similar t...    36   0.50 
YOR337W Chr15 (954344..956623) [2280 bp, 759 aa] {ON}  TEA1Ty1 e...    36   0.51 
KNAG0M02120 Chr13 (395195..397021) [1827 bp, 608 aa] {ON} Anc_2....    36   0.51 
Ecym_2672 Chr2 (1294580..1296799) [2220 bp, 739 aa] {ON} similar...    36   0.53 
KLLA0F09559g Chr6 complement(876719..878695) [1977 bp, 658 aa] {...    36   0.53 
Suva_4.76 Chr4 (144078..145667) [1590 bp, 529 aa] {ON} YDL170W (...    36   0.53 
Skud_7.646 Chr7 (1073386..1074795) [1410 bp, 469 aa] {ON} YPR196...    36   0.53 
Suva_16.59 Chr16 complement(88631..91318) [2688 bp, 895 aa] {ON}...    36   0.54 
SAKL0C00242g Chr3 (14453..16954) [2502 bp, 833 aa] {ON} weakly s...    36   0.54 
KNAG0D00690 Chr4 (105640..108267) [2628 bp, 875 aa] {ON} Anc_6.2...    36   0.55 
ZYRO0G00308g Chr7 (20674..22623) [1950 bp, 649 aa] {ON} similar ...    36   0.55 
TPHA0E00880 Chr5 complement(177030..180164) [3135 bp, 1044 aa] {...    36   0.57 
TPHA0D00840 Chr4 complement(169497..172547) [3051 bp, 1016 aa] {...    36   0.58 
YOR172W Chr15 (654210..656570) [2361 bp, 786 aa] {ON}  YRM1Zn2-C...    36   0.59 
SAKL0F12342g Chr6 (964262..967393) [3132 bp, 1043 aa] {ON} simil...    36   0.60 
Kwal_26.8109 s26 complement(650270..653182) [2913 bp, 970 aa] {O...    36   0.61 
TDEL0D00730 Chr4 complement(129036..131456) [2421 bp, 806 aa] {O...    35   0.64 
TBLA0G01800 Chr7 complement(469668..473132) [3465 bp, 1154 aa] {...    36   0.65 
NCAS0B05110 Chr2 complement(951685..953485,953561..953643) [1884...    35   0.65 
Ecym_5044 Chr5 complement(91778..94489) [2712 bp, 903 aa] {ON} s...    35   0.67 
ZYRO0C00726g Chr3 (53977..57084) [3108 bp, 1035 aa] {ON} similar...    35   0.67 
TBLA0G00510 Chr7 (104797..107604) [2808 bp, 935 aa] {ON} Anc_6.6...    35   0.69 
Smik_12.549 Chr12 (964956..967616) [2661 bp, 886 aa] {ON} YLR451...    35   0.69 
Smik_12.6 Chr12 complement(17429..19966) [2538 bp, 845 aa] {ON} ...    35   0.71 
Kwal_47.16939 s47 (180147..182156) [2010 bp, 669 aa] {ON} [conti...    35   0.73 
Skud_2.39 Chr2 complement(80293..83772) [3480 bp, 1159 aa] {ON} ...    35   0.73 
ZYRO0B14718g Chr2 (1196539..1199646) [3108 bp, 1035 aa] {ON} sim...    35   0.74 
KLTH0D00594g Chr4 (57414..59309) [1896 bp, 631 aa] {ON} conserve...    35   0.74 
KNAG0B05120 Chr2 (982236..984902) [2667 bp, 888 aa] {ON}               35   0.75 
YNR063W Chr14 (746943..748766) [1824 bp, 607 aa] {ON} Putative z...    35   0.75 
NCAS0B02930 Chr2 (504501..506606) [2106 bp, 701 aa] {ON} Anc_8.416     35   0.76 
Ecym_7235 Chr7 (489574..492405) [2832 bp, 943 aa] {ON} similar t...    35   0.78 
Smik_12.341 Chr12 complement(613817..615922) [2106 bp, 701 aa] {...    35   0.81 
KAFR0C03730 Chr3 (759382..761757) [2376 bp, 791 aa] {ON}               35   0.81 
KLTH0A06644g Chr1 complement(553084..555270) [2187 bp, 728 aa] {...    35   0.81 
Kwal_55.21884 s55 (1020057..1022705) [2649 bp, 882 aa] {ON} YLR4...    35   0.81 
KLLA0C03201g Chr3 complement(286973..288925) [1953 bp, 650 aa] {...    35   0.81 
NCAS0A12720 Chr1 (2510574..2512853) [2280 bp, 759 aa] {ON} Anc_2...    35   0.83 
TDEL0D00820 Chr4 (151394..153451) [2058 bp, 685 aa] {ON}               35   0.83 
Ecym_7239 Chr7 (501580..504774) [3195 bp, 1064 aa] {ON} similar ...    35   0.83 
TPHA0E03830 Chr5 complement(805860..808328) [2469 bp, 822 aa] {O...    35   0.84 
CAGL0H00396g Chr8 complement(37005..39827) [2823 bp, 940 aa] {ON...    35   0.89 
TDEL0C05790 Chr3 (1045249..1047057) [1809 bp, 602 aa] {ON}             35   0.90 
Smik_2.50 Chr2 complement(90559..94011) [3453 bp, 1150 aa] {ON} ...    35   0.90 
NDAI0D00220 Chr4 complement(43353..46187) [2835 bp, 944 aa] {ON}...    35   0.91 
KNAG0D03520 Chr4 complement(642517..645609) [3093 bp, 1030 aa] {...    35   0.91 
AER153W Chr5 (925950..928196) [2247 bp, 748 aa] {ON} Syntenic ho...    35   0.92 
NCAS0B08200 Chr2 (1561174..1563801) [2628 bp, 875 aa] {ON} Anc_1...    35   0.92 
YLR098C Chr12 complement(337527..339473) [1947 bp, 648 aa] {ON} ...    35   0.92 
KAFR0A02130 Chr1 (447063..449186) [2124 bp, 707 aa] {ON} Anc_2.5...    35   0.93 
TBLA0G00520 Chr7 (108060..110696) [2637 bp, 878 aa] {ON} Anc_6.6...    35   0.94 
Suva_15.415 Chr15 (726296..728899) [2604 bp, 867 aa] {ON} YCR106...    35   0.94 
Smik_6.452 Chr6 (741922..744558) [2637 bp, 878 aa] {ON} YPL248C ...    35   0.95 
TPHA0C04280 Chr3 complement(922743..926132) [3390 bp, 1129 aa] {...    35   0.95 
Kwal_14.819 s14 complement(63184..64890) [1707 bp, 568 aa] {ON} ...    35   0.98 
KLTH0E06666g Chr5 (611348..614188) [2841 bp, 946 aa] {ON} conser...    35   0.99 
Skud_15.326 Chr15 complement(588275..590731) [2457 bp, 818 aa] {...    35   0.99 
YOL089C Chr15 complement(150398..153490) [3093 bp, 1030 aa] {ON}...    35   1.0  
SAKL0H24860g Chr8 complement(2162455..2165370) [2916 bp, 971 aa]...    35   1.0  
ZYRO0C18150g Chr3 (1418645..1420360) [1716 bp, 571 aa] {ON} some...    35   1.1  
KLLA0C16489g Chr3 (1444456..1446642) [2187 bp, 728 aa] {ON} cons...    35   1.1  
ZYRO0D06688g Chr4 (577455..577507,577577..579311) [1788 bp, 595 ...    35   1.1  
NCAS0F00370 Chr6 complement(61819..65148) [3330 bp, 1109 aa] {ON...    35   1.1  
TPHA0A06090 Chr1 complement(1372559..1375102) [2544 bp, 847 aa] ...    35   1.1  
KLLA0F02750g Chr6 complement(250368..253814) [3447 bp, 1148 aa] ...    35   1.1  
KAFR0E02410 Chr5 (489279..491354) [2076 bp, 691 aa] {ON} Anc_7.5...    35   1.2  
KLLA0E19603g Chr5 complement(1739869..1741914) [2046 bp, 681 aa]...    35   1.2  
KAFR0A01480 Chr1 (294040..296217) [2178 bp, 725 aa] {ON} Anc_1.2...    35   1.2  
KLLA0C19228g Chr3 (1713787..1715562) [1776 bp, 591 aa] {ON} simi...    35   1.2  
TDEL0H00790 Chr8 complement(132519..135002) [2484 bp, 827 aa] {O...    35   1.2  
TDEL0H00590 Chr8 complement(101024..103477) [2454 bp, 817 aa] {O...    35   1.2  
YER184C Chr5 complement(556296..558680) [2385 bp, 794 aa] {ON} P...    35   1.2  
Smik_13.183 Chr13 (304049..304060,304064..306787) [2736 bp, 911 ...    35   1.3  
YBR033W Chr2 (301944..304703) [2760 bp, 919 aa] {ON}  EDS1Putati...    35   1.3  
NDAI0G05530 Chr7 (1360413..1363973) [3561 bp, 1186 aa] {ON}            35   1.3  
KNAG0E00210 Chr5 (24545..27391) [2847 bp, 948 aa] {ON} Anc_7.17 ...    35   1.4  
TDEL0A02690 Chr1 (485785..487953) [2169 bp, 722 aa] {ON}               35   1.4  
AFR171W Chr6 (752589..754427) [1839 bp, 612 aa] {ON} NOHBY629; N...    34   1.4  
NDAI0K02840 Chr11 (640461..643634) [3174 bp, 1057 aa] {ON} Anc_6...    35   1.4  
YPL248C Chr16 complement(79711..82356) [2646 bp, 881 aa] {ON}  G...    34   1.5  
KLTH0F03300g Chr6 complement(283918..285474) [1557 bp, 518 aa] {...    34   1.5  
SAKL0H00660g Chr8 complement(78740..81478) [2739 bp, 912 aa] {ON...    34   1.5  
TDEL0C05680 Chr3 complement(1020646..1022721) [2076 bp, 691 aa] ...    34   1.5  
Smik_6.23 Chr6 complement(37285..38955) [1671 bp, 556 aa] {ON} Y...    34   1.5  
Suva_5.324 Chr5 (529581..530993) [1413 bp, 470 aa] {ON} YFL052W ...    34   1.6  
Suva_4.400 Chr4 complement(710591..713704) [3114 bp, 1037 aa] {O...    34   1.7  
ZYRO0G15136g Chr7 complement(1218989..1222072) [3084 bp, 1027 aa...    34   1.7  
SAKL0A02860g Chr1 complement(259388..261625) [2238 bp, 745 aa] {...    34   1.7  
TPHA0H01980 Chr8 (467688..470669) [2982 bp, 993 aa] {ON} Anc_6.2...    34   1.7  
Kwal_47.17233 s47 (309658..312504) [2847 bp, 948 aa] {ON} [conti...    34   1.8  
SAKL0D14916g Chr4 complement(1233415..1235313) [1899 bp, 632 aa]...    34   1.8  
Smik_18.8 Chr18 (12069..14396) [2328 bp, 775 aa] {ON} YOR172W (R...    34   1.8  
KNAG0M00620 Chr13 (99320..100699) [1380 bp, 459 aa] {ON} Anc_6.1...    34   1.8  
YOR162C Chr15 complement(639560..641992) [2433 bp, 810 aa] {ON} ...    34   1.8  
Kpol_467.1 s467 (471..4340) [3870 bp, 1289 aa] {ON} (471..4340) ...    34   1.9  
TDEL0D06620 Chr4 (1197405..1199084) [1680 bp, 559 aa] {ON}             34   1.9  
KLLA0C14212g Chr3 complement(1229219..1232341) [3123 bp, 1040 aa...    34   1.9  
Suva_10.569 Chr10 (990917..992962,992995..993603) [2655 bp, 884 ...    34   1.9  
YBL005W Chr2 (217470..220400) [2931 bp, 976 aa] {ON}  PDR3Transc...    34   2.0  
Skud_4.87 Chr4 (152240..153826) [1587 bp, 528 aa] {ON} YDL170W (...    34   2.0  
Skud_4.795 Chr4 complement(1401165..1403492) [2328 bp, 775 aa] {...    34   2.0  
Kwal_33.13118 s33 (80421..82760) [2340 bp, 779 aa] {ON} YDR520C ...    34   2.1  
KLLA0D00396g Chr4 complement(36277..37362) [1086 bp, 361 aa] {ON...    33   2.1  
TBLA0E03050 Chr5 complement(764239..766578) [2340 bp, 779 aa] {O...    34   2.1  
NDAI0A01040 Chr1 complement(220931..223918) [2988 bp, 995 aa] {O...    34   2.2  
Kpol_534.28 s534 (64772..66079) [1308 bp, 435 aa] {ON} (64772..6...    33   2.2  
TDEL0E00160 Chr5 (16083..17978) [1896 bp, 631 aa] {ON}                 34   2.2  
Ecym_7203 Chr7 (415869..418523) [2655 bp, 884 aa] {ON} similar t...    34   2.3  
TDEL0G04100 Chr7 complement(746975..749074) [2100 bp, 699 aa] {O...    34   2.3  
TBLA0E05030 Chr5 complement(1294821..1297529) [2709 bp, 902 aa] ...    34   2.4  
TDEL0C01580 Chr3 complement(272178..275687) [3510 bp, 1169 aa] {...    34   2.4  
Ecym_4153 Chr4 complement(330831..333281) [2451 bp, 816 aa] {ON}...    34   2.4  
SAKL0G14256g Chr7 (1230063..1232306) [2244 bp, 747 aa] {ON} cons...    34   2.4  
KLTH0A03498g Chr1 complement(301696..303915) [2220 bp, 739 aa] {...    33   2.5  
KLLA0D00484g Chr4 (44879..47893) [3015 bp, 1004 aa] {ON} conserv...    34   2.5  
NDAI0I00740 Chr9 complement(160212..163313) [3102 bp, 1033 aa] {...    33   2.6  
SAKL0D05654g Chr4 (457485..460244) [2760 bp, 919 aa] {ON} weakly...    33   2.6  
Kwal_47.17681 s47 complement(513119..515683) [2565 bp, 854 aa] {...    33   2.7  
Smik_15.67 Chr15 complement(113506..116598) [3093 bp, 1030 aa] {...    33   2.7  
NCAS0E02620 Chr5 complement(523279..526626) [3348 bp, 1115 aa] {...    33   2.7  
TDEL0G04920 Chr7 complement(912754..914844) [2091 bp, 696 aa] {O...    33   2.7  
YFL052W Chr6 (28232..29629) [1398 bp, 465 aa] {ON} Putative zinc...    33   2.8  
TBLA0G01090 Chr7 complement(275031..277499) [2469 bp, 822 aa] {O...    33   3.2  
Kpol_1059.26 s1059 complement(57391..58653) [1263 bp, 420 aa] {O...    33   3.4  
KLTH0E08140g Chr5 (747649..749547) [1899 bp, 632 aa] {ON} conser...    33   3.4  
AER183C Chr5 complement(975879..978518) [2640 bp, 879 aa] {ON} N...    33   3.5  
ZYRO0D14058g Chr4 (1188615..1190891) [2277 bp, 758 aa] {ON} simi...    33   3.5  
AGL206C Chr7 complement(311846..314053) [2208 bp, 735 aa] {ON} N...    33   3.5  
CAGL0M02651g Chr13 complement(304583..305971) [1389 bp, 462 aa] ...    33   3.6  
KNAG0M02460 Chr13 complement(455579..458527) [2949 bp, 982 aa] {...    33   3.8  
Kwal_47.17565 s47 (457523..459409) [1887 bp, 628 aa] {ON} [conti...    33   3.9  
Kwal_55.20722 s55 (530982..533465) [2484 bp, 827 aa] {ON} YCR106...    33   4.2  
Smik_4.801 Chr4 complement(1403910..1406225) [2316 bp, 771 aa] {...    33   4.3  
KNAG0D05240 Chr4 (953893..956502) [2610 bp, 869 aa] {ON} Anc_7.5...    33   4.3  
TBLA0C00940 Chr3 (187969..190338) [2370 bp, 789 aa] {ON} Anc_2.6...    33   4.3  
ABR174W Chr2 (728570..731164) [2595 bp, 864 aa] {ON} Syntenic ho...    33   4.3  
Ecym_5001 Chr5 (915..2738) [1824 bp, 607 aa] {ON} similar to Ash...    33   4.3  
KNAG0F03720 Chr6 (695079..697379) [2301 bp, 766 aa] {ON} Anc_7.5...    33   4.3  
KLTH0D03718g Chr4 complement(362790..364790) [2001 bp, 666 aa] {...    33   4.5  
ADR375W Chr4 (1378248..1380026) [1779 bp, 592 aa] {ON} NOHBY445;...    33   4.5  
Suva_8.216 Chr8 complement(389549..391894) [2346 bp, 781 aa] {ON...    33   4.6  
TPHA0C02220 Chr3 (504550..506658) [2109 bp, 702 aa] {ON} Anc_8.4...    33   4.6  
Smik_15.342 Chr15 complement(595611..595820,595851..598070) [243...    33   4.6  
NDAI0E04190 Chr5 complement(944753..948466) [3714 bp, 1237 aa] {...    33   4.6  
Kwal_26.7014 s26 complement(164333..166297) [1965 bp, 654 aa] {O...    33   4.8  
Skud_6.7 Chr6 (12394..13791) [1398 bp, 465 aa] {ON} YPR196W (REAL)     33   4.9  
ZYRO0B00242g Chr2 (12202..14118) [1917 bp, 638 aa] {ON} conserve...    33   4.9  
Smik_26.8 Chr26 (8892..9242) [351 bp, 117 aa] {ON} YER184C (REAL)      31   5.0  
KLLA0D01452g Chr4 (124018..128355) [4338 bp, 1445 aa] {ON} simil...    33   5.0  
Kwal_26.6732 s26 (43580..45610) [2031 bp, 676 aa] {ON} [contig 4...    33   5.2  
SAKL0G17622g Chr7 complement(1525163..1527193) [2031 bp, 676 aa]...    33   5.2  
Suva_2.701 Chr2 complement(1233963..1236344) [2382 bp, 793 aa] {...    33   5.3  
Skud_12.166 Chr12 complement(320672..322621) [1950 bp, 649 aa] {...    32   5.6  
SAKL0G07634g Chr7 (636596..639364) [2769 bp, 922 aa] {ON} some s...    33   5.7  
Kwal_47.18089 s47 complement(680481..682718) [2238 bp, 745 aa] {...    32   5.7  
TDEL0G04090 Chr7 complement(744499..746730) [2232 bp, 743 aa] {O...    32   5.7  
SAKL0B06732g Chr2 complement(578508..581144) [2637 bp, 878 aa] {...    32   6.0  
Skud_2.277 Chr2 complement(508677..511877) [3201 bp, 1066 aa] {O...    32   6.2  
Suva_10.10 Chr10 complement(16722..18389) [1668 bp, 555 aa] {ON}...    32   6.2  
ZYRO0C18282g Chr3 (1431515..1433665) [2151 bp, 716 aa] {ON} cons...    32   6.9  
AGL099C Chr7 complement(516587..518830) [2244 bp, 747 aa] {ON} S...    32   7.2  
NCAS0F00310 Chr6 (49514..52084) [2571 bp, 856 aa] {ON}                 32   7.2  
ZYRO0G00374g Chr7 complement(28649..30553) [1905 bp, 634 aa] {ON...    32   7.4  
TBLA0A05850 Chr1 complement(1446872..1448845) [1974 bp, 657 aa] ...    32   7.4  
Kpol_1061.37 s1061 complement(102667..104616) [1950 bp, 649 aa] ...    32   7.5  
YIR023W Chr9 (399777..402689) [2913 bp, 970 aa] {ON}  DAL81Posit...    32   8.4  
Kpol_1057.3 s1057 (3619..6702) [3084 bp, 1027 aa] {ON} (3619..67...    32   9.6  
KNAG0A04550 Chr1 (642548..645208) [2661 bp, 886 aa] {ON} Anc_8.4...    32   9.7  

>TPHA0L00350 Chr12 complement(47367..49946) [2580 bp, 859 aa] {ON} 
          Length = 859

 Score = 1714 bits (4439), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 830/859 (96%), Positives = 830/859 (96%)

Query: 1   MGSKSNRTSSKKWKRSFRACQTCRERKIKCNLGPLDNPHKPPCERCKREQRECIFVEPSR 60
           MGSKSNRTSSKKWKRSFRACQTCRERKIKCNLGPLDNPHKPPCERCKREQRECIFVEPSR
Sbjct: 1   MGSKSNRTSSKKWKRSFRACQTCRERKIKCNLGPLDNPHKPPCERCKREQRECIFVEPSR 60

Query: 61  KSRSLSPKDINYGDDGDDNKLKFIHYQQGDNKGANNKEIQNMALEDSAWESDVSSMQNAL 120
           KSRSLSPKDINYGDDGDDNKLKFIHYQQGDNKGANNKEIQNMALEDSAWESDVSSMQNAL
Sbjct: 61  KSRSLSPKDINYGDDGDDNKLKFIHYQQGDNKGANNKEIQNMALEDSAWESDVSSMQNAL 120

Query: 121 EYLASAAKSVSQFENHKPTSKLSDMVNSYSKDDMTQENIIKELFEKTELKNPASSLIAQL 180
           EYLASAAKSVSQFENHKPTSKLSDMVNSYSKDDMTQENIIKELFEKTELKNPASSLIAQL
Sbjct: 121 EYLASAAKSVSQFENHKPTSKLSDMVNSYSKDDMTQENIIKELFEKTELKNPASSLIAQL 180

Query: 181 SRIRTKPHKKLSDIVYIGDDKLLTEEEARRLIEVFFQKLHPFFPYIPLQLHNPEQLVRYP 240
           SRIRTKPHKKLSDIVYIGDDKLLTEEEARRLIEVFFQKLHPFFPYIPLQLHNPEQLVRYP
Sbjct: 181 SRIRTKPHKKLSDIVYIGDDKLLTEEEARRLIEVFFQKLHPFFPYIPLQLHNPEQLVRYP 240

Query: 241 ILLCAVITISARYNNFGDLDLKTRESPDYNITIHEKLWMYCQRLISRTIWAEASTRSIGT 300
           ILLCAVITISARYNNFGDLDLKTRESPDYNITIHEKLWMYCQRLISRTIWAEASTRSIGT
Sbjct: 241 ILLCAVITISARYNNFGDLDLKTRESPDYNITIHEKLWMYCQRLISRTIWAEASTRSIGT 300

Query: 301 ILAFLLFTEWNPRAIHWNWSDYANDSETINFNELNEFDPINSYKGESITGFEAMRHSDRM 360
           ILAFLLFTEWNPRAIHWNWSDYANDSETINFNELNEFDPINSYKGESITGFEAMRHSDRM
Sbjct: 301 ILAFLLFTEWNPRAIHWNWSDYANDSETINFNELNEFDPINSYKGESITGFEAMRHSDRM 360

Query: 361 AWMLTGSAVRLAQDMKFIDTSNKIFLATHIAETYNAMXXXXXXXXXXXXXXXXIHSKKID 420
           AWMLTGSAVRLAQDMKFIDTSNKIFLATHIAETYNAM                IHSKKID
Sbjct: 361 AWMLTGSAVRLAQDMKFIDTSNKIFLATHIAETYNAMNVNLRSSLSESLSNVNIHSKKID 420

Query: 421 PVKIIDGKKSERYFGNEKYYLEQIFKNAKDRESSYDLLENILRERRNAKAFPDNERDFLN 480
           PVKIIDGKKSERYFGNEKYYLEQIFKNAKDRESSYDLLENILRERRNAKAFPDNERDFLN
Sbjct: 421 PVKIIDGKKSERYFGNEKYYLEQIFKNAKDRESSYDLLENILRERRNAKAFPDNERDFLN 480

Query: 481 DEYILFYSNPDDATQNDELDTPLDFTVIQRAKIELLKIMSIGYETIYLEKGRRYTTANNQ 540
           DEYILFYSNPDDATQNDELDTPLDFTVIQRAKIELLKIMSIGYETIYLEKGRRYTTANNQ
Sbjct: 481 DEYILFYSNPDDATQNDELDTPLDFTVIQRAKIELLKIMSIGYETIYLEKGRRYTTANNQ 540

Query: 541 KQNLAMLNIFSALIDSWYVNYNELLSPEETLDPVLNASKMGLQSMTQIIENESLICDYYY 600
           KQNLAMLNIFSALIDSWYVNYNELLSPEETLDPVLNASKMGLQSMTQIIENESLICDYYY
Sbjct: 541 KQNLAMLNIFSALIDSWYVNYNELLSPEETLDPVLNASKMGLQSMTQIIENESLICDYYY 600

Query: 601 CQLYIYSLSLQVEDXXXXXXXXXXXXXAKYVSIAYSSAKEILNSAKRLQEVRMLKFIPVR 660
           CQLYIYSLSLQVED             AKYVSIAYSSAKEILNSAKRLQEVRMLKFIPVR
Sbjct: 601 CQLYIYSLSLQVEDEESKLKLKELSQSAKYVSIAYSSAKEILNSAKRLQEVRMLKFIPVR 660

Query: 661 WVIRIVRAISFIVKCYVTATDKDSMNYKELNSLLSLSGIPVDESLELIHTAAVLLKESTP 720
           WVIRIVRAISFIVKCYVTATDKDSMNYKELNSLLSLSGIPVDESLELIHTAAVLLKESTP
Sbjct: 661 WVIRIVRAISFIVKCYVTATDKDSMNYKELNSLLSLSGIPVDESLELIHTAAVLLKESTP 720

Query: 721 DELHLCTRYSKILLCLYRELKMDTLSTQQAHGNDSMPERLTADTTLENAIRTEFTTTSNS 780
           DELHLCTRYSKILLCLYRELKMDTLSTQQAHGNDSMPERLTADTTLENAIRTEFTTTSNS
Sbjct: 721 DELHLCTRYSKILLCLYRELKMDTLSTQQAHGNDSMPERLTADTTLENAIRTEFTTTSNS 780

Query: 781 GSQVELTPLSNKLATLPIDRNTTPPYASFPTEVVDWFSTSADIGLEFVEPWTEMIEQRYI 840
           GSQVELTPLSNKLATLPIDRNTTPPYASFPTEVVDWFSTSADIGLEFVEPWTEMIEQRYI
Sbjct: 781 GSQVELTPLSNKLATLPIDRNTTPPYASFPTEVVDWFSTSADIGLEFVEPWTEMIEQRYI 840

Query: 841 KSGNTQNKDFDDLLSTIPK 859
           KSGNTQNKDFDDLLSTIPK
Sbjct: 841 KSGNTQNKDFDDLLSTIPK 859

>Kpol_1028.82 s1028 complement(183595..186372) [2778 bp, 925 aa]
           {ON} complement(183595..186372) [2778 nt, 926 aa]
          Length = 925

 Score =  764 bits (1974), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 428/911 (46%), Positives = 558/911 (61%), Gaps = 80/911 (8%)

Query: 3   SKSNRTSSKKWKRSFRACQTCRERKIKCNLGPLDNPHKPPCERCKREQRECIFVEPSRKS 62
           S+ +     KW+RS+RAC  CR RKIKC+LGPLDNPHKPPC RCKREQRECIF  P  K 
Sbjct: 9   SEESGNQGTKWRRSYRACVNCRSRKIKCDLGPLDNPHKPPCVRCKREQRECIF--PVTKR 66

Query: 63  RSLSPKDINY-GDDGDDNKLKFI-------HYQQGDNKGANNKEIQNMALE--DSAWESD 112
           R ++ K  N  G + + + +  I           G + G++ K+  N+  +  DS W+SD
Sbjct: 67  RDVTAKINNMKGSELERSIISSILPDVDKKSLNGGGSAGSDLKQ-NNIRKKPTDSNWQSD 125

Query: 113 VSSMQNALEYLASAAKSVSQ---------------FENH-----KPTSKLSDMVNSYSKD 152
           +S+MQ ALE+LA+A   +S+                EN       P +  S+ V+    +
Sbjct: 126 ISTMQTALEFLANAVGVISKSDTRSLLNLNQNNTLIENEDADDSNPNNDNSEDVSRSDSN 185

Query: 153 DMTQENIIKELFEKTELKNPASSLIAQLSRIRTKPHKKLSDIVYIGDDKLLTEEEARRLI 212
                N I  L          S L+  +  IR KP + LSDI YIG +KLLTE+EAR LI
Sbjct: 186 TPKSRNSIFSLIHDDTASKVISPLMGTIESIRPKPTRNLSDIEYIGPNKLLTEDEARTLI 245

Query: 213 EVFFQKLHPFFPYIPLQLHNPEQLVRYPILLCAVITISARYNNFGDLDLKTRESPDYNIT 272
            VFF  +HP+FPYIPLQLHNP++LVRYPILLCA++T+S+RYN+F ++ +      D NI 
Sbjct: 246 NVFFLTMHPYFPYIPLQLHNPDELVRYPILLCAILTVSSRYNSFNEIFINNEYEKDRNIV 305

Query: 273 IHEKLWMYCQRLISRTIWAEASTRSIGTILAFLLFTEWNPRAIHWNWSDYANDSETINFN 332
           +HEKLW YCQRLIS TIWAEASTRSIGTILAFLLFTEWNPRAIHW WSDY N+ E   F 
Sbjct: 306 VHEKLWFYCQRLISNTIWAEASTRSIGTILAFLLFTEWNPRAIHWTWSDYGNNPELTCFT 365

Query: 333 ELNEFDPINSYKGESITGFEAMRHSDRMAWMLTGSAVRLAQDMKFIDTSNKIFLATHIAE 392
           + NE + ++ +KGE  TGFEAMRHSDRMAWM TGSAVRLAQDM FID + KIF+ATHI+E
Sbjct: 366 KNNE-NNMSEFKGEKTTGFEAMRHSDRMAWMFTGSAVRLAQDMHFIDNNYKIFMATHISE 424

Query: 393 TYNAMXXXXXXXXXXXXXXXXI-----HSKKIDPVKIIDGKKSERYFGNEKYYLEQIFKN 447
           T+NAM                +     H K  D     +G      FGNE+YYLEQI K+
Sbjct: 425 TFNAMNVNQRSTLSDSLSNINLSITRSHGKNNDDE---EGHIFAENFGNEQYYLEQILKH 481

Query: 448 AKDRESSYDLLENI--LRERRNAKAFPDNERDFLNDEYILFYSNPDDATQ---------N 496
            K +E     L+ I   +   N+    D ER++LNDEYIL+Y N +  TQ         +
Sbjct: 482 DKSKEKWIKFLKEINSNKSSENSTVITDAEREYLNDEYILYYQNNNPETQPTWGNHSVTS 541

Query: 497 DELDTPLDFTVIQRAKIELLKIMSIGYETIYLEKGRRYTTANNQKQNLAMLNIFSALIDS 556
             L  PL F    +AKIE+L+IMSI YETIY  K +R    NNQ+QNLA+L+IFS LI+S
Sbjct: 542 TSLPYPLKFASFHKAKIEILRIMSIAYETIYSAKNKRVLAFNNQRQNLAVLSIFSPLIES 601

Query: 557 WYVNYNELLSPEET--LDPVLNASKMGLQSMTQIIENESLICDYYYCQLYIYSLSLQVED 614
           WY N++ LL   E    D      K  +Q ++Q IE ESLI DYYYCQLYIYSL+L+V+ 
Sbjct: 602 WYSNHHGLLKLFECAPCDMSKYKDKNTVQKLSQAIEKESLIGDYYYCQLYIYSLALKVDI 661

Query: 615 XXXXXXXXXXXXXAKYVSIAYSSAKEILNSAKRLQEVRMLKFIPVRWVIRIVRAISFIVK 674
                        AKYV +AY++AKEIL SA R+ ++++L+++PVRWV RI+R+++FIVK
Sbjct: 662 KDNNLNLSEITKSAKYVYMAYNAAKEILTSAVRVNKLKLLRYLPVRWVTRILRSVAFIVK 721

Query: 675 CYVTATDKDSMNYKELNSLLSLSGIPVDESLELIHTAAVLLKESTPDELHLCTRYSKILL 734
           C++  T+ ++    E+N+++ LSGIPVDE+LELI T +V L +++PDELHLC RYS ILL
Sbjct: 722 CFLLLTESETSENSEINAIIRLSGIPVDEALELIETTSVTLNDASPDELHLCKRYSSILL 781

Query: 735 CLYRELKMDTLSTQQAHGNDSMPERLTADTTLENAIRTEFTTTSNSGSQVELTPLSNKLA 794
            + +EL+  T +     G  +  E   AD  + N      ++  NS   +E   ++    
Sbjct: 782 YMCKELRNKTQNLYMNEGVAAKQE--NADVKVGNKSLENLSSIENSQEPIEPFIMNEHPQ 839

Query: 795 T-LPIDRNTT--------------------PPYASFPTEVVDWFSTSADIGLEFVEPWTE 833
           T LPI  NTT                    P   SF  EV+DWFS+SADIGLEFVE WTE
Sbjct: 840 TELPI--NTTEQIAIVGNEHHGIEQTPILNPNSMSFQGEVIDWFSSSADIGLEFVESWTE 897

Query: 834 MIEQRYIKSGN 844
           MIEQ Y++S +
Sbjct: 898 MIEQMYLRSSD 908

>KAFR0E03310 Chr5 complement(656129..658945) [2817 bp, 938 aa] {ON}
           Anc_5.525 YDR421W
          Length = 938

 Score =  705 bits (1819), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 399/926 (43%), Positives = 554/926 (59%), Gaps = 96/926 (10%)

Query: 3   SKSNRTSSKKWKRSFRACQTCRERKIKCNLGPLDNPHKPPCERCKREQRECIFVEPSRK- 61
            KS +T SK W+RS++AC  CR RK+KC+LGP DNPH PPC RCKREQREC+F    +K 
Sbjct: 7   GKSLKTESK-WRRSYKACLNCRARKVKCDLGPYDNPHPPPCVRCKREQRECLFTSRRKKK 65

Query: 62  ----SRSLS----PKDINYGDDGDDNKLKFIHYQQGDNKGA--NNKEIQNMALEDSAWES 111
               S ++S    P  I   DD D      I    G +KGA  +N        + S W+ 
Sbjct: 66  DDVISGTVSLTNVPSAITQEDDNDR-----IQLNSGSSKGALFSNSPKNPNTQDQSKWKY 120

Query: 112 DVSSMQNALEYLASAAKSVSQFENHKPTS---------------KLSDMVNSYSKDDMT- 155
            + SMQN LE+LA+AA SVS+  N + T+               ++ D   S  + D+T 
Sbjct: 121 GLGSMQNTLEFLATAAGSVSKESNRRLTTARHSHQYAKETSEDFRVDDSSPSSERKDITD 180

Query: 156 --QENIIKELFEKTELKNPASSLIAQLSRIRTKPHKKLSDIVYIGDDKLLTEEEARRLIE 213
             ++++I  L ++   +    SLI +LSR+R KP+KKL+DI YIG   LL+E+EAR LI+
Sbjct: 181 TSEQSVIAPLLKECGTQRATVSLIEELSRVRPKPNKKLADIDYIGPSNLLSEQEARELID 240

Query: 214 VFFQKLHPFFPYIPLQLHNPEQLVRYPILLCAVITISARYNNFGDLDLKTRESPDYNITI 273
            +F  +HPFFP IPLQL +P++LV YPILLCA++T+S+RY+ F +      E+   NI +
Sbjct: 241 AYFLTMHPFFPNIPLQLQDPDELVNYPILLCAILTMSSRYHPFSEFGFYNGENNKRNIEV 300

Query: 274 HEKLWMYCQRLISRTIWAEASTRSIGTILAFLLFTEWNPRAIHWNWSDYANDSETINFNE 333
           HE LW YCQRLIS+T+WAEASTRSIGT+LAF++FTEWNPR IHW  +DYAN +E      
Sbjct: 301 HETLWDYCQRLISQTVWAEASTRSIGTVLAFIIFTEWNPRQIHWRRTDYANSAE------ 354

Query: 334 LNEFDPINSYK-GESITGFEAMRHSDRMAWMLTGSAVRLAQDMKFIDTSNKIFLATHIAE 392
             + D  +S K  + +TG  A+R SDRM+WMLTGSAVRLAQDM FI+TS KIF+A+HI++
Sbjct: 355 -KDTDVPHSQKDDDGLTGIGAIRRSDRMSWMLTGSAVRLAQDMGFIETSTKIFVASHISD 413

Query: 393 TYNAMXXXXXXXXXXXXXXXXIHSKKIDPVKIIDGKKSE-RYFGNEKYYLEQIFKNAKDR 451
           T+ +M                  + + +    ID ++++    GNEK+YLEQ+ +N + R
Sbjct: 414 TFASMNMNQRCALSETFSVVGFGAGR-ERASAIDSEQTDVDEVGNEKFYLEQMLQNEESR 472

Query: 452 ESSYDLLENILRERRNAKAFP--DNERDFLNDEYILFYSNPDD--ATQNDELDTPLDFTV 507
           E    +LE  L+   + K  P  D ER+FLNDEY+L+Y+N +D    Q+ +L  PL F+ 
Sbjct: 473 ERWTRVLER-LQHNNDKKNGPLTDLEREFLNDEYVLYYANRNDEMVQQHLQLPFPLKFSF 531

Query: 508 IQRAKIELLKIMSIGYETIYLEKGRRYTTANNQKQNLAMLNIFSALIDSWYVNYNELL-- 565
            QRAKIEL++I+ I Y+TIY +KG+R  T+N+Q  NLA+L I S LI+ WY  Y  LL  
Sbjct: 532 HQRAKIELIRIILIAYDTIYYDKGKRKLTSNDQVHNLAVLGILSPLIEGWYATYRNLLKI 591

Query: 566 SPEETLDPVLNASKMGLQSMTQIIENESLICDYYYCQLYIYSLSLQVEDXXXXXXXXXXX 625
           S  +     +  +K  +  + + I  ES++ DYYYCQLYIYSL+LQV+            
Sbjct: 592 SSGQPYSIEIRKNKRAVHELGEEINRESILSDYYYCQLYIYSLALQVDVKGPKLRINEAT 651

Query: 626 XXAKYVSIAYSSAKEILNSAKRLQEVRMLKFIPVRWVIRIVRAISFIVKCYVTATDKDSM 685
             AKYV +AY +AKEIL S+ R+  ++MLK++PVRWV+RIVRA+SF+VKCY+T T    +
Sbjct: 652 KSAKYVELAYVAAKEILISSTRVHRLKMLKYMPVRWVMRIVRAVSFLVKCYLTLTGGGGV 711

Query: 686 NYKELNSLLSLSGIPVDESLELIHTAAVLLKESTPDELHLCTRYSKILLCLYRELKMDTL 745
              E  ++L L  I +DE++  I  AA++LKE++PDELHLC RYS ILL L +E+ + + 
Sbjct: 712 PNSEAQTILKLCCISLDETIHTIRLAALILKEASPDELHLCVRYSAILLYLCKEMNLKSK 771

Query: 746 STQQ---AHG-------NDSMPERLTADTTLENAIRTEFTTTSNSGSQVELTP----LSN 791
             Q+   +HG       N  M  R T  T   +        + N  S  EL P     +N
Sbjct: 772 RNQKLLVSHGILINESRNRQMGSRRTKATQDSDIDLGSTDDSKNIQSNNELLPNNISTTN 831

Query: 792 KLATLPID----RNTTP--------------------------PYASFPTEVVDWFSTSA 821
            L T   +    R+ TP                           + S P E +DWFS SA
Sbjct: 832 GLTTSLFNTEEMRSETPNQRIPTSAVADNTPNNLDNDGTNNPTNFPSLPDEAIDWFSGSA 891

Query: 822 DIGLEFVEPWTEMIEQRYIKSGNTQN 847
           DIGL+FVEPWTE++EQR+++SG+  N
Sbjct: 892 DIGLDFVEPWTELLEQRFLQSGDGNN 917

>SAKL0G04884g Chr7 (400351..403143) [2793 bp, 930 aa] {ON} similar
           to uniprot|Q04052 Saccharomyces cerevisiae YDR421W ARO80
           Zinc finger transcriptional activator of the Zn2Cys6
           family activates transcription of aromatic amino acid
           catabolic genes in the presence of aromatic amino acids
          Length = 930

 Score =  695 bits (1794), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 394/924 (42%), Positives = 559/924 (60%), Gaps = 109/924 (11%)

Query: 12  KWKRSFRACQTCRERKIKCNLGPLDNPHKPPCERCKREQRECIFVEPSRKSRSLSPKDIN 71
           KW+R+++AC  CR RK+KC+LGP+DNPH PPC RCKRE++ECIF E S K   L   +++
Sbjct: 18  KWRRTYQACLNCRTRKVKCDLGPVDNPHDPPCVRCKRERKECIFTE-SNKRGGLRVANVS 76

Query: 72  YGDDGDDNKLKFIH------YQQGDNKGANNKEIQNM-ALEDSAWESDVSSMQNALEYLA 124
              +   N    +       +Q   ++G+   + +   +++     S++++MQ+ALE+LA
Sbjct: 77  AIAENTANATASMSKAITSVFQGNTSEGSQQPDFKRENSIDPLPINSELTTMQDALEFLA 136

Query: 125 SAAKSVSQFENH--------------KPTSKLSDMVNSYSKDDMTQ---------ENIIK 161
            AA SV++ ++               +  S+    ++S S  D T+         E  I 
Sbjct: 137 KAAGSVAKEDSRDLVDASTKYEELESQSNSRTDTPISSGSAQDSTRNSNSANIPDEACIA 196

Query: 162 ELFEKTELKNPASSLIAQLSRIRTKPHKKLSDIVYIGDDKLLTEEEARRLIEVFFQKLHP 221
            L     L  P   LI +LS +R KP ++L+DI YIG  K+L+EEEA +LI++FF  +HP
Sbjct: 197 PLLRPHGLGRPTIPLIEKLSSVRPKPSRRLTDIEYIGTLKMLSEEEAVKLIDLFFLTMHP 256

Query: 222 FFPYIPLQLHNPEQLVRYPILLCAVITISARYNNFGDLDLKTRESPDYNITIHEKLWMYC 281
           FFP++PLQL NP++L +YPILLCA++TIS+RY++F ++++   ES + N+ IHE+LW+YC
Sbjct: 257 FFPHVPLQLQNPDELAQYPILLCAILTISSRYHSFDEVNMYNGESNNRNVEIHERLWIYC 316

Query: 282 QRLISRTIWAEASTRSIGTILAFLLFTEWNPRAIHWNWSDYANDSETINFNELNEFDPIN 341
           QRLIS+T+WAEASTRSIGT+LAFLLFTEWNPRAIHW WSDYAN+ +    N++++ D  N
Sbjct: 317 QRLISQTVWAEASTRSIGTVLAFLLFTEWNPRAIHWRWSDYANNPD---LNDVSKRDLSN 373

Query: 342 -------------SYKGESITGFEAMRHSDRMAWMLTGSAVRLAQDMKFIDTSNKIFLAT 388
                           G+ +TG  AMR SDRMAWMLTG+AVRLAQDM F++TS+KIF AT
Sbjct: 374 VACSSSSSTACNSQQHGDGLTGLSAMRRSDRMAWMLTGTAVRLAQDMGFMNTSSKIFTAT 433

Query: 389 HIAETYNAMXXXXXXXXXXXXXXXXIHSKKIDPVKIIDGKKSERYFGNEKYYLEQIFKNA 448
           HI+ET+ AM                ++  + D               NE YYL QI K+ 
Sbjct: 434 HISETHTAMNMNQRSILSQSLAEINLNGYEDD-------------VENESYYLGQILKSD 480

Query: 449 KDRESSYDLLENI----LRERRNAKAFPDNERDFLNDEYILFYSNPDDA-------TQND 497
             +E     L+ +     R R N     D ER+F+NDEY+L+YS+ D A       T ND
Sbjct: 481 GSKERWSKFLKKLGSSSTRGRMN-----DIEREFVNDEYVLYYSDKDGAPAHADEYTMND 535

Query: 498 ELDTP---------LDFTVIQRAKIELLKIMSIGYETIYLEKGRRYTTANNQKQNLAMLN 548
           + +           L F+  QRAKIELL+IMSIGYETIY  K + Y  +N+Q  NLA+L+
Sbjct: 536 DKNRKKQIEEEPYNLKFSFGQRAKIELLRIMSIGYETIYRGKLKLY--SNSQYHNLALLS 593

Query: 549 IFSALIDSWYVNYNELLSP--EETLDPVLNASKMGLQSMTQIIENESLICDYYYCQLYIY 606
           I S LI+SWY  Y  +L P      +  + + K  +  +T+ ++ ESLI DYYYCQLYIY
Sbjct: 594 ILSPLIESWYNTYKTILKPCSGAACNTAMCSEKKYIFELTEKVDRESLISDYYYCQLYIY 653

Query: 607 SLSLQVE---DXXXXXXXXXXXXXAKYVSIAYSSAKEILNSAKRLQEVRMLKFIPVRWVI 663
           SL+LQV+                 A+YV +AY++AKEILNSA R+ +++MLK++PVRWV 
Sbjct: 654 SLALQVDVGTPKDKKLRMNEITKCARYVELAYNAAKEILNSAIRVHKLKMLKYMPVRWVT 713

Query: 664 RIVRAISFIVKCYVTATDKDSMNYKELNSLLSLSGIPVDESLELIHTAAVLLKESTPDEL 723
           RIVR+++F+VKCY+T T        E N++L+LS IP +E ++ I  AA+ L+E++PDEL
Sbjct: 714 RIVRSVAFVVKCYLTLTGSGIATNPEANTILTLSVIPTEEIIQTIQRAAITLREASPDEL 773

Query: 724 HLCTRYSKILLCLYRELKMDTLSTQQAHGNDSM---PERLTADTTLENAIRTEFTTTSNS 780
           HLCTRYS IL+ L  E+K+ +    Q     S+   PE+++ +TT     + E T     
Sbjct: 774 HLCTRYSTILMYLCTEMKLRSRPNPQPPVPRSISEQPEQISVETTFNFCGKNE-THEKGQ 832

Query: 781 GSQVELTPLSNKLATLP--------IDRNTTPPYAS---FPTEVVDWFSTSADIGLEFVE 829
           GSQ        ++ +LP        +D   +P  A     PT+VVDWFSTS +IGL+FVE
Sbjct: 833 GSQQRGPLPPPRMNSLPETTNFAFNVDNFFSPQGAQTHHLPTQVVDWFSTSDEIGLDFVE 892

Query: 830 PWTEMIEQRYIKSGNTQNKDFDDL 853
           PWTEMIEQ++I + N  NK F++L
Sbjct: 893 PWTEMIEQQFISNDN--NKTFENL 914

>NCAS0F01070 Chr6 (211085..213799) [2715 bp, 904 aa] {ON} Anc_5.525
           YDR421W
          Length = 904

 Score =  679 bits (1752), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 390/899 (43%), Positives = 547/899 (60%), Gaps = 71/899 (7%)

Query: 2   GSKSNRTSSK--KWKRSFRACQTCRERKIKCNLGPLDNPHKPPCERCKREQRECIFVEPS 59
           G+ +++ SS+  KW+RSFRAC +CR RK+KC+LGPL+NPHKPPC RC+RE + CIF    
Sbjct: 14  GTTASKRSSRDIKWQRSFRACISCRMRKVKCDLGPLENPHKPPCVRCRREGKTCIFSSGG 73

Query: 60  RKSRSLSPKDINYGDDGDDNKLKFIHYQQGDNKGANN-----------KEIQNM--ALED 106
               S +   +N    G +N+  F   ++  +  AN+           K+ +N    L  
Sbjct: 74  NGMSSANLSTMN----GKNNQATFTGIKRALSVDANSTLNSQYHTTKIKKTENTYKRLPR 129

Query: 107 SAWESDVSSMQNALEYLASAAKSV---SQFENHKPTSKLSDMVNSYSKD----------- 152
             W+ +++SMQN+LE+LA AA SV   S  E+ K T+KL+   N  S D           
Sbjct: 130 EKWKLELASMQNSLEFLAKAADSVAHQSNPESFKETAKLAK--NGASNDTSENDTPVQQQ 187

Query: 153 DMTQENIIKELFEKTELKNPASSLIAQLSR---IRTKPHKKLSDIVYIGDDKLLTEEEAR 209
           D   EN +  L   T   N   S + QL +   IR K  + LSD+ +IG  KLL+EEEAR
Sbjct: 188 DSPNENYLTPL---TTPHNSRRSALPQLEKSISIRPKSSQTLSDMEFIGPSKLLSEEEAR 244

Query: 210 RLIEVFFQKLHPFFPYIPLQLHNPEQLVRYPILLCAVITISARYNNFGDLDL--KTRESP 267
            LI++FF  ++PFFP+IPLQL + ++LVRYPILLCA++TIS+RY+ F + D    T    
Sbjct: 245 ELIDLFFLTMNPFFPHIPLQLQDADELVRYPILLCAILTISSRYHPFDEFDGYNGTPGRQ 304

Query: 268 DYNITIHEKLWMYCQRLISRTIWAEASTRSIGTILAFLLFTEWNPRAIHWNWSDYANDSE 327
             NI +HEKLW+YCQRLIS+T+WAEASTRSIGTI AF++FTEWNPRAIHW WSDYAN+ E
Sbjct: 305 KRNIHVHEKLWIYCQRLISQTVWAEASTRSIGTIFAFIIFTEWNPRAIHWKWSDYANNPE 364

Query: 328 TINFNELNEFDPINSYKGESITGFEAMRHSDRMAWMLTGSAVRLAQDMKFIDTSNKIFLA 387
             +  +   F    +   + +TG  A+R SDRMAWMLTG+AVRLAQD+  I+TS K+F+A
Sbjct: 365 QYDMTKRESFSQEPNKDEDGLTGIAAIRRSDRMAWMLTGTAVRLAQDIGAIETSAKVFVA 424

Query: 388 THIAETYNAMXXXXXXXXXXXXXXXXIHSKKIDPVKIIDGKKSERYFGNEKYYLEQIFKN 447
           THI+E+Y A+                 + + +D +  ++G        NE+ YLEQI +N
Sbjct: 425 THISESYTAI-----NMNQGLILSQSFNERNLDGIDNLNG------VDNERLYLEQILQN 473

Query: 448 AKDRESSYDLLENILRERRNAKAF-PDNERDFLNDEYILFYSNPD-DATQNDELDTPLDF 505
            + +     +L+ +  E   ++ +  D ER+FLNDEY L+Y++ D D  Q+ +   PL F
Sbjct: 474 DESKARWNGILKLLDNEVGISEEYLQDVEREFLNDEYTLYYADHDEDTQQHTQQIIPLKF 533

Query: 506 TVIQRAKIELLKIMSIGYETIYLEKGRRYTTANNQKQNLAMLNIFSALIDSWYVNYNELL 565
           T  Q+AK+ELL+I+ +GYETIY EKG +   + +Q+ NLA+LNI + LI+SWY NY  LL
Sbjct: 534 TSTQKAKLELLRILILGYETIYYEKGDQRLVSTDQRHNLAVLNILAPLIESWYNNYRSLL 593

Query: 566 SPEETLDPVLNASKMGLQS--MTQIIENESLICDYYYCQLYIYSLSLQVEDXXXXXXXXX 623
              E     LN  +   ++  M++ I  E++I DYYYCQLYIYSL+LQV+          
Sbjct: 594 EIREGEVLSLNQRRNKRKAFEMSRQINTETMISDYYYCQLYIYSLALQVDVEENKLKLNE 653

Query: 624 XXXXAKYVSIAYSSAKEILNSAKRLQEVRMLKFIPVRWVIRIVRAISFIVKCYVTATDKD 683
               A +V  AY +AKEIL SA R+ ++ MLK++PVRWV+RIVR+++FIVKCY+T T  D
Sbjct: 654 IRRCASFVEKAYIAAKEILESAGRVHKLNMLKYMPVRWVLRIVRSVAFIVKCYLTLTCSD 713

Query: 684 SMNYKELNSLLSLSGIPVDESLELIHTAAVLLKESTPDELHLCTRYSKILLCLYRELKMD 743
                E N++L LS I VDE+++ I TAA+ LKE+ PDELHLCTRYS IL+ L RE+K+ 
Sbjct: 714 LSTNPEANTILRLSAISVDETIQTIQTAAITLKEAAPDELHLCTRYSAILMYLCREMKLR 773

Query: 744 TLSTQQAHGNDSMPERLTADTTLENAIRTEFTTTSNSGSQVELTPLS--NKLATLPIDRN 801
             +    +  ++  +++  + +  + +       SN G+     P S   K  T     +
Sbjct: 774 DKTNNNNNTGENEEQKILIENSNPDGVE---GVASNFGNVPSTLPPSYAQKSTTKEQLSD 830

Query: 802 TTPPYASFPTE-------VVDWFSTSADIGLEFVEPWTEMIEQRYIKSGNTQNKDFDDL 853
                 SF  E       V DWF+   DIGL+FVEPWTEMIEQRY++SG+  N  F++L
Sbjct: 831 DGAHSMSFMDEGPSLSNNVTDWFNVGGDIGLDFVEPWTEMIEQRYLQSGDV-NTSFEEL 888

>Skud_4.695 Chr4 (1233000..1235864) [2865 bp, 954 aa] {ON} YDR421W
           (REAL)
          Length = 954

 Score =  679 bits (1752), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 394/936 (42%), Positives = 527/936 (56%), Gaps = 115/936 (12%)

Query: 12  KWKRSFRACQTCRERKIKCNLGPLDNPHKPPCERCKREQRECIFVEPSRKSRSLSPKDIN 71
           K +R+++AC  CR RK+KC+LGP+DNPH PPC RCKRE ++C F     ++   SP  I 
Sbjct: 17  KRRRTYQACINCRSRKVKCDLGPVDNPHAPPCARCKRELKDCSFSSTRGETNGTSPNMIT 76

Query: 72  YGDDGDDNKLKFIHYQQGDNKGAN---------NKEIQN---MALEDSAWESDVSSMQNA 119
                  +K +    QQ  N+  +          KE  N      E   W+ ++SSMQNA
Sbjct: 77  AASKTFLSKSE----QQIRNRSTSPITADMTLSGKETGNETSFKSEGVKWKFELSSMQNA 132

Query: 120 LEYLASAAKSVSQ------FENHKPT--------------------SKLSDMVNSYSKDD 153
           LE+LA AA +V++       E+   T                     +LS   ++ S   
Sbjct: 133 LEFLAQAAGTVAKEGAKEIIEDKSATPRPLVDPLDTSHQSATDGGLKRLSRGDSAASATC 192

Query: 154 MTQENIIKELFEKTELKNPASSLIAQLSRIRTKPHKKLSDIVYIGDDKLLTEEEARRLIE 213
              EN+   L          S LI ++S +R  P +K+ D  YIG D LLT+EEA  LIE
Sbjct: 193 TPHENVTAMLAASLNANRTTSQLIREISGVRPSPTRKIEDFDYIGPDNLLTKEEAIELIE 252

Query: 214 VFFQKLHPFFPYIPLQLHNPEQLVRYPILLCAVITISARYNNFGDLDLKTRESPDYNITI 273
            FF  +HPFFP IPLQLH+P++L  YPIL CA++T+SARY+ F  L L   E+   +I +
Sbjct: 253 AFFLTMHPFFPNIPLQLHDPKELAEYPILFCAILTVSARYHRFDTLGLYNGENGLRHIEV 312

Query: 274 HEKLWMYCQRLISRTIWAEASTRSIGTILAFLLFTEWNPRAIHWNWSDYANDSETINFNE 333
           H+KLW+YCQ+LIS+TIWAEASTRSIGT+LAF++FTEWNPR+IH+ WSDYAND E  N N 
Sbjct: 313 HDKLWVYCQKLISQTIWAEASTRSIGTVLAFIIFTEWNPRSIHYKWSDYANDPELNNVNV 372

Query: 334 LNEFDPINSYKGESITGFEAMRHSDRMAWMLTGSAVRLAQDMKFIDTSNKIFLATHIAET 393
               +       E +TG  A+R SDRM+WMLTGSAVRLAQDM FI+ S+KIF+ THI+ET
Sbjct: 373 RGSKNICTRKDEEGLTGVGAIRRSDRMSWMLTGSAVRLAQDMGFIENSSKIFIVTHISET 432

Query: 394 YNAMXXXXXXXXXXXXXXXXIHSKKIDPVKIIDGKK-SERYFGNEKYYLEQIFKNAKDRE 452
            +AM                ++ +K D     DGK+ +E YFGNEK+YL++I  N + ++
Sbjct: 433 TSAMNMNQRSLLAESFSVLNLNLEKFDS----DGKENNENYFGNEKFYLDEILPNDEIKK 488

Query: 453 SSYDLLENILRERRNAK-AFPDNERDFLNDEYILFYSNPDDAT---QNDELDTPLDFTVI 508
               + E+      N K    D ER+FLNDEY+L+YSN +D T   QN     PL F+  
Sbjct: 489 RWKGVFEDSADASDNEKYLLTDWEREFLNDEYVLYYSNKNDDTNLAQNHTPPFPLRFSFA 548

Query: 509 QRAKIELLKIMSIGYETIYLEKGRRYTTANNQKQNLAMLNIFSALIDSWYVNYNELLSPE 568
           QRAKIE+++I+SI YETIY EK +R     +Q+ NL++L+IFS L++ W  NY E+L P 
Sbjct: 549 QRAKIEIIRILSIAYETIYCEKNKRKLATTDQRHNLSVLSIFSPLMEGWLSNYREVLVPL 608

Query: 569 ETLDPVLNASKMGLQSMTQI--IENESLICDYYYCQLYIYSLSLQVEDXXXXXXXXXXXX 626
             +   L   K   Q    I  I  ES+I D+ YCQLYI+SL+LQV+             
Sbjct: 609 SDVPFSLADRKNKKQVFDNIDRINGESIITDFNYCQLYIFSLALQVDGKISRLNMNEIVT 668

Query: 627 XAKYVSIAYSSAKEILNSAKRLQEVRMLKFIPVRWVIRIVRAISFIVKCYVTATDKDSMN 686
            A+YV +AY SAKEIL SAKR+    MLKF+PVRWVIRI+R+I+FIVKCY+T T  +   
Sbjct: 669 SARYVELAYRSAKEILGSAKRVSRQAMLKFMPVRWVIRIIRSIAFIVKCYLTLTGSELAT 728

Query: 687 YKELNSLLSLSGIPVDESLELIHTAAVLLKESTPDELHLCTRYSKILLCLYRELKM---- 742
             +  ++L LS I VDE+ +L+   AV LKE+TPDELHLC RY+ IL+ L  E+K+    
Sbjct: 729 NPDARNILKLSAISVDETFDLMRDTAVTLKEATPDELHLCQRYAAILMYLCTEMKLRKSS 788

Query: 743 ----------DTLSTQQAHG----------------------NDS---MPERLTADTTLE 767
                      T   +  HG                       DS    PE+L  D   +
Sbjct: 789 HLERPSLLRSSTTPLESNHGFSLEGVDVTKKSTFYRDIGGNKTDSKFETPEKLPVDEIGD 848

Query: 768 N----------AIRTEFTTTSNSGSQVELTPLSNKLATLPIDRNTTPPYASFPTEVVDWF 817
           N          AI   F   +N    +    L+N+L   P          S   EV DWF
Sbjct: 849 NLNNSNDLSGKAIVNSFVEQNN---DITAALLNNELFQGP----------SLSEEVTDWF 895

Query: 818 STSADIGLEFVEPWTEMIEQRYIKSGNTQNKDFDDL 853
             S DIGLEFVEPWTE+IEQRY++ G+  N +F++L
Sbjct: 896 GASEDIGLEFVEPWTELIEQRYMQCGDGDNNNFENL 931

>YDR421W Chr4 (1312040..1314892) [2853 bp, 950 aa] {ON}  ARO80Zinc
           finger transcriptional activator of the Zn2Cys6 family;
           activates transcription of aromatic amino acid catabolic
           genes in the presence of aromatic amino acids
          Length = 950

 Score =  677 bits (1747), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 387/918 (42%), Positives = 528/918 (57%), Gaps = 83/918 (9%)

Query: 12  KWKRSFRACQTCRERKIKCNLGPLDNPHKPPCERCKREQRECIFVEPSRKSRSLSPKDIN 71
           K +R+++AC +CR RK+KC+LGP+DNPH PPC RCKRE ++CIF      S  L P  IN
Sbjct: 17  KRRRTYQACISCRSRKVKCDLGPVDNPHDPPCARCKRELKKCIFSSNKGTSNDLPPNSIN 76

Query: 72  Y----------GDDGDDNKLKFIHYQQGDNKGANNKEIQNMALEDSAWESDVSSMQNALE 121
                       +  +D+    +       KG +++  ++   E   W+ ++SSMQNALE
Sbjct: 77  AISLPSLGKSKQEIQNDSTSPILSDVPLSRKGISSE--KSFKSEGMKWKLELSSMQNALE 134

Query: 122 YLASAAKSVSQ----------FENHKPTSKLSDMVNSYSKDD----MTQENIIKELFEKT 167
           +LA AA +V++              KP     D  N  + D+    +++ +    L+E T
Sbjct: 135 FLAQAAGTVAKEGAKEIIKEKSTTPKPLKSSLDATNKSATDEGLKRLSKSDSTNTLYENT 194

Query: 168 --------ELKNPASSLIAQLSRIRTKPHKKLSDIVYIGDDKLLTEEEARRLIEVFFQKL 219
                         S L+ ++ ++R  P +K+ D  YIG D LLT+EEA  LIE FF  +
Sbjct: 195 ADMLNHTLNTNRKTSQLMEEIGKVRPPPTRKIDDFDYIGPDSLLTKEEAIELIEAFFLTM 254

Query: 220 HPFFPYIPLQLHNPEQLVRYPILLCAVITISARYNNFGDLDLKTRESPDYNITIHEKLWM 279
           HPFFP IPLQLH+P++L  YPIL CA++T+SARY+ F  L L   E    +I +H+KLW+
Sbjct: 255 HPFFPNIPLQLHDPKELAEYPILFCAILTVSARYHPFDTLGLDNGEDGMRHIEVHDKLWV 314

Query: 280 YCQRLISRTIWAEASTRSIGTILAFLLFTEWNPRAIHWNWSDYANDSETINFNELNEFDP 339
           YCQ+LIS+TIWAEASTRSIGT+LAF++FTEWNPR+IH+ WSDYAND E  N N     + 
Sbjct: 315 YCQKLISQTIWAEASTRSIGTVLAFIIFTEWNPRSIHYKWSDYANDPELNNVNARGSKNI 374

Query: 340 INSYKGESITGFEAMRHSDRMAWMLTGSAVRLAQDMKFIDTSNKIFLATHIAETYNAMXX 399
                 E +TG  A+R SDRM+WMLTGSAVRLAQDM FI+ S+K+F+ THI+ET +AM  
Sbjct: 375 STRKDEEGLTGVGAIRRSDRMSWMLTGSAVRLAQDMGFIENSSKVFIVTHISETTSAMNM 434

Query: 400 XXXXXXXXXXXXXXIHSKKIDPVKIIDGKKS-ERYFGNEKYYLEQIFKNAKDRESSYDLL 458
                         ++  KI+     DG +S E Y GNEK+YL +I  + + +     + 
Sbjct: 435 NQRSLLAESFSVLNLNLGKIEN----DGNESNEDYLGNEKFYLNEILPDEESKLRWKRVF 490

Query: 459 ENILRERRNAKAF-PDNERDFLNDEYILFYSNPDDAT---QNDELDTPLDFTVIQRAKIE 514
           EN   +  N K F  D ER+FLNDEY+L+YSN  D T   QN     PL F+  QRAKIE
Sbjct: 491 ENSENDHDNEKNFLTDWEREFLNDEYVLYYSNKKDDTNLAQNHIPPFPLRFSFAQRAKIE 550

Query: 515 LLKIMSIGYETIYLEKGRRYTTANNQKQNLAMLNIFSALIDSWYVNYNELLSPEETLDPV 574
           +++I+SI YETIY EK +R     +Q+ NL++L++FS LI+ W  NY ELL P   +   
Sbjct: 551 IIRILSIAYETIYCEKNKRKLATTDQRHNLSVLSVFSPLIEGWLSNYRELLVPLSDVPFS 610

Query: 575 LNASKMGLQSMTQI--IENESLICDYYYCQLYIYSLSLQVEDXXXXXXXXXXXXXAKYVS 632
           L   K   Q    I  I  ES+I D+ YCQLYI+SL+LQV+              A+YV 
Sbjct: 611 LADRKNKKQIFDNIDRINGESIITDFNYCQLYIFSLALQVDGKTSRLNMNEIVTSARYVE 670

Query: 633 IAYSSAKEILNSAKRLQEVRMLKFIPVRWVIRIVRAISFIVKCYVTATDKDSMNYKELNS 692
           +AY SAKEIL+SAKR+    MLK++PVRWVIRI+R+I+FIVKCY+T T  +     +  +
Sbjct: 671 LAYRSAKEILSSAKRVSRQGMLKYMPVRWVIRIIRSIAFIVKCYLTLTGSELATNPDARN 730

Query: 693 LLSLSGIPVDESLELIHTAAVLLKESTPDELHLCTRYSKILLCLYRELKM---------- 742
           +L LS I VDE+ ++I   AV LKE+TPDELHLC RY+ IL+ L  E+K+          
Sbjct: 731 ILKLSAISVDETFDIIRDTAVTLKEATPDELHLCQRYAAILMYLCTEMKLRKKSYLERPP 790

Query: 743 --------------DTLSTQQAHGNDSMPERLT---ADTTLENAIRTEFTTTSNSGSQVE 785
                          +L  Q         +R+     +TT E + R   T   NS SQ  
Sbjct: 791 LLRDGTTPLESNRESSLEGQDLTKKPIFSKRIGYNKTETTFEPSERP-LTEEINSNSQNS 849

Query: 786 LTPLSNKLATLPIDRNTTPPYA----------SFPTEVVDWFSTSADIGLEFVEPWTEMI 835
               S  +    +++N     A          S   EV DWF  S DIGLEFVEPWTE+I
Sbjct: 850 NDTSSKGIVDPFVEQNNDITTALLNNELFQGPSLSDEVTDWFGASEDIGLEFVEPWTELI 909

Query: 836 EQRYIKSGNTQNKDFDDL 853
           EQRY++ G+  N +F++L
Sbjct: 910 EQRYMQCGDGDNNNFENL 927

>TDEL0A03890 Chr1 (695880..698375) [2496 bp, 831 aa] {ON} Anc_5.525
           YDR421W
          Length = 831

 Score =  671 bits (1732), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 377/867 (43%), Positives = 532/867 (61%), Gaps = 75/867 (8%)

Query: 4   KSNRTSSKKWKRSFRACQTCRERKIKCNLGPLDNPHKPPCERCKREQRECIFVEPSRKSR 63
           +SN+ +  KW+RS++AC  CR RKIKC++GPLD PH+PPC+RCKRE + C F++  +KS 
Sbjct: 8   RSNKDT--KWRRSYKACLNCRLRKIKCDMGPLDKPHEPPCKRCKREGKTCEFLQSRKKSV 65

Query: 64  SLSPKDINYGDDGDDNKLKFIHYQQGDNKGANNK-EIQNMALEDSAWESDVSSMQNALEY 122
                  N  +  D+ +   +   + D  G +++ E  +    D  W  ++SSMQNALE+
Sbjct: 66  FKRQHRTNGLELQDEVEKHVVITHEVDVGGPSDRIERHSRNKIDGKWRFEISSMQNALEF 125

Query: 123 LASAAKSVSQFENHKPTSKLSDMVNSYSKDDMTQENIIKELFEKTEL------------K 170
           LA AA SV++ +N     K  D  +  S+DD + +++    FE +               
Sbjct: 126 LAKAAGSVAKEDNQLHEIKQID-PSQVSRDDSSWKDLTPTSFEASRAGIMAPLEADEGSS 184

Query: 171 NPASSLIAQLSRIRTKPHKKLSDIVYIGDDKLLTEEEARRLIEVFFQKLHPFFPYIPLQL 230
             A  LI +LS +R KP  KLS++ +IG    LTEEE  +L++VFF  ++PFFP+IPLQL
Sbjct: 185 RKAVPLIKKLSSVRPKPCIKLSNLEFIGGSDQLTEEEVIKLVDVFFLTMYPFFPHIPLQL 244

Query: 231 HNPEQLVRYPILLCAVITISARYNNFGDLDLKTRESPDYNITIHEKLWMYCQRLISRTIW 290
            +PE+L RYP+LLC+++T+SARY++F D+ LK     + NI +HE+LW+YCQ+LIS+TIW
Sbjct: 245 QDPEELARYPLLLCSIVTVSARYHSFCDIGLKDNMQNNRNIEVHEQLWIYCQKLISQTIW 304

Query: 291 AEASTRSIGTILAFLLFTEWNPRAIHWNWSDYANDSETINFNELNEFDPINSYKGESITG 350
           AEASTRSIGT+LAFLLFTEWNPRAIHW WSDYAN  ++ + +  N+F    S   E +TG
Sbjct: 305 AEASTRSIGTVLAFLLFTEWNPRAIHWKWSDYANSGDSKDRS--NDFSI--SRDSERLTG 360

Query: 351 FEAMRHSDRMAWMLTGSAVRLAQDMKFIDTSNKIFLATHIAETYNAMXXXXXXXXXXXXX 410
             A+R SDRMAWMLTG+AVRLAQDM F +TS+KIF ATHI+ET+ AM             
Sbjct: 361 MAAIRRSDRMAWMLTGNAVRLAQDMGFNETSSKIFTATHISETHTAMNVGQRSTLTESLN 420

Query: 411 XXXIHSKKIDPVKIIDGKKSERYFGNEKYYLEQIFKNAKDRESSYDLLENILRERRNAKA 470
              + S K                GNE++YLE+I +N   ++     L +I  +  +   
Sbjct: 421 EINLGSIKF---------PRNNSVGNEQFYLEKILENDDSKDRWTRFLHDIRDDYAHHDE 471

Query: 471 FP--DNERDFLNDEYILFYSNPDDATQNDE---LDTPLDFTVIQRAKIELLKIMSIGYET 525
            P  D ER+FLNDEY+L+Y+   D+   D    L  PL F+ IQRAKIELL+I+++G+E 
Sbjct: 472 GPLTDIEREFLNDEYVLYYTADGDSKHRDSSNLLPFPLRFSKIQRAKIELLRIITVGFEA 531

Query: 526 IYLEKGRRYTTANNQKQNLAMLNIFSALIDSWYVNYNELLSPEE----TLDPVLNASKMG 581
           IY  K ++ +  N+  +NL++L++ S LI+SWY +Y++LL P E    T+D  L  +K  
Sbjct: 532 IYCTKDKQQSLFNDPTRNLSLLHLISPLIESWYKSYHDLLEPAEGKPCTVD--LCRNKRE 589

Query: 582 LQSMTQIIENESLICDYYYCQLYIYSLSLQVEDXXXXXXXXXXXXXAKYVSIAYSSAKEI 641
           +  + + I+ ESLIC+YYYCQLYIYS +LQV+              AKYV +AY++AK +
Sbjct: 590 VHYVVRKIDRESLICEYYYCQLYIYSSALQVDVKEGQLKLHEITRSAKYVELAYNAAKML 649

Query: 642 LNSAKRLQEVRMLKFIPVRWVIRIVRAISFIVKCYVTATDKDSMNYKELNSLLSLSGIPV 701
           L SA RL  + +LK +PVRWV RIV++++FIVKCY+T      +N    N++L L+ IP 
Sbjct: 650 LTSATRLHRLNLLKCMPVRWVTRIVKSVAFIVKCYLTLMGNAVVNNPLANTILKLTVIPA 709

Query: 702 DESLELIHTAAVLLKESTPDELHLCTRYSKILLCLYRELKMDTLSTQQAHGNDSMPERLT 761
           ++ L+ IHTAA++LKE++PDELHLC RYS IL+ L  E++            D   +  T
Sbjct: 710 EDILKTIHTAALILKEASPDELHLCMRYSTILMSLCSEMR---------ESEDYTTDSPT 760

Query: 762 ADTTLENAIRTEFTTTSNSGSQVELTPLSNKLATLPIDRNTTPPYASFPTEVVDWFSTSA 821
             TT               G   + +P+       P+D  T  P    P +VVDWFSTS 
Sbjct: 761 PGTTF--------------GQDNDPSPIQ------PLD--TAIP---LPNDVVDWFSTSD 795

Query: 822 DIGLEFVEPWTEMIEQRYIK-SGNTQN 847
           +IGLEFVE W EMIEQRY++ S  +QN
Sbjct: 796 EIGLEFVESWAEMIEQRYLQGSSYSQN 822

>Suva_2.598 Chr2 (1064757..1067654) [2898 bp, 965 aa] {ON} YDR421W
           (REAL)
          Length = 965

 Score =  671 bits (1731), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 384/930 (41%), Positives = 530/930 (56%), Gaps = 82/930 (8%)

Query: 2   GSKSNRTSS-KKWKRSFRACQTCRERKIKCNLGPLDNPHKPPCERCKREQRECIFVEPSR 60
           GS  N   +  K +R+++AC  CR RK+KC+LGP+DNPH PPC RCKRE + C+F     
Sbjct: 17  GSSENTVPTFPKRRRTYQACINCRSRKVKCDLGPVDNPHAPPCARCKRELKRCLFSSNRE 76

Query: 61  KSRSLSPKDINY--------GDDGDDNKLKFIHYQQGDNKGANNKEIQNMALEDSAWESD 112
              +LSP  IN          + G  N L           G N         E   W+ +
Sbjct: 77  AMHTLSPSMINITSKSASSKSEQGVPNDLMSSTPSDMPLSGKNTDNETLFKSEGMKWKLE 136

Query: 113 VSSMQNALEYLASAAKSVSQ----------------FENH-----KPTS-----KLSDMV 146
           +SSMQN LE+LA AA +V++                F N      +P++      LS  +
Sbjct: 137 LSSMQNTLEFLAQAAGTVAKEGAKEIIKDESTTTTPFVNSLHSSCQPSTDEGLKPLSRSL 196

Query: 147 NSYSKDDMTQENIIKELFEKTELKNPASSLIAQLSRIRTKPHKKLSDIVYIGDDKLLTEE 206
           ++ S  +   EN+   L          S LI ++ ++R  P +K+ D  YIG   LLT+E
Sbjct: 197 SAASDTNTPIENLTVALATTLNANRTTSQLIEEIGKVRPIPTRKIEDFEYIGPANLLTKE 256

Query: 207 EARRLIEVFFQKLHPFFPYIPLQLHNPEQLVRYPILLCAVITISARYNNFGDLDLKTRES 266
           EA  LIE FF  +HPFFP IP QLH+P++L +YPIL CA++T+SARY+ F  L L   E+
Sbjct: 257 EAIELIEAFFLTMHPFFPNIPFQLHDPKELAQYPILFCAILTVSARYHPFDTLGLDNGEN 316

Query: 267 PDYNITIHEKLWMYCQRLISRTIWAEASTRSIGTILAFLLFTEWNPRAIHWNWSDYANDS 326
              ++ +H+KLW+YCQ+LIS+TIWAEASTRSIGT+LAF++FTEWNPR+IH  WSDYAND 
Sbjct: 317 GTRHVEVHDKLWVYCQKLISQTIWAEASTRSIGTVLAFIIFTEWNPRSIHCKWSDYANDP 376

Query: 327 ETINFNELNEFDPINSYKG-ESITGFEAMRHSDRMAWMLTGSAVRLAQDMKFIDTSNKIF 385
           E  N N +     IN+ +  E +TG  A+R SDRM+WMLTGSAVRLAQDM FI+ S++IF
Sbjct: 377 ELNNVN-VRGGKHINTRRDEEGLTGVGAIRRSDRMSWMLTGSAVRLAQDMGFIENSSRIF 435

Query: 386 LATHIAETYNAMXXXXXXXXXXXXXXXXIHSKKIDPVKIIDGKKSERYFGNEKYYLEQIF 445
           + THI+ET +AM                ++  +         + +E Y GNE++YL++I 
Sbjct: 436 IVTHISETTSAMNMNQRSVLAESFSVLNLNLGRF---DNDGNENNENYLGNERFYLDEIL 492

Query: 446 KNAKDRESSYDLLENILRERRNAKA-FPDNERDFLNDEYILFYSNPDDAT---QNDELDT 501
            N + +E    +LEN+  +  N K    D ER+FLNDEY+L+YSN  D T   QN     
Sbjct: 493 PNDESKERWKKVLENLEADSDNEKCVLTDWEREFLNDEYVLYYSNKKDDTNLAQNHMPPF 552

Query: 502 PLDFTVIQRAKIELLKIMSIGYETIYLEKGRRYTTANNQKQNLAMLNIFSALIDSWYVNY 561
           PL F+  QRAKIE+++I+SI YETIY EK +R     +Q+ NL++L++FS L++ W  NY
Sbjct: 553 PLRFSFAQRAKIEIIRILSIAYETIYCEKNKRKLATTDQRHNLSVLSVFSPLMEGWLSNY 612

Query: 562 NELLSPEETLDPVLNASKMGLQSMTQI--IENESLICDYYYCQLYIYSLSLQVEDXXXXX 619
            E+L P   +   L   K   Q +  I  I  ES+I D+ YCQLYI+SL+LQV+      
Sbjct: 613 REVLVPLSDVPFSLADRKNKRQVLNNIDRINGESIITDFNYCQLYIFSLALQVDGKISRL 672

Query: 620 XXXXXXXXAKYVSIAYSSAKEILNSAKRLQEVRMLKFIPVRWVIRIVRAISFIVKCYVTA 679
                   AKYV +AY SAKEIL+SAKR+    MLK++PVRWVIRI+R+I+FIVKCY+T 
Sbjct: 673 NMSEIVKSAKYVELAYKSAKEILSSAKRVSRQCMLKYMPVRWVIRIIRSIAFIVKCYLTL 732

Query: 680 TDKDSMNYKELNSLLSLSGIPVDESLELIHTAAVLLKESTPDELHLCTRYSKILLCLYRE 739
           T  +     +  ++L LS I VDE+ +LI   AV LKE+TPDELHLC RY+ IL+ L  E
Sbjct: 733 TGSEIATNPDARNILKLSAISVDETFDLIRDTAVTLKEATPDELHLCQRYAAILMYLCTE 792

Query: 740 LKM---DTLSTQQAHGNDSMPERLTADTTLENAIRTEF----TTTSNSGSQVELTPLSNK 792
           +K+     L           P + + ++ LE A   +      T   S ++    P+   
Sbjct: 793 MKLRKKSHLERPPTSRTGIAPLKSSDESPLEGANLVKGPTFDKTAGTSNAECIFDPVGKT 852

Query: 793 LA---TLPIDRNTTPPY--------------------------ASFPTEVVDWFSTSADI 823
            A   +  ++ +T  P+                           S   EV DWFS S DI
Sbjct: 853 SAEETSNNLNNSTELPFKTGLNSFVEQTNDITAMLLNNELIQGPSLSEEVTDWFSASEDI 912

Query: 824 GLEFVEPWTEMIEQRYIKSGNTQNKDFDDL 853
           GLEFVEPWTE+IEQRY++ G+  N +F++L
Sbjct: 913 GLEFVEPWTELIEQRYMQCGDGDNNNFENL 942

>NDAI0H01580 Chr8 (382179..384908) [2730 bp, 909 aa] {ON} Anc_5.525
           YDR421W
          Length = 909

 Score =  667 bits (1722), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 379/908 (41%), Positives = 534/908 (58%), Gaps = 74/908 (8%)

Query: 7   RTSSKKWKRSFRACQTCRERKIKCNLGPLDNPHKPPCERCKREQRECIFVEPSRKSRSLS 66
           R  + KWKR ++AC  C+ RK+KC++GPL+NPH PPC RC+RE + C+F+    +   L 
Sbjct: 14  RAPNYKWKRGYKACTNCKLRKVKCDMGPLENPHDPPCARCRREGKTCVFLTTKGRKADLG 73

Query: 67  PKDI---------NYGDDGDDNKLKFIHYQQGDNKGANNKEIQNMALEDSAWESDVSSMQ 117
              I         N G+     +L        +      K   +  +  + W+  ++SMQ
Sbjct: 74  TSKIPSTTPTLKPNSGNSVSKKRLDSSTDLVNEVPVKIPKTSPSNPISPTKWKIGLTSMQ 133

Query: 118 NALEYLASAAKSV---SQFENHKPTSKLSDMVNSYSKDDMTQENIIK----------ELF 164
           N+LE+LA AA +V   S    H    +L+  V   +     +E+++            + 
Sbjct: 134 NSLEFLAKAAGNVGFLSAPSAHSAREELNSAVVPKATSLPQEESLMNMTSSLHSDLLNIS 193

Query: 165 EKTELKNPASSLIAQLSRIRTKPHKKLSDIVYIGDDKLLTEEEARRLIEVFFQKLHPFFP 224
              +L++ +  LI +L+ +R  P +KL+DI YIG ++LL+E +A  LI++FF  + PFFP
Sbjct: 194 PIGKLQHKSLPLIDKLNIVRPTPRRKLTDIDYIGPNRLLSESDAIELIDLFFLTMFPFFP 253

Query: 225 YIPLQLHNPEQLVRYPILLCAVITISARYNNF---GDLDLKTRESPDYNITIHEKLWMYC 281
            IPLQL NP++L +YPILLCA++TIS+RY++F    D     + +   +I +HEKLW+YC
Sbjct: 254 NIPLQLQNPKELAQYPILLCAILTISSRYHSFDTFADSINNGQNNKRRHIDVHEKLWIYC 313

Query: 282 QRLISRTIWAEASTRSIGTILAFLLFTEWNPRAIHWNWSDYANDSETINFNELNEFDPIN 341
           QRLIS+TIWAEASTRSIGTILAF++FTEWNPRAIHWNWSDYA+D    + ++ N    I 
Sbjct: 314 QRLISQTIWAEASTRSIGTILAFIIFTEWNPRAIHWNWSDYASDPALNDISKRNMEPQII 373

Query: 342 SYKGESITGFEAMRHSDRMAWMLTGSAVRLAQDMKFIDTSNKIFLATHIAETYNAMXXXX 401
             + E +TG +A+R SDRMAWML+G+AVRLAQD   I T+ K+ +ATHI++T+ AM    
Sbjct: 374 KREEEGLTGIDAIRRSDRMAWMLSGTAVRLAQDTGLIRTNTKVAIATHISDTHTAMNMNQ 433

Query: 402 XXXXXXXXXXXXIHSKKIDPVKIIDGKKSERYFG-------NEKYYLEQIFKNAKDRESS 454
                        HS   D     D     RY G       NE +YL QI +N + +E  
Sbjct: 434 RSALS--------HSFNSD---FFDHLSKSRYIGKDSTQVVNENFYLTQILQNKESKERW 482

Query: 455 YDLLENILRE-RRNAKAFPDNERDFLNDEYILFYSNPD-DATQNDELDTPLDFTVIQRAK 512
             +     ++         D E +FLNDEY L++S  D D++Q   L  PL FT +QRAK
Sbjct: 483 KKISATFQKDNEETVGQLSDMEYEFLNDEYALYFSKEDNDSSQRPPL--PLKFTFVQRAK 540

Query: 513 IELLKIMSIGYETIYLEKGRRYTTANNQKQNLAMLNIFSALIDSWYVNYNELLSPEET-- 570
           +ELL+I+++GYETIY E G +   +++Q++NLA+LNI S LIDSWY NYN LL  +    
Sbjct: 541 LELLRIVTLGYETIYYENGEQRLVSDDQRRNLAVLNILSPLIDSWYSNYNSLLKTDAVRP 600

Query: 571 LDPVLNASKMGLQSMTQIIENESLICDYYYCQLYIYSLSLQVEDXXXXXXXXXXXXXAKY 630
           + P ++  K     M+Q I  E++I DYYYCQLYI+SL+LQV+              A Y
Sbjct: 601 VSPGMHKRKQEAFKMSQNISGETMISDYYYCQLYIFSLALQVDVGQNKLKLNEITRCAIY 660

Query: 631 VSIAYSSAKEILNSAKRLQEVRMLKFIPVRWVIRIVRAISFIVKCYVTATDKDSMNYKEL 690
           V  AY +AKEIL SA R+ +++MLK++PV+WV+RIVR+++FIVKCY+T T     +  E 
Sbjct: 661 VEKAYVAAKEILESAGRVHKLKMLKYMPVKWVMRIVRSVAFIVKCYLTLTSGSFSSNPEA 720

Query: 691 NSLLSLSGIPVDESLELIHTAAVLLKESTPDELHLCTRYSKILLCLYRELKMDTLSTQQA 750
            ++LSLS I VDE+++ I   A++LKE+ PDELHL TRYS ILL L RE+K    S+QQ+
Sbjct: 721 RTILSLSAISVDETIQTIQDTAIILKEAAPDELHLSTRYSAILLYLCREMKSKHESSQQS 780

Query: 751 HGNDS--------------------MPERLTADTTLENAIRTEFTTTSNSGSQVELTPLS 790
            G DS                    M E +   +  E A +   T+  N   Q+    L 
Sbjct: 781 KGYDSKSSSNAPLSDDVITNQSGDKMSEDILLKSHAEVAAKDPRTSQENIELQMNKPNLD 840

Query: 791 NKLATLPIDRN-TTPPYASFPTEVVDWFSTSADIGLEFVEPWTEMIEQRYIKSGNTQNKD 849
            K A+   D + TT      P +V +WF+TS +IGLEFVEPWTEMIEQ Y++SG+  N  
Sbjct: 841 GKFAS---DMDFTTDNLNELPGDVANWFTTSGNIGLEFVEPWTEMIEQMYLQSGDA-NTT 896

Query: 850 FDDLLSTI 857
           FDDL   I
Sbjct: 897 FDDLYKEI 904

>Smik_4.696 Chr4 (1232828..1235677) [2850 bp, 949 aa] {ON} YDR421W
           (REAL)
          Length = 949

 Score =  665 bits (1717), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 387/927 (41%), Positives = 531/927 (57%), Gaps = 84/927 (9%)

Query: 3   SKSNRTSSKKWKRSFRACQTCRERKIKCNLGPLDNPHKPPCERCKREQRECIFVEPSRKS 62
           S++  ++  K +R+++AC  CR RK+KC+LGP+DNPH+PPC RCKRE REC+F       
Sbjct: 8   SENTTSALPKRRRTYQACINCRSRKVKCDLGPVDNPHEPPCARCKRELRECLFSSQKVVK 67

Query: 63  RSLSPKDINY-----GDDGDDNKLKFIHYQQGDNKGANNKEIQNMALEDSAWESDVSSMQ 117
            S SP  +N      G+  + ++           KG N++ +     +   W+ ++SSMQ
Sbjct: 68  NSTSPHMVNTICQSKGEIPNHSRRLISSEMALSEKGTNDETL--FKSDGVKWKLELSSMQ 125

Query: 118 NALEYLASAAKSVSQFENHKPTSK---------------------------LSDMVNSYS 150
           NALE+LA AA +V++ E  K T K                           LS      S
Sbjct: 126 NALEFLAQAAGTVAK-EGAKETIKDRSATPRPSESSLDTPHQSAANKELKTLSISECDAS 184

Query: 151 KDDMTQENIIKELFEKTELKNPASSLIAQLSRIRTKPHKKLSDIVYIGDDKLLTEEEARR 210
             +   ENI   L          S LI ++SR R  P +++ D  YIG D LLT+EEA  
Sbjct: 185 ATNTPHENITDTLAAALNSNQKMSQLIKEISRARPMPTRRIDDFEYIGPDNLLTKEEAIE 244

Query: 211 LIEVFFQKLHPFFPYIPLQLHNPEQLVRYPILLCAVITISARYNNFGDLDLKTRESPDYN 270
           LIE FF  +HPFFP IPLQLH+P++L  YPIL C+++T+SARY+ F  L L   E+   +
Sbjct: 245 LIEAFFLTMHPFFPNIPLQLHDPKELAEYPILFCSILTVSARYHPFDTLGLDNGENGIRH 304

Query: 271 ITIHEKLWMYCQRLISRTIWAEASTRSIGTILAFLLFTEWNPRAIHWNWSDYANDSETIN 330
           I +H+KLW+YCQ+LIS+TIWAEASTRSIGT+LAF++FTEWNPR+IH+ WSDYAND E  N
Sbjct: 305 IEVHDKLWIYCQKLISQTIWAEASTRSIGTVLAFIIFTEWNPRSIHYKWSDYANDPELNN 364

Query: 331 FNELNEFDPINSYKG-ESITGFEAMRHSDRMAWMLTGSAVRLAQDMKFIDTSNKIFLATH 389
              + E   I++ K  E +TG  A+R SDRM+WMLTGSAVRLAQDM FI+ S+KIF+ TH
Sbjct: 365 VG-VRESKNISTKKDEEGLTGVGAIRRSDRMSWMLTGSAVRLAQDMGFIENSSKIFIVTH 423

Query: 390 IAETYNAMXXXXXXXXXXXXXXXXIHSKKIDPVKIIDGKKS-ERYFGNEKYYLEQIFKNA 448
           I+ET +AM                ++ +K D     DG K  E Y GNEK+YL +I  + 
Sbjct: 424 ISETTSAMNMNQRPLLAESFSVLNLNVRKFDD----DGNKGNENYLGNEKFYLNEILPDD 479

Query: 449 KDRESSYDLL-ENILRERRNAKAFPDNERDFLNDEYILFYSNPDDAT---QNDELDTPLD 504
           + ++    +  ++   +        D ER+FLNDEY+L+YSN  D T   QN    +PL 
Sbjct: 480 ESKKRWKKVFKDSEDDDDSEKNILTDWEREFLNDEYVLYYSNKKDDTNLAQNPMPPSPLR 539

Query: 505 FTVIQRAKIELLKIMSIGYETIYLEKGRRYTTANNQKQNLAMLNIFSALIDSWYVNYNEL 564
           F+  QRAKIE+++I+SI YETIY EK +R     +Q+ NL++L++FS LI+ W  NY E+
Sbjct: 540 FSFAQRAKIEIIRILSIAYETIYCEKNKRKLATTDQRHNLSVLSVFSPLIEGWLSNYREV 599

Query: 565 LSPEETLDPVLNASKMGLQSMTQI--IENESLICDYYYCQLYIYSLSLQVEDXXXXXXXX 622
           L P   +  +L   K   Q    I  +  E++I D+ YCQLYI+SL+LQV+         
Sbjct: 600 LVPISDVSFLLADRKNKKQVFDNINRLNGETIITDFNYCQLYIFSLALQVDGKTSRLNMN 659

Query: 623 XXXXXAKYVSIAYSSAKEILNSAKRLQEVRMLKFIPVRWVIRIVRAISFIVKCYVTATDK 682
                A+YV +AY SAKEIL+SAKR+    MLK++PVRW IRI+R+I+FIVKCY+T T  
Sbjct: 660 EIMTSARYVELAYRSAKEILSSAKRVSRQGMLKYMPVRWAIRIIRSIAFIVKCYLTLTGS 719

Query: 683 DSMNYKELNSLLSLSGIPVDESLELIHTAAVLLKESTPDELHLCTRYSKILLCLYRELK- 741
           +     +  ++L LS I VDE+ ++I   AV LKE+TPDELHLC RY+ IL+ L  E+K 
Sbjct: 720 ELATNPDARNILKLSAISVDETFDIIRDTAVTLKEATPDELHLCQRYAAILMYLCTEMKL 779

Query: 742 ----------MDTLSTQQAHGN-DSMPERL--TADTTLENAIRT---EFTTTSNSGSQVE 785
                     + T  T     N +S PE +  T   T    IR+   E  + S+  S +E
Sbjct: 780 RKKSYTERPPLSTNGTTPLESNCESSPEGVDFTKKPTFPKNIRSNKAECNSESSKKSPME 839

Query: 786 -----------------LTPL--SNKLATLPIDRNTTPPYASFPTEVVDWFSTSADIGLE 826
                              P    N   T  +  N      S   EV DWF  S DIGL 
Sbjct: 840 EIDSNLNNPNNLSSKVIFNPFVEQNNDTTTTLLNNELFQGPSLSEEVTDWFGASEDIGLG 899

Query: 827 FVEPWTEMIEQRYIKSGNTQNKDFDDL 853
           FVEPWTE+IEQRY++ G+    +F++L
Sbjct: 900 FVEPWTELIEQRYMQCGDGDINNFENL 926

>ZYRO0D12518g Chr4 (1055521..1058166) [2646 bp, 881 aa] {ON} similar
           to uniprot|Q04052 Saccharomyces cerevisiae YDR421W ARO80
           Zinc finger transcriptional activator of the Zn2Cys6
           family activates transcription of aromatic amino acid
           catabolic genes in the presence of aromatic amino acids
          Length = 881

 Score =  662 bits (1709), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 382/887 (43%), Positives = 529/887 (59%), Gaps = 62/887 (6%)

Query: 4   KSNRTSSKKWKRSFRACQTCRERKIKCNLGPLDNPHKPPCERCKREQRECIFVEPSRKSR 63
           +S+ ++  KW+R ++AC +CR +K+KC++GPLDNPH PPC RC+RE +ECI  E  R+  
Sbjct: 9   ESSGSNPTKWRRIYKACISCRNKKMKCDMGPLDNPHGPPCMRCRRENKECILPENKRRGN 68

Query: 64  S---LSPKDINYGDDGDDNKLKFIH--YQQGDNKGANNKEIQNMALEDSAWESDVSSMQN 118
           +        I  G  G  NK +       Q      N     N+ L D  W+ ++ +M N
Sbjct: 69  TDTEFKLGKIENGLVGVMNKSESEQSLLSQTRAPPPNGSTSNNLDLVDPKWKFEIGTMYN 128

Query: 119 ALEYLASAAKSVSQFE---------------NHKPTSKLSD-MVNSYSKDDMTQENIIKE 162
           ALE+LA AA SVS+ E                + P + L+  M ++    D++ E+ +  
Sbjct: 129 ALEFLAKAAGSVSKEEPIEMKSPQNRSDLGVGNMPDTALNGVMSDNIGNLDISDESFLAP 188

Query: 163 LFEKTELKNPASSLIAQLSRIRTKPHKKLSDIVYIGDDKLLTEEEARRLIEVFFQKLHPF 222
           L      +  A+ LI +LS +R K  KKL D+ YIG  KLL+E+EA RLI++FF  +HPF
Sbjct: 189 LTTANGSQRAAAPLIEKLSSMRPKSSKKLIDVDYIGPSKLLSEDEATRLIDIFFLTMHPF 248

Query: 223 FPYIPLQLHNPEQLVRYPILLCAVITISARYNNFGDLDLKTRESPDYNITIHEKLWMYCQ 282
           FP+IPLQL +P++LVRYPILLCA++TISARYN FG+L     E+ + NI +HE+LW+YCQ
Sbjct: 249 FPHIPLQLQDPDELVRYPILLCAILTISARYNPFGELGFYDGEAHNRNIEVHERLWIYCQ 308

Query: 283 RLISRTIWAEASTRSIGTILAFLLFTEWNPRAIHWNWSDYANDSETINFNELNEFDPINS 342
           RLIS+TIWAEASTRSIGT+LAFLLFTEWNPRAIHW WSDYAN+ E  +  +         
Sbjct: 309 RLISQTIWAEASTRSIGTVLAFLLFTEWNPRAIHWKWSDYANNPELNDVTKRETHGANTP 368

Query: 343 YKGESITGFEAMRHSDRMAWMLTGSAVRLAQDMKFIDTSNKIFLATHIAETYNAMXXXXX 402
              E+ TG  A+R SDRMAWML G+AVRLAQDM FIDTS+KIF+ATHIAE + AM     
Sbjct: 369 RDTETFTGMAAVRRSDRMAWMLIGAAVRLAQDMSFIDTSSKIFVATHIAEAHTAM----- 423

Query: 403 XXXXXXXXXXXIHSKKI--DPVKIIDGKKSERY--FGNEKYYLEQIFKNAKDRESSYDLL 458
                      ++ K I  + +  ++ +  ER    GNE +YLE I +  + +E   + L
Sbjct: 424 ----------NLNQKSILSESLSEVNREVLERLDDIGNENFYLEHILQKDESKERWTNFL 473

Query: 459 ENILRERRNAKAFP--DNERDFLNDEYILFYSNP-DDATQNDELDT--PLDFTVIQRAKI 513
           +N+   RR     P  D ER+FLNDEY+L+Y N  +DA+    L    PL F+  QRAKI
Sbjct: 474 QNVSEGRRAKGTGPLTDMEREFLNDEYVLYYVNARNDASSKSSLTLPFPLKFSHPQRAKI 533

Query: 514 ELLKIMSIGYETIYL--EKGRRYTTANNQKQNLAMLNIFSALIDSWYVNYNELLSPEETL 571
           ELL+I++IGYE+IY   EK +      N K+NLA+L I S LI+ W+  Y +LL P    
Sbjct: 534 ELLRILTIGYESIYYESEKDKTQLINGNPKRNLALLEIISTLIEKWHATYKDLLIPANAT 593

Query: 572 DPVLNAS--KMGLQSMTQIIENESLICDYYYCQLYIYSLSLQVEDXXXXXXXXXXXXXAK 629
              L+ +  K  +  +TQ I+ ESL CDY YCQLYIYSL+LQ +              A+
Sbjct: 594 PCSLDMARNKRAVHELTQQIDRESLSCDYNYCQLYIYSLALQNDVKNMDLKMPEIRKSAR 653

Query: 630 YVSIAYSSAKEILNSAKRLQEVRMLKFIPVRWVIRIVRAISFIVKCYVTATDKDSMNYKE 689
           YV +AY +A+ IL+SA+R+  ++ML+++PVRWV RIVRA++F+VKCY+  T KD +    
Sbjct: 654 YVELAYRAAEGILDSAERIHSLKMLRYMPVRWVTRIVRAVAFLVKCYLVLT-KDGLAANP 712

Query: 690 L-NSLLSLSGIPVDESLELIHTAAVLLKESTPDELHLCTRYSKILLCLYRELKMDTLSTQ 748
           +  ++L L+ IP +E++ +I  AAV L+E+ PDE+HL  RYSKIL  L  E+KM    TQ
Sbjct: 713 VAGTILRLTVIPSEETVPIIERAAVTLQEAAPDEVHLGMRYSKILKFLCAEVKM---RTQ 769

Query: 749 QAHGNDSMPERLTADTTLENAIRTEFTTTSNSGSQVELTPLSNKLATLPIDRNTTP---- 804
            +  ++   E       LE   R            V     S    ++ ++ +  P    
Sbjct: 770 MSERDEEAEEERKQRQQLECYHRQPRERRQQHAQPVISQSHSPPSPSVMLNSSMDPYSPS 829

Query: 805 -PYASFPTE-VVDWFSTSADIGLEFVEPWTEMIEQRYIKS--GNTQN 847
            P A  P E   D F+ S DIGL+FV+ WTEMIE RY++   GN ++
Sbjct: 830 APPADLPFEDPFDLFAASDDIGLDFVDTWTEMIENRYMQDELGNIES 876

>KLTH0G03718g Chr7 (292858..295431) [2574 bp, 857 aa] {ON} similar
           to uniprot|Q04052 Saccharomyces cerevisiae YDR421W ARO80
           Zinc finger transcriptional activator of the Zn2Cys6
           family activates transcription of aromatic amino acid
           catabolic genes in the presence of aromatic amino acids
          Length = 857

 Score =  611 bits (1576), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 352/879 (40%), Positives = 514/879 (58%), Gaps = 79/879 (8%)

Query: 8   TSSKKWKRSFRACQTCRERKIKCNLGPLDNPHKPPCERCKREQRECIFVEPSRKSRSLSP 67
            SS+K++R ++AC  CR RK +C+LGP D+P  PPC RCKRE++EC+F+E S++      
Sbjct: 12  VSSQKYRRGYKACLNCRSRKTRCDLGPPDSPRDPPCVRCKRERKECVFLENSKRG---GR 68

Query: 68  KDINYGDDGDDNKLKFIHYQQGDNKGANNKEIQNMALEDSAWESDVSSMQNALEYLASAA 127
           K I +  DG+ +      ++  D            ++++ +   +++SM NALE+LA AA
Sbjct: 69  KRIEWTVDGNTDVNATARFEAEDKYIPVATLKDTTSIKEGSLTPELNSMHNALEFLAKAA 128

Query: 128 KSVSQFENHKPTSKLSDMVNSYSKDDMTQENIIKELFEKTELKNPASS------------ 175
            S ++ ++          + SY + D T   I ++ + + E  N  +S            
Sbjct: 129 GSAAKEDSR-------SRIPSYERQDKT---IREKTYHREESPNQHASGSKRASLATPGK 178

Query: 176 LIAQLSRIRTKPHKKLSDIVYIGDDKLLTEEEARRLIEVFFQKLHPFFPYIPLQLHNPEQ 235
           LI +LS  +      L D+ YIG  KLLTE+EA RLI++FF  +HPFFPYIP QL   ++
Sbjct: 179 LIEKLSDWKPGSLYDLGDVEYIGGHKLLTEKEATRLIDLFFLNMHPFFPYIPFQLRCSQE 238

Query: 236 LVRYPILLCAVITISARYNNFGDLDLKTRESPDYNITIHEKLWMYCQRLISRTIWAEAST 295
           L RYPILLCA++TISARY+NF +  +   E    NI +H++LW+YCQRLIS+++WAEAST
Sbjct: 239 LKRYPILLCAILTISARYHNFAEHKVSEGERSSRNIEVHDRLWIYCQRLISQSVWAEAST 298

Query: 296 RSIGTILAFLLFTEWNPRAIHWNWSDYANDSETINFNELNEFDPINSYKGESITGFEAMR 355
           RS+GTILAFLLFTEWNPRAIHW+W+DYAND+   + +  +           S+TG  AMR
Sbjct: 299 RSVGTILAFLLFTEWNPRAIHWHWTDYANDTSLSDISRRDYHSEAKRSDNTSLTGMGAMR 358

Query: 356 HSDRMAWMLTGSAVRLAQDMKFIDTSNKIFLATHIAETYNAMXXXXXXXXXXXXXXXXIH 415
            SDRMAWMLTG+AVRLAQDM F++ S KIF A HI ET  AM                I 
Sbjct: 359 RSDRMAWMLTGTAVRLAQDMGFMNNSPKIFTALHITETQTAM----------NMNQRSIL 408

Query: 416 SKKIDPVKIIDGKKSERYFGNEKYYLEQIFKN--AKDRESSYDLLENILRERRNAKAFPD 473
           S+ +  V  ++G   +   G     +E+IF+N  +K R  SY    + +  +  +  F D
Sbjct: 409 SQSLAEVS-LNGHDGDS--GLSSACIEEIFRNEDSKRRWKSYTQQRDSVEGK--SVGFCD 463

Query: 474 NERDFLNDEYILFYSNPDDATQN-DELDT----------PLDFTVIQRAKIELLKIMSIG 522
           NE++FL DEY  F++   DA ++   L T           L FT  QRAK+ELL+IMSIG
Sbjct: 464 NEKEFLIDEYAFFHNEDSDAYRDLSNLGTHEKSKLSAADKLLFTPRQRAKVELLRIMSIG 523

Query: 523 YETIYLEKGRRYTTANNQKQNLAMLNIFSALIDSWYVNYNELLSP--EETLDPVLNASKM 580
           YE IY +  +   T  + K  LA+L I + +I  W+  Y  LL P       P  + +K 
Sbjct: 524 YEAIYYKDTK--LTLIDHKHKLAVLGILAPMIKGWHNTYKHLLVPFAGGQCPPTRDENKN 581

Query: 581 GLQSMTQIIENESLICDYYYCQLYIYSLSLQVE---DXXXXXXXXXXXXXAKYVSIAYSS 637
                   I++ESLI DY+YCQLYIYSL+LQ+E   +             AKYV +AY++
Sbjct: 582 ATYDTPSKIDSESLISDYFYCQLYIYSLALQIEAGTEKDKKPNINELTKSAKYVELAYNA 641

Query: 638 AKEILNSAKRLQEVRMLKFIPVRWVIRIVRAISFIVKCYVTATDKDSMNYKELNSLLSLS 697
           AKE+L+SA R+ ++R LK++PVRW  RI+RA++F+V+CY+T T     +     ++L++ 
Sbjct: 642 AKEVLHSAIRVHKLRALKYMPVRWAARIIRAVAFVVRCYMTLTGSGLGSDPRATTILAVC 701

Query: 698 GIPVDESLELIHTAAVLLKESTPDELHLCTRYSKILLCLYRELKMDTLSTQQAHGNDSMP 757
            I  +E +E+I  AA+ L+E++PDELHLC+R+S +L+ L  E+K    S  Q   N  + 
Sbjct: 702 VISAEEIIEMIQKAAITLREASPDELHLCSRFSTVLMFLCTEMKRKQHSEPQ---NSEL- 757

Query: 758 ERLTADTTLENAIRTEFTTTSNSGSQVELTPLSNKLAT---LPIDRNTTPPYASFPTEVV 814
            R ++  +L N         +++ +++  TP  N  AT   +P    T  P +  P+E+ 
Sbjct: 758 -RRSSSHSLHNP--------TDAPARMPTTPAENYAATDFAIPAFLETPHP-SHLPSELE 807

Query: 815 DWFSTSADIGLEFVEPWTEMIEQRYIKSGNTQNKDFDDL 853
           DWF TS D+GL+FVEPW EM+EQ++I   N +N  F++L
Sbjct: 808 DWFCTSDDVGLDFVEPWAEMLEQQFI--NNDKNMTFENL 844

>KNAG0C03250 Chr3 complement(635995..638805) [2811 bp, 936 aa] {ON}
           Anc_5.525 YDR421W
          Length = 936

 Score =  585 bits (1507), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 343/923 (37%), Positives = 508/923 (55%), Gaps = 94/923 (10%)

Query: 13  WKRSFRACQTCRERKIKCNLGPLDNPHKPPCERCKREQRECIFVEPSRKSRSLSPKDINY 72
           W R F+AC  CR +K++C+ GP DNPH PPC RCKRE + C F   + K + +   +   
Sbjct: 19  WIRGFKACTNCRIKKVRCDFGPSDNPHPPPCARCKRESKNCTFTAKTGKEQDMVTGEATN 78

Query: 73  GDDGDD------NKLKFIHYQQGDNKG--ANNKEIQNMALEDSAWESDVSSMQNALEYLA 124
           G    D      N+L         + G   N  E+ N A  ++ W+ +++SM N L +LA
Sbjct: 79  GIPTVDTVPVKKNELALPALAVTVSPGLIQNRSEMGNEANPNTGWKLELTSMHNTLAFLA 138

Query: 125 SAAKSVSQFENHK------------PTSKLSDMVN------SYSKDDMTQENIIKELFEK 166
            AA +VS   N              P+ ++S + +      + S       N  K L ++
Sbjct: 139 QAAGTVSNTLNKGLMKKTLPSDRSTPSLEISRLGSKTPTGFASSLGLGMPSNPTKTLLQE 198

Query: 167 TELKNPASSLIAQLSRIRTKPHKKLSDIVYIGDDKLLTEEEARRLIEVFFQKLHPFFPYI 226
            E +N    LI +    ++K  K L DI  IG++ LL+E+EA   I+ FF  +HPFFPYI
Sbjct: 199 IETQNKVQ-LIEKSKNTKSKVPKTLKDIKCIGENGLLSEQEATAFIDAFFCTMHPFFPYI 257

Query: 227 PLQLHNPEQLVRYPILLCAVITISARYNNFGDLDLKTRESPDYNITIHEKLWMYCQRLIS 286
           PLQL +P +L+ YPILLCA++TIS RY++F +      +    N  +HEKLW  CQ ++S
Sbjct: 258 PLQLQDPLELLEYPILLCAILTISTRYHSFSEFGFDNGDYNKRNFEVHEKLWDNCQVMLS 317

Query: 287 RTIWAEASTRSIGTILAFLLFTEWNPRAIHWNWSDYANDSETINFNELNEFDPINSYKGE 346
           +TIW EASTRSIGT+LAF+LFTEWNPR IHW  SDYAND +            +++ + E
Sbjct: 318 KTIWGEASTRSIGTVLAFILFTEWNPRQIHWKKSDYANDDD-------EAVSELSNDEAE 370

Query: 347 SITGFEAMRHSDRMAWMLTGSAVRLAQDMKFIDTSNKIFLATHIAETYNAMXXXXXXXXX 406
            +TG +A+R SDRMAWMLTGSAVRLAQDM F++T+ K+ +ATHI++ + +M         
Sbjct: 371 ELTGTKAIRRSDRMAWMLTGSAVRLAQDMGFMETNAKVCVATHISDAFASMNMNQKPVLS 430

Query: 407 XXXXXXXIHSKKIDPVKIIDGKKSERYFGNEKYYLEQIFKNAKDRESSYDLL-----ENI 461
                    +       +     S     +E+ +++Q+ +N         +L     E++
Sbjct: 431 GNFNVLQGGTNNYTSDPLNSSGSSHESTCSEQAFMKQMLENTNSHTRWRHILSSLQMEDL 490

Query: 462 LRERRN--AKAFPDNERDFLNDEYILFYSNPDDATQNDELDTPLDFTVIQRAKIELLKIM 519
            + +RN  +    D ER+FLNDE+IL+YS    +   +    PL F+  Q+AKIEL  IM
Sbjct: 491 FQRQRNEYSNDLSDLEREFLNDEFILYYSLERRSDNQETPPFPLQFSYAQKAKIELTNIM 550

Query: 520 SIGYETIYLEKGRRYTTANNQKQNLAMLNIFSALIDSWYVNY-NELLSPEETLDPVLNAS 578
            +GY+TIY ++GR+   +NNQ  NL++L+I S L++ W+  Y N L++P  + +P    +
Sbjct: 551 LLGYDTIYYDRGRKKLASNNQLHNLSVLSILSPLMEGWHNVYKNLLIAP--SANPYTTTT 608

Query: 579 KMGLQSMTQI---IENESLICDYYYCQLYIYSLSLQVEDXXXXXXXXXXXXXAKYVSIAY 635
           +   ++M ++   I++ES+ICDY Y QLYIYSL+LQ +              AKYV IA+
Sbjct: 609 RGDKRAMYELSKNIDSESIICDYRYSQLYIYSLALQADFKRAELTVSEITQNAKYVEIAF 668

Query: 636 SSAKEILNSAKRLQEVRMLKFIPVRWVIRIVRAISFIVKCYV----TATDKDSMNYKELN 691
           ++AKEI+ SA R+ ++ +LK++PVRWV+R+VRA+SF+VKC +    T+      +  E+ 
Sbjct: 669 NAAKEIIFSAFRVHKLNLLKYMPVRWVMRLVRAVSFLVKCCLILNATSIGGGGSSEAEVR 728

Query: 692 SLLSLSGIPVDESLELIHTAAVLLKESTPDELHLCTRYSKILLCLYRELKMDTLSTQQAH 751
           ++L L  I V ++   I  AA+ LKE+TPDELHL  RYS ILL L REL+ +  S+++  
Sbjct: 729 TILKLCSISVKDTANTIKMAAMTLKEATPDELHLSMRYSAILLYLCRELESEKDSSKKIP 788

Query: 752 GNDSMPERLTADTTLENAIRTEFTTTSNSGSQVELTPLSNKLATLPI------------- 798
             ++   +     T E     E    S  G        +N+L T+P+             
Sbjct: 789 FPNNATTKYAISPTYEGR-DGEIAAGSAGGCANTAHITANRLRTVPLSDINETTGRNTED 847

Query: 799 -------------DRN---------------TTPPYASFPTEVVDWFSTSADIGLEFVEP 830
                        DRN               T     S P EV +WFS +A+IGLEFVEP
Sbjct: 848 TANNNIVNGSLNGDRNHLGTTEGTGAASQSTTDRLTGSLPDEVTNWFSGNAEIGLEFVEP 907

Query: 831 WTEMIEQRYIKSGNTQNKDFDDL 853
           WT+MIEQR+++SG T N  F++L
Sbjct: 908 WTDMIEQRFLQSG-TGNDVFEEL 929

>KLLA0A01804g Chr1 complement(159689..162526) [2838 bp, 945 aa] {ON}
           similar to uniprot|Q04052 Saccharomyces cerevisiae
           YDR421W ARO80 Zinc finger transcriptional activator of
           the Zn2Cys6 family activates transcription of aromatic
           amino acid catabolic genes in the presence of aromatic
           amino acids
          Length = 945

 Score =  583 bits (1502), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 324/776 (41%), Positives = 468/776 (60%), Gaps = 58/776 (7%)

Query: 6   NRTSSKK--WKRSFRACQTCRERKIKCNLGPLDNPHKPPCERCKREQRECIFVEPSR--- 60
           ++T+ KK  +KR ++AC  C+ RK+KC+LGP DNPH PPC RCKRE REC+F E  R   
Sbjct: 8   SQTAPKKQTFKRGYKACLNCKMRKVKCDLGPFDNPHGPPCVRCKRESRECMFTETKRGGF 67

Query: 61  ---KSRSLSPKDINYGDDGDDNKLKFIHYQQGDNK-GANNKEIQNMALEDSAWESDVSSM 116
              K   +S K+ + G    D     I  Q    +   +   +Q    +D +  +D  ++
Sbjct: 68  RVAKQSLVSLKEESAGKSMADVITSVIQGQTLKKELDTDLDRLQTHTKDDISINTDPPTL 127

Query: 117 QNALEYLASAAKSVSQ------------FENHKPTSKLSDM--VNSY----SKDDMTQEN 158
           QNA  +LA AA SV++            ++  +PT  +S    V+SY    +   M   +
Sbjct: 128 QNAFYFLAKAAGSVAKEDLRDQVDAATKYDEIEPTDAVSRQPSVSSYGNKQATGSMEPSS 187

Query: 159 IIKEL-------FEKTELKNPAS-SLIAQLSRIRTKPHKKLSDIVYIGDDKLLTEEEARR 210
           I K L       F + E + P +  LI +LS +R KP  KL DI YIG  +LLTE EAR+
Sbjct: 188 IPKMLTDSYVTSFVEPEGQKPGTIPLIEKLSSVRPKPSMKLGDIEYIGPYQLLTEAEARK 247

Query: 211 LIEVFFQKLHPFFPYIPLQLHNPEQLVRYPILLCAVITISARYNNFGDLDLKTRESPDYN 270
            I+ FF  +HPF PYIPLQL + ++L RYP+LLC ++TISARY+   DL L   ++   +
Sbjct: 248 RIDAFFLTMHPFSPYIPLQLQDADELARYPLLLCTILTISARYHTLHDLGLNEIDN-TVH 306

Query: 271 ITIHEKLWMYCQRLISRTIWAEASTRSIGTILAFLLFTEWNPRAIHWNWSDYANDSETIN 330
           + +HE+LW+YCQRL+S+T+WAEASTRSIGTILAFL+FTEWNPRAIHW  SDYAN  +  +
Sbjct: 307 VELHERLWIYCQRLVSQTVWAEASTRSIGTILAFLIFTEWNPRAIHWKGSDYANYPDISD 366

Query: 331 FNELNEFDPINSYKGESITGFEAMRHSDRMAWMLTGSAVRLAQDMKFIDTSNKIFLATHI 390
             +            +S+TG  AMR SDRM+W+LTG+AVRLAQD+  I+ S+KIF+ THI
Sbjct: 367 LPKRPSSQTSQPQGSDSLTGLAAMRRSDRMSWLLTGNAVRLAQDLNVIEFSSKIFVMTHI 426

Query: 391 AETYNAMXXXXXXXXXXXXXXXXIHSKKIDPVKIIDGKKSERYFGNEKYYLEQIFKNAKD 450
            ET+ AM                ++  +            +    NE+++LE+I +N K 
Sbjct: 427 CETHTAMNLNKRSSLSESLSEVRLNGFE------------DNDLDNEQFFLERILQNDKS 474

Query: 451 RESSYDLLENILRERRNAKAFPDNERDFLNDEYILFYSNPDDATQNDELDTPLDFTVIQR 510
           +E     LE +  ER    +  D ER+FLNDEY+L++ N ++     + +  L F+ IQR
Sbjct: 475 KERWARFLERV-GERSKKGSLTDIEREFLNDEYLLYHYNTENPNTQSDPEFRLKFSKIQR 533

Query: 511 AKIELLKIMSIGYETIYLEKGRRYTTANNQKQNLAMLNIFSALIDSWYVNYNELLSP--E 568
            K+ELLKI+S+GYE +Y  K     +++++ Q L+ML++ S LI+ WY  Y  LL P   
Sbjct: 534 GKVELLKIVSLGYENVYNGK----LSSHDRHQRLSMLSVLSPLIEGWYNIYKSLLVPCGG 589

Query: 569 ETLDPVLNASKMGLQSMTQIIENESLICDYYYCQLYIYSLSLQVEDXXXXXXX---XXXX 625
                  +++K  +  MT+ +E+ESLI DYYYCQLYIYSL+LQ +               
Sbjct: 590 AACSIAKSSNKSFVFEMTEKVEHESLISDYYYCQLYIYSLALQWDHQDTSTSKLRLNEIT 649

Query: 626 XXAKYVSIAYSSAKEILNSAKRLQEVRMLKFIPVRWVIRIVRAISFIVKCYVTATDKDSM 685
             A+YV +AY++AKEILNSA+R+ +++MLK++PVRWV+RIVR+I F++KCY+T T     
Sbjct: 650 KSARYVELAYNAAKEILNSAQRVHKLKMLKYMPVRWVMRIVRSIVFMIKCYLTLTGNGIT 709

Query: 686 NYKELNSLLSLSGIPVDESLELIHTAAVLLKESTPDELHLCTRYSKILLCLYRELK 741
              E N++L++S +P DE ++ I   A++L+ + PDELHLC+RYS IL+ L  E+K
Sbjct: 710 QNPEANTILTMSVLPTDEIIQTIQRTAIILRAAAPDELHLCSRYSTILMYLCTEMK 765

 Score = 49.3 bits (116), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 31/95 (32%), Positives = 48/95 (50%), Gaps = 8/95 (8%)

Query: 748 QQAHGNDSM--PERLTADTTLENAIRTEFTTTSNSGSQVELTPLSNKLATLPIDRNTTPP 805
           QQ   ND    P+  T D+ L  A               +  P S  + T P   N++  
Sbjct: 837 QQETTNDEQQRPDTFTVDSALGVASINSAPPAPVPEPAPDTNPAS-AINTGP---NSSGG 892

Query: 806 YASFPTEVVDWFSTSADIGLEFVEPWTEMIEQRYI 840
           Y   P ++VDWF+ + +IGL+FV PWTEM+E++++
Sbjct: 893 Y--LPPQLVDWFNDNNEIGLDFVGPWTEMVEKQFV 925

>TBLA0D01670 Chr4 complement(413360..416416) [3057 bp, 1018 aa] {ON}
           Anc_5.525 YDR421W
          Length = 1018

 Score =  579 bits (1493), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 322/829 (38%), Positives = 481/829 (58%), Gaps = 95/829 (11%)

Query: 1   MGSKSNRTSSKKWKRSFRACQTCRERKIKCNLGPLDNPHKPPCERCKREQRECIFVEPSR 60
           M  K ++  S +W+RS++AC  CR +K+KC+LGPL+NPH PPC RCKRE R+CIF EP +
Sbjct: 12  MSDKKSKGKSVRWRRSYKACINCRLKKVKCDLGPLENPHSPPCVRCKREARDCIFDEPLK 71

Query: 61  KSRSLSPKDINYGDDGDDNKLKFIHYQQGDNKGANNKEIQN-----MALEDSAWESDVSS 115
           K  ++     N  D  DDN+   +     D    N   IQ      +A  +S + +D+S+
Sbjct: 72  KLGTVE----NENDSIDDNQR--VPNSPEDEIQQNTDIIQERISSIVATNESRFNNDISN 125

Query: 116 -----------------------MQNALEYLASAAKSVS-------------QFENH--- 136
                                  M+NALE+LA+AA   +             +FE     
Sbjct: 126 SQKHERKDKPSERKSNLKVNFTNMRNALEFLANAAGQAAEERLSEEEEELNNKFEKELND 185

Query: 137 ------KPTSKLSDMVNSYSKDDMTQENIIKELFEKTEL-KNPASSLIAQLSRIRTKPHK 189
                  P ++ +   +S    D++ E+I      + E  +   +SLI  +   R   ++
Sbjct: 186 DHISIDSPATQSTTSTDSVKHLDLSDESIASLFLSENETNRKKVTSLIEAVIAARPISNR 245

Query: 190 KLSDIVYIGDDKLLTEEEARRLIEVFFQKLHPFFPYIPLQLHNPEQLVRYPILLCAVITI 249
           KL+D  YIG  K+++E EA +LI  FF  +HPF+PY+P QL +P +L RYPILLC ++TI
Sbjct: 246 KLTDYDYIGKSKMISEFEAIQLINAFFLTMHPFYPYLPDQLQDPHELARYPILLCTILTI 305

Query: 250 SARYNNFGDLDLKTRESPDYNITIHEKLWMYCQRLISRTIWAEASTRSIGTILAFLLFTE 309
           S+R++ F +L      +   +I +HEKLW+YCQ++IS+T+WAEASTRS+GT+LAFLLFTE
Sbjct: 306 SSRHHKFNELGTYNGVNDKRHIDVHEKLWVYCQKMISQTVWAEASTRSLGTVLAFLLFTE 365

Query: 310 WNPRAIHWNWSDYANDSETINFNELNEFDP----INSY--KGESITGFEAMRHSDRMAWM 363
           WNPRAIHW W+DYAN+       +LN+F      IN Y   G+  TG  A+R SDRMAWM
Sbjct: 366 WNPRAIHWKWADYANNP------KLNDFSTSDTGINDYLKVGKRTTGLGAIRRSDRMAWM 419

Query: 364 LTGSAVRLAQDMKFIDTSNKIFLATHIAETYNAMXXXXXXXXXXXXXXXXIHSKKIDPVK 423
           L G++VR+AQDM FI+ S+ +F+ATH +ET++AM                    ++   +
Sbjct: 420 LCGTSVRIAQDMGFIENSSNVFVATHTSETFHAMNVGQRSSLNESLNDTYYSQGRMSSYR 479

Query: 424 IIDGKKSERYFGNEKYYLEQIF-KNAKDRESSY---DLLENILR--ERRNAKAFPDNERD 477
                K ++   NE +Y+E IF +N K  E +Y    L ENI    +  +  A  D  R 
Sbjct: 480 ----NKQQQTLKNEIFYIENIFSENFKITERNYWKSQLQENIENKIDIDDKIALSDKVRG 535

Query: 478 FLNDEYILFYSNPDDATQNDE-----------LDTPLDFTVIQRAKIELLKIMSIGYETI 526
           FLNDE+ LFYSN +D T ++E           L  P++ +  Q+A IELL+I S  Y+TI
Sbjct: 536 FLNDEFALFYSNGNDPTYSNERNNQPYSSFSTLPLPVNLSKSQQANIELLRIFSTAYKTI 595

Query: 527 YLEKGRRYTTANNQKQNLAMLNIFSALIDSWYVNYNELLSPEETLDPV-LN--ASKMGLQ 583
           Y     +  ++NNQ  N+++L+IF+ L+ +W + + +LL P +  +P+ LN   +K  ++
Sbjct: 596 YSRNQNQKLSSNNQSHNISLLDIFAPLLHNWTIAFGDLLQPSDVCEPINLNNRNNKRVVK 655

Query: 584 SMTQIIENESLICDYYYCQLYIYSLSLQVEDXXXXXXXXXXXXXAKYVSIAYSSAKEILN 643
              +IIE ESLICDY YCQLYI+SL+LQ+               + Y+++AY SAKE + 
Sbjct: 656 EFNKIIEGESLICDYNYCQLYIFSLALQIGLDGEILTVNEITKSSTYINLAYQSAKEYIL 715

Query: 644 SAKRLQEVRMLKFIPVRWVIRIVRAISFIVKCY--VTATDKDSMNYKELNSLLSLSGIPV 701
           S +R+  ++MLK++PVRW+ R++RA +F+VKCY  V  TD++  +  E+N +  L G   
Sbjct: 716 STERVFTLKMLKYMPVRWLTRLIRATAFLVKCYLSVAGTDQELNSISEINMIFKLGGTSA 775

Query: 702 DESLELIHTAAVLLKESTPDELHLCTRYSKILLCLYRELKMDTLSTQQA 750
           +E LELI  +A+LL  S+PDELHLC+RYS I++C Y+E+    L+ ++ 
Sbjct: 776 NEVLELIKKSAILLGSSSPDELHLCSRYSSIIMCFYKEMSEKNLTRKRG 824

 Score = 62.8 bits (151), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 26/40 (65%), Positives = 29/40 (72%)

Query: 802  TTPPYASFPTEVVDWFSTSADIGLEFVEPWTEMIEQRYIK 841
            T  P  S   E +DWFS S DIGLEFVE WTEM+EQRY+K
Sbjct: 970  TGEPTGSHANEFLDWFSASGDIGLEFVESWTEMLEQRYMK 1009

>CAGL0F03025g Chr6 (295783..298569) [2787 bp, 928 aa] {ON} similar
           to uniprot|Q04052 Saccharomyces cerevisiae YDR421w
           positive transcription regulator of ARO9 and ARO10
          Length = 928

 Score =  529 bits (1363), Expect = e-174,   Method: Compositional matrix adjust.
 Identities = 332/921 (36%), Positives = 505/921 (54%), Gaps = 94/921 (10%)

Query: 5   SNRTSSKKWKRSFRACQTCRERKIKCNLGPLDNPHKPPCERCKREQRECIFVEPSRKSRS 64
           S+ +  +K K +F AC  C+ +KIKC+LGP D P  PPC  C+R +  C F  P  K   
Sbjct: 23  SSSSQGQKHKNTFGACLRCKYKKIKCDLGPADRPVSPPCAACRRSRSHCFFNAPKVKIGK 82

Query: 65  LSPKDINYG---------------------------DDGDDNKLKFIHYQQGDN-KGANN 96
           L     + G                            +G+ N    +H     N  G  N
Sbjct: 83  LGNILDSQGLQSSQSTSPTSASMLNAITQSLQNHRAMNGNQN----MHLNNLSNLVGLKN 138

Query: 97  KEIQNMAL---------------EDSAWESDVSSMQNALEYLASAAKSVSQFENHKP-TS 140
           + ++ ++L                D+AW+ +++SMQ+ALE+LA A K  + ++N++P  S
Sbjct: 139 QNLEGVSLNSPNTALIEACDRVKSDTAWKLELTSMQSALEFLAKATKLRNDYKNNEPFGS 198

Query: 141 KLSDMVNSYSKD-DMTQENIIKELFEKTELKNPASSLIAQLSRIRT----KPHKKLSDIV 195
             SD  ++ S+  D+++++   E    T   +  +S  +    I       P     +  
Sbjct: 199 TRSDAASTTSETRDLSEKDNGNESDSTTNSTSKDTSTRSSYPSIEAIKPEVPTPSNHNYD 258

Query: 196 YIGDDKLLTEEEARRLIEVFFQKLHPFFPYIPLQLHNPEQLVRYPILLCAVITISARYNN 255
            +GD KL+T +EAR L+ +FF  +HPF+PYIPL L + ++L +YP+LL  ++ ISARYN 
Sbjct: 259 LLGDGKLVTMDEARMLVNIFFNFMHPFYPYIPLHLQDFDELFKYPLLLHCILAISARYNP 318

Query: 256 FGDLDLKTRESPDYNITIHEKLWMYCQRLISRTIWAEASTRSIGTILAFLLFTEWNPRAI 315
           F  +        + N+ IH KLW +CQ+L+S+T+W++ASTRSIGT LAFLLFTEWNPRAI
Sbjct: 319 FDKVGFDNGIEGNRNVIIHNKLWTHCQQLLSQTVWSQASTRSIGTTLAFLLFTEWNPRAI 378

Query: 316 HWNWSDYANDSETINFNELNEFDPINSYKGESITGFEAMRHSDRMAWMLTGSAVRLAQDM 375
           HW  SD A+     N +   E DP      + + G   ++ SDRMAWM TG+A+RLAQ+M
Sbjct: 379 HWEVSDTAHYLSDNNVSSSKE-DP------DGLGGIATVKRSDRMAWMFTGTAIRLAQEM 431

Query: 376 KFIDTSNKIFLATHIAETYNAMXXXXXXXXXXXXXXXXIHSKKIDPVKIIDGKKSERYFG 435
             ++ + KI+ A +IAE   A                    K+ +    ID  KS+    
Sbjct: 432 DILENNAKIYTAANIAEICYASNMNLKPTLGESLVSIDGGMKEFE----IDNPKSQDDIE 487

Query: 436 NEKYYLEQIFKNAKDRESS-----YDLLENILRERRNAKAFPDNERDFLNDEYILFYSNP 490
           NE   L+ +   A+++ES+     +    + L+E  N     D E +FLNDEY + Y + 
Sbjct: 488 NED-LLKFVQLVAQNKESTKKWAIHKAYSDKLKE-ENPDLIIDLETEFLNDEYSINYLDE 545

Query: 491 DDATQNDELDTPLDFTVIQRAKIELLKIMSIGYETIYLEKGRRYTTANNQKQNLAMLNIF 550
           + +     L  P+ +T  Q+A++ELL+I++I Y+TIY EK ++  ++ +QK+NL +L++ 
Sbjct: 546 NSSF----LKNPIPYTTYQKAQLELLRIVTITYQTIYYEKMKKRVSSVDQKKNLMILDVL 601

Query: 551 SALIDSWYVNYNELLSPEETLDPV-LNASKMGLQSMTQIIENESLICDYYYCQLYIYSLS 609
           S ++++WY+NY +L+ P     PV ++   +     T  I  ES I DYYYCQLY +SL+
Sbjct: 602 SPILNAWYLNYYKLMKPVSDEKPVIISLDDLSKFKRTANIRGESFISDYYYCQLYTFSLA 661

Query: 610 LQVEDXXXXXXXXXXXXXAKYVSIAYSSAKEILNSAKRLQEVRMLKFIPVRWVIRIVRAI 669
           LQVE              A++V  AY +AKEIL SA R+ +V MLK++PVRWV+RIVR+ 
Sbjct: 662 LQVEVKESKLTLNEMIKSARFVEQAYRAAKEILKSAIRVHKVDMLKYMPVRWVMRIVRSA 721

Query: 670 SFIVKCYVTATDKDSMNYKELNSLLSLSGIPVDESLELIHTAAVLLKESTPDELHLCTRY 729
           SFIVKCY+T  D       E  S+L LSGI VD+++ +I  AAV+LKESTPDELHL +++
Sbjct: 722 SFIVKCYITLCDHSMATNSEAKSILKLSGILVDDTVHMIRQAAVILKESTPDELHLASKF 781

Query: 730 SKILLCLYREL---KMDTLSTQQAHGNDSMPERLTADTTLENAIRTEFTTTSNSGSQV-- 784
           S IL+ L +E+   K D  +    +G ++ P  L + TT + ++      T +S +Q   
Sbjct: 782 STILMFLCKEIDERKRDNENLMTGNGLNNDPS-LESQTTHKESLEASNHDTISSDAQEPP 840

Query: 785 -------ELTPLSNKLATLPIDRNTTPPYASF----PTEVVDWFSTSADIGLEFVEPWTE 833
                  + T      +T  +  N+      F    P +V+DWFS S +IGL+FVEPWTE
Sbjct: 841 SENDSSHDTTTQGTANSTRKVGPNSIDEIGQFTAYLPEDVIDWFSASNNIGLDFVEPWTE 900

Query: 834 MIEQRYIKSGNTQNKDFDDLL 854
           +IEQ+YI++ +   +DFD L 
Sbjct: 901 LIEQKYIQNKDGF-QDFDQLF 920

>ADR199C Chr4 complement(1048528..1051362) [2835 bp, 944 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDR421W
           (ARO80)
          Length = 944

 Score =  523 bits (1346), Expect = e-171,   Method: Compositional matrix adjust.
 Identities = 337/942 (35%), Positives = 490/942 (52%), Gaps = 127/942 (13%)

Query: 5   SNRTSSKKWKRSFRACQTCRERKIKCNLGPLDNPHKPPCERCKREQRECIFVE------- 57
           SN  S +KW+R ++AC  CR RK++C+LGP+D P +PPC RC RE++ECIF E       
Sbjct: 17  SNAGSGRKWRRIYKACLNCRTRKVRCDLGPVDKPREPPCVRCSRERKECIFTELRRGRNR 76

Query: 58  ---------------------------PSRKSRSLS--PKDINYGDDGDDNKLKFIHYQQ 88
                                      PS  +   S  P  ++ G D   +       + 
Sbjct: 77  RIRVAKNDRAGHAEPDGGICVANAHGDPSSATGRFSGEPTALSAGSDPSPDSAS---NRG 133

Query: 89  GDNKGANNKEIQNMALEDSAWESDVSSMQNALEYLASAAKSVSQFENHKPTSKLSDMVNS 148
            D++ +N+ E +     + +  S+ +++ N LE+L  AA SV++ +N +  S  S  V  
Sbjct: 134 RDDQSSNSDEPEFSERPELSLSSEFTTLHNTLEFLTKAAGSVAK-DNGRLLSS-STAVGK 191

Query: 149 YSKDDMTQENIIKELFEK----------TELKNP-------ASSLIAQLSRIRTKPHKKL 191
           +S      E+I  +L+            +  +NP       A+S   Q     TK +  L
Sbjct: 192 HSA--AICESITLQLYNPLHNGQYASVVSGPRNPEAITDQAAASRTPQEEPESTK-YPLL 248

Query: 192 SDIVYIGDDKLLTEEEARRLIEVFFQKLHPFFPYIPLQLHNPEQLVRYPILLCAVITISA 251
            +I Y+G +  LT EE  RL E+FF   +PFFP+IPL + +PE+L RYPILLC V++ISA
Sbjct: 249 RNIEYVGPNNTLTVEEVIRLTELFFVTHYPFFPHIPLHMQDPEELARYPILLCGVLSISA 308

Query: 252 RYNNFGDLDLKTRESPDYNITIHEKLWMYCQRLISRTIWAEASTRSIGTILAFLLFTEWN 311
           RY+ F D+ L  R SP  NI +HE LW YCQ++IS+T+W EASTRSIGT+L FL+FTEWN
Sbjct: 309 RYHKFEDIGLSNRGSPTRNIDVHEYLWRYCQQMISQTVWTEASTRSIGTVLVFLIFTEWN 368

Query: 312 PRAIHWNWSDYAN---------DSETINFNELNEFDPINSYKG--------ESITGFEAM 354
           PRAIH   +DYAN          SE  N        P     G        +  +G  AM
Sbjct: 369 PRAIHRKCNDYANATDRQNEQSHSEKANTAHCGSGIPATERNGPRRFVLADQGSSGLSAM 428

Query: 355 RHSDRMAWMLTGSAVRLAQDMKFIDTSNKIFLATHIAETYNAMXXXXXXXXXXXXXXXXI 414
           R S RMAWML G+AVRLAQDM FI+TS+KIF+ATH +ET  AM                I
Sbjct: 429 RRSKRMAWMLVGNAVRLAQDMDFINTSSKIFVATHTSETNCAMNMGQNSTLSHSLMNANI 488

Query: 415 ---HSKKIDPVKIIDGKKSERYFGNEKYYLEQIFKNAKDRESSYDLLENILRERRNAKAF 471
               S        +  +  ERY    K  L+++ K+         L    L + R     
Sbjct: 489 IGSESSTAISNPPMPSETEERY----KSVLQRLGKHVPRGRGLSQLYNEFLEDERILYGL 544

Query: 472 PDNERDFLNDEYILFYSNPDDATQND-ELDTPLDFTVI------------QRAKIELLKI 518
                     EY+  Y +  D T+N+  ++T  + +++            QRAKIELL+I
Sbjct: 545 GG------GSEYVEAYCDSLDQTKNNVSIETAYESSLLERGGQQVFLSFAQRAKIELLRI 598

Query: 519 MSIGYETIYLEKGRRYTTANNQKQNLAMLNIFSALIDSWYVNYNELLSPE--ETLDPVLN 576
           MS+GYETIY    +       +   L++L + S  I++WY  YN LL P      +P  +
Sbjct: 599 MSVGYETIYSNHAK--LVLREKHHILSVLGLLSPQIENWYTQYNSLLVPAGGAPFNPTAD 656

Query: 577 ASKMGLQSMTQIIENESLICDYYYCQLYIYSLSLQVEDXXXXXXXXX----XXXXAKYVS 632
            S++    + + I+ ES+ICDYYYCQLYIYSL+L V+                  A+YV 
Sbjct: 657 FSRINPLDLVRRIDAESIICDYYYCQLYIYSLALTVDFRKPRHPNASWLDRLMKSARYVE 716

Query: 633 IAYSSAKEILNSAKRLQEVRMLKFIPVRWVIRIVRAISFIVKCYVTATDKDSMNYKELNS 692
           +AY++A+E+L SA R+  +RMLK++P RWV RIV A++FIVKCY+T     + ++ E ++
Sbjct: 717 LAYNAAREVLRSAIRVHRIRMLKYMPTRWVERIVGAVAFIVKCYLTMAAHLTASH-EASA 775

Query: 693 LLSLSGIPVDESLELIHTAAVLLKESTPDELHLCTRYSKILLCLYRELKMDTLSTQQAHG 752
           +L+LS IP DE +  I  AA+ L+E++PD++HLC +YS IL+ L  E+K+    T     
Sbjct: 776 ILTLSAIPPDEVVNTIQRAAITLREASPDDVHLCNKYSTILMYLCSEMKLRNWPTPTPPL 835

Query: 753 NDSM---PERLTA-DTTLENAIR----TEFTTTSNSGSQVELTPLSNKLATLPIDRNTTP 804
             S+   P R+   + +   A R          S +    +  PL +   TL    +   
Sbjct: 836 PRSVSGEPIRVPVFECSATPAARIFSPPHHPAESQTTGGTDPPPLPDH--TLAAPSSDPA 893

Query: 805 PY---ASFPTEVVDWFSTSADIGLEFVEPWTEMIEQRYIKSG 843
           P+   +  P E++DW  TS +IGL+FVEPWT++IE R ++SG
Sbjct: 894 PFDTTSHLPWELIDWLHTSDEIGLDFVEPWTDVIE-RLMESG 934

>KLLA0E02663g Chr5 (244696..248025) [3330 bp, 1109 aa] {ON}
          conserved hypothetical protein
          Length = 1109

 Score = 52.0 bits (123), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 30/72 (41%), Positives = 35/72 (48%), Gaps = 6/72 (8%)

Query: 5  SNRTSSKKWKRSFRACQTCRERKIKC----NLGPLDNPHKPPCERCKREQRECIFVEPSR 60
          S    S+K K + RAC  CRERKIKC    N  P   P K  C  C R   EC+FV  +R
Sbjct: 12 SRHPDSRKRKVAKRACLACRERKIKCDGEANPDPSGGPGK--CTNCVRSTLECVFVASNR 69

Query: 61 KSRSLSPKDINY 72
            R +  K   Y
Sbjct: 70 GGRRVFDKSKRY 81

>SAKL0G02992g Chr7 (243859..247044) [3186 bp, 1061 aa] {ON}
          conserved hypothetical protein
          Length = 1061

 Score = 51.2 bits (121), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 30/83 (36%), Positives = 41/83 (49%), Gaps = 7/83 (8%)

Query: 5  SNRTSSKKWKRSFRACQTCRERKIKCN---LGPLDNPHKPPCERCKREQRECIFVEPSRK 61
          ++RTS  K K + RAC TCRE+KIKC+      L       C  C     +C+FV   R 
Sbjct: 4  ADRTSDPKRKVARRACLTCREKKIKCDGEVRASLGGSDPGICSNCAASGSKCVFVASMRG 63

Query: 62 SRSLSPK----DINYGDDGDDNK 80
           R +S K    D ++ D+ D  K
Sbjct: 64 GRRVSKKEKCVDTSFSDEQDGFK 86

>KAFR0C03900 Chr3 (787524..789980) [2457 bp, 818 aa] {ON}
          Anc_2.654 YKL015W
          Length = 818

 Score = 50.1 bits (118), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 23/59 (38%), Positives = 33/59 (55%), Gaps = 7/59 (11%)

Query: 3  SKSNRTSSKKWKRSFRACQTCRERKIKCNLGPLDNPHKPPCERCKREQRECIFVEPSRK 61
          ++S    +KK KR   AC  CR+R IKC       P+  PC +C +   +C ++EPSRK
Sbjct: 17 TQSKIDKTKKQKRQQIACLECRKRHIKC-------PNGNPCFKCLKNNLKCEYIEPSRK 68

>TBLA0F01200 Chr6 (295744..299004) [3261 bp, 1086 aa] {ON} Anc_3.109
           YOL089C
          Length = 1086

 Score = 50.1 bits (118), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 27/76 (35%), Positives = 40/76 (52%), Gaps = 14/76 (18%)

Query: 14  KRSFRACQTCRERKIKCNLGPLDNPHKPPCERCKREQRECIFVEPSRKS----------- 62
           KR+ RAC++CR+RKIKC+  P+D P    C  C +    C+F    RK+           
Sbjct: 135 KRATRACESCRKRKIKCD--PVD-PITNKCSNCTKFHMICVFDNRKRKATNANTNSNKLL 191

Query: 63  RSLSPKDINYGDDGDD 78
           ++++PK     DD DD
Sbjct: 192 KTMNPKSHESEDDQDD 207

>Suva_10.323 Chr10 complement(566314..568755) [2442 bp, 813 aa]
          {ON} YLR228C (REAL)
          Length = 813

 Score = 49.7 bits (117), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 26/84 (30%), Positives = 45/84 (53%), Gaps = 11/84 (13%)

Query: 2  GSKSNRTSSKKWK---RSFRACQTCRERKIKCNLGPLDNPHKPPCERCKREQRECIF--V 56
          G + ++TS+ K K   +S   C  C+ R++KC+ G      KP C++C   + EC++  +
Sbjct: 22 GKRVSKTSTGKRKFHNKSKTGCDNCKRRRVKCDEG------KPFCKKCTNMKLECVYSPI 75

Query: 57 EPSRKSRSLSPKDINYGDDGDDNK 80
          +P R+  S + K     +DG D K
Sbjct: 76 QPRRRKDSSTSKFATIVEDGIDRK 99

>Kwal_27.9688 s27 complement(21328..23853) [2526 bp, 841 aa] {ON}
          YML099C (ARG81) - zinc-finger transcription factor of
          the Zn(2)-Cys(6) binuclear cluster domain type [contig
          336] FULL
          Length = 841

 Score = 48.9 bits (115), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 23/52 (44%), Positives = 32/52 (61%), Gaps = 8/52 (15%)

Query: 4  KSNRTSSKKWKR--SFRACQTCRERKIKCNLGPLDNPHKPPCERCKREQREC 53
          KS+ T  K+ +R  +F  C TCR RK+KC+LG      KP C+RC++   EC
Sbjct: 5  KSSDTKGKEVRRVKTFTGCWTCRSRKVKCDLG------KPNCQRCEKSGLEC 50

>Ecym_5397 Chr5 (805712..808192) [2481 bp, 826 aa] {ON} similar to
           Ashbya gossypii AER370W
          Length = 826

 Score = 48.9 bits (115), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 35/119 (29%), Positives = 53/119 (44%), Gaps = 20/119 (16%)

Query: 1   MGSKSNRTSSK--KWKRSFRACQTCRERKIKCNLGPLDNPHKPPCERCKREQRECIFVEP 58
           M S+  R  S+  K +R  RAC  CR++K+KC     DN H  PC  C     EC + +P
Sbjct: 1   MSSQLERQGSRIAKRRRITRACDECRKKKVKC-----DNRH--PCIHCTVYSYECTYNQP 53

Query: 59  SRKSRSLSPKDINYGDDGDDNKLKFIHYQQGDNKGANNKEIQNMALEDSAWESDVSSMQ 117
           +R++        N   +G +N  +     +  N G +      MA+      S V S+Q
Sbjct: 54  ARRTGG------NKNSEGGENVCRGNRGVKMGNDGGD-----GMAVTGKGSVSKVKSLQ 101

>YKL015W Chr11 (408544..411483) [2940 bp, 979 aa] {ON}
          PUT3Transcriptional activator of proline utilization
          genes, constitutively binds PUT1 and PUT2 promoter
          sequences as a dimer and undergoes a conformational
          change to form the active state; differentially
          phosphorylated in the presence of different nitrogen
          sources; has a Zn(2)-Cys(6) binuclear cluster domain
          Length = 979

 Score = 48.5 bits (114), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 21/56 (37%), Positives = 31/56 (55%), Gaps = 7/56 (12%)

Query: 6  NRTSSKKWKRSFRACQTCRERKIKCNLGPLDNPHKPPCERCKREQRECIFVEPSRK 61
          N+   K+ +RS  AC +CR+R IKC       P   PC++C      C ++EPS+K
Sbjct: 20 NKQPQKRQQRSSVACLSCRKRHIKC-------PGGNPCQKCVTSNAICEYLEPSKK 68

>CAGL0I07755g Chr9 complement(745585..748746) [3162 bp, 1053 aa]
           {ON} similar to uniprot|Q12180 Saccharomyces cerevisiae
           YOL089c HAL9
          Length = 1053

 Score = 48.5 bits (114), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 28/100 (28%), Positives = 49/100 (49%), Gaps = 10/100 (10%)

Query: 11  KKWKRSFRACQTCRERKIKCNLGPLDNPHKPPCERCKREQRECIFV-EPSRKSRSLSPKD 69
           K+ +R+ +AC+ CR+RK KC+     +P+   C  C +   +CIF+ EP++K R  S + 
Sbjct: 169 KEKRRAAKACEYCRKRKTKCDEV---SPYTNKCSNCSKAGVDCIFITEPTKKKRKSSSEG 225

Query: 70  INYGDD------GDDNKLKFIHYQQGDNKGANNKEIQNMA 103
                        +  K K      GDN+  +   ++N+A
Sbjct: 226 TKVNKSPKPAAKTNSTKHKVKKQSDGDNEPVHQNTVENIA 265

>KLLA0E18129g Chr5 (1613115..1615712) [2598 bp, 865 aa] {ON}
          similar to uniprot|P25502 Saccharomyces cerevisiae
          YKL015W PUT3 Positive regulator of PUT (proline
          utilization) genes zinc-finger transcription factor of
          the Zn(2)-Cys(6) binuclear cluster domain type
          Length = 865

 Score = 47.8 bits (112), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 22/51 (43%), Positives = 27/51 (52%), Gaps = 7/51 (13%)

Query: 11 KKWKRSFRACQTCRERKIKCNLGPLDNPHKPPCERCKREQRECIFVEPSRK 61
          KK KRS  AC  CR R IKC       P   PC +C +    C +VEP++K
Sbjct: 37 KKVKRSSLACTRCRRRHIKC-------PGGNPCSKCLKAGVACEYVEPNKK 80

>SAKL0D00264g Chr4 complement(24754..27300) [2547 bp, 848 aa] {ON}
          similar to uniprot|P05085 Saccharomyces cerevisiae
          YML099C ARG81 Zinc-finger transcription factor of the
          Zn(2)-Cys(6) binuclear cluster domain type involved in
          the regulation of arginine-responsive genes acts with
          Arg80p and Arg82p
          Length = 848

 Score = 47.8 bits (112), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 18/39 (46%), Positives = 25/39 (64%), Gaps = 6/39 (15%)

Query: 15 RSFRACQTCRERKIKCNLGPLDNPHKPPCERCKREQREC 53
          ++F  C TCR RK+KC+LG      +P C+RC+R   EC
Sbjct: 15 KTFTGCWTCRSRKVKCDLG------RPSCKRCERSGFEC 47

>KLLA0C10923g Chr3 complement(939148..941475) [2328 bp, 775 aa]
          {ON} weakly similar to uniprot|P07272 Saccharomyces
          cerevisiae YLR014C PPR1 Zinc finger transcription
          factor containing a Zn(2)-Cys(6) binuclear cluster
          domain positively regulates transcription of genes
          involved in uracil biosynthesis activity may be
          modulated by interaction with Tup1p
          Length = 775

 Score = 47.8 bits (112), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 25/61 (40%), Positives = 33/61 (54%), Gaps = 6/61 (9%)

Query: 1  MGSKSNRTSSKKWKRSFRACQTCRERKIKCNLGPLDNPHKPPCERCKREQRECIFVEPSR 60
          M +K  + SS    RS  AC+ CR RKIKC     DN   P C +C + Q  CI ++PS 
Sbjct: 1  MANKVTKESSGNIYRSVAACKRCRIRKIKC-----DNKF-PSCTKCIQAQEPCITIDPST 54

Query: 61 K 61
          +
Sbjct: 55 R 55

>KLTH0E16500g Chr5 (1460844..1463345) [2502 bp, 833 aa] {ON}
          similar to uniprot|P05085 Saccharomyces cerevisiae
          YML099C ARG81 Zinc-finger transcription factor of the
          Zn(2)-Cys(6) binuclear cluster domain type involved in
          the regulation of arginine-responsive genes acts with
          Arg80p and Arg82p
          Length = 833

 Score = 47.0 bits (110), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 18/39 (46%), Positives = 24/39 (61%), Gaps = 6/39 (15%)

Query: 15 RSFRACQTCRERKIKCNLGPLDNPHKPPCERCKREQREC 53
          ++F  C TCR RK+KC+LG      KP C+RC +   EC
Sbjct: 18 KTFTGCWTCRSRKVKCDLG------KPTCQRCDKSGLEC 50

>Skud_11.214 Chr11 (389377..389855,389895..392361) [2946 bp, 981
          aa] {ON} YKL015W (REAL)
          Length = 981

 Score = 47.0 bits (110), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 20/56 (35%), Positives = 30/56 (53%), Gaps = 7/56 (12%)

Query: 6  NRTSSKKWKRSFRACQTCRERKIKCNLGPLDNPHKPPCERCKREQRECIFVEPSRK 61
          N+   ++  RS  AC +CR+R IKC       P   PC++C      C ++EPS+K
Sbjct: 20 NKQRQRRQPRSAVACLSCRKRHIKC-------PGGSPCQKCITSNAICEYLEPSKK 68

>SAKL0H13024g Chr8 complement(1119585..1121849) [2265 bp, 754 aa]
           {ON} similar to gnl|GLV|KLLA0A04169g Kluyveromyces
           lactis KLLA0A04169g and some similarites with YDR213W
           uniprot|Q12151 Saccharomyces cerevisiae YDR213W UPC2
           involved in sterol uptake zinc finger transcription
           factor of the Zn(2)-Cys(6) binuclear cluster domain type
          Length = 754

 Score = 47.0 bits (110), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 23/99 (23%), Positives = 50/99 (50%), Gaps = 19/99 (19%)

Query: 2   GSKSNRTSSKKWK---RSFRACQTCRERKIKCNLGPLDNPHKPPCERCKREQRECIFVEP 58
           G + ++TS+ K K   +S   C  C+ R++KC+ G      KP C++C   + EC++   
Sbjct: 33  GKRVSKTSTGKRKFHNKSKNGCDNCKRRRVKCDEG------KPCCQKCINMKLECVYTPI 86

Query: 59  SRKSRSLSPKDINYGDDGDDNKLKFIHYQQGDNKGANNK 97
           +++ + L+ + +          +K++     D++G  N+
Sbjct: 87  TQRKKRLNGETV----------VKYVTSNTEDDRGVTNR 115

>ZYRO0G19338g Chr7 complement(1601895..1603856) [1962 bp, 653 aa]
           {ON} similar to uniprot|Q754A1 Ashbya gossypii AFR171W
           AFR171Wp and some similarites with YDR034C
           uniprot|P40971 Saccharomyces cerevisiae YDR034C LYS14
           Transcriptional activator involved in regulation of
           genes of the lysine biosynthesis pathway requires
           2-aminoadipate semialdehyde as co-inducer
          Length = 653

 Score = 46.6 bits (109), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 52/189 (27%), Positives = 81/189 (42%), Gaps = 32/189 (16%)

Query: 4   KSNRTSSKKWKRSFRACQTCRERKIKCNLGPLDNPHKPPCERCKREQRECIFVEPSRKSR 63
           K   T  KK K S   C  C++RK+KC      +  KP C +C    ++C++ +PS    
Sbjct: 5   KKTVTIRKKRKYSKLGCNECKKRKVKC------DEQKPECWQCSHLGKKCVYDQPSNGPP 58

Query: 64  SLSPKDIN------------YGDDGDDNKLKFIHYQQGDNKGANNKE--IQN--MALEDS 107
             S K IN            YG + +DN     H  +      NN+   IQN  +AL+  
Sbjct: 59  YKSVKFINASSEDIYSIQSIYGPNTNDND-NADHGYEAQEFSNNNRAPPIQNETLALDSQ 117

Query: 108 AWESDVSSMQNALEYLASAAKSVSQFENHKPT------SKLSDMVNSYSKDDMTQENIIK 161
             + D +S+ N    LA+  + V+   +  P         +  M+ +      + ENI K
Sbjct: 118 FSDGDFASVLNEATELAN--ELVTSMVDPPPMDTTLTGEHIPQMLGA-QNSSTSWENISK 174

Query: 162 ELFEKTELK 170
           ELF  +EL+
Sbjct: 175 ELFMLSELE 183

>Smik_11.240 Chr11 (395459..395932,395981..398437) [2931 bp, 976
          aa] {ON} YKL015W (REAL)
          Length = 976

 Score = 47.0 bits (110), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 20/56 (35%), Positives = 30/56 (53%), Gaps = 7/56 (12%)

Query: 6  NRTSSKKWKRSFRACQTCRERKIKCNLGPLDNPHKPPCERCKREQRECIFVEPSRK 61
          N+    + +RS  AC +CR+R IKC       P   PC++C      C ++EPS+K
Sbjct: 20 NKQRQGRQQRSSIACLSCRKRHIKC-------PGGNPCQKCVASNAICEYLEPSKK 68

>KAFR0C01320 Chr3 (273213..276233) [3021 bp, 1006 aa] {ON} Anc_3.109
           YOL089C
          Length = 1006

 Score = 47.0 bits (110), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 22/51 (43%), Positives = 30/51 (58%), Gaps = 4/51 (7%)

Query: 14  KRSFRACQTCRERKIKCNLGPLDNPHKPPCERCKREQRECIFV-EPSRKSR 63
           +R  +AC  CR+RKIKC  GP+ NP K  C+ C +    C F  +PS + R
Sbjct: 97  RRVSKACDHCRKRKIKC--GPI-NPAKNKCDNCIKYSSACTFTHQPSNQKR 144

>TDEL0F05470 Chr6 (1017743..1020175) [2433 bp, 810 aa] {ON}
           Anc_8.423 YLR228C
          Length = 810

 Score = 46.6 bits (109), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 26/84 (30%), Positives = 43/84 (51%), Gaps = 11/84 (13%)

Query: 2   GSKSNRTSSKKWK---RSFRACQTCRERKIKCNLGPLDNPHKPPCERCKREQRECIF--V 56
           G + +RTS+ K K   +S   C  C+ R++KC+ G      KP C++C   + +C++  V
Sbjct: 29  GKRVSRTSTGKRKFHNKSKNGCDNCKRRRVKCDEG------KPACQKCLNMKLDCVYTPV 82

Query: 57  EPSRKSRSLSPKDINYGDDGDDNK 80
           +P +K  S   K +    D  D K
Sbjct: 83  QPKKKKDSTVVKYVTRNSDEYDEK 106

>Skud_12.296 Chr12 complement(540407..542851) [2445 bp, 814 aa]
          {ON} YLR228C (REAL)
          Length = 814

 Score = 46.6 bits (109), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 23/80 (28%), Positives = 42/80 (52%), Gaps = 11/80 (13%)

Query: 2  GSKSNRTSSKKWK---RSFRACQTCRERKIKCNLGPLDNPHKPPCERCKREQRECIF--V 56
          G K ++TS+ K K   +S   C  C+ R++KC+ G      KP C++C   + +C++  +
Sbjct: 24 GKKVSKTSTGKRKFHNKSKTGCDNCKRRRVKCDEG------KPFCKKCTNMKLDCVYSPI 77

Query: 57 EPSRKSRSLSPKDINYGDDG 76
          +P R+  S + +      DG
Sbjct: 78 QPRRRKDSSTSRFATAAQDG 97

>NDAI0E03460 Chr5 (742144..744993) [2850 bp, 949 aa] {ON} Anc_8.423
          Length = 949

 Score = 46.6 bits (109), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 26/93 (27%), Positives = 44/93 (47%), Gaps = 20/93 (21%)

Query: 2   GSKSNRTSSKKWK---RSFRACQTCRERKIKCNLGPLDNPHKPPCERCKREQRECIFVEP 58
           G K ++TS+ K K   +S   C  C+ R++KC      +  KP C++C   Q  C++  P
Sbjct: 43  GKKVSKTSTGKRKFHNKSKNGCDNCKRRRVKC------DESKPHCQKCVNMQLHCVYTPP 96

Query: 59  -----------SRKSRSLSPKDINYGDDGDDNK 80
                      +RK++S+S    +     DDN+
Sbjct: 97  QPRRSKGRNDTTRKTKSMSGMSDSIMTSTDDNE 129

>Suva_11.213 Chr11 (392506..392993,393045..395514) [2958 bp, 985
          aa] {ON} YKL015W (REAL)
          Length = 985

 Score = 46.6 bits (109), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 20/51 (39%), Positives = 28/51 (54%), Gaps = 7/51 (13%)

Query: 11 KKWKRSFRACQTCRERKIKCNLGPLDNPHKPPCERCKREQRECIFVEPSRK 61
          +K  RS  AC +CR+R IKC       P   PC++C      C ++EPS+K
Sbjct: 25 RKQPRSAVACLSCRKRHIKC-------PGGNPCQKCITSNAICEYLEPSKK 68

>TBLA0A00730 Chr1 (156043..159156) [3114 bp, 1037 aa] {ON}
          Anc_2.654 YKL015W
          Length = 1037

 Score = 46.6 bits (109), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 20/50 (40%), Positives = 26/50 (52%), Gaps = 7/50 (14%)

Query: 12 KWKRSFRACQTCRERKIKCNLGPLDNPHKPPCERCKREQRECIFVEPSRK 61
          K ++  RAC  CRER IKC       P   PC++C      C F EP++K
Sbjct: 51 KKRKITRACIRCRERHIKC-------PGNDPCQKCLEANHICKFSEPNKK 93

>CAGL0F07865g Chr6 complement(768270..770804) [2535 bp, 844 aa]
          {ON} similar to uniprot|Q12151 Saccharomyces cerevisiae
          YDR213w UPC2
          Length = 844

 Score = 46.2 bits (108), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 22/69 (31%), Positives = 38/69 (55%), Gaps = 12/69 (17%)

Query: 2  GSKSNRTSSKKWK---RSFRACQTCRERKIKCNLGPLDNPHKPPCERCKREQRECIFV-- 56
          G K + TS+ K K   +S   C  C+ R++KC+ G      KP C++C + + EC++   
Sbjct: 33 GKKVSTTSTGKRKFHNKSKNGCDHCKRRRVKCDEG------KPMCDKCVKMKLECVYTPV 86

Query: 57 -EPSRKSRS 64
            P R++R+
Sbjct: 87 QPPKRRTRT 95

>YLR228C Chr12 complement(600019..602463) [2445 bp, 814 aa] {ON}
          ECM22Sterol regulatory element binding protein,
          regulates transcription of sterol biosynthetic genes;
          contains Zn[2]-Cys[6] binuclear cluster; homologous to
          Upc2p; relocates from intracellular membranes to
          perinuclear foci on sterol depletion
          Length = 814

 Score = 46.2 bits (108), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 23/72 (31%), Positives = 40/72 (55%), Gaps = 11/72 (15%)

Query: 2  GSKSNRTSSKKWK---RSFRACQTCRERKIKCNLGPLDNPHKPPCERCKREQRECIF--V 56
          G K ++TS+ K K   +S   C  C+ R++KC+ G      KP C++C   + +C++  +
Sbjct: 23 GKKVSKTSTGKRKFHNKSKTGCDNCKRRRVKCDEG------KPFCKKCTNMKLDCVYSPI 76

Query: 57 EPSRKSRSLSPK 68
          +P R+  S S K
Sbjct: 77 QPRRRKDSSSSK 88

>Skud_10.10 Chr10 complement(21672..24173) [2502 bp, 833 aa] {ON}
          YJL206C (REAL)
          Length = 833

 Score = 46.2 bits (108), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 25/79 (31%), Positives = 35/79 (44%), Gaps = 10/79 (12%)

Query: 15 RSFRACQTCRERKIKCNLGPLDNPHKPPCERCKREQRECIFVEPSRKSRSLSPKDINYGD 74
          R+ RAC  CR+RK++C+        + PC  C+    EC +  P R S +    D    D
Sbjct: 29 RAHRACVACRKRKVRCS-------GQTPCRLCQNNSFECKYDRPPRNSSAF---DKELSD 78

Query: 75 DGDDNKLKFIHYQQGDNKG 93
          D      +  H    DNKG
Sbjct: 79 DSPLYSQRASHQDHNDNKG 97

>TBLA0E04750 Chr5 (1222163..1226014) [3852 bp, 1283 aa] {ON}
           Anc_4.344 YML076C
          Length = 1283

 Score = 46.2 bits (108), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 20/60 (33%), Positives = 30/60 (50%)

Query: 4   KSNRTSSKKWKRSFRACQTCRERKIKCNLGPLDNPHKPPCERCKREQRECIFVEPSRKSR 63
           K  R+     KR+  AC +C   K+KC    LD+ ++ PC+RC +  + C F    R  R
Sbjct: 106 KPTRSEGGSSKRNTFACVSCHSSKVKCIPSQLDDIYRKPCQRCLKNGKVCTFDLSKRTKR 165

>KAFR0J01710 Chr10 complement(327570..330116) [2547 bp, 848 aa]
          {ON} Anc_2.231 YIL130W
          Length = 848

 Score = 46.2 bits (108), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 22/78 (28%), Positives = 38/78 (48%), Gaps = 7/78 (8%)

Query: 12 KWKRSFRACQTCRERKIKCNLGPLDNPHKPPCERCKREQRECIFVEPSRKSRSLSPKDIN 71
          K +R  RAC  CR++K+KC+        + PC  C     EC + +PS+++ S     ++
Sbjct: 10 KRRRVTRACDECRKKKVKCD-------GQQPCIHCTVYSYECTYNQPSKRTNSSVTGSMS 62

Query: 72 YGDDGDDNKLKFIHYQQG 89
            +    N L  ++ Q G
Sbjct: 63 ATNISSQNMLSTLNIQSG 80

>NCAS0H00270 Chr8 complement(45600..48320) [2721 bp, 906 aa] {ON}
           Anc_7.512
          Length = 906

 Score = 46.2 bits (108), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 75/321 (23%), Positives = 127/321 (39%), Gaps = 62/321 (19%)

Query: 9   SSKKWKRSFRACQTCRERKIKCNL---GPLDNPHKPPCERCKREQRECIFVEPSRKSRSL 65
           ++ K KR F AC  CR++K KC+     P       PC +C+++   C+  +  R++   
Sbjct: 36  TNHKRKRKF-ACVECRQQKSKCDAYEKAP------DPCTKCQKKGVPCVLKKDFRRTYKR 88

Query: 66  SPKDI----------NYGDDGDDNKLKFIHYQQG---DNKGANNKEIQNMALEDSAWESD 112
           +  ++          +  +   D  LK I  +Q    DN+    ++++   L+ S     
Sbjct: 89  ARNELIEKRFKELTNSLTNLSSDEILKKIEQEQNALLDNRNFTKEKVKQ--LKKSNSIPS 146

Query: 113 VSSMQNALEYLASAAKSVSQFENHKPTSKLSDMVNSYSKDDMTQENIIKELFEKTELKNP 172
           +SS  + L   +SA  S +   N+ P   L +MV +   D MT+E               
Sbjct: 147 ISSNPSKLSPPSSAMGSTT---NNIPIPSLINMVGTLKFDRMTEE--------------- 188

Query: 173 ASSLIAQLSRIRTKPHKKLSDIVYIGDDKLLTEEEARRLIEVFFQKLHPFFPYIPLQLHN 232
                    +++  P K L DI        ++  +   L + +  K H F P + L    
Sbjct: 189 ---------QLKCTP-KSLGDI-------YMSSSDIAELFQEYATKYHQFLPVVDLSKGA 231

Query: 233 PEQLVRYPILLCAVITISARYNNFGDLDLKTRESPDYNITIHEKLWMYCQRL-ISRTIWA 291
                  P L   ++ I  R   FG +DL TR S     T+ E       R   S T   
Sbjct: 232 ERIYTLSPCLFWVILLIGLR-RKFGAIDLMTRLSSLVKSTLAEITISPIIRYNPSDTDEP 290

Query: 292 EASTRSIGTILAFLLFTEWNP 312
             +  S+ ++ +FLL+T W P
Sbjct: 291 VLNVASVYSVQSFLLYTFWPP 311

>Kwal_47.17506 s47 (431921..434695) [2775 bp, 924 aa] {ON} YGL013C
          (PDR1) - zinc-finger transcription factor of the
          Zn(2)-Cys(6) binuclear cluster domain type [contig 207]
          FULL
          Length = 924

 Score = 46.2 bits (108), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 25/70 (35%), Positives = 31/70 (44%), Gaps = 7/70 (10%)

Query: 5  SNRTSSKKWKRSFRACQTCRERKIKCNLGPLDNPHKPPCERCKREQRECIFVEPSRKSRS 64
           NR   KK  +  RAC  CR RKIKC           PC  C+  + EC +  PS  S S
Sbjct: 4  GNRVVKKKRSKVSRACNNCRRRKIKCT-------GAQPCLNCQTYRCECTYSIPSPASLS 56

Query: 65 LSPKDINYGD 74
               +N+ D
Sbjct: 57 SGDVALNFRD 66

>Kpol_455.10 s455 (12074..14566) [2493 bp, 830 aa] {ON}
          (12074..14566) [2493 nt, 831 aa]
          Length = 830

 Score = 45.8 bits (107), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 22/51 (43%), Positives = 30/51 (58%), Gaps = 7/51 (13%)

Query: 3  SKSNRTSSKKWKRSFRACQTCRERKIKCNLGPLDNPHKPPCERCKREQREC 53
          +K+N+ S K+ K +F  C TCR RKIKC+L       KP C +C   + EC
Sbjct: 10 AKNNKNSYKRIK-TFTGCWTCRSRKIKCDLT------KPSCRKCTNSRIEC 53

>Kpol_1001.3 s1001 complement(9551..12121) [2571 bp, 856 aa] {ON}
           complement(9551..12121) [2571 nt, 857 aa]
          Length = 856

 Score = 45.8 bits (107), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 40/134 (29%), Positives = 60/134 (44%), Gaps = 19/134 (14%)

Query: 7   RTSSKKW---KRSFRACQTCRERKIKCNLGPLDNPHKPPCERCKREQRECIF----VEPS 59
           R +S +W   KR+  AC +C   K KC    LD+    PC+RC R ++ C F        
Sbjct: 51  RINSSEWEKRKRNTFACISCHASKQKCVPSDLDDIFLKPCQRCFRSKKICAFDLSKRTRK 110

Query: 60  RKSRSLSPKDINYGDDGDDNKLKF--------IHYQQGDNKGANNKEI----QNMALEDS 107
           RKSRS+ P   +   +   N++K         I  Q       N   I    QN+AL  S
Sbjct: 111 RKSRSIGPLKHSASSEEVSNQVKISSQSMQHSITLQDQSLMKQNLANIPYSNQNVALSCS 170

Query: 108 AWESDVSSMQNALE 121
             E+  S+ Q++++
Sbjct: 171 GLENQPSADQSSIK 184

>TPHA0F00830 Chr6 complement(188299..191877) [3579 bp, 1192 aa]
          {ON} Anc_4.113 YGL013C
          Length = 1192

 Score = 45.8 bits (107), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 21/57 (36%), Positives = 30/57 (52%), Gaps = 7/57 (12%)

Query: 8  TSSKKWKRSFRACQTCRERKIKCNLGPLDNPHKPPCERCKREQRECIFVEPSRKSRS 64
          T+ K+  +  +ACQ+CR RKIKCN          PC  C   + ECI+  P   S++
Sbjct: 16 TAKKQRNKVSKACQSCRRRKIKCN-------GINPCSNCTTYECECIYSIPDSNSQT 65

>TPHA0C04980 Chr3 (1072547..1075105) [2559 bp, 852 aa] {ON}
          Anc_8.879 YML099C
          Length = 852

 Score = 45.8 bits (107), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 20/51 (39%), Positives = 28/51 (54%), Gaps = 6/51 (11%)

Query: 3  SKSNRTSSKKWKRSFRACQTCRERKIKCNLGPLDNPHKPPCERCKREQREC 53
          S S+R +  K  ++F  C TCR RKIKC+L       KP C++C+     C
Sbjct: 6  STSSRDADNKRAKTFEGCWTCRLRKIKCDL------KKPKCDKCRSSAISC 50

>NCAS0H03420 Chr8 complement(648059..650767) [2709 bp, 902 aa]
          {ON} Anc_2.654
          Length = 902

 Score = 45.8 bits (107), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 22/58 (37%), Positives = 31/58 (53%), Gaps = 7/58 (12%)

Query: 4  KSNRTSSKKWKRSFRACQTCRERKIKCNLGPLDNPHKPPCERCKREQRECIFVEPSRK 61
          K+N   S K +    AC  CR+R IKC+ G        PC RC +   +C ++EPS+K
Sbjct: 13 KNNTEPSSKRRPKSLACILCRKRHIKCSGGN-------PCARCIKHDLKCEYIEPSKK 63

>SAKL0E08998g Chr5 complement(747085..749556) [2472 bp, 823 aa]
          {ON} similar to uniprot|P40467 Saccharomyces cerevisiae
          YIL130W ASG1 Proposed transcriptional activator member
          of the Gal4p family of zinc cluster proteins
          Length = 823

 Score = 45.8 bits (107), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 19/59 (32%), Positives = 32/59 (54%), Gaps = 7/59 (11%)

Query: 12 KWKRSFRACQTCRERKIKCNLGPLDNPHKPPCERCKREQRECIFVEPSRKSRSLSPKDI 70
          K +R  RAC  CR++K+KC+        + PC  C     EC + +P+++  S +P+ I
Sbjct: 7  KRRRVTRACDECRKKKVKCD-------GQQPCIHCTVYSYECTYNQPTKRGGSCAPQTI 58

>NCAS0A04750 Chr1 (944929..948354) [3426 bp, 1141 aa] {ON} Anc_2.547
          Length = 1141

 Score = 45.8 bits (107), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 20/53 (37%), Positives = 30/53 (56%), Gaps = 4/53 (7%)

Query: 3   SKSNRTSSKKWKRSFRACQTCRERKIKCNLGPLDNPHKPPCERCKREQRECIF 55
           + SN +S KK  ++ RAC  CR++KIKC+     +  K  C  C+R   +C F
Sbjct: 58  AASNSSSQKKRTKASRACDQCRKKKIKCDF----SEEKTLCSNCQRNGEKCTF 106

>NCAS0C00220 Chr3 (22532..25051) [2520 bp, 839 aa] {ON} Anc_8.879
          Length = 839

 Score = 45.4 bits (106), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 21/52 (40%), Positives = 30/52 (57%), Gaps = 8/52 (15%)

Query: 4  KSNRTSSKKWKRS--FRACQTCRERKIKCNLGPLDNPHKPPCERCKREQREC 53
          KS +T +K+ +R+  F  C TCR RK+KC+L       +P C RC +   EC
Sbjct: 3  KSAKTQTKRPRRAKTFTGCWTCRSRKVKCDL------RRPGCVRCDKSGLEC 48

>Ecym_1146 Chr1 (302989..304986) [1998 bp, 665 aa] {ON} similar to
           Ashbya gossypii AER141C
          Length = 665

 Score = 45.4 bits (106), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 55/243 (22%), Positives = 99/243 (40%), Gaps = 43/243 (17%)

Query: 14  KRSFRACQTCRERKIKCNLGPLDNPHKPPCERCKREQRECIFVEPSRKSRSLSPKDINYG 73
           KR  + C  C++ K+KC           PC RC R   EC F++     +S S +     
Sbjct: 8   KRRTKPCSNCKQNKVKCEYN-----EGLPCSRCTRNGLECYFIQRGNIDKSPSSQK---- 58

Query: 74  DDGDDNKLKFIHYQQGDNKGANNKEIQNMALEDSAWESDVSSMQNALE-YLASAAKSVSQ 132
               +  L+F    Q        KE  N      + +  +++ ++ALE  L     S  Q
Sbjct: 59  ---QETMLQF----QTATTQEPIKEWMN------SIDERLNTFESALESVLGLLHGSQIQ 105

Query: 133 FENHKPTSKLSDMVNSYSKDDMTQENIIKELFEKTELKNPASSLIAQLSRIRTKPHKKLS 192
            +      +       ++  D+ Q  +I  LF+   L                K +  ++
Sbjct: 106 QQQQINLLQQQISQQQHNLPDINQL-LIPTLFDSNSL---------------VKQYTDVN 149

Query: 193 DIVYIGDDKLLTEEEARRLIEVFFQKL-HPFFPYIPLQLHNPEQLVRYPILLCAVITISA 251
           D  +   D +LT+++A+ L+ +F +   +  F Y    LH  +  V  P+LL A+ T+++
Sbjct: 150 DFRF---DHVLTKQQAQELLALFDKNCSNHLFHYTIGDLHIDDLWVNSPLLLAAICTVAS 206

Query: 252 RYN 254
           RY+
Sbjct: 207 RYH 209

>TDEL0C04480 Chr3 (799022..801580) [2559 bp, 852 aa] {ON}
          Anc_2.231 YIL130W possible pseudogene; NNN added to
          avoid internal stop codon
          Length = 852

 Score = 45.4 bits (106), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 19/64 (29%), Positives = 33/64 (51%), Gaps = 7/64 (10%)

Query: 1  MGSKSNRTSSKKWKRSFRACQTCRERKIKCNLGPLDNPHKPPCERCKREQRECIFVEPSR 60
          MG +  +    K +R  RAC  CR++K+KC+        + PC  C     EC + +P++
Sbjct: 1  MGDQQQQILQNKRRRVTRACDECRKKKVKCD-------GQQPCIHCTVYSYECTYNQPTK 53

Query: 61 KSRS 64
          +S +
Sbjct: 54 RSNT 57

>KNAG0A02550 Chr1 complement(262867..265059) [2193 bp, 730 aa]
          {ON} Anc_8.423 YLR228C
          Length = 730

 Score = 45.4 bits (106), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 21/64 (32%), Positives = 34/64 (53%), Gaps = 9/64 (14%)

Query: 6  NRTSSKKW-KRSFRACQTCRERKIKCNLGPLDNPHKPPCERCKREQRECIFV--EPSRKS 62
          N T  +K+  +S   C  C+ R++KC+ G      KP C++C   + EC+F   +P RK 
Sbjct: 19 NSTGKRKFHNKSKNGCDNCKRRRVKCDEG------KPFCQKCANMRLECVFTPPQPRRKK 72

Query: 63 RSLS 66
            +S
Sbjct: 73 SKVS 76

>Ecym_4635 Chr4 complement(1238691..1241261) [2571 bp, 856 aa] {ON}
           similar to Ashbya gossypii ACR209W + ACR208C
          Length = 856

 Score = 45.4 bits (106), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 28/95 (29%), Positives = 41/95 (43%), Gaps = 5/95 (5%)

Query: 9   SSKKWKRSFRACQTCRERKIKCN---LGPLDNPHKPPCERCKREQRECIFVEPSRKSRSL 65
           S KK K + RAC  CR+RKI+C+    G +    +  C  C     +CIFV   R  R +
Sbjct: 7   SGKKRKVAKRACLACRKRKIRCDGETRGTVVEDGQRVCSNCANHGLKCIFVRSQRGGRRM 66

Query: 66  SPKDINYGDDGDDNKLKFIHYQQGDNKGANNKEIQ 100
             K + +     +NK   I     + +G      Q
Sbjct: 67  PRKKLQHAT--SENKTSCIDSNDTNRQGYKESPFQ 99

>NDAI0C00260 Chr3 (40019..43144) [3126 bp, 1041 aa] {ON} Anc_2.654
          YKL015W
          Length = 1041

 Score = 45.1 bits (105), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 19/47 (40%), Positives = 25/47 (53%), Gaps = 7/47 (14%)

Query: 15 RSFRACQTCRERKIKCNLGPLDNPHKPPCERCKREQRECIFVEPSRK 61
          R   AC  CR R +KC       P+  PC RC + + +C + EPSRK
Sbjct: 35 RKSNACIQCRRRHVKC-------PNGNPCLRCVKSKLQCEYSEPSRK 74

>KLLA0A03421g Chr1 (308414..311056) [2643 bp, 880 aa] {ON} weakly
          similar to uniprot|P39720 Saccharomyces cerevisiae
          YAL051W OAF1 Oleate-activated transcription factor acts
          alone and as a heterodimer with Pip2p activates genes
          involved in beta-oxidation of fatty acids and
          peroxisome organization and biogenesis
          Length = 880

 Score = 44.7 bits (104), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 20/52 (38%), Positives = 30/52 (57%), Gaps = 7/52 (13%)

Query: 4  KSNRTSSKKWKRSFRACQTCRERKIKCNLGPLDNPHKPPCERCKREQRECIF 55
          ++N  + K++K SF  CQ CR+ K KC+        KP C RC+R  + CI+
Sbjct: 6  EANLKAKKRYKLSF-VCQLCRKSKTKCD------RKKPSCARCQRLNKPCIY 50

>AAL175W Chr1 (32874..35525) [2652 bp, 883 aa] {ON} Non-syntenic
          homolog of Saccharomyces cerevisiae YML099C (ARG81)
          Length = 883

 Score = 44.7 bits (104), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 17/39 (43%), Positives = 25/39 (64%), Gaps = 6/39 (15%)

Query: 15 RSFRACQTCRERKIKCNLGPLDNPHKPPCERCKREQREC 53
          ++F  C TCR RK+KC+LG      KP C+RC++   +C
Sbjct: 39 KTFTGCWTCRLRKVKCDLG------KPSCQRCEKSGLDC 71

>SAKL0D03586g Chr4 (290224..292629) [2406 bp, 801 aa] {ON} similar
           to uniprot|P40971 Saccharomyces cerevisiae YDR034C LYS14
           Transcriptional activator involved in regulation of
           genes of the lysine biosynthesis pathway requires
           2-aminoadipate semialdehyde as co-inducer
          Length = 801

 Score = 44.7 bits (104), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 20/58 (34%), Positives = 33/58 (56%), Gaps = 9/58 (15%)

Query: 7   RTSSKKWKRSFRACQTCRERKIKCNLGPLDNPHKPPCERCKREQRECIFV-EPSRKSR 63
           + S +K+ R+   C  C++R++KC+ G      KP C +C R  REC+++  P  K R
Sbjct: 153 KISKRKYSRN--GCTECKKRRMKCDEG------KPSCWQCTRLNRECVYILNPKNKKR 202

>NCAS0A12580 Chr1 complement(2481447..2483561) [2115 bp, 704 aa]
          {ON} 
          Length = 704

 Score = 44.7 bits (104), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 18/53 (33%), Positives = 31/53 (58%), Gaps = 4/53 (7%)

Query: 3  SKSNRTSSKKWKRSFRACQTCRERKIKCNLGPLDNPHKPPCERCKREQRECIF 55
          +K  R+ ++K K++ RAC  C  R+IKC+     NP    C  C++ + +C+F
Sbjct: 27 NKPERSYNRKRKKASRACDQCHHRRIKCDF----NPETRNCSGCEKTEEKCLF 75

>NDAI0K00150 Chr11 complement(20792..23653) [2862 bp, 953 aa] {ON}
          Anc_8.879 YML099C
          Length = 953

 Score = 44.7 bits (104), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 16/39 (41%), Positives = 24/39 (61%), Gaps = 6/39 (15%)

Query: 15 RSFRACQTCRERKIKCNLGPLDNPHKPPCERCKREQREC 53
          ++F  C TCR RK+KC+L       +P C RC+R + +C
Sbjct: 7  KTFTGCWTCRSRKVKCDL------RRPNCSRCERSELQC 39

>NDAI0K01800 Chr11 (401055..404687) [3633 bp, 1210 aa] {ON}
           Anc_2.547
          Length = 1210

 Score = 44.7 bits (104), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 21/55 (38%), Positives = 31/55 (56%), Gaps = 5/55 (9%)

Query: 2   GSKSNRTSS-KKWKRSFRACQTCRERKIKCNLGPLDNPHKPPCERCKREQRECIF 55
           GS +N T++ KK  ++ RAC  CR++KIKC+     N     C  C+R   +C F
Sbjct: 72  GSNTNNTTTVKKRTKASRACDQCRKKKIKCDFTEAKN----ICSNCQRNAEKCTF 122

>SAKL0G19470g Chr7 complement(1677759..1680254) [2496 bp, 831 aa]
          {ON} similar to uniprot|P25502 Saccharomyces cerevisiae
          YKL015W PUT3 Positive regulator of PUT (proline
          utilization) genes zinc-finger transcription factor of
          the Zn(2)-Cys(6) binuclear cluster domain type
          Length = 831

 Score = 44.7 bits (104), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 19/51 (37%), Positives = 26/51 (50%), Gaps = 7/51 (13%)

Query: 11 KKWKRSFRACQTCRERKIKCNLGPLDNPHKPPCERCKREQRECIFVEPSRK 61
          K+ KRS  AC  CR R +KC       P   PC +C      C ++EP++K
Sbjct: 39 KRQKRSSMACVRCRRRHVKC-------PGGNPCSKCIAANIACEYIEPNKK 82

>Smik_2.438 Chr2 (786437..787846) [1410 bp, 469 aa] {ON} YBR297W
          (REAL)
          Length = 469

 Score = 44.3 bits (103), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 30/85 (35%), Positives = 40/85 (47%), Gaps = 20/85 (23%)

Query: 19 ACQTCRERKIKCNLGPLDNPHKPPCERCKREQRECIFVEPSRKSRSLSPKDINYGDDGDD 78
          AC  CR R++KC+        K PC RC +   EC + +P RK     PK I     GD 
Sbjct: 7  ACDFCRVRRVKCD-------GKKPCSRCIQHDFECTYQQPLRKR---GPKRI-----GDR 51

Query: 79 NKLKFI----HYQQGDNKGANNKEI 99
          N LK+I     Y+  ++   N  EI
Sbjct: 52 N-LKYITEAQKYKDNNDSCTNTAEI 75

>KNAG0K00820 Chr11 complement(153470..156622) [3153 bp, 1050 aa]
           {ON} Anc_3.109 YOL089C
          Length = 1050

 Score = 44.7 bits (104), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 25/67 (37%), Positives = 35/67 (52%), Gaps = 7/67 (10%)

Query: 14  KRSFRACQTCRERKIKCNLGPLDNPHKPPCERCKREQRECIF----VEPSRKSRSLSPKD 69
           KR   AC  CR+RKIKC  GP+ N  +  C  C +   EC F       +RK  +L P++
Sbjct: 142 KRVSMACDHCRKRKIKC--GPI-NTVENKCSHCIKYNAECTFQHRDAMQARKRNNLDPQN 198

Query: 70  INYGDDG 76
            +YG+  
Sbjct: 199 DDYGESA 205

>Smik_12.289 Chr12 complement(540824..543262) [2439 bp, 812 aa]
          {ON} YLR228C (REAL)
          Length = 812

 Score = 44.3 bits (103), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 21/72 (29%), Positives = 40/72 (55%), Gaps = 11/72 (15%)

Query: 2  GSKSNRTSSKKWK---RSFRACQTCRERKIKCNLGPLDNPHKPPCERCKREQRECIF--V 56
          G + ++TS+ K K   +S   C  C+ R++KC+ G      KP C++C   + +C++  +
Sbjct: 23 GKRVSKTSTGKRKFHNKSKTGCDNCKRRRVKCDEG------KPFCKKCTNMKLDCVYSPI 76

Query: 57 EPSRKSRSLSPK 68
          +P R+  S + K
Sbjct: 77 QPRRRKDSSTSK 88

>NCAS0I00270 Chr9 complement(33129..35963) [2835 bp, 944 aa] {ON}
          Anc_7.17 YAL051W
          Length = 944

 Score = 44.3 bits (103), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 19/51 (37%), Positives = 27/51 (52%), Gaps = 7/51 (13%)

Query: 5  SNRTSSKKWKRSFRACQTCRERKIKCNLGPLDNPHKPPCERCKREQRECIF 55
          S  T  K+++ SF  CQ CR  K+KC      +  KP C RC +   EC++
Sbjct: 26 SQVTKKKRYRLSF-VCQGCRRSKVKC------DQEKPVCSRCSKHDLECVY 69

>Kwal_56.22605 s56 (200072..202669) [2598 bp, 865 aa] {ON} YOL089C
          (HAL9) - 1:1 [contig 184] FULL
          Length = 865

 Score = 44.3 bits (103), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 26/75 (34%), Positives = 34/75 (45%), Gaps = 3/75 (4%)

Query: 3  SKSNRTSSKKWKRSFRACQTCRERKIKCNLGPLDNPHKPPCERCKREQRECIFVEPSRKS 62
          S +  +  K  KR  +AC  CR+RKIKC  GP+ NP    CE C +    C F      S
Sbjct: 12 SPTELSGGKFRKRVPKACDHCRKRKIKC--GPV-NPITGTCENCNKFNTSCTFRHHDEIS 68

Query: 63 RSLSPKDINYGDDGD 77
          R     D+    D +
Sbjct: 69 RHRKFTDLKRASDNE 83

>Ecym_8159 Chr8 (330207..332933) [2727 bp, 908 aa] {ON} similar to
          Ashbya gossypii AAL175W
          Length = 908

 Score = 44.3 bits (103), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 18/46 (39%), Positives = 27/46 (58%), Gaps = 6/46 (13%)

Query: 8  TSSKKWKRSFRACQTCRERKIKCNLGPLDNPHKPPCERCKREQREC 53
          T+ +   ++F  C TCR RK+KC+LG      KP C+RC++    C
Sbjct: 34 TARRPRAKTFTGCWTCRIRKVKCDLG------KPNCQRCEKSGLSC 73

>Kwal_56.23058 s56 complement(381390..383717) [2328 bp, 775 aa] {ON}
           YDR034C (LYS14) - 1:1 [contig 183] FULL
          Length = 775

 Score = 44.3 bits (103), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 23/70 (32%), Positives = 37/70 (52%), Gaps = 9/70 (12%)

Query: 6   NRTSSKKWKRSFRACQTCRERKIKCNLGPLDNPHKPPCERCKREQRECIFVEPSRKSRSL 65
            +T  +K+ R+   C  C+ R++KC+ G      KP C +C R  REC++V  + K+R  
Sbjct: 137 GKTVKRKYSRN--GCTECKRRRMKCDEG------KPTCWQCARLNRECVYVIRT-KNRKR 187

Query: 66  SPKDINYGDD 75
            PK  +   D
Sbjct: 188 RPKSTDNSKD 197

>TPHA0B00410 Chr2 complement(84722..87559) [2838 bp, 945 aa] {ON}
          Anc_4.344 YML076C
          Length = 945

 Score = 44.3 bits (103), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 22/58 (37%), Positives = 29/58 (50%)

Query: 11 KKWKRSFRACQTCRERKIKCNLGPLDNPHKPPCERCKREQRECIFVEPSRKSRSLSPK 68
          +K KR+  AC TC   K KC    L+N    PC RC + +R+C F    R     +PK
Sbjct: 33 QKRKRNTVACITCHSSKQKCVPSDLNNIFWKPCIRCLKSKRQCTFDLSKRTRNRRTPK 90

>KLTH0C00814g Chr3 (76637..79141) [2505 bp, 834 aa] {ON} similar
          to uniprot|P25502 Saccharomyces cerevisiae YKL015W PUT3
          Positive regulator of PUT (proline utilization) genes
          zinc-finger transcription factor of the Zn(2)-Cys(6)
          binuclear cluster domain type
          Length = 834

 Score = 43.9 bits (102), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 21/57 (36%), Positives = 30/57 (52%), Gaps = 7/57 (12%)

Query: 5  SNRTSSKKWKRSFRACQTCRERKIKCNLGPLDNPHKPPCERCKREQRECIFVEPSRK 61
          S+RTS ++ KRS  AC  CR R  KC+        + PC  C      C ++EP++K
Sbjct: 38 SSRTSKRRIKRSGLACVRCRRRHAKCS-------GEKPCSTCVAANIACEYMEPNKK 87

>KLLA0F04609g Chr6 complement(451579..454329) [2751 bp, 916 aa]
          {ON} similar to uniprot|P40467 Saccharomyces cerevisiae
          YIL130W ASG1 Proposed transcriptional activator member
          of the Gal4p family of zinc cluster proteins
          Length = 916

 Score = 43.9 bits (102), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 18/51 (35%), Positives = 28/51 (54%), Gaps = 7/51 (13%)

Query: 12 KWKRSFRACQTCRERKIKCNLGPLDNPHKPPCERCKREQRECIFVEPSRKS 62
          K +R  RAC  CR++K+KC+        K PC  C     EC + +P+R++
Sbjct: 6  KRRRVTRACDECRKKKVKCD-------GKQPCIHCTVYNYECTYNQPTRRT 49

>CAGL0M12298g Chr13 complement(1227303..1230287) [2985 bp, 994 aa]
           {ON} similar to uniprot|P39720 Saccharomyces cerevisiae
           YAL051w OAF1 peroxisome proliferating transcription
           factor or uniprot|P52960 Saccharomyces cerevisiae
           YOR363c PIP2
          Length = 994

 Score = 43.9 bits (102), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 35/122 (28%), Positives = 56/122 (45%), Gaps = 19/122 (15%)

Query: 4   KSNRTSSKKWKRSFRACQTCRERKIKCNLGPLDNPHKPPCERCKREQRECIFVEPSRKSR 63
           + N   ++K  R    CQ CR  K +C+        KP C RCK+ + EC++    + + 
Sbjct: 11  EGNAARTRKRNRISFVCQACRRSKTRCD------KEKPICTRCKKLKLECVYDMAKQSAP 64

Query: 64  SLSPKDINYGDDGDD-----NK-LKFIHYQQG--DNKGAN--NKEIQNMALEDSAWESDV 113
            +  KD      G D     NK +K +  Q+    NK +N  +  ++NM   +S +ESD 
Sbjct: 65  RIPSKDATIARLGRDVDYWKNKAMKLMQEQESMPVNKDSNVSSGSLENM---NSDYESDG 121

Query: 114 SS 115
            S
Sbjct: 122 ES 123

>KLLA0C17050g Chr3 (1490472..1493339) [2868 bp, 955 aa] {ON}
           conserved hypothetical protein
          Length = 955

 Score = 43.9 bits (102), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 29/105 (27%), Positives = 44/105 (41%), Gaps = 24/105 (22%)

Query: 12  KWKRSFRACQTCRERKIKCNLGPLDNPHKPPCERCKREQRECIFVEPSRKSR------SL 65
           K +R   +C  C +RKIKC+        KP CE C +   EC++   +R SR      S 
Sbjct: 38  KRQRQILSCVACHKRKIKCDRA------KPVCESCGKNGWECLYFLNARVSRGGKHNIST 91

Query: 66  SPKDINYGDDGDDNKLKFI------------HYQQGDNKGANNKE 98
             +D+   +   +  LK I            H QQ  N  ++ K+
Sbjct: 92  GTEDVTASEASKEELLKVIEKAKVLELEQQRHQQQNKNDNSSQKQ 136

>ZYRO0A00440g Chr1 complement(27895..30447) [2553 bp, 850 aa] {ON}
          similar to uniprot|P05085 Saccharomyces cerevisiae
          YML099C ARG81 Zinc-finger transcription factor of the
          Zn(2)-Cys(6) binuclear cluster domain type involved in
          the regulation of arginine-responsive genes acts with
          Arg80p and Arg82p
          Length = 850

 Score = 43.5 bits (101), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 20/48 (41%), Positives = 28/48 (58%), Gaps = 7/48 (14%)

Query: 6  NRTSSKKWKRSFRACQTCRERKIKCNLGPLDNPHKPPCERCKREQREC 53
          N T SK+ K +F  C TCR RK+KC+L       +P C+RC++    C
Sbjct: 27 NGTKSKRGK-TFTGCWTCRSRKVKCDL------RRPHCQRCEKSGLVC 67

>Ecym_7440 Chr7 complement(902108..904804) [2697 bp, 898 aa] {ON}
           similar to Ashbya gossypii AER183C
          Length = 898

 Score = 43.5 bits (101), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 26/93 (27%), Positives = 39/93 (41%), Gaps = 15/93 (16%)

Query: 14  KRSFRACQTCRERKIKCNLGPLDNPHKPPCERCKREQRECIFVEPSRKSRSLSPKDINYG 73
           KR  +AC TCR +KIKCN        + PC  C +   EC +    ++ R +  +  N  
Sbjct: 21  KRVSKACDTCRAKKIKCN-------GEEPCSNCGKHDLECAYTHVIKRRRPVPTRISNRK 73

Query: 74  DDGD--------DNKLKFIHYQQGDNKGANNKE 98
             GD        +  L+ +  + G   G   KE
Sbjct: 74  LLGDLSSRLQRLEQLLERVSSKLGAGAGRQGKE 106

>Smik_4.460 Chr4 (833609..836365) [2757 bp, 918 aa] {ON} YDR213W
          (REAL)
          Length = 918

 Score = 43.5 bits (101), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 19/58 (32%), Positives = 31/58 (53%), Gaps = 9/58 (15%)

Query: 2  GSKSNRTSSKKWK---RSFRACQTCRERKIKCNLGPLDNPHKPPCERCKREQRECIFV 56
          G K + TS+ K K   +S   C  C+ R++KC+ G      KP C++C   + EC++ 
Sbjct: 30 GKKVSTTSTGKRKFHNKSKNGCDNCKRRRVKCDEG------KPACKKCTNMKLECVYT 81

>TBLA0C01910 Chr3 complement(448085..448684,448765..451611) [3447
           bp, 1148 aa] {ON} Anc_5.577 YML034W
          Length = 1148

 Score = 43.5 bits (101), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 22/60 (36%), Positives = 32/60 (53%), Gaps = 7/60 (11%)

Query: 12  KWKRSFRACQTCRERKIKCNLGPLDNPHKPPCERCKREQRECIFVE-PSRKSRSLSPKDI 70
           K  +  RAC TCR+ KI C+        KP C  C ++ + CI+ + PS  + S  PKD+
Sbjct: 300 KLNKKPRACLTCRKSKIGCDRT------KPDCNNCTKKNKTCIYPDVPSTANSSNKPKDL 353

>NCAS0C02730 Chr3 (513280..515607) [2328 bp, 775 aa] {ON} Anc_8.423
          Length = 775

 Score = 43.5 bits (101), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 21/74 (28%), Positives = 35/74 (47%), Gaps = 9/74 (12%)

Query: 2   GSKSNRTSSKKWK---RSFRACQTCRERKIKCNLGPLDNPHKPPCERCKREQRECIFVEP 58
           G K ++TS+ K K   +S   C  C+ R++KC+        KP C++C     EC++  P
Sbjct: 37  GKKVSKTSTGKRKFHNKSKNGCDNCKRRRVKCD------ELKPTCQKCINMNLECVYSMP 90

Query: 59  SRKSRSLSPKDINY 72
             +    S   + Y
Sbjct: 91  KPRKAKGSSTSVRY 104

>TDEL0D05150 Chr4 (932888..935878) [2991 bp, 996 aa] {ON} Anc_3.109
           YOL089C
          Length = 996

 Score = 43.5 bits (101), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 32/92 (34%), Positives = 40/92 (43%), Gaps = 10/92 (10%)

Query: 14  KRSFRACQTCRERKIKCNLGPLDNPHKPPCERCKREQRECIFV---EPSRKSRSLSPKDI 70
           KR  RAC  CR RKIKC+  P+ NP    C  C +    C F    +  ++ R+    D 
Sbjct: 112 KRVARACDHCRRRKIKCD--PV-NPQTNKCSNCTKYDANCTFRVRDDVEKRKRANEAIDG 168

Query: 71  NYGDDGDDNKLKFI----HYQQGDNKGANNKE 98
           + G   D N L F       Q GD   A N E
Sbjct: 169 SGGVSEDLNILGFAPTPGMGQNGDEYHAGNME 200

>AGL091W Chr7 (535317..537917) [2601 bp, 866 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YLR228C (ECM22) and
           YDR213W (UPC2)
          Length = 866

 Score = 43.5 bits (101), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 43/155 (27%), Positives = 68/155 (43%), Gaps = 33/155 (21%)

Query: 2   GSKSNRTSSKKWK---RSFRACQTCRERKIKCNLGPLDNPHKPPCERCKREQRECIF--V 56
           G K ++T++ K K   +S   C  C+ R++KC+ G      KP C++C + +  C++   
Sbjct: 68  GKKVSKTATGKRKFHNKSKNGCDNCKRRRVKCDEG------KPGCQKCLKMRLSCVYTPA 121

Query: 57  EPSRKSRSLSPKDINY-------GDDGD-DNKLKFIHYQQGDNKGANNKEIQNMALEDSA 108
           +P +K        I Y        DDGD D  +K++       +G + K       +DS 
Sbjct: 122 KPRKKKDRDVETVIKYVTRGNDEKDDGDVDTVIKYV------TRGNDEK-------DDSR 168

Query: 109 WESDVSSMQNALEYLASAAKSVSQFENHKPTSKLS 143
            E      QNA    A+ A S SQ E   P +  S
Sbjct: 169 DELGQQDNQNA-PLAANLAVSGSQIEGAVPQTSPS 202

>TBLA0I02540 Chr9 (590352..594131) [3780 bp, 1259 aa] {ON} Anc_8.423
           YLR228C
          Length = 1259

 Score = 43.5 bits (101), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 18/58 (31%), Positives = 33/58 (56%), Gaps = 9/58 (15%)

Query: 2   GSKSNRTSSKKWK---RSFRACQTCRERKIKCNLGPLDNPHKPPCERCKREQRECIFV 56
           G K ++TS+ K K   +S   C  C+ R++KC+ G      KP C++C   + +C+++
Sbjct: 182 GKKVSKTSTGKRKFHNKSKNGCVNCKRRRVKCDEG------KPTCKKCLNMKLDCVYL 233

>Kwal_23.3122 s23 complement(166388..168754) [2367 bp, 788 aa]
          {ON} YDR213W (UPC2) - zinc finger transcription factor
          of the Zn(2)-Cys(6) binuclear cluster domain type
          [contig 249] FULL
          Length = 788

 Score = 43.5 bits (101), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 23/69 (33%), Positives = 37/69 (53%), Gaps = 10/69 (14%)

Query: 2  GSKSNRTSSKK---WKRSFRACQTCRERKIKCNLGPLDNPHKPPCERCKREQRECIFVE- 57
          G K ++TS+ K    K+S   C  C+ R++KC      +  KP C++C   + EC++   
Sbjct: 29 GKKVSKTSTGKRKFHKKSKNGCDNCKRRRVKC------DEDKPSCQKCLNMKLECVYTPV 82

Query: 58 PSRKSRSLS 66
           SRK +S S
Sbjct: 83 TSRKRKSSS 91

>Kpol_538.52 s538 (126243..128966) [2724 bp, 907 aa] {ON}
          (126243..128966) [2724 nt, 908 aa]
          Length = 907

 Score = 43.5 bits (101), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 16/35 (45%), Positives = 23/35 (65%), Gaps = 6/35 (17%)

Query: 14 KRSFRACQTCRERKIKCNLGPLDNPHKPPCERCKR 48
          ++SF  C TCR RK+KC+L      ++P C+RC R
Sbjct: 11 RKSFNGCWTCRSRKVKCDL------NRPKCQRCDR 39

>KLTH0C07480g Chr3 (645219..647546) [2328 bp, 775 aa] {ON} similar
           to uniprot|P40971 Saccharomyces cerevisiae YDR034C LYS14
           Transcriptional activator involved in regulation of
           genes of the lysine biosynthesis pathway requires
           2-aminoadipate semialdehyde as co- inducer
          Length = 775

 Score = 43.5 bits (101), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 24/66 (36%), Positives = 36/66 (54%), Gaps = 8/66 (12%)

Query: 3   SKSNRTSSKKWKRSFRACQTCRERKIKCNLGPLDNPHKPPCERCKREQRECIFVEPSRKS 62
           S SN  + K+ K S   C  C+ R++KC+ G      KP C +C R  REC+++  + K+
Sbjct: 133 SNSNGKTVKR-KYSRNGCTECKRRRMKCDEG------KPTCWQCARLNRECVYIIRT-KN 184

Query: 63  RSLSPK 68
           R   PK
Sbjct: 185 RKRRPK 190

>TBLA0H00680 Chr8 complement(144914..147556) [2643 bp, 880 aa] {ON}
           Anc_8.423 YLR228C
          Length = 880

 Score = 43.5 bits (101), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 18/65 (27%), Positives = 36/65 (55%), Gaps = 9/65 (13%)

Query: 2   GSKSNRTSSKKWK---RSFRACQTCRERKIKCNLGPLDNPHKPPCERCKREQRECIFVEP 58
           G K ++TS  K K   +S   C  C+ R++KC+ G      KP C++C   + +C+++  
Sbjct: 85  GKKVSKTSKGKRKFHNKSKNGCANCKRRRVKCDEG------KPTCQKCLNMKLQCVYLPV 138

Query: 59  SRKSR 63
           + +++
Sbjct: 139 TARNK 143

>KAFR0L02130 Chr12 (403953..406601) [2649 bp, 882 aa] {ON}
          Anc_8.879 YML099C
          Length = 882

 Score = 43.1 bits (100), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 18/48 (37%), Positives = 27/48 (56%), Gaps = 6/48 (12%)

Query: 6  NRTSSKKWKRSFRACQTCRERKIKCNLGPLDNPHKPPCERCKREQREC 53
          N+ S  +  ++F  C TCR RK+KC+L       +P C RC+R   +C
Sbjct: 8  NKRSRIQRAKTFTGCWTCRARKVKCDL------TRPSCTRCERSGLKC 49

>Suva_6.285 Chr6 (499581..501941) [2361 bp, 786 aa] {ON} YJL206C
           (REAL)
          Length = 786

 Score = 43.1 bits (100), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 27/85 (31%), Positives = 38/85 (44%), Gaps = 25/85 (29%)

Query: 15  RSFRACQTCRERKIKCNLGPLDNPHKPPCERCKREQRECIFVEPSRK----SRSLSPKDI 70
           R+ RAC  CR+RK++C+        + PC  C   + EC +  P RK     R LS    
Sbjct: 62  RAHRACMACRKRKVRCS-------GQIPCRFCHTNKLECTYDRPPRKPPVFGRELS---- 110

Query: 71  NYGDDGDDNKLKFIHYQQGDNKGAN 95
                 DDN L    Y QG ++  +
Sbjct: 111 ------DDNSL----YSQGTSQQGD 125

>KNAG0J00210 Chr10 (26132..28717) [2586 bp, 861 aa] {ON} Anc_8.879
          YML099C
          Length = 861

 Score = 43.1 bits (100), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 22/56 (39%), Positives = 28/56 (50%), Gaps = 9/56 (16%)

Query: 1  MGSKSNRTSSKKWKR---SFRACQTCRERKIKCNLGPLDNPHKPPCERCKREQREC 53
          M SK  R   K   R   +F  C TCR RK+KC+L       +P C RC++   EC
Sbjct: 1  MTSKQRRPRVKARPRRAKTFTGCWTCRSRKVKCDL------RRPGCLRCEKSSLEC 50

>Skud_15.546 Chr15 (990335..991963) [1629 bp, 542 aa] {ON} YOR380W
           (REAL)
          Length = 542

 Score = 43.1 bits (100), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 31/102 (30%), Positives = 41/102 (40%), Gaps = 7/102 (6%)

Query: 1   MGSKSNRTSSKKWKRSFRACQTCRERKIKCNLGPLDNPHKPPCERCKREQRECIFVEPSR 60
           M S  + +   K +R  +AC  CRERK KCN        K PCE C      C + +   
Sbjct: 1   MVSSGSNSQPYKRQRVRKACVPCRERKRKCN-------GKSPCEMCIAYGYACHYTDVDG 53

Query: 61  KSRSLSPKDINYGDDGDDNKLKFIHYQQGDNKGANNKEIQNM 102
            S S    +  YG D     L  I   +  +  A N   QN+
Sbjct: 54  SSTSPRVDETPYGTDNRPYSLPNILRNEARSVDAQNVTNQNI 95

>ZYRO0D14080g Chr4 (1191418..1194183) [2766 bp, 921 aa] {ON} weakly
           similar to uniprot|Q12172 Saccharomyces cerevisiae
           YOR162C YRR1 Zn2-Cys6 zinc-finger transcription factor
           that activates genes involved in multidrug resistance
           paralog of Yrm1p acting on an overlapping set of target
           genes
          Length = 921

 Score = 43.1 bits (100), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 23/70 (32%), Positives = 35/70 (50%), Gaps = 7/70 (10%)

Query: 8   TSSKKWKRSFRACQTCRERKIKCNLGPLDNPHKPPCERC-KREQRECIFVEPSRKSRSLS 66
           T  KK  +  ++C  CR RK++C      +  KP C  C  RE  EC+++E S   R+++
Sbjct: 41  TVKKKRMKPIKSCTFCRRRKLRC------DQQKPMCSTCIARELPECVYMESSSTPRTVA 94

Query: 67  PKDINYGDDG 76
            K  N    G
Sbjct: 95  GKRGNIDSIG 104

>Kpol_1039.11 s1039 (29727..32705) [2979 bp, 992 aa] {ON}
          (29727..32705) [2979 nt, 993 aa]
          Length = 992

 Score = 43.1 bits (100), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 18/53 (33%), Positives = 28/53 (52%), Gaps = 7/53 (13%)

Query: 12 KWKRSFRACQTCRERKIKCNLGPLDNPHKPPCERCKREQRECIFVEPSRKSRS 64
          K +R  RAC  CR++K+KC+        + PC  C      C + +PS++S S
Sbjct: 28 KRRRVTRACDECRKKKVKCD-------GQQPCIHCTVYSYNCTYNQPSKRSNS 73

>Suva_2.381 Chr2 (669136..671892) [2757 bp, 918 aa] {ON} YDR213W
          (REAL)
          Length = 918

 Score = 43.1 bits (100), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 19/58 (32%), Positives = 31/58 (53%), Gaps = 9/58 (15%)

Query: 2  GSKSNRTSSKKWK---RSFRACQTCRERKIKCNLGPLDNPHKPPCERCKREQRECIFV 56
          G K + TS+ K K   +S   C  C+ R++KC+ G      KP C++C   + EC++ 
Sbjct: 30 GKKVSTTSTGKRKFHNKSKNGCDNCKRRRVKCDEG------KPACKKCTNMKLECLYT 81

>NDAI0A06990 Chr1 (1593540..1596476) [2937 bp, 978 aa] {ON}
           Anc_3.109
          Length = 978

 Score = 43.1 bits (100), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 25/66 (37%), Positives = 33/66 (50%), Gaps = 9/66 (13%)

Query: 14  KRSFRACQTCRERKIKCNLGPLDNPHKPPCERCKREQRECIF---VEPSRKSRSLSPKDI 70
           KR  RAC  CR+RKIKC+     +P    C  C +   +C F   +E  +K R    KD 
Sbjct: 150 KRGTRACDYCRKRKIKCSAV---DPKTKKCPNCDKNNMKCTFKFHMELEKKKRL---KDA 203

Query: 71  NYGDDG 76
            + DDG
Sbjct: 204 EFYDDG 209

>NCAS0B06550 Chr2 complement(1242371..1245091) [2721 bp, 906 aa]
          {ON} Anc_2.231
          Length = 906

 Score = 43.1 bits (100), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 18/52 (34%), Positives = 28/52 (53%), Gaps = 7/52 (13%)

Query: 12 KWKRSFRACQTCRERKIKCNLGPLDNPHKPPCERCKREQRECIFVEPSRKSR 63
          K +R  RAC  CR++K+KC+        + PC  C     EC +  PS++S+
Sbjct: 29 KRRRVTRACDECRKKKVKCD-------GQQPCIHCTVYSYECTYNHPSKRSQ 73

>TDEL0D03610 Chr4 (664819..666993) [2175 bp, 724 aa] {ON} Anc_3.264
           YDR034C
          Length = 724

 Score = 42.7 bits (99), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 20/52 (38%), Positives = 28/52 (53%), Gaps = 8/52 (15%)

Query: 5   SNRTSSKKWKRSFRACQTCRERKIKCNLGPLDNPHKPPCERCKREQRECIFV 56
           SN    +K+ R+   C  C+ R+IKC+        KP C +C R  RECI+V
Sbjct: 110 SNGNVKRKYSRN--GCTECKRRRIKCD------ETKPTCWQCARLNRECIYV 153

>ZYRO0D08316g Chr4 (719929..721971) [2043 bp, 680 aa] {ON}
          conserved hypothetical protein
          Length = 680

 Score = 42.7 bits (99), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 21/54 (38%), Positives = 28/54 (51%), Gaps = 2/54 (3%)

Query: 2  GSKSNRTSSKKWKRSFRACQTCRERKIKCNLGPLDNPHKPPCERCKREQRECIF 55
          G    R    K KR+ RAC TCR  K +C L P+  P++  C RC+  +  C F
Sbjct: 15 GVHKPRKKEFKGKRAVRACDTCRRLKTRCILSPI--PNEFYCLRCESLKIHCSF 66

>Suva_2.187 Chr2 complement(320833..323187) [2355 bp, 784 aa] {ON}
           YDR034C (REAL)
          Length = 784

 Score = 42.7 bits (99), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 22/64 (34%), Positives = 32/64 (50%), Gaps = 9/64 (14%)

Query: 4   KSNRTSSKKWKRSFRACQTCRERKIKCNLGPLDNPHKPPCERCKREQRECIFV-EPSRKS 62
           K   T  +K+ R+   C  C+ R++KC+        KP C +C R  REC++V  P  K 
Sbjct: 139 KKGNTVKRKYSRN--GCSECKRRRMKCD------ETKPTCWQCARLNRECVYVLNPKNKK 190

Query: 63  RSLS 66
           R  S
Sbjct: 191 RRTS 194

>Skud_4.475 Chr4 (844018..846759) [2742 bp, 913 aa] {ON} YDR213W
          (REAL)
          Length = 913

 Score = 42.7 bits (99), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 19/58 (32%), Positives = 31/58 (53%), Gaps = 9/58 (15%)

Query: 2  GSKSNRTSSKKWK---RSFRACQTCRERKIKCNLGPLDNPHKPPCERCKREQRECIFV 56
          G K + TS+ K K   +S   C  C+ R++KC+ G      KP C++C   + EC++ 
Sbjct: 30 GKKVSTTSTGKRKFHNKSKNGCDNCKRRRVKCDEG------KPACKKCTNMKLECLYT 81

>KLTH0D16456g Chr4 complement(1360294..1362279) [1986 bp, 661 aa]
          {ON} conserved hypothetical protein
          Length = 661

 Score = 42.4 bits (98), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 22/61 (36%), Positives = 32/61 (52%), Gaps = 6/61 (9%)

Query: 14 KRSFRACQTCRERKIKCNLGPLDNPHKPPCERCKREQRECIFVE-PSRKSRSLSPKDINY 72
          +R  + C  C++ K+KC           PCERC R Q +C F E  S ++ +LS  +IN 
Sbjct: 7  RRRTKPCTNCKKNKVKCLY-----QDSLPCERCARHQLQCHFAENNSLRNETLSVHEINT 61

Query: 73 G 73
          G
Sbjct: 62 G 62

>KAFR0E01250 Chr5 complement(249538..251748) [2211 bp, 736 aa] {ON}
           Anc_3.264 YDR034C
          Length = 736

 Score = 42.4 bits (98), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 21/61 (34%), Positives = 30/61 (49%), Gaps = 7/61 (11%)

Query: 4   KSNRTSSKKWKRSFRACQTCRERKIKCNLGPLDNPHKPPCERCKREQRECIFV-EPSRKS 62
           K  + +  K K S   C  C+ R++KC+        KP C +C R  REC++V  P  K 
Sbjct: 139 KDGKGNIVKRKYSRNGCTECKRRRMKCD------ETKPSCWQCARLNRECVYVLNPKNKK 192

Query: 63  R 63
           R
Sbjct: 193 R 193

>Skud_7.638 Chr7 (1060062..1061483) [1422 bp, 473 aa] {ON} YFL052W
          (REAL)
          Length = 473

 Score = 42.4 bits (98), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 23/65 (35%), Positives = 34/65 (52%), Gaps = 16/65 (24%)

Query: 6  NRTSSKKWKRSFRACQTCRERKIKCNLGPLDNPHKPPCERCKREQRECIFVEPSRKSRSL 65
          N TS+K+      AC  CR R++KC+        K PC RC +   +C +++P RK    
Sbjct: 5  NMTSAKQ------ACDCCRVRRVKCD-------GKKPCNRCLQHDLKCTYLQPLRKR--- 48

Query: 66 SPKDI 70
           PK+I
Sbjct: 49 GPKNI 53

>CAGL0H06875g Chr8 complement(682518..684626) [2109 bp, 702 aa]
          {ON} some similarities with uniprot|P05085
          Saccharomyces cerevisiae YML099c ARG81
          Length = 702

 Score = 42.4 bits (98), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 19/53 (35%), Positives = 29/53 (54%), Gaps = 11/53 (20%)

Query: 1  MGSKSNRTSSKKWKRSFRACQTCRERKIKCNLGPLDNPHKPPCERCKREQREC 53
          M  KS R+      +++  C TCR RK+KC+L       +P C RC+R + +C
Sbjct: 1  MDKKSTRSV-----KTYSGCWTCRARKVKCDLV------RPSCLRCRRSKVQC 42

>KLTH0E03256g Chr5 complement(294997..297021) [2025 bp, 674 aa]
          {ON} weakly similar to uniprot|P39529 Saccharomyces
          cerevisiae YJL206C Hypothetical ORF
          Length = 674

 Score = 42.4 bits (98), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 24/54 (44%), Positives = 30/54 (55%), Gaps = 8/54 (14%)

Query: 10 SKKWKRSFRACQTCRERKIKCNLGPLDNPHKPPCERC--KREQRECIFVEPSRK 61
          +K+ KRS +ACQ C  +K+KC LG      KPPC  C   + Q  CIF    RK
Sbjct: 7  AKERKRSKKACQRCSAQKVKC-LG-----EKPPCRACVLSKNQDNCIFPVKPRK 54

>Kpol_1033.15 s1033 complement(32885..34586,34699..34781) [1785 bp,
           594 aa] {ON} complement(32885..34586,34699..34781) [1785
           nt, 595 aa]
          Length = 594

 Score = 42.4 bits (98), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 35/111 (31%), Positives = 51/111 (45%), Gaps = 18/111 (16%)

Query: 1   MGSKSNRTSSKKWKRSFRACQTCRERKIKCNLGPLDNPHKPPCERCKREQRECIFVEPS- 59
           MGS S+    K       ACQ CR+R+ KCN        + PC  C +   EC+ V    
Sbjct: 16  MGSDSSGLKRK------LACQGCRKRRRKCNF-------EVPCSNCIKFGSECVSVNLDL 62

Query: 60  RKSR--SLSPKDINYGDDGDDNKLKFIHYQQGDNKGANNKEIQNMALEDSA 108
           RKSR      K +       ++ LK  H  + DN+   NK I+++ ++D A
Sbjct: 63  RKSRYSCTYVKTLENRIAHLESSLK--HIAEVDNEEEKNKIIESLVIDDIA 111

>KAFR0C04980 Chr3 (987900..990755) [2856 bp, 951 aa] {ON} Anc_7.17
          YOR363C
          Length = 951

 Score = 42.4 bits (98), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 18/53 (33%), Positives = 29/53 (54%), Gaps = 7/53 (13%)

Query: 3  SKSNRTSSKKWKRSFRACQTCRERKIKCNLGPLDNPHKPPCERCKREQRECIF 55
           K+ +   K+ + SF  CQ CR+ K KC+        KP C RC+++  EC++
Sbjct: 49 GKAGKVVKKRNRISF-VCQACRKAKTKCD------KEKPMCSRCRKQDLECVY 94

>KNAG0H01260 Chr8 (220201..222426) [2226 bp, 741 aa] {ON} Anc_3.264
           YDR034C
          Length = 741

 Score = 42.4 bits (98), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 18/55 (32%), Positives = 30/55 (54%), Gaps = 8/55 (14%)

Query: 2   GSKSNRTSSKKWKRSFRACQTCRERKIKCNLGPLDNPHKPPCERCKREQRECIFV 56
           GSK+     +K+ R+   C  C+ R++KC+        KP C +C R  R+C++V
Sbjct: 123 GSKNGHIVKRKYSRN--GCVECKRRRMKCD------ETKPKCWQCDRLNRDCVYV 169

>NDAI0D03540 Chr4 complement(838966..842289) [3324 bp, 1107 aa]
          {ON} 
          Length = 1107

 Score = 42.0 bits (97), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 20/56 (35%), Positives = 27/56 (48%), Gaps = 7/56 (12%)

Query: 18 RACQTCRERKIKCNLGPLDNPHKPPCERCKREQRECIFVEPSRKSRSLSPKDINYG 73
          +AC  CR+RKIKC         K PC  C+  Q  CI+  P  + +  S + I  G
Sbjct: 42 KACDNCRKRKIKCT-------GKMPCPTCEAYQCPCIYSAPKPRKKRTSKRHIRSG 90

>Kpol_1061.11 s1061 complement(31679..33880) [2202 bp, 733 aa] {ON}
           complement(31679..33880) [2202 nt, 734 aa]
          Length = 733

 Score = 42.0 bits (97), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 21/62 (33%), Positives = 32/62 (51%), Gaps = 7/62 (11%)

Query: 4   KSNRTSSKKWKRSFRACQTCRERKIKCNLGPLDNPHKPPCERCKREQRECIFV-EPSRKS 62
           K ++ +  K K S   C  C+ R++KC+        KP C +C R  REC++V  P  K 
Sbjct: 103 KDSKGNVVKRKYSRNGCAECKRRRMKCD------ETKPTCWQCSRLNRECVYVLNPKNKK 156

Query: 63  RS 64
           R+
Sbjct: 157 RN 158

>Suva_16.25 Chr16 complement(31437..31868) [432 bp, 143 aa] {ON}
          YGR288W (REAL)
          Length = 143

 Score = 39.7 bits (91), Expect = 0.007,   Method: Composition-based stats.
 Identities = 19/53 (35%), Positives = 27/53 (50%), Gaps = 10/53 (18%)

Query: 18 RACQTCRERKIKCNLGPLDNPHKPPCERCKREQRECIFVEPSRKSRSLSPKDI 70
          +AC  CR R++KC+        K PC RC +    C +++P RK     PK I
Sbjct: 39 QACDCCRVRRVKCD-------GKGPCGRCLQRDLNCTYLQPLRKR---GPKSI 81

>Smik_9.39 Chr9 (80510..83548) [3039 bp, 1012 aa] {ON} YIL130W
          (REAL)
          Length = 1012

 Score = 42.0 bits (97), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 20/67 (29%), Positives = 34/67 (50%), Gaps = 14/67 (20%)

Query: 10 SKKWKRSFRACQTCRERKIKCNLGPLDNPHKPPCERCKREQRECIFVEPSRKSRSLSPKD 69
          S K +R  RAC  CR++K+KC+        + PC  C     EC + +P+++++      
Sbjct: 11 SVKRRRVTRACDECRKKKVKCD-------GQQPCIHCTVYSYECTYKKPTKRTQ------ 57

Query: 70 INYGDDG 76
           N G+ G
Sbjct: 58 -NSGNSG 63

>KLLA0D10197g Chr4 complement(861726..864296) [2571 bp, 856 aa]
          {ON} similar to uniprot|P05085 Saccharomyces cerevisiae
          YML099C ARG81 Zinc-finger transcription factor of the
          Zn(2)-Cys(6) binuclear cluster domain type involved in
          the regulation of arginine-responsive genes acts with
          Arg80p and Arg82p
          Length = 856

 Score = 42.0 bits (97), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 16/39 (41%), Positives = 23/39 (58%), Gaps = 6/39 (15%)

Query: 15 RSFRACQTCRERKIKCNLGPLDNPHKPPCERCKREQREC 53
          ++F  C TCR RK+KC+L       +P CERC++    C
Sbjct: 9  KTFTGCWTCRSRKVKCDL------RRPGCERCEKGGLIC 41

>Smik_10.25 Chr10 complement(45977..48295) [2319 bp, 772 aa] {ON}
           YJL206C (REAL)
          Length = 772

 Score = 42.0 bits (97), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 26/85 (30%), Positives = 39/85 (45%), Gaps = 11/85 (12%)

Query: 15  RSFRACQTCRERKIKCNLGPLDNPHKPPCERCKREQRECIFVEPSRKSRSLSPKDINYGD 74
           R+ RAC  CR+RK++C+        + PC  C+    EC +  P R S   S  D    D
Sbjct: 53  RAHRACVACRKRKVRCS-------GQTPCRLCQNNSFECKYDRPPRNS---SVFDREVSD 102

Query: 75  DGDDNKLKFIHYQQGDNKGANNKEI 99
           D         H Q+G++K ++   I
Sbjct: 103 DSSSYPQSIPH-QEGEDKRSSTCTI 126

>YIL130W Chr9 (102782..105676) [2895 bp, 964 aa] {ON}  ASG1Zinc
          cluster protein proposed to function as a
          transcriptional regulator involved in the stress
          response; null mutants have a respiratory deficiency,
          calcofluor white sensitivity and slightly increased
          cycloheximide resistance
          Length = 964

 Score = 42.0 bits (97), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 20/67 (29%), Positives = 34/67 (50%), Gaps = 14/67 (20%)

Query: 10 SKKWKRSFRACQTCRERKIKCNLGPLDNPHKPPCERCKREQRECIFVEPSRKSRSLSPKD 69
          S K +R  RAC  CR++K+KC+        + PC  C     EC + +P+++++      
Sbjct: 11 SVKRRRVTRACDECRKKKVKCD-------GQQPCIHCTVYSYECTYKKPTKRTQ------ 57

Query: 70 INYGDDG 76
           N G+ G
Sbjct: 58 -NSGNSG 63

>NDAI0C04840 Chr3 (1117201..1120047) [2847 bp, 948 aa] {ON}
           Anc_8.423
          Length = 948

 Score = 42.0 bits (97), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 19/68 (27%), Positives = 37/68 (54%), Gaps = 11/68 (16%)

Query: 2   GSKSNRTSSKKWK---RSFRACQTCRERKIKCNLGPLDNPHKPPCERCKREQRECIF--V 56
           G K ++TS+ K K   +S   C  C++R++KC      +  KP C++C   Q  C++  +
Sbjct: 42  GKKVSKTSTGKRKFHNKSKNGCDNCKKRRVKC------DEVKPSCKKCTNMQLTCVYSPL 95

Query: 57  EPSRKSRS 64
           +P ++ + 
Sbjct: 96  QPRKRPKG 103

>Suva_9.59 Chr9 (97521..100298) [2778 bp, 926 aa] {ON} YIL130W
          (REAL)
          Length = 926

 Score = 42.0 bits (97), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 20/67 (29%), Positives = 34/67 (50%), Gaps = 14/67 (20%)

Query: 10 SKKWKRSFRACQTCRERKIKCNLGPLDNPHKPPCERCKREQRECIFVEPSRKSRSLSPKD 69
          S K +R  RAC  CR++K+KC+        + PC  C     EC + +P+++++      
Sbjct: 11 SVKRRRVTRACDECRKKKVKCD-------GQQPCIHCTVYSYECTYKKPTKRTQ------ 57

Query: 70 INYGDDG 76
           N G+ G
Sbjct: 58 -NSGNSG 63

>NDAI0A03420 Chr1 complement(782010..785336) [3327 bp, 1108 aa]
          {ON} 
          Length = 1108

 Score = 42.0 bits (97), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 21/53 (39%), Positives = 25/53 (47%), Gaps = 7/53 (13%)

Query: 5  SNRTSSKKWKRSFRACQTCRERKIKCNLGPLDNPHKPPCERCKREQRECIFVE 57
          SN    +  K+  +AC  CR RKIKC  G        PC  C   Q EC+F E
Sbjct: 2  SNPIVKRPRKKVVKACLNCRRRKIKCT-GTF------PCSNCAAYQCECVFDE 47

>ZYRO0E05676g Chr5 complement(439616..442816) [3201 bp, 1066 aa]
          {ON} some similarities with uniprot|P32862
          Saccharomyces cerevisiae YKL038W RGT1
          Glucose-responsive transcription factor that regulates
          expression of several glucose transporter (HXT) genes
          in response to glucose binds to promoters and acts both
          as a transcriptional activator and repressor
          Length = 1066

 Score = 42.0 bits (97), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 18/53 (33%), Positives = 29/53 (54%), Gaps = 4/53 (7%)

Query: 3  SKSNRTSSKKWKRSFRACQTCRERKIKCNLGPLDNPHKPPCERCKREQRECIF 55
          S  N ++SK+  ++ RAC  CR+RKI+C+     +  K  C  C++    C F
Sbjct: 51 SGGNTSASKRRTKASRACDQCRKRKIRCDY----DDDKGVCTSCRKNGESCAF 99

>TDEL0B00480 Chr2 (83911..86418) [2508 bp, 835 aa] {ON} Anc_8.879
          YML099C
          Length = 835

 Score = 41.6 bits (96), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 19/51 (37%), Positives = 29/51 (56%), Gaps = 8/51 (15%)

Query: 5  SNRTSSKKWKRS--FRACQTCRERKIKCNLGPLDNPHKPPCERCKREQREC 53
          + R+  +K KR+  F  C TCR RK+KC+L       +P C RC++   +C
Sbjct: 11 TERSYVQKGKRAKTFTGCWTCRSRKVKCDL------QRPNCGRCEKSGLDC 55

>TBLA0C06230 Chr3 (1509702..1512089) [2388 bp, 795 aa] {ON}
          Anc_6.60 YLR266C
          Length = 795

 Score = 41.6 bits (96), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 16/46 (34%), Positives = 27/46 (58%), Gaps = 6/46 (13%)

Query: 10 SKKWKRSFRACQTCRERKIKCNLGPLDNPHKPPCERCKREQRECIF 55
          ++K ++  +AC  CR+RK+KC+L       KP C++C      CI+
Sbjct: 4  TRKRRKIIKACVFCRKRKLKCDLT------KPKCKQCSSRNLNCIY 43

>TPHA0M01040 Chr13 complement(202491..204803) [2313 bp, 770 aa] {ON}
           Anc_3.264 YDR034C
          Length = 770

 Score = 41.6 bits (96), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 25/74 (33%), Positives = 36/74 (48%), Gaps = 9/74 (12%)

Query: 12  KWKRSFRACQTCRERKIKCNLGPLDNPHKPPCERCKREQRECIFV-EPSRKSRS--LSPK 68
           K K S   C  C+ R++KC+        KP C +C R  R C++V  P  K R+  L   
Sbjct: 132 KRKYSRNGCTECKRRRMKCD------ETKPTCWQCSRLNRHCVYVFNPKNKKRNKDLLAT 185

Query: 69  DINYGDDGDDNKLK 82
            ++  D+ D  KLK
Sbjct: 186 ALSSNDNEDKFKLK 199

>KAFR0B06340 Chr2 (1311310..1313904) [2595 bp, 864 aa] {ON}
          Anc_8.423 YLR228C
          Length = 864

 Score = 41.6 bits (96), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 19/60 (31%), Positives = 32/60 (53%), Gaps = 9/60 (15%)

Query: 2  GSKSNRTSSKKWK---RSFRACQTCRERKIKCNLGPLDNPHKPPCERCKREQRECIFVEP 58
          G K ++TS+ K K   +S   C  C+ R++KC      +  KP C +C   + +C++V P
Sbjct: 34 GKKVSKTSTGKRKFHNKSKTGCLNCKRRRVKC------DETKPFCIKCTNMKLDCVYVTP 87

>CAGL0C01199g Chr3 complement(121944..124712) [2769 bp, 922 aa] {ON}
           similar to uniprot|Q12151 Saccharomyces cerevisiae
           YDR213w UPC2
          Length = 922

 Score = 41.6 bits (96), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 25/96 (26%), Positives = 42/96 (43%), Gaps = 16/96 (16%)

Query: 2   GSKSNRTSSKK---WKRSFRACQTCRERKIKCNLGPLDNPHKPPCERCKREQRECIF--- 55
           G + ++TS+ K    K+S   C  C+ R++KC+ G      KP C++C      C++   
Sbjct: 27  GKRVSKTSTGKRKFHKKSKTGCDNCKRRRVKCDEG------KPGCKKCSNLNLVCVYSTV 80

Query: 56  ----VEPSRKSRSLSPKDINYGDDGDDNKLKFIHYQ 87
               V     SR       N  ++ DDN  + +  Q
Sbjct: 81  VDNKVAKKTTSRKGKSPGANSLENSDDNTRRSVSPQ 116

>KLTH0F07854g Chr6 complement(677647..680013) [2367 bp, 788 aa]
          {ON} some similarities with uniprot|Q12151
          Saccharomyces cerevisiae YDR213W UPC2 involved in
          sterol uptake zinc finger transcription factor of the
          Zn(2)- Cys(6) binuclear cluster domain type
          Length = 788

 Score = 41.6 bits (96), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 18/58 (31%), Positives = 31/58 (53%), Gaps = 9/58 (15%)

Query: 2  GSKSNRTSSKK---WKRSFRACQTCRERKIKCNLGPLDNPHKPPCERCKREQRECIFV 56
          G K ++TS+ K    K+S   C  C+ R++KC      +  KP C++C   + EC++ 
Sbjct: 29 GKKVSKTSTGKRKFHKKSKNGCDNCKRRRVKC------DEDKPSCQKCINMKLECVYT 80

>NDAI0B03850 Chr2 complement(970366..973158) [2793 bp, 930 aa]
          {ON} Anc_2.231 YIL130W
          Length = 930

 Score = 41.6 bits (96), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 17/51 (33%), Positives = 28/51 (54%), Gaps = 7/51 (13%)

Query: 12 KWKRSFRACQTCRERKIKCNLGPLDNPHKPPCERCKREQRECIFVEPSRKS 62
          K +R  RAC  CR++K+KC+        + PC  C     EC + +P+++S
Sbjct: 31 KRRRVTRACDECRKKKVKCD-------GQQPCIHCTVYSYECTYNQPTKRS 74

>NDAI0D00900 Chr4 (205039..207636) [2598 bp, 865 aa] {ON} 
          Length = 865

 Score = 41.6 bits (96), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 16/51 (31%), Positives = 30/51 (58%), Gaps = 7/51 (13%)

Query: 9  SSKKWKRSFRACQTCRERKIKCNLGPLDNPHKPPCERCKREQRECIFVEPS 59
          S ++ +RS   C TC+ +K++C+        +P C RC+R  R+C++  P+
Sbjct: 21 SLRRQRRS-HVCITCKNQKLRCD------RERPSCSRCRRIGRDCVYESPT 64

>YDR034C Chr4 complement(509737..512109) [2373 bp, 790 aa] {ON}
           LYS14Transcriptional activator involved in regulation of
           genes of the lysine biosynthesis pathway; requires
           2-aminoadipate semialdehyde as co-inducer
          Length = 790

 Score = 41.6 bits (96), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 21/64 (32%), Positives = 32/64 (50%), Gaps = 9/64 (14%)

Query: 4   KSNRTSSKKWKRSFRACQTCRERKIKCNLGPLDNPHKPPCERCKREQRECIFV-EPSRKS 62
           K   T  +K+ R+   C  C+ R++KC+        KP C +C R  R+C++V  P  K 
Sbjct: 145 KKGNTVKRKYSRN--GCSECKRRRMKCD------ETKPTCWQCARLNRQCVYVLNPKNKK 196

Query: 63  RSLS 66
           R  S
Sbjct: 197 RRTS 200

>Smik_15.561 Chr15 (997239..998879) [1641 bp, 546 aa] {ON} YOR380W
          (REAL)
          Length = 546

 Score = 41.6 bits (96), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 25/67 (37%), Positives = 30/67 (44%), Gaps = 7/67 (10%)

Query: 1  MGSKSNRTSSKKWKRSFRACQTCRERKIKCNLGPLDNPHKPPCERCKREQRECIFVEPSR 60
          M S      S K +R  +AC  CRERK KCN        K PCE C      C +++  R
Sbjct: 1  MASSVPNIPSYKRQRVRKACVPCRERKRKCN-------GKSPCEMCISYGYVCHYMDKDR 53

Query: 61 KSRSLSP 67
           S S  P
Sbjct: 54 SSSSSFP 60

>Kwal_23.4754 s23 (845550..847988) [2439 bp, 812 aa] {ON} YIL130W
          (GIN1) - 1:1 [contig 5] FULL
          Length = 812

 Score = 41.6 bits (96), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 17/50 (34%), Positives = 27/50 (54%), Gaps = 7/50 (14%)

Query: 12 KWKRSFRACQTCRERKIKCNLGPLDNPHKPPCERCKREQRECIFVEPSRK 61
          K +R  RAC  CR++K+KC+        + PC  C     EC + +PS++
Sbjct: 7  KRRRVTRACDECRKKKVKCD-------GQQPCIHCTVYSYECTYNQPSKR 49

>KNAG0H00250 Chr8 (37360..40050) [2691 bp, 896 aa] {ON} Anc_2.654
           YKL015W
          Length = 896

 Score = 41.6 bits (96), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 22/60 (36%), Positives = 28/60 (46%), Gaps = 12/60 (20%)

Query: 7   RTSSKKWKRSFR-----ACQTCRERKIKCNLGPLDNPHKPPCERCKREQRECIFVEPSRK 61
           R  SKK K++ R     AC  CR R  KC       P   PC +C      C ++EPS+K
Sbjct: 58  RKVSKKEKKANRSRLPVACVACRRRHSKC-------PGGNPCSKCIAANLTCEYIEPSKK 110

>ZYRO0G10252g Chr7 (819658..822768) [3111 bp, 1036 aa] {ON}
          similar to uniprot|P12383 Saccharomyces cerevisiae
          YGL013C PDR1 Zinc cluster protein that is a master
          regulator involved in recruiting other zinc cluster
          proteins to pleiotropic drug response elements (PDREs)
          to fine tune the regulation of multidrug resistance
          genes
          Length = 1036

 Score = 41.6 bits (96), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 24/68 (35%), Positives = 30/68 (44%), Gaps = 9/68 (13%)

Query: 18 RACQTCRERKIKCNLGPLDNPHKPPCERCKREQRECIFVEP--SRKSRSLSPKDINYGDD 75
          RAC  CR RKIKC         K PC  C+  Q EC++       KS + +  + N    
Sbjct: 15 RACYNCRRRKIKCT-------GKYPCSSCEAYQCECLYFPGYVPTKSNTSTNGNTNVNAK 67

Query: 76 GDDNKLKF 83
           DDN  K 
Sbjct: 68 ADDNSWKL 75

>Suva_13.49 Chr13 complement(75704..78352) [2649 bp, 882 aa] {ON}
          YML099C (REAL)
          Length = 882

 Score = 41.6 bits (96), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 15/39 (38%), Positives = 23/39 (58%), Gaps = 6/39 (15%)

Query: 15 RSFRACQTCRERKIKCNLGPLDNPHKPPCERCKREQREC 53
          ++F  C TCR RK+KC+L       +P C+RC++    C
Sbjct: 16 KTFTGCWTCRGRKVKCDL------RRPHCQRCEKSNLPC 48

>Smik_4.269 Chr4 complement(491110..493446) [2337 bp, 778 aa] {ON}
           YDR034C (REAL)
          Length = 778

 Score = 41.6 bits (96), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 22/64 (34%), Positives = 31/64 (48%), Gaps = 9/64 (14%)

Query: 4   KSNRTSSKKWKRSFRACQTCRERKIKCNLGPLDNPHKPPCERCKREQRECIFV-EPSRKS 62
           K   T  +K+ R+   C  C+ R++KC+        KP C +C R  R CI+V  P  K 
Sbjct: 133 KKGNTVKRKYSRN--GCSECKRRRMKCD------ETKPTCWQCARLNRHCIYVLNPKNKK 184

Query: 63  RSLS 66
           R  S
Sbjct: 185 RRTS 188

>NDAI0B01680 Chr2 (398598..401372) [2775 bp, 924 aa] {ON}
          Anc_2.547
          Length = 924

 Score = 41.6 bits (96), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 20/52 (38%), Positives = 27/52 (51%), Gaps = 4/52 (7%)

Query: 4  KSNRTSSKKWKRSFRACQTCRERKIKCNLGPLDNPHKPPCERCKREQRECIF 55
          KS   +SKK  +  RAC  C +R+I+CN   + N     C  CKR    C+F
Sbjct: 35 KSLTETSKKRSKVSRACDQCHKRRIRCNYNKVTN----MCAGCKRIGEHCLF 82

>Skud_9.37 Chr9 (79947..82811) [2865 bp, 954 aa] {ON} YIL130W
          (REAL)
          Length = 954

 Score = 41.6 bits (96), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 17/55 (30%), Positives = 31/55 (56%), Gaps = 7/55 (12%)

Query: 10 SKKWKRSFRACQTCRERKIKCNLGPLDNPHKPPCERCKREQRECIFVEPSRKSRS 64
          S K +R  RAC  CR++K+KC+        + PC  C     EC + +P++++++
Sbjct: 11 SVKRRRVTRACDECRKKKVKCD-------GQQPCIHCTVYSYECTYKKPTKRTQN 58

>NCAS0A10550 Chr1 (2100725..2102950) [2226 bp, 741 aa] {ON}
           Anc_3.264
          Length = 741

 Score = 41.2 bits (95), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 22/66 (33%), Positives = 35/66 (53%), Gaps = 10/66 (15%)

Query: 3   SKSNRTSSKKWKRSFRACQTCRERKIKCNLGPLDNPHKPPCERCKREQRECIFVEPS--- 59
           + + +T+  K K S   C  C+ R++KC+        KP C +C R  REC+++  S   
Sbjct: 115 TNAKKTNIVKRKYSRNGCAECKRRRMKCD------ETKPICWQCARLSRECVYIVKSGNK 168

Query: 60  -RKSRS 64
            RKS+S
Sbjct: 169 KRKSKS 174

>Smik_2.151 Chr2 (282822..285581) [2760 bp, 919 aa] {ON} YBR033W
          (REAL)
          Length = 919

 Score = 41.6 bits (96), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 17/47 (36%), Positives = 27/47 (57%), Gaps = 4/47 (8%)

Query: 10 SKKWKRSFRACQTCRERKIKCNLGPLDNPHKPPCERCKREQRECIFV 56
          +K+ K++ RAC  CR+++IKC      N H   C+ C     +C+FV
Sbjct: 46 TKQRKKASRACDQCRKKRIKCRF----NQHTGVCQGCLEVNEKCLFV 88

>Suva_8.436 Chr8 (788699..790336) [1638 bp, 545 aa] {ON} YOR380W
           (REAL)
          Length = 545

 Score = 41.2 bits (95), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 61/258 (23%), Positives = 85/258 (32%), Gaps = 96/258 (37%)

Query: 1   MGSKSNRTSSKKWKRSFRACQTCRERKIKCNLGPLDNPHKPPCERCKREQRECIFVEPSR 60
           M S  +     K +R  +AC  CRERK KCN        K PCE C              
Sbjct: 1   MASSGSNPQPYKRQRVRKACVPCRERKRKCN-------GKSPCEMC-------------- 39

Query: 61  KSRSLSPKDINYGDDGDDNKLKFIHYQQGDNKGANNKEIQNMALEDSAWESDVSSMQNAL 120
                    + YG           HY + D   A                   SS  N +
Sbjct: 40  ---------VAYG--------YVCHYTEEDGPLA-------------------SSRMNQV 63

Query: 121 EYLASAAKSVSQFENHKPTSKLSDMVNSYSKDDMTQENIIKELFEKTELKNPASSLIAQL 180
           E L    K+      + P   + +  +S     +T  NII     +  +++ A +    L
Sbjct: 64  EELPHDTKN----RPYVPLDIIGNGTHSTDSQHVTNGNIIDRTKSRYTIQHSAVAFPRSL 119

Query: 181 S--------------------RIRTKP--HKKLSDIVYIGDDKLLTEEEARRLIEVFFQK 218
                                R   KP  H  LSDIV        T+EE  R+ +V+F  
Sbjct: 120 GLELRSTNPPRLHCFAWHCGIRPEEKPSFHVPLSDIV--------TKEEYYRISKVYFSV 171

Query: 219 LHPFFPYIPLQLHNPEQL 236
           +HP F  +     +PEQL
Sbjct: 172 VHPIFDIV-----DPEQL 184

>Skud_4.287 Chr4 complement(501344..503698) [2355 bp, 784 aa] {ON}
           YDR034C (REAL)
          Length = 784

 Score = 41.2 bits (95), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 21/64 (32%), Positives = 32/64 (50%), Gaps = 9/64 (14%)

Query: 4   KSNRTSSKKWKRSFRACQTCRERKIKCNLGPLDNPHKPPCERCKREQRECIFV-EPSRKS 62
           K   T  +K+ R+   C  C+ R++KC+        KP C +C R  R+C++V  P  K 
Sbjct: 139 KKGNTVKRKYSRN--GCSECKRRRMKCD------ETKPTCWQCARLNRQCVYVLNPKNKK 190

Query: 63  RSLS 66
           R  S
Sbjct: 191 RRTS 194

>KAFR0A06690 Chr1 complement(1354262..1357255) [2994 bp, 997 aa]
          {ON} Anc_4.113 YGL013C
          Length = 997

 Score = 41.2 bits (95), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 18/46 (39%), Positives = 26/46 (56%), Gaps = 7/46 (15%)

Query: 10 SKKWKRSFRACQTCRERKIKCNLGPLDNPHKPPCERCKREQRECIF 55
          SK+ ++  RAC  CR+RKIKC+          PC  C+  Q +C+F
Sbjct: 13 SKRRRKVNRACDNCRKRKIKCS-------ETTPCTNCQIYQCKCVF 51

>KNAG0A04480 Chr1 complement(626229..629270) [3042 bp, 1013 aa] {ON}
           Anc_8.423 YLR228C
          Length = 1013

 Score = 41.2 bits (95), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 18/61 (29%), Positives = 32/61 (52%), Gaps = 9/61 (14%)

Query: 2   GSKSNRTSSKKWK---RSFRACQTCRERKIKCNLGPLDNPHKPPCERCKREQRECIFVEP 58
           G   ++TS+ K K   +S   C  C++R++KC+ G      KP C++C      C+++  
Sbjct: 76  GKTVSKTSTGKRKFHNKSKTGCINCKKRRVKCDEG------KPACKKCTNMSLSCVYISA 129

Query: 59  S 59
           S
Sbjct: 130 S 130

>KAFR0B01450 Chr2 (273614..276880) [3267 bp, 1088 aa] {ON}
          Anc_2.547 YKL038W
          Length = 1088

 Score = 41.2 bits (95), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 17/51 (33%), Positives = 29/51 (56%), Gaps = 4/51 (7%)

Query: 5  SNRTSSKKWKRSFRACQTCRERKIKCNLGPLDNPHKPPCERCKREQRECIF 55
          S  +S+K+  ++ RAC  CR++K+KC+ G      +  C  C+R   +C F
Sbjct: 48 SRSSSNKRRTKASRACDQCRKKKVKCDNG----DDRSVCTNCQRNGEKCTF 94

>Ecym_4144 Chr4 complement(306206..308728) [2523 bp, 840 aa] {ON}
          similar to Ashbya gossypii AGL091W
          Length = 840

 Score = 41.2 bits (95), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 20/65 (30%), Positives = 36/65 (55%), Gaps = 11/65 (16%)

Query: 2  GSKSNRTSSKK---WKRSFRACQTCRERKIKCNLGPLDNPHKPPCERCKREQRECIF--V 56
          G K ++T++ K    K+S   C  C+ R++KC      + +KP C++C + +  CI+   
Sbjct: 36 GKKVSKTATGKRKFHKKSKNGCDNCKRRRVKC------DENKPCCQKCFKMKLHCIYTPA 89

Query: 57 EPSRK 61
          +P RK
Sbjct: 90 KPRRK 94

>Kpol_495.21 s495 (71447..74704) [3258 bp, 1085 aa] {ON}
           (71447..74704) [3258 nt, 1086 aa]
          Length = 1085

 Score = 41.2 bits (95), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 22/53 (41%), Positives = 29/53 (54%), Gaps = 3/53 (5%)

Query: 4   KSNRTSSKKWKRSF-RACQTCRERKIKCNLGPLDNPHKPPCERCKREQRECIF 55
           KSN +++K  KR   RAC  CR+RKIKC+   + N     C  C +   EC F
Sbjct: 106 KSNVSTTKVQKRRVARACDRCRKRKIKCD--EIKNLKVNKCSNCVKYGAECTF 156

>YML099C Chr13 complement(74398..77040) [2643 bp, 880 aa] {ON}
          ARG81Zinc-finger transcription factor of the
          Zn(2)-Cys(6) binuclear cluster domain type, involved in
          the regulation of arginine-responsive genes; acts with
          Arg80p and Arg82p
          Length = 880

 Score = 41.2 bits (95), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 19/51 (37%), Positives = 27/51 (52%), Gaps = 8/51 (15%)

Query: 5  SNRTSSKKWKRS--FRACQTCRERKIKCNLGPLDNPHKPPCERCKREQREC 53
          S++   KK  R+  F  C TCR RK+KC+L        P C+RC++    C
Sbjct: 4  SSKNGPKKMGRAKTFTGCWTCRGRKVKCDL------RHPHCQRCEKSNLPC 48

>TBLA0B06240 Chr2 complement(1469510..1473817) [4308 bp, 1435 aa]
           {ON} Anc_4.344 YML076C
          Length = 1435

 Score = 41.2 bits (95), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 19/55 (34%), Positives = 27/55 (49%)

Query: 1   MGSKSNRTSSKKWKRSFRACQTCRERKIKCNLGPLDNPHKPPCERCKREQRECIF 55
           M +K   T    +KRS  AC  C   K KC     ++ ++ PC+RC +  R C F
Sbjct: 324 MPTKMETTEKGSFKRSTFACVRCHSLKQKCLPSDFNDIYRKPCKRCLKTNRLCKF 378

>TBLA0G01130 Chr7 (287952..291350) [3399 bp, 1132 aa] {ON}
          Anc_8.879 YML099C
          Length = 1132

 Score = 41.2 bits (95), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 16/39 (41%), Positives = 22/39 (56%), Gaps = 6/39 (15%)

Query: 15 RSFRACQTCRERKIKCNLGPLDNPHKPPCERCKREQREC 53
          R++  C TCR RKIKC      +  KP C+RC +   +C
Sbjct: 11 RTYSGCWTCRSRKIKC------DQQKPQCKRCLKANLKC 43

>ZYRO0E00572g Chr5 (35940..38456) [2517 bp, 838 aa] {ON} similar
          to uniprot|P25502 Saccharomyces cerevisiae YKL015W PUT3
          Positive regulator of PUT (proline utilization) genes
          zinc-finger transcription factor of the Zn(2)-Cys(6)
          binuclear cluster domain type
          Length = 838

 Score = 41.2 bits (95), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 16/48 (33%), Positives = 25/48 (52%), Gaps = 7/48 (14%)

Query: 14 KRSFRACQTCRERKIKCNLGPLDNPHKPPCERCKREQRECIFVEPSRK 61
          +RS  AC  CR + +KC       P   PC +C   +  C ++EP++K
Sbjct: 36 RRSTLACVRCRRKHVKC-------PGGDPCSKCSAARIACEYLEPNKK 76

>KNAG0A02300 Chr1 (214177..216363) [2187 bp, 729 aa] {ON}  gene
          extends into a gap in the genome sequence
          Length = 729

 Score = 41.2 bits (95), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 18/49 (36%), Positives = 29/49 (59%), Gaps = 7/49 (14%)

Query: 10 SKKWKRSFRACQTCRERKIKCNLGPLDNPHKPPCERCK-REQRECIFVE 57
          ++K ++  R C  CR+RK++C+ G      +P C  CK R   ECI++E
Sbjct: 15 TRKKRKHIRTCTFCRQRKVRCDQG------RPLCSSCKARGFSECIYLE 57

>NCAS0B02860 Chr2 complement(488982..491591) [2610 bp, 869 aa] {ON}
           Anc_8.423
          Length = 869

 Score = 41.2 bits (95), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 25/80 (31%), Positives = 38/80 (47%), Gaps = 11/80 (13%)

Query: 2   GSKSNRTSSKKWK---RSFRACQTCRERKIKCNLGPLDNPHKPPCERCKREQRECIF--V 56
           G K + TS+ K K   +S + C  C+ R++KC      +  KP C RC      C++  V
Sbjct: 34  GKKVSATSTGKRKFHNKSKQGCTHCKRRRVKC------DELKPACRRCLNWNVPCVYPVV 87

Query: 57  EPSRKSRSLSPKDINYGDDG 76
           +P ++  S   K I    DG
Sbjct: 88  QPKKRKVSTVVKYITRKADG 107

>Kpol_1042.6 s1042 (9848..11548,11550..11612,11615..12193) [2343
          bp, 780 aa] {ON}
          (9848..11548,11550..11612,11615..12193) [2343 nt, 781
          aa]
          Length = 780

 Score = 41.2 bits (95), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 19/56 (33%), Positives = 32/56 (57%), Gaps = 7/56 (12%)

Query: 3  SKSNRTSSKKWKRSFRACQTCRERKIKCNLGPLDNPHKPPCERC-KREQRECIFVE 57
          S ++    K+ ++  ++C  CR+RK+KC+ G      +P C +C  RE  ECI+ E
Sbjct: 19 SVTDGCGKKRRRKVIKSCTFCRKRKLKCDHG------RPMCNQCSSRELPECIYTE 68

>Kpol_1002.5 s1002 (11943..14819) [2877 bp, 958 aa] {ON}
           (11943..14819) [2877 nt, 959 aa]
          Length = 958

 Score = 41.2 bits (95), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 24/57 (42%), Positives = 30/57 (52%), Gaps = 8/57 (14%)

Query: 3   SKSNRTSSKKW----KRSFRACQTCRERKIKCNLGPLDNPHKPPCERCKREQRECIF 55
           S+S+ T S K     K++ RAC  CR+RKIKC+    DN  K  C  C R    C F
Sbjct: 54  SRSSSTGSAKGSIGGKKATRACDQCRKRKIKCD---YDN-DKNVCSSCNRNGDRCQF 106

>KLTH0G09108g Chr7 (744062..746410) [2349 bp, 782 aa] {ON} weakly
          similar to uniprot|P40467 Saccharomyces cerevisiae
          YIL130W ASG1 Proposed transcriptional activator member
          of the Gal4p family of zinc cluster proteins
          Length = 782

 Score = 41.2 bits (95), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 17/50 (34%), Positives = 27/50 (54%), Gaps = 7/50 (14%)

Query: 12 KWKRSFRACQTCRERKIKCNLGPLDNPHKPPCERCKREQRECIFVEPSRK 61
          K +R  RAC  CR++K+KC+        + PC  C     EC + +PS++
Sbjct: 7  KRRRVTRACDECRKKKVKCD-------GQQPCIHCTVYSYECTYNQPSKR 49

>Ecym_3392 Chr3 (741359..743902) [2544 bp, 847 aa] {ON} similar to
          Ashbya gossypii ACL096W
          Length = 847

 Score = 41.2 bits (95), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 18/58 (31%), Positives = 29/58 (50%), Gaps = 7/58 (12%)

Query: 4  KSNRTSSKKWKRSFRACQTCRERKIKCNLGPLDNPHKPPCERCKREQRECIFVEPSRK 61
          K    + ++ KR+  AC  CR+R ++C       P   PC +C      C ++EPS+K
Sbjct: 41 KEGGGNKERKKRAPLACLRCRKRHVRC-------PGGNPCSKCVSANIACEYLEPSKK 91

>TBLA0E00700 Chr5 complement(138121..141945) [3825 bp, 1274 aa] {ON}
           Anc_7.17 YOR363C
          Length = 1274

 Score = 41.2 bits (95), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 18/46 (39%), Positives = 24/46 (52%), Gaps = 6/46 (13%)

Query: 10  SKKWKRSFRACQTCRERKIKCNLGPLDNPHKPPCERCKREQRECIF 55
           +KK  R    CQ+CR+ K KC      N  KP C RCK+    C++
Sbjct: 64  TKKRNRISFVCQSCRKSKTKC------NKDKPSCSRCKKLGIFCVY 103

>Smik_13.36 Chr13 complement(71547..74189) [2643 bp, 880 aa] {ON}
          YML099C (REAL)
          Length = 880

 Score = 40.8 bits (94), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 19/54 (35%), Positives = 28/54 (51%), Gaps = 7/54 (12%)

Query: 1  MGSKSNRTSSKKWK-RSFRACQTCRERKIKCNLGPLDNPHKPPCERCKREQREC 53
          MG  S   + K  + ++F  C TCR RK+KC+L        P C+RC++    C
Sbjct: 1  MGITSKNGTKKLGRAKTFTGCWTCRGRKVKCDL------RHPHCQRCEKSNLPC 48

>YOR380W Chr15 (1051290..1052930) [1641 bp, 546 aa] {ON}
           RDR1Transcriptional repressor involved in the control of
           multidrug resistance; negatively regulates expression of
           the PDR5 gene; member of the Gal4p family of zinc
           cluster proteins
          Length = 546

 Score = 40.8 bits (94), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 56/239 (23%), Positives = 93/239 (38%), Gaps = 53/239 (22%)

Query: 1   MGSKSNRTSSKKWKRSFRACQTCRERKIKCNLGPLDNPHKPPCERCKREQRECIFVEPSR 60
           M S  +     K +R  +AC  CRERK KCN        K PCE C      C +++   
Sbjct: 1   MASPGSTALPHKRQRVRKACVPCRERKRKCN-------GKSPCEMCVAYGYVCHYID--G 51

Query: 61  KSRSLSPKDINYGDDGDDNKLK-FIHYQQGDNKGANNKEIQNMALEDSAWESDVSSMQNA 119
           +  S SP+    G+   D + + F+      N+       QN+  ++     D +  +  
Sbjct: 52  RVPSASPQVQQVGETSPDTESRPFVLPGIHRNEQPQPINTQNVTSQNIV---DPTKSRYT 108

Query: 120 LEYLASAAKSVSQFENHKPTSKLSDMVNSYSKDDMTQENIIKELFEKTELKNPASSLIAQ 179
           +++ A A       E     S     ++S++     +             +NP S ++  
Sbjct: 109 IQHSAVAFPRCLGLELR---STNPPRLHSFAWHCGIRPE-----------ENPNSHVL-- 152

Query: 180 LSRIRTKPHKKLSDIVYIGDDKLLTEEEARRLIEVFFQKLHPFFPYIPLQLHNPEQLVR 238
                      LSD+V        T+EE  R+ +V+F  +HP F  +     NPEQL +
Sbjct: 153 -----------LSDLV--------TKEEYYRISKVYFSVVHPIFDVV-----NPEQLAK 187

>ABL099W Chr2 (212830..215232) [2403 bp, 800 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YDR034C (LYS14)
          Length = 800

 Score = 40.8 bits (94), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 19/57 (33%), Positives = 29/57 (50%), Gaps = 6/57 (10%)

Query: 12  KWKRSFRACQTCRERKIKCNLGPLDNPHKPPCERCKREQRECIFVEPSRKSRSLSPK 68
           K K S   C  C+ R++KC+ G      KP C +C R  REC ++  +R  +  + K
Sbjct: 189 KRKYSRNGCTECKRRRMKCDEG------KPICWQCSRLNRECKYILNARNKKRAAAK 239

>Skud_13.43 Chr13 complement(73880..76522) [2643 bp, 880 aa] {ON}
          YML099C (REAL)
          Length = 880

 Score = 40.8 bits (94), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 15/39 (38%), Positives = 22/39 (56%), Gaps = 6/39 (15%)

Query: 15 RSFRACQTCRERKIKCNLGPLDNPHKPPCERCKREQREC 53
          ++F  C TCR RK+KC+L        P C+RC++    C
Sbjct: 16 KTFTGCWTCRGRKVKCDL------RHPHCQRCEKSNLPC 48

>SAKL0A01386g Chr1 (132287..134599) [2313 bp, 770 aa] {ON}
          conserved hypothetical protein
          Length = 770

 Score = 40.8 bits (94), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 20/52 (38%), Positives = 26/52 (50%), Gaps = 2/52 (3%)

Query: 4  KSNRTSSKKWKRSFRACQTCRERKIKCNLGPLDNPHKPPCERCKREQRECIF 55
          K  R    K KR+ RAC +CR  K +C   PL  P++  C RC   +  C F
Sbjct: 14 KPKRQLRAKGKRALRACDSCRRLKTRCIPSPL--PNEIQCLRCDSLKLRCSF 63

>SAKL0D14542g Chr4 complement(1195951..1198791) [2841 bp, 946 aa]
          {ON} similar to gnl|GLV|KLLA0A03421g Kluyveromyces
          lactis KLLA0A03421g and weakly similar to YAL051W
          uniprot|P39720 Saccharomyces cerevisiae YAL051W OAF1
          Oleate- activated transcription factor acts alone and
          as a heterodimer with Pip2p activates genes involved in
          beta- oxidation of fatty acids and peroxisome
          organization and biogenesis
          Length = 946

 Score = 40.8 bits (94), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 22/57 (38%), Positives = 32/57 (56%), Gaps = 10/57 (17%)

Query: 11 KKWKRSFRACQTCRERKIKCNLGPLDNPHKPPCERCKREQRECIF---VEPSRKSRS 64
          K+ K SF  CQ+CR+ K KC      +  KP C RC R   +CI+   ++P+ K+ S
Sbjct: 21 KRNKLSF-VCQSCRKSKTKC------DKQKPSCSRCLRLGHQCIYDLELQPTPKNPS 70

>KLTH0C10098g Chr3 complement(836528..838843) [2316 bp, 771 aa] {ON}
           weakly similar to uniprot|Q6B2M3 Saccharomyces
           cerevisiae YOR172W YRM1 Zn2-Cys6 zinc-finger
           transcription factor that activates genes involved in
           multidrug resistance paralog of Yrr1p acting on an
           overlapping set of target genes
          Length = 771

 Score = 40.8 bits (94), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 17/57 (29%), Positives = 33/57 (57%), Gaps = 7/57 (12%)

Query: 2   GSKSNRTSSKKWKRSFRACQTCRERKIKCNLGPLDNPHKPPCERC-KREQRECIFVE 57
           G+ S  ++ ++ ++  ++C  CR+RK+KC      +  KP C  C +R+  ECI+ +
Sbjct: 50  GASSKPSTRRRRRKVIKSCTFCRQRKMKC------DQQKPMCGSCVERKLSECIYTD 100

>NCAS0A07610 Chr1 complement(1512914..1515982) [3069 bp, 1022 aa]
          {ON} Anc_7.17
          Length = 1022

 Score = 40.8 bits (94), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 19/54 (35%), Positives = 27/54 (50%), Gaps = 7/54 (12%)

Query: 2  GSKSNRTSSKKWKRSFRACQTCRERKIKCNLGPLDNPHKPPCERCKREQRECIF 55
             SNR   K+ + SF  CQ CR+ K KC      +  KP C RC ++   C++
Sbjct: 29 AGGSNRQIKKRNRISF-VCQECRKAKTKC------DKEKPACTRCVKQNLACVY 75

>Ecym_5131 Chr5 (278980..281292) [2313 bp, 770 aa] {ON} similar to
           Ashbya gossypii ABL099W
          Length = 770

 Score = 40.8 bits (94), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 17/47 (36%), Positives = 25/47 (53%), Gaps = 6/47 (12%)

Query: 10  SKKWKRSFRACQTCRERKIKCNLGPLDNPHKPPCERCKREQRECIFV 56
           S K K S   C  C+ R++KC+ G      KP C +C R  R C+++
Sbjct: 140 SGKRKYSRNGCTECKRRRMKCDEG------KPVCWQCSRLNRSCVYI 180

>YDR213W Chr4 (889751..892492) [2742 bp, 913 aa] {ON}  UPC2Sterol
          regulatory element binding protein, induces
          transcription of sterol biosynthetic genes and of
          DAN/TIR gene products; Ecm22p homolog; relocates from
          intracellular membranes to perinuclear foci on sterol
          depletion
          Length = 913

 Score = 40.8 bits (94), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 19/58 (32%), Positives = 29/58 (50%), Gaps = 9/58 (15%)

Query: 2  GSKSNRTSSKKWK---RSFRACQTCRERKIKCNLGPLDNPHKPPCERCKREQRECIFV 56
          G K + TS+ K K   +S   C  C+ R++KC+ G      KP C +C   + EC + 
Sbjct: 30 GKKVSTTSTGKRKFHNKSKNGCDNCKRRRVKCDEG------KPACRKCTNMKLECQYT 81

>TPHA0B01585 Chr2 complement(352396..354834) [2439 bp, 812 aa] {ON}
          Length = 812

 Score = 40.8 bits (94), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 20/59 (33%), Positives = 30/59 (50%), Gaps = 1/59 (1%)

Query: 19  ACQTCRERKIKCNLGPLDNPHKPPCERCKREQRECIFVEPSRK-SRSLSPKDINYGDDG 76
           AC  C   K KC    L + ++ PC +CKR + +C+F    RK +R  +    +Y  DG
Sbjct: 48  ACVRCHRLKQKCLPSDLADIYRKPCSKCKRMRLKCVFDLTKRKRNRKRNSNITDYKQDG 106

>CAGL0K11902g Chr11 complement(1149210..1151705) [2496 bp, 831 aa]
           {ON} similar to uniprot|P40971 Saccharomyces cerevisiae
           YDR034c LYS14 transcriptional activator of lysine
           pathway genes
          Length = 831

 Score = 40.8 bits (94), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 19/56 (33%), Positives = 28/56 (50%), Gaps = 7/56 (12%)

Query: 12  KWKRSFRACQTCRERKIKCNLGPLDNPHKPPCERCKREQRECIFV-EPSRKSRSLS 66
           K K S   C  C+ R++KC+        KP C +C R  R+C+++  P  K R  S
Sbjct: 196 KRKYSRNGCAECKRRRMKCD------ESKPKCWQCTRLNRDCVYILNPKNKKRKTS 245

>TBLA0G02610 Chr7 complement(689843..692845) [3003 bp, 1000 aa] {ON}
           Anc_2.231 YIL130W
          Length = 1000

 Score = 40.8 bits (94), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 17/50 (34%), Positives = 26/50 (52%), Gaps = 7/50 (14%)

Query: 12  KWKRSFRACQTCRERKIKCNLGPLDNPHKPPCERCKREQRECIFVEPSRK 61
           K +R  RAC  CR++K+KC+        + PC  C     EC + +PS +
Sbjct: 58  KRRRVTRACDECRKKKVKCD-------GQQPCIHCTVYSYECTYNQPSTR 100

>KLLA0F04213g Chr6 (400673..402979) [2307 bp, 768 aa] {ON} similar
           to uniprot|P40971 Saccharomyces cerevisiae YDR034C LYS14
           Transcriptional activator involved in regulation of
           genes of the lysine biosynthesis pathway requires
           2-aminoadipate semialdehyde as co-inducer
          Length = 768

 Score = 40.4 bits (93), Expect = 0.019,   Method: Compositional matrix adjust.
 Identities = 16/45 (35%), Positives = 26/45 (57%), Gaps = 6/45 (13%)

Query: 12  KWKRSFRACQTCRERKIKCNLGPLDNPHKPPCERCKREQRECIFV 56
           K K S   C  C++R++KC+ G      KP C +C R  R+C+++
Sbjct: 147 KRKYSRNGCLECKKRRMKCDEG------KPTCWQCARLNRKCVYI 185

>Skud_13.66 Chr13 complement(111847..114666) [2820 bp, 939 aa] {ON}
           YML076C (REAL)
          Length = 939

 Score = 40.4 bits (93), Expect = 0.019,   Method: Compositional matrix adjust.
 Identities = 20/66 (30%), Positives = 36/66 (54%), Gaps = 1/66 (1%)

Query: 3   SKSNRTSSKKWKRSFRACQTCRERKIKCNLGPLDNPHKPPCERCKREQRECIFVEPSRKS 62
           +K   T + K KR+  AC  C   K KC     ++ ++ PC+RC + ++ C F + S+++
Sbjct: 58  TKLETTENGKIKRNSFACVCCHSLKQKCEPSDTNDIYRKPCQRCLKHKKLCKF-DLSKRT 116

Query: 63  RSLSPK 68
           R   P+
Sbjct: 117 RKRKPR 122

>SAKL0A00704g Chr1 complement(78811..80967) [2157 bp, 718 aa] {ON}
           similar to uniprot|P35995 Saccharomyces cerevisiae
           YKL222C Hypothetical ORF and similar to uniprot|Q12340
           Saccharomyces cerevisiae YOR172W
          Length = 718

 Score = 40.4 bits (93), Expect = 0.019,   Method: Compositional matrix adjust.
 Identities = 57/243 (23%), Positives = 103/243 (42%), Gaps = 51/243 (20%)

Query: 11  KKWKRSFRACQTCRERKIKCNLGPLDNPHKPPCERC-KREQRECIFVEPSRKSRSLSPKD 69
           +K ++  ++C  CR+RK+KC      +  KP C  C  R   EC++VE  + +  + P D
Sbjct: 10  RKRRKVIKSCLFCRKRKLKC------DHKKPKCSTCAARNLPECVYVE--KFTHEIDP-D 60

Query: 70  INYGDDGDDNKLKFIHYQQGDNKGANNKEIQNMALEDSAWESDVSSMQ--------NALE 121
           +            F+         A  KE++    E + + S+  + Q        N   
Sbjct: 61  V------------FLSSTPNVELAARIKELEA---ELATYRSNAHAAQSDKNPILRNGFL 105

Query: 122 YLASAAKSVSQFENHKPTSKLSDMVNSYSKDDMTQENIIKELFEKTELK----NPASSLI 177
              ++ +S+       PTS     VNSY          I +  +K  +K    N  S+L 
Sbjct: 106 SQKNSGRSIM----FGPTS-FRQNVNSYIPKFHESFRAIWKKLKKERMKWKILNDYSTL- 159

Query: 178 AQLSRIRTKPHKKLSDIVYIGDDKLLTEEEARRLIEVFFQK--LHPFFPYIPLQLHNPEQ 235
           A++S I   P      ++    D L + E+ ++L+E+FF+    H F      Q+ +P++
Sbjct: 160 AEISVIERSPINSSKSVIQAVCDTLPSYEDIQQLLEIFFESNLFHSF------QILDPQK 213

Query: 236 LVR 238
           ++R
Sbjct: 214 VLR 216

>YGR288W Chr7 (1070293..1071714) [1422 bp, 473 aa] {ON}
          MAL13MAL-activator protein, part of complex locus MAL1;
          nonfunctional in genomic reference strain S288C
          Length = 473

 Score = 40.4 bits (93), Expect = 0.020,   Method: Compositional matrix adjust.
 Identities = 19/53 (35%), Positives = 28/53 (52%), Gaps = 10/53 (18%)

Query: 18 RACQTCRERKIKCNLGPLDNPHKPPCERCKREQRECIFVEPSRKSRSLSPKDI 70
          +AC  CR R++KC+        K PC  C +   +C +++PSRK     PK I
Sbjct: 11 QACDCCRIRRVKCD-------GKRPCSSCLQNSLDCTYLQPSRKR---GPKSI 53

>NCAS0A06190 Chr1 (1226184..1228868) [2685 bp, 894 aa] {ON}
           Anc_4.344 YML076C
          Length = 894

 Score = 40.4 bits (93), Expect = 0.020,   Method: Compositional matrix adjust.
 Identities = 20/58 (34%), Positives = 33/58 (56%), Gaps = 1/58 (1%)

Query: 12  KWKRSFRACQTCRERKIKCNLGPLDNPHKPPCERCKREQRECIFVEPSRKSRSLSPKD 69
           K KR+  AC  C   K KC    +++ +  PC+RC R ++ C F + S+++R   PK+
Sbjct: 54  KLKRNTFACVRCHSLKQKCVPSDVNDIYLKPCQRCSRNKQVCKF-DLSKRTRKRKPKN 110

>NDAI0A03410 Chr1 complement(778569..781511) [2943 bp, 980 aa]
          {ON} 
          Length = 980

 Score = 40.4 bits (93), Expect = 0.020,   Method: Compositional matrix adjust.
 Identities = 24/59 (40%), Positives = 28/59 (47%), Gaps = 9/59 (15%)

Query: 12 KWKRSFRACQTCRERKIKCNLGPLDNPHKPPCERCKREQRECIFVEPSRKSRSLSPKDI 70
          K  RS RAC+ CR RKIKC+          PC  C+     C F    RK  +LS K I
Sbjct: 10 KKTRSSRACENCRARKIKCS-------GNQPCSNCEIYNCPCAFTPIKRK--NLSDKGI 59

>KLLA0A06039g Chr1 (557368..559341) [1974 bp, 657 aa] {ON} weakly
           similar to uniprot|P36023 Saccharomyces cerevisiae
           YKR064W
          Length = 657

 Score = 40.4 bits (93), Expect = 0.021,   Method: Compositional matrix adjust.
 Identities = 28/93 (30%), Positives = 36/93 (38%), Gaps = 25/93 (26%)

Query: 11  KKWKRSFRACQTCRERKIKCNLGPLDNPHKPPCERCKREQRECIFVEPSRKSRSLSPKDI 70
           KK  R    C  CR RK KC+ G      KP C  C +    C+                
Sbjct: 12  KKRHRPTLVCLNCRRRKTKCDRG------KPSCSNCLKLGETCV---------------- 49

Query: 71  NYGDDGDDNKLKFIHYQQGDNKGANNKEIQNMA 103
            Y +D D+N  K + Y+  D+ G    E  NMA
Sbjct: 50  -YSEDTDENASKKVRYEYMDDLGL--PEFINMA 79

>ZYRO0A10956g Chr1 (881429..883996) [2568 bp, 855 aa] {ON} similar
          to uniprot|P07272 Saccharomyces cerevisiae YLR014C PPR1
          Zinc finger transcription factor containing a
          Zn(2)-Cys(6) binuclear cluster domain positively
          regulates transcription of genes involved in uracil
          biosynthesis activity may be modulated by interaction
          with Tup1p
          Length = 855

 Score = 40.4 bits (93), Expect = 0.021,   Method: Compositional matrix adjust.
 Identities = 16/46 (34%), Positives = 28/46 (60%), Gaps = 8/46 (17%)

Query: 15 RSFRACQTCRERKIKCNLGPLDNPHK-PPCERCKREQRECIFVEPS 59
          +S  AC+ CR +KIKC+       H+ P C++C R  + C+ ++P+
Sbjct: 28 KSISACKRCRTKKIKCD-------HEFPSCKKCARANKPCVSLDPA 66

>Kpol_529.15 s529 complement(38664..41510) [2847 bp, 948 aa] {ON}
           complement(38664..41510) [2847 nt, 949 aa]
          Length = 948

 Score = 40.4 bits (93), Expect = 0.022,   Method: Compositional matrix adjust.
 Identities = 18/61 (29%), Positives = 32/61 (52%), Gaps = 8/61 (13%)

Query: 3   SKSNRTSSKKWKRSFRACQTCRERKIKCNLGPLDNPHKPPCERCKREQRECIF--VEPSR 60
           SK++    K  K+S   C  C+ R++KC      +  KP C++C   +  C++  V+P +
Sbjct: 94  SKTSTGKRKFHKKSKNGCDNCKRRRVKC------DESKPICQKCINMKLNCVYTPVQPRK 147

Query: 61  K 61
           K
Sbjct: 148 K 148

>KNAG0G02130 Chr7 complement(482333..484231) [1899 bp, 632 aa]
          {ON} 
          Length = 632

 Score = 40.4 bits (93), Expect = 0.022,   Method: Compositional matrix adjust.
 Identities = 16/45 (35%), Positives = 23/45 (51%), Gaps = 7/45 (15%)

Query: 19 ACQTCRERKIKCNLGPLDNPHKPPCERCKREQRECIFVEPSRKSR 63
          AC  CR ++ KCN+       K PC  C+R   +CIF     +S+
Sbjct: 20 ACLHCRHKRKKCNM-------KSPCSNCQRAGMKCIFTHEDLRSK 57

>TPHA0L01060 Chr12 (220857..223778) [2922 bp, 973 aa] {ON}
          Anc_8.423 YLR228C
          Length = 973

 Score = 40.4 bits (93), Expect = 0.022,   Method: Compositional matrix adjust.
 Identities = 17/57 (29%), Positives = 30/57 (52%), Gaps = 9/57 (15%)

Query: 2  GSKSNRTSSKKWK---RSFRACQTCRERKIKCNLGPLDNPHKPPCERCKREQRECIF 55
          G K ++TS+ K K   +S   C  C+ R++KC      +  KP C +C   + +C++
Sbjct: 31 GKKVSKTSTGKRKFHNKSKNGCDNCKRRRVKC------DEAKPACVKCSNMKLDCVY 81

>KLTH0D07260g Chr4 complement(635598..638537) [2940 bp, 979 aa]
          {ON} some similarities with uniprot|P32862
          Saccharomyces cerevisiae YKL038W RGT1
          Glucose-responsive transcription factor that regulates
          expression of several glucose transporter (HXT) genes
          in response to glucose binds to promoters and acts both
          as a transcriptional activator and repressor
          Length = 979

 Score = 40.4 bits (93), Expect = 0.023,   Method: Compositional matrix adjust.
 Identities = 19/54 (35%), Positives = 29/54 (53%), Gaps = 8/54 (14%)

Query: 2  GSKSNRTSSKKWKRSFRACQTCRERKIKCNLGPLDNPHKPPCERCKREQRECIF 55
          G+ S+R  SK    + RAC  CRE+K +C+     +  +P C  C+R  + C F
Sbjct: 21 GAASDRRRSK----TSRACDQCREKKTRCDF----SDERPICSACQRMGKTCTF 66

>ACL096W Chr3 (169508..172015) [2508 bp, 835 aa] {ON} Syntenic
          homolog of Saccharomyces cerevisiae YKL015W (PUT3)
          Length = 835

 Score = 40.4 bits (93), Expect = 0.023,   Method: Compositional matrix adjust.
 Identities = 20/62 (32%), Positives = 29/62 (46%), Gaps = 9/62 (14%)

Query: 2  GSKSNRTSSKK--WKRSFRACQTCRERKIKCNLGPLDNPHKPPCERCKREQRECIFVEPS 59
          G+ + R    K   KR+  AC  CR R ++C       P   PC +C      C ++EPS
Sbjct: 41 GTLAGREERNKRPAKRAPLACLRCRRRHVRC-------PGGTPCAKCAVANIACEYLEPS 93

Query: 60 RK 61
          +K
Sbjct: 94 KK 95

>YPR196W Chr16 (931376..932788) [1413 bp, 470 aa] {ON} Putative
          maltose-responsive transcription factor
          Length = 470

 Score = 40.0 bits (92), Expect = 0.023,   Method: Compositional matrix adjust.
 Identities = 17/54 (31%), Positives = 28/54 (51%), Gaps = 10/54 (18%)

Query: 18 RACQTCRERKIKCNLGPLDNPHKPPCERCKREQRECIFVEPSRKSRSLSPKDIN 71
          ++C  CR R++KC+          PC+RC++    C +++P RK     PK I 
Sbjct: 6  QSCDCCRVRRVKCD-------RNRPCDRCRQRNLRCTYLQPLRKR---GPKSIG 49

>YML076C Chr13 complement(112513..115347) [2835 bp, 944 aa] {ON}
           WAR1Homodimeric Zn2Cys6 zinc finger transcription
           factor; binds to a weak acid response element to induce
           transcription of PDR12 and FUN34, encoding an acid
           transporter and a putative ammonia transporter,
           respectively
          Length = 944

 Score = 40.4 bits (93), Expect = 0.023,   Method: Compositional matrix adjust.
 Identities = 20/66 (30%), Positives = 35/66 (53%), Gaps = 1/66 (1%)

Query: 3   SKSNRTSSKKWKRSFRACQTCRERKIKCNLGPLDNPHKPPCERCKREQRECIFVEPSRKS 62
           +K   T   K KR+  AC  C   K KC    +++ ++ PC RC + ++ C F + S+++
Sbjct: 59  TKLETTEKGKTKRNSFACVCCHSLKQKCEPSDVNDIYRKPCRRCLKHKKLCKF-DLSKRT 117

Query: 63  RSLSPK 68
           R   P+
Sbjct: 118 RKRKPR 123

>Skud_2.145 Chr2 (271582..274335) [2754 bp, 917 aa] {ON} YBR033W
           (REAL)
          Length = 917

 Score = 40.0 bits (92), Expect = 0.025,   Method: Compositional matrix adjust.
 Identities = 20/74 (27%), Positives = 38/74 (51%), Gaps = 10/74 (13%)

Query: 9   SSKKWKRSFRACQTCRERKIKCNLGPLDNPHKPPCERCKREQRECIFVE------PSRKS 62
           ++K+ K++ RAC  CR+++IKC      N H   C+ C      C+F+       P++K 
Sbjct: 45  TTKQRKKASRACDQCRKKRIKCRF----NQHTRVCQGCLEVGGHCLFLRVPLKRGPAKKK 100

Query: 63  RSLSPKDINYGDDG 76
            + +  + +  D+G
Sbjct: 101 TTGTSNERSSSDNG 114

>YLL054C Chr12 complement(32673..35204) [2532 bp, 843 aa] {ON}
          Putative protein of unknown function with similarity to
          Pip2p, an oleate-specific transcriptional activator of
          peroxisome proliferation; YLL054C is not an essential
          gene
          Length = 843

 Score = 40.0 bits (92), Expect = 0.025,   Method: Compositional matrix adjust.
 Identities = 23/58 (39%), Positives = 30/58 (51%), Gaps = 8/58 (13%)

Query: 8  TSSKKWKRSFRACQTCRERKIKCNLGPLDNPHKPPCERCKREQRECIF-VEPSRKSRS 64
           S KK K SF  C  C++RKIKC      +   P C +CK     C + VEP R ++S
Sbjct: 4  ASQKKVKPSF-VCLRCKQRKIKC------DKLWPTCSKCKASSSICSYEVEPGRINKS 54

>ZYRO0A09350g Chr1 (749695..752076) [2382 bp, 793 aa] {ON} similar
          to gnl|GLV|KLLA0A04169g Kluyveromyces lactis
          KLLA0A04169g and some similarites with YDR213W
          uniprot|Q12151 Saccharomyces cerevisiae YDR213W UPC2
          involved in sterol uptake zinc finger transcription
          factor of the Zn(2)-Cys(6) binuclear cluster domain
          type
          Length = 793

 Score = 40.0 bits (92), Expect = 0.026,   Method: Compositional matrix adjust.
 Identities = 20/65 (30%), Positives = 32/65 (49%), Gaps = 9/65 (13%)

Query: 2  GSKSNRTSSKKWK---RSFRACQTCRERKIKCNLGPLDNPHKPPCERCKREQRECIFVEP 58
          G K + TS+ K K   +S   C  C+ R++KC+ G      KP C +C   + +C++   
Sbjct: 26 GKKVSITSTGKRKFHNKSKNGCDNCKRRRVKCDEG------KPLCRKCVNMKLDCVYTPA 79

Query: 59 SRKSR 63
            K R
Sbjct: 80 QPKKR 84

>TDEL0F02330 Chr6 complement(429974..433234) [3261 bp, 1086 aa]
          {ON} Anc_4.113 YGL013C
          Length = 1086

 Score = 40.0 bits (92), Expect = 0.026,   Method: Compositional matrix adjust.
 Identities = 18/38 (47%), Positives = 19/38 (50%), Gaps = 7/38 (18%)

Query: 18 RACQTCRERKIKCNLGPLDNPHKPPCERCKREQRECIF 55
          RAC+ CR RKIKC           PC  C   Q ECIF
Sbjct: 18 RACENCRRRKIKCT-------GNQPCNNCVTYQCECIF 48

>YOR363C Chr15 complement(1020222..1023212) [2991 bp, 996 aa] {ON}
           PIP2Autoregulatory oleate-specific transcriptional
          activator of peroxisome proliferation, contains
          Zn(2)-Cys(6) cluster domain, forms heterodimer with
          Oaf1p, binds oleate response elements (OREs), activates
          beta-oxidation genes
          Length = 996

 Score = 40.0 bits (92), Expect = 0.026,   Method: Compositional matrix adjust.
 Identities = 19/50 (38%), Positives = 26/50 (52%), Gaps = 7/50 (14%)

Query: 6  NRTSSKKWKRSFRACQTCRERKIKCNLGPLDNPHKPPCERCKREQRECIF 55
          NR   K+ + SF  CQ CR+ K KC      +  KP C RC ++   CI+
Sbjct: 12 NRVGKKRNRLSF-VCQACRKAKTKC------DQEKPRCGRCTKQNLFCIY 54

>SAKL0A09856g Chr1 complement(867959..871021) [3063 bp, 1020 aa]
          {ON} some similarities with uniprot|P32862
          Saccharomyces cerevisiae YKL038W RGT1
          Glucose-responsive transcription factor that regulates
          expression of several glucose transporter (HXT) genes
          in response to glucose binds to promoters and acts both
          as a transcriptional activator and repressor
          Length = 1020

 Score = 40.0 bits (92), Expect = 0.027,   Method: Compositional matrix adjust.
 Identities = 20/54 (37%), Positives = 29/54 (53%), Gaps = 4/54 (7%)

Query: 2  GSKSNRTSSKKWKRSFRACQTCRERKIKCNLGPLDNPHKPPCERCKREQRECIF 55
          G+  + T +KK  +  RAC  CR++KIKC++   DNP    C  C +    C F
Sbjct: 18 GTTYSTTETKKRSKVSRACDQCRKKKIKCDVSE-DNPV---CSGCFKVGDRCTF 67

>TPHA0A04540 Chr1 (1031790..1035326) [3537 bp, 1178 aa] {ON}
           Anc_3.109 YOL089C
          Length = 1178

 Score = 40.0 bits (92), Expect = 0.029,   Method: Compositional matrix adjust.
 Identities = 18/42 (42%), Positives = 23/42 (54%), Gaps = 2/42 (4%)

Query: 14  KRSFRACQTCRERKIKCNLGPLDNPHKPPCERCKREQRECIF 55
           KR  RAC  CR+RKIKC+     +P+   C  C +   EC F
Sbjct: 247 KRVSRACDHCRKRKIKCD--EKRDPNTNKCSNCIKYNSECTF 286

>Kwal_23.6425 s23 (1574518..1576725) [2208 bp, 735 aa] {ON}
          YKL222C - Hypothetical ORF [contig 17] FULL
          Length = 735

 Score = 40.0 bits (92), Expect = 0.031,   Method: Compositional matrix adjust.
 Identities = 18/50 (36%), Positives = 29/50 (58%), Gaps = 7/50 (14%)

Query: 9  SSKKWKRSFRACQTCRERKIKCNLGPLDNPHKPPCERC-KREQRECIFVE 57
           S+K ++S + C  CR+RK+KC      + ++P C  C  R   EC++VE
Sbjct: 25 GSRKRRKSIKQCLFCRKRKLKC------DKNRPVCGTCASRGLTECVYVE 68

>ADR405C Chr4 complement(1435702..1438125) [2424 bp, 807 aa] {ON}
          Syntenic homolog of Saccharomyces cerevisiae YAL051W
          (OAF1) and YOR363C (PIP2); Tandem gene triplication in
          this genome
          Length = 807

 Score = 40.0 bits (92), Expect = 0.031,   Method: Compositional matrix adjust.
 Identities = 23/67 (34%), Positives = 33/67 (49%), Gaps = 8/67 (11%)

Query: 1  MGSKSNRTSSKKWKRSFRACQTCRERKIKCNLGPLDNPHKPPCERCKREQRECIF-VEPS 59
          +  K  +T  ++ K SF  CQ+CR  K KC      +  KP C RC +    C++ VE  
Sbjct: 21 VSGKVTKTKGRRNKLSF-VCQSCRRSKTKC------DKVKPSCTRCVKNGSVCVYDVETQ 73

Query: 60 RKSRSLS 66
           K +S S
Sbjct: 74 TKPKSRS 80

>TBLA0I01890 Chr9 complement(423851..426328) [2478 bp, 825 aa] {ON}
           Anc_3.264 YDR034C
          Length = 825

 Score = 39.7 bits (91), Expect = 0.032,   Method: Compositional matrix adjust.
 Identities = 19/54 (35%), Positives = 28/54 (51%), Gaps = 7/54 (12%)

Query: 12  KWKRSFRACQTCRERKIKCNLGPLDNPHKPPCERCKREQRECIFV-EPSRKSRS 64
           K K S   C  C++R++KC+        KP C +C R  R CI++  P  K R+
Sbjct: 155 KRKYSRNGCTECKKRRMKCD------ETKPICWQCSRLNRSCIYILNPKNKKRN 202

>Smik_12.77 Chr12 complement(159125..161836) [2712 bp, 903 aa]
          {ON} YLR014C (REAL)
          Length = 903

 Score = 39.7 bits (91), Expect = 0.033,   Method: Compositional matrix adjust.
 Identities = 21/64 (32%), Positives = 34/64 (53%), Gaps = 13/64 (20%)

Query: 3  SKSNRTSSKKW-------KRSFRACQTCRERKIKCNLGPLDNPHKPPCERCKREQRECIF 55
          +KSNR+  +K         +S  AC+ CR +KIKC      +   P C+RC + Q  C+ 
Sbjct: 9  NKSNRSHLRKGDSPNIAISKSRTACKRCRLKKIKC------DQEFPSCKRCAKLQVPCVS 62

Query: 56 VEPS 59
          ++P+
Sbjct: 63 LDPA 66

>CAGL0J07150g Chr10 complement(688858..691926) [3069 bp, 1022 aa]
          {ON} similar to uniprot|P39720 Saccharomyces cerevisiae
          YAL051w OAF1 peroxisome proliferating transcription
          factor or uniprot|P52960 Saccharomyces cerevisiae
          YOR363c PIP2
          Length = 1022

 Score = 39.7 bits (91), Expect = 0.034,   Method: Compositional matrix adjust.
 Identities = 22/62 (35%), Positives = 30/62 (48%), Gaps = 10/62 (16%)

Query: 10 SKKWKRSFRACQTCRERKIKCNLGPLDNPHKPPCERCKREQRECIFVEPSRKSRSLSPKD 69
          SKK  R    CQ CR+ K KC      +  KP C RC +    C++   S+K    +PK+
Sbjct: 13 SKKRNRLSFVCQGCRKAKTKC------DKEKPACSRCLKHGIRCVYDLTSQK----APKN 62

Query: 70 IN 71
           N
Sbjct: 63 PN 64

>KNAG0E01760 Chr5 (350254..352962) [2709 bp, 902 aa] {ON}
          Anc_2.231 YIL130W
          Length = 902

 Score = 39.7 bits (91), Expect = 0.035,   Method: Compositional matrix adjust.
 Identities = 16/51 (31%), Positives = 27/51 (52%), Gaps = 7/51 (13%)

Query: 12 KWKRSFRACQTCRERKIKCNLGPLDNPHKPPCERCKREQRECIFVEPSRKS 62
          K +R  RAC  CR++K+KC+        + PC  C     EC +  P++++
Sbjct: 29 KRRRVTRACDECRKKKVKCD-------GQQPCIHCTVYSYECTYNHPTKRT 72

>TBLA0C04050 Chr3 complement(980010..983633) [3624 bp, 1207 aa]
          {ON} Anc_4.113 YGL013C
          Length = 1207

 Score = 39.7 bits (91), Expect = 0.036,   Method: Compositional matrix adjust.
 Identities = 17/38 (44%), Positives = 19/38 (50%), Gaps = 7/38 (18%)

Query: 18 RACQTCRERKIKCNLGPLDNPHKPPCERCKREQRECIF 55
          +AC  CR RKIKC         + PC  CK    ECIF
Sbjct: 15 KACDNCRRRKIKC-------SGERPCAGCKTYNCECIF 45

>SAKL0C03938g Chr3 complement(377431..379773) [2343 bp, 780 aa]
          {ON} weakly similar to uniprot|P40467 Saccharomyces
          cerevisiae YIL130W ASG1 Proposed transcriptional
          activator member of the Gal4p family of zinc cluster
          proteins and to YJL206C uniprot|P39529 Saccharomyces
          cerevisiae YJL206C
          Length = 780

 Score = 39.7 bits (91), Expect = 0.036,   Method: Compositional matrix adjust.
 Identities = 21/71 (29%), Positives = 33/71 (46%), Gaps = 8/71 (11%)

Query: 5  SNRTSSKKWKRSFRACQTCRERKIKCNLGPLDNPHKPPCERCKREQRECIFVEPSRKSRS 64
          +NR   K+ + S RAC  CR+RK++C+        + PC  C      C +   SR  + 
Sbjct: 18 TNRLQPKRLRVS-RACDVCRQRKVRCD-------GRQPCIHCTVYSYNCTYNPTSRTRKR 69

Query: 65 LSPKDINYGDD 75
          +  K+    DD
Sbjct: 70 VRAKESAQPDD 80

>Smik_12.157 Chr12 complement(317470..319404) [1935 bp, 644 aa]
          {ON} YLR098C (REAL)
          Length = 644

 Score = 39.7 bits (91), Expect = 0.037,   Method: Compositional matrix adjust.
 Identities = 15/48 (31%), Positives = 27/48 (56%), Gaps = 7/48 (14%)

Query: 19 ACQTCRERKIKCNLGPLDNPHKPPCERCKREQRECIFVEPSRKSRSLS 66
          ACQ+CR R+ KC++       + PC  C + Q +C+F +   +++  S
Sbjct: 43 ACQSCRRRRRKCDM-------EKPCSNCIKFQTDCVFAQQDLRNKRYS 83

>CAGL0F02519g Chr6 (245120..247618) [2499 bp, 832 aa] {ON} weakly
          similar to uniprot|P39529 Saccharomyces cerevisiae
          YJL206c
          Length = 832

 Score = 39.7 bits (91), Expect = 0.037,   Method: Compositional matrix adjust.
 Identities = 17/53 (32%), Positives = 28/53 (52%), Gaps = 7/53 (13%)

Query: 12 KWKRSFRACQTCRERKIKCNLGPLDNPHKPPCERCKREQRECIFVEPSRKSRS 64
          + +R  RAC  C++RK KC  G        PC+ C++   +CI+ E +   +S
Sbjct: 28 RTQRLSRACDLCKKRKTKCQGG-------NPCQSCRKANIQCIYREIASHDKS 73

>Suva_15.77 Chr15 complement(123654..126743) [3090 bp, 1029 aa] {ON}
           YOL089C (REAL)
          Length = 1029

 Score = 39.7 bits (91), Expect = 0.037,   Method: Compositional matrix adjust.
 Identities = 22/58 (37%), Positives = 28/58 (48%), Gaps = 6/58 (10%)

Query: 14  KRSFRACQTCRERKIKCNLGPLDNPHKPPCERCKREQRECIFV---EPSRKSRSLSPK 68
           KR  +AC  CR+RKI+C+     +P    C  C + Q  C F    E  RK R L  K
Sbjct: 127 KRVSKACDHCRKRKIRCDEV---DPQTNKCSNCVKFQSACTFKHRDEILRKKRKLETK 181

>KLLA0A10329g Chr1 (903873..905792) [1920 bp, 639 aa] {ON}
          conserved hypothetical protein
          Length = 639

 Score = 39.7 bits (91), Expect = 0.037,   Method: Compositional matrix adjust.
 Identities = 24/75 (32%), Positives = 34/75 (45%), Gaps = 12/75 (16%)

Query: 11 KKWKRSFRACQTCRERKIKCNLGPLDNPHKPPCERCKREQRECIFVEPSRKSRSLSPKDI 70
          KK  RS+  CQ C+  K KC      +  KP C  CK+   +C +      SR+L     
Sbjct: 8  KKVARSYMGCQKCKSLKKKC------DEVKPHCGYCKKRGFQCDY------SRTLKWGGR 55

Query: 71 NYGDDGDDNKLKFIH 85
           + D+    K+KF H
Sbjct: 56 PFKDNRVSKKMKFEH 70

>Kwal_47.16862 s47 complement(147009..149240) [2232 bp, 743 aa]
          {ON} YML076C (WAR1) - ORF [contig 219] FULL
          Length = 743

 Score = 39.7 bits (91), Expect = 0.038,   Method: Compositional matrix adjust.
 Identities = 17/51 (33%), Positives = 28/51 (54%)

Query: 5  SNRTSSKKWKRSFRACQTCRERKIKCNLGPLDNPHKPPCERCKREQRECIF 55
          S  TS+ + KR+  AC  C  +K KC    + + ++ PC RC++  + C F
Sbjct: 45 SPTTSAGRPKRNTFACTNCHAQKSKCVPSDVLDIYRKPCVRCRKRNKLCTF 95

>TPHA0F01380 Chr6 complement(318207..320879) [2673 bp, 890 aa] {ON}
           Anc_2.231 YIL130W
          Length = 890

 Score = 39.7 bits (91), Expect = 0.038,   Method: Compositional matrix adjust.
 Identities = 17/57 (29%), Positives = 30/57 (52%), Gaps = 7/57 (12%)

Query: 8   TSSKKWKRSFRACQTCRERKIKCNLGPLDNPHKPPCERCKREQRECIFVEPSRKSRS 64
            + KK +R  RAC  CR++K+KC+        + PC  C     +C + +P +K+ +
Sbjct: 60  VTQKKRRRVTRACDECRKKKVKCD-------GQNPCIHCTVYSYKCSYDQPVKKNNT 109

>NCAS0A03580 Chr1 complement(712039..715380) [3342 bp, 1113 aa]
          {ON} 
          Length = 1113

 Score = 39.7 bits (91), Expect = 0.038,   Method: Compositional matrix adjust.
 Identities = 18/42 (42%), Positives = 20/42 (47%), Gaps = 7/42 (16%)

Query: 14 KRSFRACQTCRERKIKCNLGPLDNPHKPPCERCKREQRECIF 55
          K+  +AC  CR RKIKC           PC  C   Q ECIF
Sbjct: 31 KKVSKACANCRRRKIKCT-------GTYPCSNCAAYQCECIF 65

>Skud_15.532 Chr15 complement(959437..962439) [3003 bp, 1000 aa]
          {ON} YAL051W (REAL)
          Length = 1000

 Score = 39.7 bits (91), Expect = 0.039,   Method: Compositional matrix adjust.
 Identities = 19/51 (37%), Positives = 28/51 (54%), Gaps = 7/51 (13%)

Query: 5  SNRTSSKKWKRSFRACQTCRERKIKCNLGPLDNPHKPPCERCKREQRECIF 55
          ++R S K+ + SF  CQ CR+ K KC      +  KP C RC ++   CI+
Sbjct: 11 TDRISRKRNRLSF-VCQACRKAKTKC------DQEKPRCGRCTKQNLFCIY 54

>NDAI0D03180 Chr4 (759984..762953) [2970 bp, 989 aa] {ON} Anc_4.344
           YML076C
          Length = 989

 Score = 39.7 bits (91), Expect = 0.040,   Method: Compositional matrix adjust.
 Identities = 22/61 (36%), Positives = 33/61 (54%), Gaps = 1/61 (1%)

Query: 3   SKSNRTSSKKWKRSFRACQTCRERKIKCNLGPLDNPHKPPCERCKREQRECIFVEPSRKS 62
           SK   T + K KR+  AC  C   K KC     ++ ++ PCERC R  + C F + S+++
Sbjct: 69  SKMETTENGKIKRNTFACVRCHSLKQKCVPSDTNDIYRRPCERCLRTGKLCKF-DLSKRT 127

Query: 63  R 63
           R
Sbjct: 128 R 128

>ZYRO0A03058g Chr1 (247954..250164) [2211 bp, 736 aa] {ON} similar
           to uniprot|P40971 Saccharomyces cerevisiae YDR034C LYS14
           Transcriptional activator involved in regulation of
           genes of the lysine biosynthesis pathway requires
           2-aminoadipate semialdehyde as co-inducer
          Length = 736

 Score = 39.7 bits (91), Expect = 0.040,   Method: Compositional matrix adjust.
 Identities = 16/45 (35%), Positives = 24/45 (53%), Gaps = 6/45 (13%)

Query: 12  KWKRSFRACQTCRERKIKCNLGPLDNPHKPPCERCKREQRECIFV 56
           K K S   C  C+ R++KC+        KP C +C R  REC+++
Sbjct: 112 KRKYSRNGCTECKRRRMKCD------ETKPTCWQCARLNRECVYI 150

>TPHA0F02550 Chr6 (559614..562013) [2400 bp, 799 aa] {ON} Anc_6.61
          YOR172W
          Length = 799

 Score = 39.7 bits (91), Expect = 0.040,   Method: Compositional matrix adjust.
 Identities = 24/76 (31%), Positives = 39/76 (51%), Gaps = 12/76 (15%)

Query: 5  SNRTSSKKWKRSFRACQTCRERKIKCNLGPLDNPHKPPCERC-KREQRECIFVEPSRKSR 63
          +N+   KK  +  ++C  CR RK+KC      + +KP C  C  R+++EC +   +  SR
Sbjct: 12 TNQGVKKKRNKLIKSCTFCRMRKLKC------DKNKPMCSTCVVRQRKECSYTYTT-SSR 64

Query: 64 SLSPKDINYGDDGDDN 79
          + SP      +DG  N
Sbjct: 65 ASSPT----ANDGKVN 76

>SAKL0D02596g Chr4 (204347..206599) [2253 bp, 750 aa] {ON}
          conserved hypothetical protein
          Length = 750

 Score = 39.3 bits (90), Expect = 0.042,   Method: Compositional matrix adjust.
 Identities = 18/49 (36%), Positives = 27/49 (55%), Gaps = 6/49 (12%)

Query: 14 KRSFRACQTCRERKIKCNLGPLDNPHKPPCERCKREQRECIFVEPSRKS 62
          KRS   C TCR+RK KC+        +P C  CKR   +C++V  ++ +
Sbjct: 30 KRSKSGCLTCRKRKKKCDEA------RPRCTGCKRNLLDCVWVNEAQGT 72

>KLLA0C08657g Chr3 (757100..759268) [2169 bp, 722 aa] {ON} some
          similarities with YDR520c
          Length = 722

 Score = 39.3 bits (90), Expect = 0.043,   Method: Compositional matrix adjust.
 Identities = 17/51 (33%), Positives = 27/51 (52%), Gaps = 2/51 (3%)

Query: 5  SNRTSSKKWKRSFRACQTCRERKIKCNLGPLDNPHKPPCERCKREQRECIF 55
          + +T +K+  R  +AC  C++ K KC   P+  P +  C RC   +R C F
Sbjct: 9  AKKTPAKRGTRGVKACDYCKKLKAKCVPSPV--PGEVRCLRCDSLKRHCSF 57

>NCAS0A03070 Chr1 (603639..605609) [1971 bp, 656 aa] {ON} 
          Length = 656

 Score = 39.3 bits (90), Expect = 0.044,   Method: Compositional matrix adjust.
 Identities = 15/46 (32%), Positives = 24/46 (52%), Gaps = 6/46 (13%)

Query: 10 SKKWKRSFRACQTCRERKIKCNLGPLDNPHKPPCERCKREQRECIF 55
          S + +R    C  CR +K++CN        +P C RC+R  R C++
Sbjct: 5  SIRGQRPTHVCAACRTQKLRCN------RERPSCSRCQRIGRTCVY 44

>SAKL0G17908g Chr7 (1552344..1554773) [2430 bp, 809 aa] {ON}
          similar to uniprot|Q03631 Saccharomyces cerevisiae
          YML076C WAR1 zinc finger transcription factor
          Length = 809

 Score = 39.3 bits (90), Expect = 0.045,   Method: Compositional matrix adjust.
 Identities = 17/50 (34%), Positives = 25/50 (50%)

Query: 6  NRTSSKKWKRSFRACQTCRERKIKCNLGPLDNPHKPPCERCKREQRECIF 55
          ++    K KR+  AC  C   K KC    ++N +  PC+RC +  R C F
Sbjct: 50 SKNDGGKPKRNTFACTNCHSLKQKCVPSDINNIYGRPCQRCMKCNRTCKF 99

>KLLA0F14322g Chr6 (1328925..1331078) [2154 bp, 717 aa] {ON}
          uniprot|Q7Z8R2 Kluyveromyces lactis Sip4 protein
          Length = 717

 Score = 39.3 bits (90), Expect = 0.045,   Method: Compositional matrix adjust.
 Identities = 19/46 (41%), Positives = 24/46 (52%), Gaps = 6/46 (13%)

Query: 8  TSSKKWKRSFRACQTCRERKIKCNLGPLDNPHKPPCERCKREQREC 53
          T+S K KR  +AC  CR +KIKC      +  KP C  CK+    C
Sbjct: 51 TASTKVKRFSQACDRCRLKKIKC------DGIKPSCSNCKKIGYHC 90

>KLTH0F18392g Chr6 (1484590..1487211) [2622 bp, 873 aa] {ON} similar
           to uniprot|P08638 Saccharomyces cerevisiae YLR451W LEU3
           Zinc-finger transcription factor that regulates genes
           involved in branched chain amino acid biosynthesis and
           ammonia assimilation positively regulated by
           alpha-isopropylmalate an intermediate in leucine
           biosynthesis
          Length = 873

 Score = 39.3 bits (90), Expect = 0.045,   Method: Compositional matrix adjust.
 Identities = 54/251 (21%), Positives = 103/251 (41%), Gaps = 34/251 (13%)

Query: 11  KKWKRSFRACQTCRERKIKCNLGPLDNPHKPP--CERCKREQRECIFVEPSRKSRSLSPK 68
           +K +R   AC  CR++K KC     D   + P  C RC ++  +C+  +  R++      
Sbjct: 22  RKGRRKKLACVECRQQKSKC-----DAHERAPESCTRCAKKNVQCVLQKDFRRTYKRVRN 76

Query: 69  DINYGDDGDDNKLKFIHYQQGDNKGANNKEIQNMALEDSAWESDVSSMQNALEYLASAAK 128
           ++       + + K +  +   N GA     +    + +  + +  + +  ++    AA 
Sbjct: 77  EV------IEKRFKEL-TKSLSNLGAEEILRRIEEEQQTLLDQNNFTKEKLMKLRQDAAS 129

Query: 129 SVSQFENHKPTSKLSDM------VNSYSKDDMTQENIIKELFEKTELKNPASSLIAQLSR 182
            + +  +   TS + D       + S S +D  +E+  +E     E+  P S+ +   + 
Sbjct: 130 GLDKASSTLSTSSVDDTPTAEPPIESLSAEDRNRES--EEAAVTIEV--PTSANVFNSNI 185

Query: 183 IRTKPHKKLSDIVYIGDDKLLTEEEARRLIEVFFQKLHPFFPYIPLQLHNPEQLVRY-PI 241
           I   P K L D+        ++ E+ R L E F  K HPF P + +    PE +    P 
Sbjct: 186 IHCSP-KSLGDV-------YMSSEDIRDLYEEFTAKYHPFLPVVDIS-KGPELIYSLSPC 236

Query: 242 LLCAVITISAR 252
           L   ++ I  R
Sbjct: 237 LFWVIMLIGLR 247

>TDEL0B07490 Chr2 complement(1314447..1317044) [2598 bp, 865 aa]
           {ON} Anc_2.654 YKL015W
          Length = 865

 Score = 39.3 bits (90), Expect = 0.047,   Method: Compositional matrix adjust.
 Identities = 15/43 (34%), Positives = 21/43 (48%), Gaps = 7/43 (16%)

Query: 19  ACQTCRERKIKCNLGPLDNPHKPPCERCKREQRECIFVEPSRK 61
           AC  CR R +KC       P   PC +C      C ++EP++K
Sbjct: 75  ACVRCRRRHVKC-------PGGQPCAKCASANIACEYLEPNKK 110

>Kwal_34.15751 s34 (40148..42034) [1887 bp, 628 aa] {ON} [contig
          274] FULL
          Length = 628

 Score = 39.3 bits (90), Expect = 0.047,   Method: Compositional matrix adjust.
 Identities = 19/55 (34%), Positives = 26/55 (47%), Gaps = 7/55 (12%)

Query: 7  RTSSKKWKRSFRACQTCRERKIKCNLGPLDNPHKPPCERCKREQRECIFVEPSRK 61
          +T   K  R    C  CR RK+KC      N  KP C RC +   +C++  P R+
Sbjct: 2  QTPKSKKNRISHVCDACRIRKLKC------NKQKPSCSRCVKHDLQCVYT-PYRR 49

>ZYRO0G17512g Chr7 complement(1447970..1449541) [1572 bp, 523 aa]
          {ON} similar to uniprot|P43634 Saccharomyces cerevisiae
          YLR098C CHA4 Zinc-finger protein with Zn[2]-Cys[6]
          fungal- type binuclear cluster domain; DNA-binding
          transcriptional activator or CHA1 and to YOR337W
          uniprot|P47988 Saccharomyces cerevisiae YOR337W TEA1
          Mutants are defective in Ty1 Enhancer-mediated
          Activation Ty1 enhancer activator
          Length = 523

 Score = 39.3 bits (90), Expect = 0.047,   Method: Compositional matrix adjust.
 Identities = 19/47 (40%), Positives = 28/47 (59%), Gaps = 8/47 (17%)

Query: 19 ACQTCRERKIKCNLGPLDNPHKPPCERCKREQRECI-FVEPSRKSRS 64
          ACQ CR+++ KC+L       + PC RC R + ECI  V+  RK ++
Sbjct: 7  ACQNCRQKRKKCDL-------ELPCSRCTRLKVECIPTVQDMRKEKA 46

>NCAS0A01630 Chr1 complement(317259..320390) [3132 bp, 1043 aa]
          {ON} Anc_4.113
          Length = 1043

 Score = 39.3 bits (90), Expect = 0.047,   Method: Compositional matrix adjust.
 Identities = 18/45 (40%), Positives = 23/45 (51%), Gaps = 7/45 (15%)

Query: 18 RACQTCRERKIKCNLGPLDNPHKPPCERCKREQRECIFVEPSRKS 62
          +AC  CR+RKIKC         K PC  C+  Q  CI+    RK+
Sbjct: 46 KACDNCRKRKIKCT-------GKQPCATCEAYQCPCIYSTQKRKT 83

>KLTH0H16170g Chr8 complement(1391996..1393855) [1860 bp, 619 aa]
          {ON} some similarities with uniprot|P52960
          Saccharomyces cerevisiae YOR363C PIP2 peroxisome
          induction pathway 2 (PIP2) transcriptional activator of
          peroxisome proliferation may form heterodimer with Oaf1
          to activate oleate-inducible gene expression activator
          of peroxisome proliferation
          Length = 619

 Score = 39.3 bits (90), Expect = 0.048,   Method: Compositional matrix adjust.
 Identities = 19/50 (38%), Positives = 24/50 (48%), Gaps = 7/50 (14%)

Query: 12 KWKRSFRACQTCRERKIKCNLGPLDNPHKPPCERCKREQRECIFVEPSRK 61
          K  R    C  CR RK+KC+        KP C RC +   ECI+  P R+
Sbjct: 7  KRNRRLHVCDACRIRKLKCDKA------KPNCSRCAKHGLECIY-NPYRQ 49

>Smik_17.27 Chr17 complement(29476..31542) [2067 bp, 688 aa] {ON}
          YKL222C (REAL)
          Length = 688

 Score = 39.3 bits (90), Expect = 0.049,   Method: Compositional matrix adjust.
 Identities = 20/83 (24%), Positives = 39/83 (46%), Gaps = 15/83 (18%)

Query: 6  NRTSSKKWKRSFRACQTCRERKIKCNLGPLDNPHKPPCERCKREQRECIFVEPSRKSRSL 65
          N+  + +  ++ +AC  CR +K KC+        +P C +C+  + EC+++       S+
Sbjct: 2  NKKKAVRRNKAIKACLNCRRKKQKCDQA------RPQCYQCRIRKTECVYLGEKADKNSI 55

Query: 66 S---------PKDINYGDDGDDN 79
          S         P DIN+    D++
Sbjct: 56 SIPNSILDTTPFDINHVGSKDNS 78

>Kwal_55.20674 s55 complement(515392..516147) [756 bp, 252 aa]
          {OFF} [contig 140] PARTIAL
          Length = 252

 Score = 38.5 bits (88), Expect = 0.051,   Method: Composition-based stats.
 Identities = 15/41 (36%), Positives = 23/41 (56%), Gaps = 6/41 (14%)

Query: 20 CQTCRERKIKCNLGPLDNPHKPPCERCKREQRECIFVEPSR 60
          C++CR+RK KC+        KP C+RC R    C++  P +
Sbjct: 21 CKSCRQRKRKCS------REKPQCQRCARLSIPCVYELPPK 55

>KNAG0M00120 Chr13 complement(12320..14965) [2646 bp, 881 aa] {ON}
          
          Length = 881

 Score = 39.3 bits (90), Expect = 0.051,   Method: Compositional matrix adjust.
 Identities = 15/44 (34%), Positives = 24/44 (54%), Gaps = 6/44 (13%)

Query: 10 SKKWKRSFRACQTCRERKIKCNLGPLDNPHKPPCERCKREQREC 53
          S+K KR+   C  C+ +K++CN        +P C RC+R  + C
Sbjct: 25 SQKSKRTVSVCIPCKSQKLRCNKA------RPICSRCQRLGKHC 62

>KLTH0G07898g Chr7 (636890..639490) [2601 bp, 866 aa] {ON} similar
          to uniprot|P07272 Saccharomyces cerevisiae YLR014C PPR1
          Zinc finger transcription factor containing a
          Zn(2)-Cys(6) binuclear cluster domain positively
          regulates transcription of genes involved in uracil
          biosynthesis activity may be modulated by interaction
          with Tup1p
          Length = 866

 Score = 39.3 bits (90), Expect = 0.052,   Method: Compositional matrix adjust.
 Identities = 17/45 (37%), Positives = 23/45 (51%), Gaps = 6/45 (13%)

Query: 15 RSFRACQTCRERKIKCNLGPLDNPHKPPCERCKREQRECIFVEPS 59
          RS  AC+ CR RK+KC      +   P C RC      C+ V+P+
Sbjct: 33 RSIAACKRCRVRKVKC------DQKFPSCSRCVTANEPCVSVDPA 71

>NDAI0F00110 Chr6 (10745..12271) [1527 bp, 508 aa] {ON} 
          Length = 508

 Score = 38.9 bits (89), Expect = 0.052,   Method: Compositional matrix adjust.
 Identities = 17/39 (43%), Positives = 22/39 (56%), Gaps = 6/39 (15%)

Query: 15 RSFRACQTCRERKIKCNLGPLDNPHKPPCERCKREQREC 53
          RS+  C TCR RK+KC+        +P C RCK+   EC
Sbjct: 15 RSYSGCWTCRARKVKCDT------QRPKCCRCKQLGIEC 47

>CAGL0F07909g Chr6 (776659..779808) [3150 bp, 1049 aa] {ON} some
          similarities with uniprot|Q12180 Saccharomyces
          cerevisiae YOL089c HAL9 or uniprot|P38114 Saccharomyces
          cerevisiae YBR150c TBS1
          Length = 1049

 Score = 39.3 bits (90), Expect = 0.053,   Method: Compositional matrix adjust.
 Identities = 17/43 (39%), Positives = 26/43 (60%), Gaps = 5/43 (11%)

Query: 14 KRSFRACQTCRERKIKCN-LGPLDNPHKPPCERCKREQRECIF 55
          +RS +AC  CR+RKI+C+ + P+ N     C  C + + EC F
Sbjct: 35 RRSTKACDHCRKRKIRCDEVNPVTN----KCSNCVKFKVECTF 73

>KLTH0G13200g Chr7 (1133333..1133382,1133450..1135100) [1701 bp,
          566 aa] {ON} highly similar to uniprot|Q04176
          Saccharomyces cerevisiae YDR397C NCB2 Beta subunit of
          the NC2 dimeric histone-fold complex represses RNA
          polymerase II transcription through binding to TBP and
          inhibition of TFIIA and TFIIB homologous to the Dr1
          subunit of the mammalian NC2 (negative
          cofactor2)[INTRON]
          Length = 566

 Score = 38.9 bits (89), Expect = 0.054,   Method: Compositional matrix adjust.
 Identities = 16/45 (35%), Positives = 25/45 (55%), Gaps = 7/45 (15%)

Query: 19 ACQTCRERKIKCNLGPLDNPHKPPCERCKREQRECIFVEPSRKSR 63
          ACQ+CR+R+ KCNL       + PC  C++   EC+ +    + R
Sbjct: 17 ACQSCRKRRRKCNL-------ESPCSNCQKYGVECVPINQDLRRR 54

>ZYRO0G12584g Chr7 complement(996642..998702) [2061 bp, 686 aa]
          {ON} conserved hypothetical protein
          Length = 686

 Score = 38.9 bits (89), Expect = 0.055,   Method: Compositional matrix adjust.
 Identities = 21/59 (35%), Positives = 32/59 (54%), Gaps = 6/59 (10%)

Query: 14 KRSFRACQTCRERKIKCNLGPLDNPHKPPCERCKREQRECIFVEPSRKSRSLSPKDINY 72
          KRS   C TCR RK KC      +  KP C+ C+R   +CI+ + + K ++   K+ +Y
Sbjct: 28 KRSKSGCLTCRNRKKKC------DETKPLCKGCRRNFLQCIWPQGNSKRKTNDQKEDSY 80

>SAKL0D14520g Chr4 complement(1192788..1195739) [2952 bp, 983 aa]
          {ON} similar to uniprot|P39720 Saccharomyces cerevisiae
          YAL051W OAF1 Oleate-activated transcription factor acts
          alone and as a heterodimer with Pip2p activates genes
          involved in beta-oxidation of fatty acids and
          peroxisome organization and biogenesis
          Length = 983

 Score = 39.3 bits (90), Expect = 0.055,   Method: Compositional matrix adjust.
 Identities = 25/69 (36%), Positives = 36/69 (52%), Gaps = 9/69 (13%)

Query: 6  NRTSSKKWKRSFRACQTCRERKIKCNLGPLDNPHKPPCERCKREQRECIF-VEPSRKSRS 64
          N  SSK+ + SF  C+ CR+ K KC      +  KP C RC +   EC++ +E   + R+
Sbjct: 15 NSHSSKRNRISF-VCKACRKSKTKC------DREKPSCTRCIKNGIECVYDIEQQTQPRN 67

Query: 65 LSPKDINYG 73
           S KD   G
Sbjct: 68 PS-KDATIG 75

>TPHA0C01080 Chr3 (246019..247794) [1776 bp, 591 aa] {ON}
          Anc_8.283 YLR098C
          Length = 591

 Score = 38.9 bits (89), Expect = 0.056,   Method: Compositional matrix adjust.
 Identities = 19/46 (41%), Positives = 25/46 (54%), Gaps = 8/46 (17%)

Query: 19 ACQTCRERKIKCNLGPLDNPHKPPCERCKREQRECIFV-EPSRKSR 63
          ACQ CR+R+ KCN          PC  C + Q +C+ V E  RK+R
Sbjct: 16 ACQNCRKRRRKCNF-------LIPCSNCIKFQTDCVAVNEDLRKTR 54

>Kwal_YGOB_gneas1 s33 complement(285483..287042) [1560 bp, 519 aa]
          {ON} KLLA0D00396g homolog - hypothetical protein
          [contig MAT] FULL
          Length = 519

 Score = 38.9 bits (89), Expect = 0.056,   Method: Compositional matrix adjust.
 Identities = 20/54 (37%), Positives = 30/54 (55%), Gaps = 5/54 (9%)

Query: 14 KRSFRACQTCRERKIKCNLGPLDNPHKPPCERCKREQRECI--FVEPSRKSRSL 65
          K++ R+C  CR+ KIKC+   L       C  CK++  EC   FV P ++S+ L
Sbjct: 12 KKALRSCVRCRKNKIKCD---LQETRPDCCTPCKKKGHECYVDFVVPHQRSQEL 62

>Suva_10.18 Chr10 complement(36048..38576) [2529 bp, 842 aa] {ON}
          YLL054C (REAL)
          Length = 842

 Score = 38.9 bits (89), Expect = 0.057,   Method: Compositional matrix adjust.
 Identities = 23/65 (35%), Positives = 31/65 (47%), Gaps = 8/65 (12%)

Query: 11 KKWKRSFRACQTCRERKIKCNLGPLDNPHKPPCERCKREQRECIF-VEPSRKSRSLSPKD 69
          K  K SF  C  C++RKIKC      +   P C +CK     C + +EP R + S    +
Sbjct: 7  KNAKPSF-VCLRCKQRKIKC------DKLWPTCSKCKASSSACTYEIEPGRTNISPPITN 59

Query: 70 INYGD 74
            YGD
Sbjct: 60 NPYGD 64

>Smik_15.350 Chr15 (610312..612666) [2355 bp, 784 aa] {ON} YOR172W
          (REAL)
          Length = 784

 Score = 38.9 bits (89), Expect = 0.057,   Method: Compositional matrix adjust.
 Identities = 18/56 (32%), Positives = 32/56 (57%), Gaps = 7/56 (12%)

Query: 3  SKSNRTSSKKWKRSFRACQTCRERKIKCNLGPLDNPHKPPCERCKREQR-ECIFVE 57
          S+ +   ++K ++  R+C  CR+RK++C      +  KP C  CK + R +CI+ E
Sbjct: 14 SEDSGKKTQKRRKPIRSCAFCRKRKLRC------DRQKPICSTCKTKGRSDCIYTE 63

>YJL206C Chr10 complement(47659..49935) [2277 bp, 758 aa] {ON}
          Putative protein of unknown function; similar to
          transcriptional regulators from the Zn[2]-Cys[6]
          binuclear cluster protein family; mRNA is weakly cell
          cycle regulated, peaking in S phase; induced rapidly
          upon MMS treatment
          Length = 758

 Score = 38.9 bits (89), Expect = 0.058,   Method: Compositional matrix adjust.
 Identities = 18/48 (37%), Positives = 26/48 (54%), Gaps = 7/48 (14%)

Query: 15 RSFRACQTCRERKIKCNLGPLDNPHKPPCERCKREQRECIFVEPSRKS 62
          R+ RAC  CR+RK++C+ G +      PC  C+    EC +  P R S
Sbjct: 42 RAHRACIACRKRKVRCS-GNI------PCRLCQTNSYECKYDRPPRNS 82

>Skud_12.544 Chr12 (969942..972608) [2667 bp, 888 aa] {ON} YLR451W
           (REAL)
          Length = 888

 Score = 38.9 bits (89), Expect = 0.059,   Method: Compositional matrix adjust.
 Identities = 75/327 (22%), Positives = 123/327 (37%), Gaps = 60/327 (18%)

Query: 6   NRTSSKKWKRSFRACQTCRERKIKCNLGPLDNPHKP-PCERCKREQRECIFVEPSRKSRS 64
           NR      KR F AC  CR++K KC+     +   P PC +C ++   CI     R++  
Sbjct: 24  NRAGMIARKRKF-ACVECRQQKSKCDA----HERAPGPCTKCAKKNVPCILKRDFRRTYK 78

Query: 65  LSPKDI----------NYGDDGDDNKLKFIHYQQG---DNKGANNKEIQNMALEDSAWES 111
            +  +              +   D  LK I  +Q    DN     ++++   L  SA+ES
Sbjct: 79  RARNEAIEKRFKELTRTLTNLTSDEILKKIEEEQEIVLDNSNFTKEKVKR--LRKSAFES 136

Query: 112 -DVSSMQNALEYLASAAKSVSQFENHKPTSKLSDMVNSYSKDDMTQENIIKELFEKTELK 170
            D+ S   +   L     + +    H  +S L+ +  S + D +   N++ E        
Sbjct: 137 TDIES--RSYRTLRGEPIAYNTNRKHTDSSPLTLLSPSTNSDYVQPINVMTE-------- 186

Query: 171 NPASSLIAQLSRIRTKPHKKLSDIVYIGDDKLLTEEEARRLIEVFFQKLHPFFPYIPLQL 230
                      +++  P K L D+        L+  +   L + F  K H F P + L  
Sbjct: 187 ----------EQLKCLP-KSLGDV-------YLSSSDIAELFQEFATKYHQFLPVVDLSK 228

Query: 231 HNPEQLVRYPILLCAVITISARYNNFGDLDLKTRESPDYNITIHEKLWMYCQRLISRTIW 290
                    P L   ++ I  R   FG  DL TR S    + +   L       I R   
Sbjct: 229 GAERIYHLSPCLFWVILLIGLR-RKFGATDLMTRLS----VLVKSVLSEITISPIIRYTP 283

Query: 291 AE-----ASTRSIGTILAFLLFTEWNP 312
           ++      +  S+ ++ AFLL+T W P
Sbjct: 284 SDNDEPVLNVASVYSVQAFLLYTFWPP 310

>Ecym_5015 Chr5 (29616..32099) [2484 bp, 827 aa] {ON} similar to
          Ashbya gossypii ADR405C
          Length = 827

 Score = 38.9 bits (89), Expect = 0.061,   Method: Compositional matrix adjust.
 Identities = 23/61 (37%), Positives = 33/61 (54%), Gaps = 8/61 (13%)

Query: 7  RTSSKKWKRSFRACQTCRERKIKCNLGPLDNPHKPPCERCKREQRECIF-VEPSRKSRSL 65
          +  S++ K SF  CQTCR+ K KC      +  KP C RC +    C++ VE  +K +S 
Sbjct: 24 KKKSRRNKLSF-VCQTCRKSKTKC------DKLKPLCTRCIKNNFVCVYDVETQKKPKSR 76

Query: 66 S 66
          S
Sbjct: 77 S 77

>Smik_13.64 Chr13 complement(110338..113172) [2835 bp, 944 aa] {ON}
           YML076C (REAL)
          Length = 944

 Score = 38.9 bits (89), Expect = 0.061,   Method: Compositional matrix adjust.
 Identities = 20/66 (30%), Positives = 34/66 (51%), Gaps = 1/66 (1%)

Query: 3   SKSNRTSSKKWKRSFRACQTCRERKIKCNLGPLDNPHKPPCERCKREQRECIFVEPSRKS 62
           +K   T   K KR+  AC  C   K KC     ++ ++ PC RC + ++ C F + S+++
Sbjct: 58  TKLETTEKGKIKRNSFACVCCHSLKQKCEPSDANDIYRKPCRRCLKHRKLCKF-DLSKRT 116

Query: 63  RSLSPK 68
           R   P+
Sbjct: 117 RKRKPR 122

>TBLA0G00490 Chr7 (99344..102100) [2757 bp, 918 aa] {ON} 
          Length = 918

 Score = 38.9 bits (89), Expect = 0.061,   Method: Compositional matrix adjust.
 Identities = 19/55 (34%), Positives = 28/55 (50%), Gaps = 7/55 (12%)

Query: 2  GSKSNRTSSKKWKRSFRACQTCRERKIKCNLGPLDNPHKPPCERCK-REQRECIF 55
           S  N+   KK + + ++C  CR RK+KC      +  KP C  C+ R   ECI+
Sbjct: 17 SSAVNKPPRKKRRSTIKSCSFCRRRKLKC------DKSKPLCSTCRARNFTECIY 65

>TBLA0G00730 Chr7 complement(165589..167994) [2406 bp, 801 aa]
          {ON} 
          Length = 801

 Score = 38.9 bits (89), Expect = 0.062,   Method: Compositional matrix adjust.
 Identities = 27/84 (32%), Positives = 41/84 (48%), Gaps = 16/84 (19%)

Query: 1  MGSK-SNRTSSKKWKRSFRACQTCRERKIKCNLGPLDNPHKPPCERCKREQRECIFVEPS 59
          M SK S RT   K+ +    C  C++  IKCN        KP C+ C R +++C ++   
Sbjct: 1  MASKLSKRTVISKYSK--HGCIQCKKSHIKCN------EEKPACQNCIRSKKDCKYL-TQ 51

Query: 60 RKSRSLSPKDINYGDDGDDNKLKF 83
            S+S+S      G + D  K+KF
Sbjct: 52 FISKSIS------GSNRDTFKIKF 69

>Smik_16.20 Chr16 complement(26236..27657) [1422 bp, 473 aa] {ON}
          YGR288W (REAL)
          Length = 473

 Score = 38.5 bits (88), Expect = 0.063,   Method: Compositional matrix adjust.
 Identities = 18/53 (33%), Positives = 27/53 (50%), Gaps = 10/53 (18%)

Query: 18 RACQTCRERKIKCNLGPLDNPHKPPCERCKREQRECIFVEPSRKSRSLSPKDI 70
          +AC  CR R++KC+        K PC  C +    C +++PS+K     PK I
Sbjct: 11 QACDCCRVRRVKCD-------SKRPCSSCLQNNLSCTYLQPSKKR---GPKSI 53

>NDAI0A05750 Chr1 complement(1302180..1304459) [2280 bp, 759 aa]
           {ON} Anc_3.264
          Length = 759

 Score = 38.9 bits (89), Expect = 0.064,   Method: Compositional matrix adjust.
 Identities = 16/53 (30%), Positives = 28/53 (52%), Gaps = 8/53 (15%)

Query: 4   KSNRTSSKKWKRSFRACQTCRERKIKCNLGPLDNPHKPPCERCKREQRECIFV 56
           K    + +K+ R+   C  C+ R++KC+        KP C +C R  REC+++
Sbjct: 117 KKGHIAKRKYSRN--GCTECKRRRMKCD------ETKPICWQCARLNRECVYI 161

>TDEL0B06360 Chr2 complement(1127150..1130095) [2946 bp, 981 aa]
          {ON} Anc_2.547 YKL038W
          Length = 981

 Score = 38.9 bits (89), Expect = 0.065,   Method: Compositional matrix adjust.
 Identities = 18/46 (39%), Positives = 24/46 (52%), Gaps = 4/46 (8%)

Query: 10 SKKWKRSFRACQTCRERKIKCNLGPLDNPHKPPCERCKREQRECIF 55
          SKK  ++ RAC  CR+RKIKC+     +  K  C  C +    C F
Sbjct: 39 SKKRTKASRACDQCRKRKIKCDF----SEEKGICTSCSKNADRCAF 80

>Kwal_26.7095 s26 (211883..214399) [2517 bp, 838 aa] {ON} YOR363C
          (PIP2) - activator of peroxisome proliferation [contig
          46] FULL
          Length = 838

 Score = 38.9 bits (89), Expect = 0.065,   Method: Compositional matrix adjust.
 Identities = 15/44 (34%), Positives = 27/44 (61%), Gaps = 7/44 (15%)

Query: 12 KWKRSFRACQTCRERKIKCNLGPLDNPHKPPCERCKREQRECIF 55
          + ++SF  C+ C++RKIKC+        +P C RC + + EC++
Sbjct: 23 RMRQSF-VCRNCKKRKIKCDKA------RPSCGRCSKLELECVY 59

>TDEL0G04890 Chr7 (903504..903581,903640..905316) [1755 bp, 584
          aa] {ON} 
          Length = 584

 Score = 38.5 bits (88), Expect = 0.066,   Method: Compositional matrix adjust.
 Identities = 19/52 (36%), Positives = 27/52 (51%), Gaps = 7/52 (13%)

Query: 7  RTSSKKWKR-SFRACQTCRERKIKCNLGPLDNPHKPPCERCKREQRECIFVE 57
          R S    KR S   C+ C+ RKIKC+ G      KP C  C R ++ C +++
Sbjct: 3  RVSGTPRKRYSHNGCKECKRRKIKCDEG------KPVCWHCDRLEKSCQYLQ 48

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.317    0.132    0.384 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 93,210,869
Number of extensions: 4232075
Number of successful extensions: 17703
Number of sequences better than 10.0: 673
Number of HSP's gapped: 17929
Number of HSP's successfully gapped: 688
Length of query: 859
Length of database: 53,481,399
Length adjustment: 118
Effective length of query: 741
Effective length of database: 39,950,811
Effective search space: 29603550951
Effective search space used: 29603550951
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 70 (31.6 bits)