Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
TPHA0K011506.69ON32432416650.0
Kpol_1008.29singletonON5381321239e-07
YOR177C (MPC54)6.69ON4643051086e-05
SAKL0A08206g6.69ON645126940.004
Suva_8.2336.69ON465254900.009
ZYRO0A11132gsingletonON698138870.025
Skud_10.1701.295ON1230114840.076
ZYRO0E04708gsingletonON611215830.085
ABR149W7.488ON1226153830.092
Suva_6.1491.295ON1230114820.12
YJL074C (SMC3)1.295ON1230114780.39
Smik_10.1671.295ON1229114770.44
TBLA0F027507.488ON1414140750.93
TBLA0A09700singletonON53283721.9
TDEL0D016201.295ON1223114722.0
Suva_2.5285.414ON944144722.1
NCAS0G022202.121ON129126672.4
NDAI0G056301.295ON1229116703.4
KLLA0D10681g7.508ON46259693.8
Kwal_27.101901.475ON27568684.0
AGR274C6.69ON37585684.7
TDEL0B05810na 1ON122241685.6
Suva_2.4515.296ON87786676.9
YDR356W (SPC110)5.414ON944102677.3
NDAI0E050405.702ON197372678.0
CAGL0H04015gsingletonON32780668.2
TPHA0H016805.414ON98968669.8
TBLA0I029004.238ON179489669.9
TPHA0D015502.279ON497696610.0
NOTE: 6 genes in the same pillar as TPHA0K01150 were not hit in these BLAST results
LIST: Skud_15.344 Smik_15.362 KLTH0G15334g Kwal_56.23256 TDEL0G04560 Ecym_3119

BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= TPHA0K01150
         (324 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

TPHA0K01150 Chr11 (241560..242534) [975 bp, 324 aa] {ON} Anc_6.6...   645   0.0  
Kpol_1008.29 s1008 complement(62595..64211) [1617 bp, 538 aa] {O...    52   9e-07
YOR177C Chr15 complement(665785..667179) [1395 bp, 464 aa] {ON} ...    46   6e-05
SAKL0A08206g Chr1 (729465..731402) [1938 bp, 645 aa] {ON} conser...    41   0.004
Suva_8.233 Chr8 complement(415017..416414) [1398 bp, 465 aa] {ON...    39   0.009
ZYRO0A11132g Chr1 complement(890189..892285) [2097 bp, 698 aa] {...    38   0.025
Skud_10.170 Chr10 (316063..319755) [3693 bp, 1230 aa] {ON} YJL07...    37   0.076
ZYRO0E04708g Chr5 complement(354494..356329) [1836 bp, 611 aa] {...    37   0.085
ABR149W Chr2 (679580..683260) [3681 bp, 1226 aa] {ON} Syntenic h...    37   0.092
Suva_6.149 Chr6 (248275..251967) [3693 bp, 1230 aa] {ON} YJL074C...    36   0.12 
YJL074C Chr10 complement(299157..302849) [3693 bp, 1230 aa] {ON}...    35   0.39 
Smik_10.167 Chr10 complement(290936..294625) [3690 bp, 1229 aa] ...    34   0.44 
TBLA0F02750 Chr6 (661437..665681) [4245 bp, 1414 aa] {ON} Anc_7....    33   0.93 
TBLA0A09700 Chr1 complement(2385365..2386963) [1599 bp, 532 aa] ...    32   1.9  
TDEL0D01620 Chr4 complement(321963..325634) [3672 bp, 1223 aa] {...    32   2.0  
Suva_2.528 Chr2 (942956..945790) [2835 bp, 944 aa] {ON} YDR356W ...    32   2.1  
NCAS0G02220 Chr7 (394509..394898) [390 bp, 129 aa] {ON} Anc_2.12...    30   2.4  
NDAI0G05630 Chr7 complement(1393671..1397360) [3690 bp, 1229 aa]...    32   3.4  
KLLA0D10681g Chr4 complement(911076..912464) [1389 bp, 462 aa] {...    31   3.8  
Kwal_27.10190 s27 complement(235124..235951) [828 bp, 275 aa] {O...    31   4.0  
AGR274C Chr7 complement(1252837..1253964) [1128 bp, 375 aa] {ON}...    31   4.7  
TDEL0B05810 Chr2 complement(1025990..1029658) [3669 bp, 1222 aa]...    31   5.6  
Suva_2.451 Chr2 (796994..799627) [2634 bp, 877 aa] {ON} YDR285W ...    30   6.9  
YDR356W Chr4 (1186107..1188941) [2835 bp, 944 aa] {ON}  SPC110In...    30   7.3  
NDAI0E05040 Chr5 (1150358..1156279) [5922 bp, 1973 aa] {ON} Anc_...    30   8.0  
CAGL0H04015g Chr8 complement(377281..378264) [984 bp, 327 aa] {O...    30   8.2  
TPHA0H01680 Chr8 (384306..387275) [2970 bp, 989 aa] {ON} Anc_5.4...    30   9.8  
TBLA0I02900 Chr9 complement(687092..692476) [5385 bp, 1794 aa] {...    30   9.9  
TPHA0D01550 Chr4 complement(319711..321204) [1494 bp, 497 aa] {O...    30   10.0 

>TPHA0K01150 Chr11 (241560..242534) [975 bp, 324 aa] {ON} Anc_6.69
           YOR177C
          Length = 324

 Score =  645 bits (1665), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 324/324 (100%), Positives = 324/324 (100%)

Query: 1   MGALPENNMEQFMEYLKEYADNSDENDDERDKYKVQLINEYCDNERLQTVQFGKEEVKMF 60
           MGALPENNMEQFMEYLKEYADNSDENDDERDKYKVQLINEYCDNERLQTVQFGKEEVKMF
Sbjct: 1   MGALPENNMEQFMEYLKEYADNSDENDDERDKYKVQLINEYCDNERLQTVQFGKEEVKMF 60

Query: 61  DSREDISNKNIQPFKTNSNRGALKPIIKAVEKISMDNNVNEELEVKECLAACFSLCSVDE 120
           DSREDISNKNIQPFKTNSNRGALKPIIKAVEKISMDNNVNEELEVKECLAACFSLCSVDE
Sbjct: 61  DSREDISNKNIQPFKTNSNRGALKPIIKAVEKISMDNNVNEELEVKECLAACFSLCSVDE 120

Query: 121 EKFTDLSISKKLRRLYISIGSAFKVKELFFYWVRMRIENELQKQISDQELQIKLLKQNLT 180
           EKFTDLSISKKLRRLYISIGSAFKVKELFFYWVRMRIENELQKQISDQELQIKLLKQNLT
Sbjct: 121 EKFTDLSISKKLRRLYISIGSAFKVKELFFYWVRMRIENELQKQISDQELQIKLLKQNLT 180

Query: 181 DITDSEKTRTLELLNFQNKYNKTILEKTELEDKVKMLDVSVDTLKKELLGTEDTISDLEN 240
           DITDSEKTRTLELLNFQNKYNKTILEKTELEDKVKMLDVSVDTLKKELLGTEDTISDLEN
Sbjct: 181 DITDSEKTRTLELLNFQNKYNKTILEKTELEDKVKMLDVSVDTLKKELLGTEDTISDLEN 240

Query: 241 FKEQCIIKKLEVAELDTEVKRLNNKNMEWRKKSNEYKLDLSRRDAEVKEAQMKQQELLIK 300
           FKEQCIIKKLEVAELDTEVKRLNNKNMEWRKKSNEYKLDLSRRDAEVKEAQMKQQELLIK
Sbjct: 241 FKEQCIIKKLEVAELDTEVKRLNNKNMEWRKKSNEYKLDLSRRDAEVKEAQMKQQELLIK 300

Query: 301 FEHLKKYMIILTIIFRMISLDILS 324
           FEHLKKYMIILTIIFRMISLDILS
Sbjct: 301 FEHLKKYMIILTIIFRMISLDILS 324

>Kpol_1008.29 s1008 complement(62595..64211) [1617 bp, 538 aa] {ON}
           complement(62595..64211) [1617 nt, 539 aa]
          Length = 538

 Score = 52.0 bits (123), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 37/132 (28%), Positives = 72/132 (54%), Gaps = 2/132 (1%)

Query: 50  VQFGKEEVKMFDSREDISNKNIQPFKTNSNRGALKPIIKAVEKISMDNNVNEELEVKECL 109
           ++F    + +FD  +++S   IQ   T S+  + K I+K  E    D    ++ E+ + +
Sbjct: 74  IRFDCNRILIFDQDKEVSKSGIQKILTKSS-SSQKSILKKREDDIEDKLYPQDDEITQIV 132

Query: 110 AACFSLCSVDEEKFTDLSISKKLRRLYISIGSAFKVKELFFYWVRMRIENELQKQISDQE 169
              F+LC V+ +    +S  ++L RL +SI +AF  KE+   +++ ++E++L  +I +Q+
Sbjct: 133 KRMFTLCGVNLKHIEGISFKEQLERLSVSITNAFNTKEMCSKYIKQKLESQLNDKILEQQ 192

Query: 170 LQIKLLKQNLTD 181
             +K  K NL D
Sbjct: 193 ETVKYWK-NLFD 203

>YOR177C Chr15 complement(665785..667179) [1395 bp, 464 aa] {ON}
           MPC54Component of the meiotic outer plaque, a
           membrane-organizing center which is assembled on the
           cytoplasmic face of the spindle pole body during meiosis
           II and triggers the formation of the prospore membrane;
           potential Cdc28p substrate
          Length = 464

 Score = 46.2 bits (108), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 84/305 (27%), Positives = 140/305 (45%), Gaps = 62/305 (20%)

Query: 50  VQFGKEEVKMFDSREDIS--NKN--------------IQPFKTNSNRGALK-PIIKAVEK 92
           V+FG ++V +FD R+ ++  NKN              I P     N+ +LK P  K   K
Sbjct: 39  VRFGDDDVNIFDQRKKVNEINKNNTVKRSIPSSISTTITP-----NKSSLKSPRGKRASK 93

Query: 93  ISMDNNV-----NEEL-EVKECLAACFSLCSVDEEKFTDLSIS---KKLRRLYISIG--- 140
            S DN       NE L EV + +  C++LC++  +  +  SIS   +    L + I    
Sbjct: 94  NSFDNETKLESKNETLKEVNDAVNRCYALCNIPTKHVSINSISDLAQTFETLAVGITHET 153

Query: 141 --------SAFKVKELFFYWVRMRIE-NELQKQISDQELQIKLLKQNLTDITDSEKTRTL 191
                   S   +  L+++    + E NE   Q++   L +K+ KQNL    D  K +  
Sbjct: 154 NRKAECERSKNAIDSLYYHEQLEKKELNEKSLQMAIDHL-LKVTKQNLRQADDGNKLKET 212

Query: 192 ELLNFQNKYNKTILEKTELEDKVKMLDVSVDTLKKELL--GTEDTISDLENFKEQCIIKK 249
           E L       K+ +E+ E  D  K   +S+++L+++LL   T + I   + +K Q   ++
Sbjct: 213 EAL-------KSFIEEIEEVDDNK---ISINSLQQQLLEEKTANNILRRDYYKLQERGRR 262

Query: 250 L--EVAEL-DTEVKRLNNKNMEWRKKSNEYKLDLSRRD---AEVKEAQMKQQELLIKFEH 303
           L  E  EL D   K++  K  E +K  NE K+ L+  D   AE      K+++   K+ +
Sbjct: 263 LCHEFQELQDDYSKQMKQKEYEVQKLKNEIKVLLNMNDNLKAEKAHYSQKEKQYFQKYTY 322

Query: 304 LKKYM 308
           ++KYM
Sbjct: 323 IEKYM 327

>SAKL0A08206g Chr1 (729465..731402) [1938 bp, 645 aa] {ON} conserved
           hypothetical protein
          Length = 645

 Score = 40.8 bits (94), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 38/126 (30%), Positives = 58/126 (46%), Gaps = 24/126 (19%)

Query: 50  VQFGKEEVKMFDSREDISN--KNIQPFKTNSN--RGALKPIIKAVEKIS----------- 94
           ++FG+  VKMF S   I N  +   P K N N    ++K ++  VEK S           
Sbjct: 140 IRFGENSVKMFYSDSLIGNGLEENPPRKPNGNLKHDSVKSVL--VEKNSDNACPLKSKDS 197

Query: 95  ----MDNNVNEELE---VKECLAACFSLCSVDEEKFTDLSISKKLRRLYISIGSAFKVKE 147
                D  VN  +E     E +  CF+LC+V  E   +  +   L+RL   I SAFK +E
Sbjct: 198 DTADQDWEVNVPIENTVALEAITRCFNLCNVPLEDLDEDDLVMSLQRLSFGIVSAFKTQE 257

Query: 148 LFFYWV 153
           + + ++
Sbjct: 258 MCYKYL 263

>Suva_8.233 Chr8 complement(415017..416414) [1398 bp, 465 aa] {ON}
           YOR177C (REAL)
          Length = 465

 Score = 39.3 bits (90), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 61/254 (24%), Positives = 111/254 (43%), Gaps = 46/254 (18%)

Query: 9   MEQFMEYLKEYADNSDENDDERDKYKVQLINEYCDNERLQTVQFGKEEVKMFDSREDISN 68
           M +   Y   Y +N++ N +    YK     E   ++    V+FG ++V +FD R+ ++ 
Sbjct: 1   MPEDPHYSDSYGENNNSNPNMVSPYKDSFFKEVTPSK--PNVRFGDDDVNIFDQRKKVNE 58

Query: 69  KNIQ-------PFKTNS----NRGALK-PIIKAVEKISMDN----NVNEEL--EVKECLA 110
            N         P  TN+    N+ +LK P   +  K   D       N+E   +V + + 
Sbjct: 59  INKSSYIKKSIPLSTNTNSTPNKSSLKSPRSDSTSKPGFDYIDQLESNDETFKDVNDAVN 118

Query: 111 ACFSLCSVDEEKFTDLSIS---KKLRRLYISIG-----------SAFKVKELFFYWVRMR 156
            C++LC++  +  +  SIS   +    L + I            S   +  L+++    +
Sbjct: 119 RCYALCNIPTKHVSIKSISDLAQTFETLAVGITHETNRKAECERSKNAIDSLYYHEQLEK 178

Query: 157 IE-NELQKQISDQELQIKLLKQNLTDITDSEKTRTLELLNFQNKYNKTILEKTELEDKVK 215
            E NE   Q++   L +K+ KQNL    D+ K +  E+L       K+  E+ E  D  K
Sbjct: 179 KELNEKSLQMAIDHL-LKVTKQNLRQADDTNKLKETEVL-------KSFFEEIEEVDDNK 230

Query: 216 MLDVSVDTLKKELL 229
              +S++ L+++LL
Sbjct: 231 ---ISINNLEQQLL 241

>ZYRO0A11132g Chr1 complement(890189..892285) [2097 bp, 698 aa] {ON}
           some similarities with uniprot|Q22X91 Tetrahymena
           thermophila SB210 TTHERM_00561660 Viral A-type inclusion
           protein repeat containing protein
          Length = 698

 Score = 38.1 bits (87), Expect = 0.025,   Method: Compositional matrix adjust.
 Identities = 35/138 (25%), Positives = 63/138 (45%), Gaps = 15/138 (10%)

Query: 28  DERDKYKVQLINEYCDNERLQTVQFGKEEVKMFDSREDISNKNIQP--FKTNSNRGAL-- 83
           D +  Y+    NE  + E+L+   FG+ E   FD  E++    ++   +K  S  GAL  
Sbjct: 66  DPKIPYEAYFANETEEREKLR---FGENETITFDINEEVGKLVMKEAEYKPASQHGALDQ 122

Query: 84  -----KPIIKAVEK--ISMDNNVNEELEV-KECLAACFSLCSVDEEKFTDLSISKKLRRL 135
                K I+K   +  I    + N  ++  +E +  C+++C +  +      +   L +L
Sbjct: 123 KNTKNKSILKTNPRTVIPYRPHANPYIDACQEVMIKCYNMCGISVDYLDIDKMFDSLGKL 182

Query: 136 YISIGSAFKVKELFFYWV 153
              I + FK+KEL F +V
Sbjct: 183 MFGISNEFKMKELCFNYV 200

>Skud_10.170 Chr10 (316063..319755) [3693 bp, 1230 aa] {ON} YJL074C
            (REAL)
          Length = 1230

 Score = 37.0 bits (84), Expect = 0.076,   Method: Compositional matrix adjust.
 Identities = 34/114 (29%), Positives = 61/114 (53%), Gaps = 7/114 (6%)

Query: 195  NFQNKYNKTILEKTELEDKVKMLDVSVDTLKKELLGTEDTISDLENFKEQCIIKKLEVAE 254
            NFQ    KT+++KT L  + + L   +  +   LL  +  I+D  +     +++KL   +
Sbjct: 928  NFQKSVEKTMIKKTTLVSRREELQQRIREIG--LLPEDALINDFSDITSDQLLQKLN--D 983

Query: 255  LDTEVKRLNNKN---MEWRKKSNEYKLDLSRRDAEVKEAQMKQQELLIKFEHLK 305
            ++TE+  L N N    E  KK NE + DLS R +E+ E++   Q+L+++ +  K
Sbjct: 984  MNTEISGLKNVNKRAFENFKKFNEKRKDLSERASELDESKNSIQDLIVRLKQQK 1037

>ZYRO0E04708g Chr5 complement(354494..356329) [1836 bp, 611 aa] {ON}
           conserved hypothetical protein
          Length = 611

 Score = 36.6 bits (83), Expect = 0.085,   Method: Compositional matrix adjust.
 Identities = 53/215 (24%), Positives = 99/215 (46%), Gaps = 28/215 (13%)

Query: 50  VQFGKEEVKMFDSREDISNKNIQPFKTNSNRGAL---KPIIKAVEK-------ISMDNNV 99
           V+FG +E+ +F+  E I +      K NS+   +    PI+K  +K       +  DN +
Sbjct: 78  VKFGDKEIVIFNEDERIGH----SMKANSSVDNVILPLPILKISQKGASDIKYMEPDNKM 133

Query: 100 NEELE-VKECLAACFSLCSVDEEKFTDLSISKKLRRLYISIGSAFKVKELFFYWVRMRIE 158
             + E + E    C++LC++   +F + +  K L++L   I  +FK K+  + ++R    
Sbjct: 134 ATQQERLFEVFRRCYTLCNLPMSQFDENNPFKSLKKLCEGIKKSFKAKDECYKYIRYEEN 193

Query: 159 NELQKQISDQELQIKLLKQNLTDITDSEKTRTLELLNFQNKYNKTILEKTELEDKVKMLD 218
             L +       +I+ LK  + ++ D ++  +L LL      NK      E  +++K L 
Sbjct: 194 RRLSQ-------EIRKLKDTIQELKD-DRHNSLVLLQI----NKLQKHNNEYRNEIKDLT 241

Query: 219 VSVDTLKKELLGTEDTISDLENFKEQCIIKKLEVA 253
             V +   E       IS+L+  K Q +++KL  A
Sbjct: 242 AQVTSTNYENSELRSNISELQTTKNQ-LMEKLGTA 275

>ABR149W Chr2 (679580..683260) [3681 bp, 1226 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YBL047C (EDE1)
          Length = 1226

 Score = 36.6 bits (83), Expect = 0.092,   Method: Composition-based stats.
 Identities = 31/153 (20%), Positives = 76/153 (49%), Gaps = 11/153 (7%)

Query: 160 ELQKQISDQELQIKLLKQNLTDITDSEKTRTLELLNFQNKYNKTILEKTELEDKVKMLDV 219
           E+++ ++    + ++L Q L +   +  +   EL N Q +  +     T+L++K+   + 
Sbjct: 572 EVEQLLTKARAETEVLTQQLQNTESTCHSTQSELTNLQLELQECEKTNTQLKEKISNYNN 631

Query: 220 SVDTLKKELLGTEDTISDLENF----KEQCIIKKLEVAELDTEVKRLNN---KNMEWRKK 272
            + +L+++L G +  +           +Q  +     A L+ E+K L++   K +E RK+
Sbjct: 632 LILSLQQDLAGKQQQVKQQRALVDVNTQQADLNATTGAGLEEEIKGLDDRLAKLIEKRKE 691

Query: 273 SNEYKLDLSRRDAEVKEAQM----KQQELLIKF 301
            ++Y+ ++ R+  +++E  +    + QEL  K+
Sbjct: 692 LDDYQTNIERQHKDLEEKHLQFVSRSQELENKY 724

>Suva_6.149 Chr6 (248275..251967) [3693 bp, 1230 aa] {ON} YJL074C
            (REAL)
          Length = 1230

 Score = 36.2 bits (82), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 34/114 (29%), Positives = 61/114 (53%), Gaps = 7/114 (6%)

Query: 195  NFQNKYNKTILEKTELEDKVKMLDVSVDTLKKELLGTEDTISDLENFKEQCIIKKLEVAE 254
            NFQ    KT+++KT L  + + L   +  +   LL  +  ++D  +     +++KL   +
Sbjct: 928  NFQKSVEKTMIKKTTLVTRREELQQRIREIG--LLPEDALVNDFSDITSDQLLQKLN--D 983

Query: 255  LDTEVKRLNNKN---MEWRKKSNEYKLDLSRRDAEVKEAQMKQQELLIKFEHLK 305
            ++TE+  L N N    E  KK NE + DLS R +E+ E++   Q+L++K +  K
Sbjct: 984  MNTEISSLKNVNKRAFENFKKFNEKRKDLSGRASELDESKDSIQDLIVKLKQQK 1037

>YJL074C Chr10 complement(299157..302849) [3693 bp, 1230 aa] {ON}
            SMC3Subunit of the multiprotein cohesin complex required
            for sister chromatid cohesion in mitotic cells; also
            required, with Rec8p, for cohesion and recombination
            during meiosis; phylogenetically conserved SMC
            chromosomal ATPase family member
          Length = 1230

 Score = 34.7 bits (78), Expect = 0.39,   Method: Compositional matrix adjust.
 Identities = 32/114 (28%), Positives = 61/114 (53%), Gaps = 7/114 (6%)

Query: 195  NFQNKYNKTILEKTELEDKVKMLDVSVDTLKKELLGTEDTISDLENFKEQCIIKKLEVAE 254
            NFQ    KT+++KT L  + + L   +  +   LL  +  ++D  +     ++++L   +
Sbjct: 928  NFQKSVEKTMIKKTTLVTRREELQQRIREIG--LLPEDALVNDFSDITSDQLLQRLN--D 983

Query: 255  LDTEVKRLNNKN---MEWRKKSNEYKLDLSRRDAEVKEAQMKQQELLIKFEHLK 305
            ++TE+  L N N    E  KK NE + DL+ R +E+ E++   Q+L++K +  K
Sbjct: 984  MNTEISGLKNVNKRAFENFKKFNERRKDLAERASELDESKDSIQDLIVKLKQQK 1037

>Smik_10.167 Chr10 complement(290936..294625) [3690 bp, 1229 aa] {ON}
            YJL074C (REAL)
          Length = 1229

 Score = 34.3 bits (77), Expect = 0.44,   Method: Compositional matrix adjust.
 Identities = 33/114 (28%), Positives = 61/114 (53%), Gaps = 7/114 (6%)

Query: 195  NFQNKYNKTILEKTELEDKVKMLDVSVDTLKKELLGTEDTISDLENFKEQCIIKKLEVAE 254
            NFQ    KT+++KT L  + + L   +  +   LL  +  ++D  +     +++KL   +
Sbjct: 928  NFQKSVEKTMIKKTTLVTRREELQQRIREIG--LLPEDALVNDFSDITSDQLLQKLN--D 983

Query: 255  LDTEVKRLNNKN---MEWRKKSNEYKLDLSRRDAEVKEAQMKQQELLIKFEHLK 305
            ++TE+  L N N    E  KK +E + DLS R +E+ E++   Q+L++K +  K
Sbjct: 984  MNTEISGLKNVNKRAFENFKKFDEKRKDLSERASELDESKDSIQDLIVKLKQQK 1037

>TBLA0F02750 Chr6 (661437..665681) [4245 bp, 1414 aa] {ON} Anc_7.488
           YBL047C
          Length = 1414

 Score = 33.5 bits (75), Expect = 0.93,   Method: Composition-based stats.
 Identities = 33/140 (23%), Positives = 69/140 (49%), Gaps = 12/140 (8%)

Query: 175 LKQNLTDITDSEKTRTLELLNFQNKYNKTILEKTELEDKVKMLDVSVDTLK------KEL 228
           L+  L  + ++ K   L+L     ++N++     EL++K+  ++ + + L+      K +
Sbjct: 651 LQTQLVTLENTNKESELKLNELTAQFNESQKLNDELKEKMTTINTTTNDLENKIEELKSV 710

Query: 229 LGTEDTISDLENFKEQCIIKKLEVAELDTEVKRLNNKNMEWRKKSNEYKLDLSRRDAEVK 288
              E +++D+ +  +Q  +K++ V  L+TE+  L  K   + KK  E  LD  +   E +
Sbjct: 711 YQKEKSMTDVNS--KQLELKEINVETLNTELSDLQEKIDIYLKKQKE--LDDYKTQVEQQ 766

Query: 289 EAQMKQ--QELLIKFEHLKK 306
            AQ++   Q+L  K   L +
Sbjct: 767 HAQLESTYQQLATKTNELNE 786

 Score = 30.4 bits (67), Expect = 8.1,   Method: Composition-based stats.
 Identities = 32/132 (24%), Positives = 55/132 (41%), Gaps = 10/132 (7%)

Query: 166 SDQELQIKLLKQNLTDITDSEKTRTLELLNFQNKYNKTILEKTELEDKVKMLDVSVDTLK 225
           SD   ++      LT++++   + T +      K +KT +E   + D    + + + TL+
Sbjct: 565 SDASAKLSTATTELTNLSNQMSSLTNQASINNEKKSKTEMELKRVTDMKNSMQLKLTTLR 624

Query: 226 KELLGTEDTISDLENFKEQCIIKKLEVAELDTEVKRLNNKNMEWRKKSNEYKLDLSRRDA 285
           +     + TI D+EN +        E   L T++  L N N E   K NE         A
Sbjct: 625 QT---NDKTIKDIENTQLSINTINNENTNLQTQLVTLENTNKESELKLNELT-------A 674

Query: 286 EVKEAQMKQQEL 297
           +  E+Q    EL
Sbjct: 675 QFNESQKLNDEL 686

>TBLA0A09700 Chr1 complement(2385365..2386963) [1599 bp, 532 aa]
           {ON} 
          Length = 532

 Score = 32.3 bits (72), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 24/83 (28%), Positives = 42/83 (50%), Gaps = 8/83 (9%)

Query: 105 VKECLAACFSLCSVDE-EKFTDLSISKKLRRLYISIGSAFKVKELFFYWVRMRIE----- 158
           ++     CF  C V +  +F   +I   L  L +SI    K K + F ++  +       
Sbjct: 207 IENGFLKCFEFCYVLKIPQFEPNNIPLMLNFLSLSILHLIKFKNIHFSYLNFKNNENFKN 266

Query: 159 --NELQKQISDQELQIKLLKQNL 179
             N+L K+I++ +L+IK+LK+NL
Sbjct: 267 QLNQLNKKINNLKLEIKILKENL 289

>TDEL0D01620 Chr4 complement(321963..325634) [3672 bp, 1223 aa] {ON}
            Anc_1.295 YJL074C
          Length = 1223

 Score = 32.3 bits (72), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 31/114 (27%), Positives = 57/114 (50%), Gaps = 4/114 (3%)

Query: 193  LLNFQNKYNKTILEKTELEDKVKMLDVSVDTLKKELLGTEDTISDLENFKEQCIIKKLEV 252
            L  FQ    K++++KT L  + + L   +  +    L  E+ ++   N   + +++KL  
Sbjct: 923  LETFQKDAEKSMVKKTTLASRREELQRKIREVG---LLAEEALNSFSNLSSEELLRKLNA 979

Query: 253  AELD-TEVKRLNNKNMEWRKKSNEYKLDLSRRDAEVKEAQMKQQELLIKFEHLK 305
               D + +K +N K  E  KK +E KL+L  R  E+ E++   Q L++K +  K
Sbjct: 980  VNEDISGLKNVNKKAFENFKKFHEKKLELEDRSKELDESKTSIQNLIVKLKQQK 1033

>Suva_2.528 Chr2 (942956..945790) [2835 bp, 944 aa] {ON} YDR356W
           (REAL)
          Length = 944

 Score = 32.3 bits (72), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 38/144 (26%), Positives = 78/144 (54%), Gaps = 7/144 (4%)

Query: 154 RMRIENELQKQISDQELQIKLLKQNLTDITDSEKTRTLELLNFQNKYNKTILEKTELEDK 213
           R RIE    ++++D E ++K +K  + ++ +S   ++  L + +N+  K   +  ELE+K
Sbjct: 229 RERIE----RKLNDSESKLKTMKGQVHELENSANRKSSLLESKENELRKVKDQLKELENK 284

Query: 214 VKMLDVSVDTLKKELLGTEDTISDLENFKEQCIIKKLEVAELDTEVKRLNNKNMEWRKKS 273
                  +D+ K EL    D +++LEN   Q   K  ++   ++E+K+L N+  E   K 
Sbjct: 285 ADATCSQLDSKKNELRKLTDQLNELEN---QANEKDSQLKSKESELKKLTNQLNELENKV 341

Query: 274 NEYKLDLSRRDAEVKEAQMKQQEL 297
           N+     S +++E+K+++++  EL
Sbjct: 342 NQNGSQSSAKESELKKSKIQITEL 365

>NCAS0G02220 Chr7 (394509..394898) [390 bp, 129 aa] {ON} Anc_2.121
           YNL149C
          Length = 129

 Score = 30.4 bits (67), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 35/126 (27%), Positives = 59/126 (46%), Gaps = 18/126 (14%)

Query: 123 FTDLSISKKLRRLYISIGSAFKVKELFFYWVRMRIENELQKQISDQELQIKLL----KQN 178
           F D  I K +R L I +G    V+    Y  R   + +L++Q+ D E   ++L    K+N
Sbjct: 16  FEDFDIYKGIR-LVIIVGGYLLVRN---YVAREMAKKQLERQVRDDE---RMLSDNKKKN 68

Query: 179 LTDITDSEKTRTLELLNFQNKYNKTILEKTELEDKVKMLDVSVDTLKKE-LLGTEDTISD 237
           L D  ++EK        + NK  K + ++ E      ML  +++ +KKE     ED+  D
Sbjct: 69  LVDDPETEKMAQSTQFGWGNKTRKRVKKQQE------MLQKAIEQIKKEKKFAGEDSDED 122

Query: 238 LENFKE 243
           + +  E
Sbjct: 123 IADLLE 128

>NDAI0G05630 Chr7 complement(1393671..1397360) [3690 bp, 1229 aa] {ON}
            Anc_1.295 YJL074C
          Length = 1229

 Score = 31.6 bits (70), Expect = 3.4,   Method: Compositional matrix adjust.
 Identities = 32/116 (27%), Positives = 60/116 (51%), Gaps = 8/116 (6%)

Query: 193  LLNFQNKYNKTILEKTELEDKVKMLDVSVDTLKKELLGTEDTISDLENFKEQCIIKKLEV 252
            L NFQ    KT+++KT L  +   L   +  +    L +ED + D  +   + +++KL+ 
Sbjct: 924  LENFQKDAEKTMIKKTTLSTRRDELQQKIREIG---LLSEDVLHDFNDLSSEELLEKLK- 979

Query: 253  AELDTEVKRLNNKN---MEWRKKSNEYKLDLSRRDAEVKEAQMKQQELLIKFEHLK 305
              ++ E+  LNN N    E  KK +E   +L +R +E+ E++   +EL+ + +  K
Sbjct: 980  -SVNDEIAGLNNVNKRAFENFKKFDEKHTELEKRASELDESKTSIKELITRLKQQK 1034

>KLLA0D10681g Chr4 complement(911076..912464) [1389 bp, 462 aa] {ON}
           similar to uniprot|P47158 Saccharomyces cerevisiae
           YJR122W CAF17 Mitochondrial protein that interacts with
           Ccr4p in the two-hybrid system 3'-untranslated region
           contains a putative mRNA localization element common to
           genes encoding mitochondrial proteins
          Length = 462

 Score = 31.2 bits (69), Expect = 3.8,   Method: Compositional matrix adjust.
 Identities = 24/59 (40%), Positives = 31/59 (52%), Gaps = 4/59 (6%)

Query: 169 ELQIKLLKQNLTDIT--DSEKTRTLELLNFQNKYNKTIL-EKTELEDKVKMLDVSVDTL 224
           +LQ   +K+NLT I+  + EK  TL  LNF +KYN  I  E T LED +         L
Sbjct: 48  KLQPNFVKKNLTTISTKEQEKNNTLSSLNF-SKYNWGIYKECTRLEDHISRFGTYTGFL 105

>Kwal_27.10190 s27 complement(235124..235951) [828 bp, 275 aa] {ON}
           YJR046W (TAH11) - Product of gene unknown [contig 40]
           PARTIAL
          Length = 275

 Score = 30.8 bits (68), Expect = 4.0,   Method: Compositional matrix adjust.
 Identities = 20/68 (29%), Positives = 39/68 (57%), Gaps = 7/68 (10%)

Query: 169 ELQIKLLKQNLTDITDSEKTRTLELLNFQNKYNKTILEKTELEDKVKMLDVSVDTLKKEL 228
           E+ I++  +NLT+ T S K+R L+   + +++   +L+K E+  +V +L +      K+ 
Sbjct: 47  EITIQIPSRNLTN-TLSGKSRKLQYSEYADQWLSDVLQKPEVPPEVPVLSI------KKR 99

Query: 229 LGTEDTIS 236
            G+EDT  
Sbjct: 100 RGSEDTFG 107

>AGR274C Chr7 complement(1252837..1253964) [1128 bp, 375 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YOR177C
           (MPC54)
          Length = 375

 Score = 30.8 bits (68), Expect = 4.7,   Method: Compositional matrix adjust.
 Identities = 21/85 (24%), Positives = 39/85 (45%), Gaps = 2/85 (2%)

Query: 72  QPFKTNSNRGALKPIIKAVEKISMDNNVNEEL--EVKECLAACFSLCSVDEEKFTDLSIS 129
           QP   +S     K I+ + +    +N+ NEE   EV+  L  CF+ C++D +   +  + 
Sbjct: 64  QPSARSSMTTPRKSILVSRQTTETENSDNEEDPDEVELLLHRCFNFCNLDTDGVAERPLV 123

Query: 130 KKLRRLYISIGSAFKVKELFFYWVR 154
           + L  +   I S F+  E  + +  
Sbjct: 124 ENLELISYGIISTFRFHECCYKYAH 148

>TDEL0B05810 Chr2 complement(1025990..1029658) [3669 bp, 1222 aa]
           {ON} 
          Length = 1222

 Score = 30.8 bits (68), Expect = 5.6,   Method: Composition-based stats.
 Identities = 16/41 (39%), Positives = 24/41 (58%)

Query: 187 KTRTLELLNFQNKYNKTILEKTELEDKVKMLDVSVDTLKKE 227
           K   LE L FQNK  K I E T +    ++ D S++TL+++
Sbjct: 107 KKSLLECLAFQNKITKGIPEGTAVNSPFEIWDQSLETLQRD 147

>Suva_2.451 Chr2 (796994..799627) [2634 bp, 877 aa] {ON} YDR285W
           (REAL)
          Length = 877

 Score = 30.4 bits (67), Expect = 6.9,   Method: Compositional matrix adjust.
 Identities = 30/86 (34%), Positives = 50/86 (58%), Gaps = 5/86 (5%)

Query: 209 ELEDKVKMLDVSVDTLKKELLGTEDTISDLENFKEQCIIKKLEVAELDTEVKRL--NNKN 266
           ELE++ + L   +D  KKE+ G E+++SD++  K+Q I+ K E  ++  E   L  N +N
Sbjct: 657 ELEEQCRYLKGCLD--KKEI-GVEESLSDVKILKQQVIVLKSEKQDITAEKLELQDNLEN 713

Query: 267 MEWRKKSNEYKLDLSRRDAEVKEAQM 292
           +E   K+ + K+ L RR+ E K  Q 
Sbjct: 714 LEEVTKNLQQKVQLQRRELEEKTKQF 739

>YDR356W Chr4 (1186107..1188941) [2835 bp, 944 aa] {ON}  SPC110Inner
           plaque spindle pole body (SPB) component, ortholog of
           human kendrin; involved in connecting nuclear
           microtubules to SPB; interacts with Tub4p-complex and
           calmodulin; phosphorylated by Mps1p in cell
           cycle-dependent manner
          Length = 944

 Score = 30.4 bits (67), Expect = 7.3,   Method: Compositional matrix adjust.
 Identities = 26/102 (25%), Positives = 55/102 (53%), Gaps = 1/102 (0%)

Query: 164 QISDQELQIKLLKQNLTDITDSEKTRTLELLNFQNKYNKTILEKTELEDKVKMLDVSVDT 223
           Q S +E ++K+LK  + ++ +   T+  +L+  + K    + + T+LE K+   D  + +
Sbjct: 347 QSSAKENELKMLKNKIAELEEEISTKNSQLIAKEGKLASLMAQLTQLESKLNQRDSQLGS 406

Query: 224 LKKELLGTEDTIS-DLENFKEQCIIKKLEVAELDTEVKRLNN 264
            ++EL  T D +  D+   +E+ + K   + +L  +VK+L N
Sbjct: 407 REEELKKTNDKLQKDIRIAREETVSKDERIIDLQKKVKQLEN 448

>NDAI0E05040 Chr5 (1150358..1156279) [5922 bp, 1973 aa] {ON} Anc_5.702
            YIL149C
          Length = 1973

 Score = 30.4 bits (67), Expect = 8.0,   Method: Compositional matrix adjust.
 Identities = 22/72 (30%), Positives = 41/72 (56%), Gaps = 4/72 (5%)

Query: 209  ELEDKVKMLDVSVDTLKKELLGTEDTISDLENFKEQCIIKKLEVAELD---TEVKRLNNK 265
            +LE++VK  + + +  ++EL    +    +   +EQ    + E+AEL    T+ KRL N+
Sbjct: 1039 DLEEQVKYANKAQNNYEQELQNHANVSKTISQLREQTQHYRTEIAELTISATDAKRLLNE 1098

Query: 266  N-MEWRKKSNEY 276
            N + W+K+ +EY
Sbjct: 1099 NQISWQKQRDEY 1110

>CAGL0H04015g Chr8 complement(377281..378264) [984 bp, 327 aa] {ON}
           weakly similar to uniprot|Q06704 Saccharomyces
           cerevisiae YLR309c IMH1
          Length = 327

 Score = 30.0 bits (66), Expect = 8.2,   Method: Compositional matrix adjust.
 Identities = 28/80 (35%), Positives = 42/80 (52%), Gaps = 10/80 (12%)

Query: 100 NEELEVKECL-AACFSLCSVDEEKFTDL---SISKKLRRLYISIGSAFKVKELFFYWVRM 155
           NEELE    L + CF+LC++D E  TDL   S+ K    L  +I   FK +      V+ 
Sbjct: 102 NEELEALRLLISRCFTLCNMDLEVPTDLDYDSVCKMFSLLSRAIPQNFKER---TQEVKR 158

Query: 156 RIENELQKQISDQELQIKLL 175
           R++   ++QI+     I+LL
Sbjct: 159 RLD---EQQIASNREHIRLL 175

>TPHA0H01680 Chr8 (384306..387275) [2970 bp, 989 aa] {ON} Anc_5.414
           YDR356W
          Length = 989

 Score = 30.0 bits (66), Expect = 9.8,   Method: Compositional matrix adjust.
 Identities = 26/68 (38%), Positives = 38/68 (55%), Gaps = 3/68 (4%)

Query: 193 LLNFQNKYNKTILEKTELEDKVKMLDVSVDTLKKELLGTEDTISDLENFKEQCIIKKLEV 252
           LL F ++ N  I  K ELED    L+  +++L+K L  T  T  +LE  K +   K+LE+
Sbjct: 664 LLQFNSEKNAIINSKKELEDN---LNNKINSLEKLLQQTSSTDVELETLKSELRGKELEI 720

Query: 253 AELDTEVK 260
            EL  +VK
Sbjct: 721 KELYKKVK 728

>TBLA0I02900 Chr9 complement(687092..692476) [5385 bp, 1794 aa] {ON}
            Anc_4.238 YDL058W
          Length = 1794

 Score = 30.0 bits (66), Expect = 9.9,   Method: Compositional matrix adjust.
 Identities = 30/89 (33%), Positives = 50/89 (56%), Gaps = 11/89 (12%)

Query: 211  EDKVKMLDVSVDTLKKELLGTEDTISDLEN-FKEQCIIKKLEVAELDTEV----KRLNNK 265
            E K+K    ++D+LKKELLG E  +  L++  + Q  +    V+E DTE+    K+L N 
Sbjct: 1508 ESKLKDYMGNIDSLKKELLGKEKALGILQSQLESQLSV----VSEKDTEIADIRKQLKNS 1563

Query: 266  NMEWRKKSNEYKLDLSRRD--AEVKEAQM 292
            N++  +K    KL  S  +  A +KE+++
Sbjct: 1564 NIKLNEKEVSEKLAKSAAEDLAAIKESEL 1592

>TPHA0D01550 Chr4 complement(319711..321204) [1494 bp, 497 aa] {ON}
           Anc_2.279 YIL097W
          Length = 497

 Score = 30.0 bits (66), Expect = 10.0,   Method: Compositional matrix adjust.
 Identities = 25/69 (36%), Positives = 39/69 (56%), Gaps = 5/69 (7%)

Query: 170 LQIKLLKQNLTDITDSEKTRTLELLNFQNKYNKTILEKTELEDKVKMLDVS-----VDTL 224
           +  ++LK+NL  +  S K RT E+    NK N+ +   T   DK  +L+++     VD L
Sbjct: 23  IPAEILKRNLNKLERSVKLRTDEISVLLNKVNELMDSNTLENDKSAVLEINKIIKKVDRL 82

Query: 225 KKELLGTED 233
           +KELL T+D
Sbjct: 83  EKELLKTKD 91

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.315    0.132    0.354 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 37,411,294
Number of extensions: 1866980
Number of successful extensions: 12192
Number of sequences better than 10.0: 943
Number of HSP's gapped: 12196
Number of HSP's successfully gapped: 1437
Length of query: 324
Length of database: 53,481,399
Length adjustment: 110
Effective length of query: 214
Effective length of database: 40,868,139
Effective search space: 8745781746
Effective search space used: 8745781746
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (22.0 bits)
S2: 66 (30.0 bits)