Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
TPHA0K005405.526ON67567531790.0
ZYRO0D12540g5.526ON5484213024e-28
SAKL0G04906g5.526ON6085612973e-27
KLTH0G03740g5.526ON6314632858e-26
Kwal_47.186465.526ON6355022841e-25
TDEL0A039005.526ON6713892725e-24
CAGL0K07271g5.526ON7761372583e-22
YML006C (GIS4)5.526ON7741292565e-22
NDAI0C010705.526ON7572312555e-22
Smik_13.1455.526ON774922512e-21
NCAS0H025505.526ON7432412512e-21
Suva_13.1565.526ON772922502e-21
Skud_13.1485.526ON779922502e-21
Ecym_40615.526ON6634492404e-20
Kpol_1023.995.526ON551902384e-20
TBLA0D016605.526ON866902352e-19
KLLA0A01782g5.526ON5284082304e-19
KNAG0B037105.526ON711912252e-18
KAFR0C053905.526ON455931992e-15
NDAI0H015905.526ON371911855e-14
NCAS0F010805.526ON379671563e-10
ADR198C5.526ON5491361394e-08
TBLA0G009405.526ON782731083e-04
YNL242W (ATG2)2.1ON1592140840.23
KNAG0C032405.526ON32441780.76
YJR098C1.114ON65665752.2
Suva_14.1002.1ON1584119752.2
Skud_14.972.1ON1589117752.4
ABR203W5.579ON35954715.4
NDAI0D007207.321ON505149715.9
NDAI0A056203.284ON57153708.7
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= TPHA0K00540
         (675 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

TPHA0K00540 Chr11 complement(107389..109416) [2028 bp, 675 aa] {...  1229   0.0  
ZYRO0D12540g Chr4 (1059795..1061441) [1647 bp, 548 aa] {ON} some...   120   4e-28
SAKL0G04906g Chr7 (403654..405480) [1827 bp, 608 aa] {ON} some s...   119   3e-27
KLTH0G03740g Chr7 (295985..297880) [1896 bp, 631 aa] {ON} simila...   114   8e-26
Kwal_47.18646 s47 complement(909622..911529) [1908 bp, 635 aa] {...   114   1e-25
TDEL0A03900 Chr1 (698940..700955) [2016 bp, 671 aa] {ON} Anc_5.5...   109   5e-24
CAGL0K07271g Chr11 complement(712294..714624) [2331 bp, 776 aa] ...   103   3e-22
YML006C Chr13 complement(256092..258416) [2325 bp, 774 aa] {ON} ...   103   5e-22
NDAI0C01070 Chr3 complement(209024..211297) [2274 bp, 757 aa] {O...   102   5e-22
Smik_13.145 Chr13 complement(244766..247090) [2325 bp, 774 aa] {...   101   2e-21
NCAS0H02550 Chr8 (506755..508986) [2232 bp, 743 aa] {ON} Anc_5.5...   101   2e-21
Suva_13.156 Chr13 complement(246662..248980) [2319 bp, 772 aa] {...   100   2e-21
Skud_13.148 Chr13 complement(242351..244690) [2340 bp, 779 aa] {...   100   2e-21
Ecym_4061 Chr4 (133342..135333) [1992 bp, 663 aa] {ON} similar t...    97   4e-20
Kpol_1023.99 s1023 complement(232194..233849) [1656 bp, 551 aa] ...    96   4e-20
TBLA0D01660 Chr4 complement(409692..412292) [2601 bp, 866 aa] {O...    95   2e-19
KLLA0A01782g Chr1 complement(157216..158802) [1587 bp, 528 aa] {...    93   4e-19
KNAG0B03710 Chr2 complement(710003..712138) [2136 bp, 711 aa] {O...    91   2e-18
KAFR0C05390 Chr3 (1080797..1082164) [1368 bp, 455 aa] {ON} Anc_5...    81   2e-15
NDAI0H01590 Chr8 (385963..387078) [1116 bp, 371 aa] {ON}               76   5e-14
NCAS0F01080 Chr6 (214243..215382) [1140 bp, 379 aa] {ON} Anc_5.5...    65   3e-10
ADR198C Chr4 complement(1046482..1048131) [1650 bp, 549 aa] {ON}...    58   4e-08
TBLA0G00940 Chr7 complement(228909..231257) [2349 bp, 782 aa] {O...    46   3e-04
YNL242W Chr14 (191324..196102) [4779 bp, 1592 aa] {ON}  ATG2Peri...    37   0.23 
KNAG0C03240 Chr3 complement(634593..635567) [975 bp, 324 aa] {ON}      35   0.76 
YJR098C Chr10 complement(613186..615156) [1971 bp, 656 aa] {ON} ...    33   2.2  
Suva_14.100 Chr14 (186040..190794) [4755 bp, 1584 aa] {ON} YNL24...    33   2.2  
Skud_14.97 Chr14 (180038..184807) [4770 bp, 1589 aa] {ON} YNL242...    33   2.4  
ABR203W Chr2 (782704..783783) [1080 bp, 359 aa] {ON} Syntenic ho...    32   5.4  
NDAI0D00720 Chr4 complement(157493..159010) [1518 bp, 505 aa] {O...    32   5.9  
NDAI0A05620 Chr1 (1268907..1270622) [1716 bp, 571 aa] {ON}             32   8.7  

>TPHA0K00540 Chr11 complement(107389..109416) [2028 bp, 675 aa] {ON}
           Anc_5.526 YML006C
          Length = 675

 Score = 1229 bits (3179), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 617/675 (91%), Positives = 617/675 (91%)

Query: 1   MVLFDEIKDDKYSSLWTWYLNCIRNGEFEELLKEEDKYRSILNKIRETLQTHARNIEMEE 60
           MVLFDEIKDDKYSSLWTWYLNCIRNGEFEELLKEEDKYRSILNKIRETLQTHARNIEMEE
Sbjct: 1   MVLFDEIKDDKYSSLWTWYLNCIRNGEFEELLKEEDKYRSILNKIRETLQTHARNIEMEE 60

Query: 61  EDANISDGNILFLSLHYTLDKDKEIIDDFLVDNFPNVDLSNIVIREICNNNINSEHFKKD 120
           EDANISDGNILFLSLHYTLDKDKEIIDDFLVDNFPNVDLSNIVIREICNNNINSEHFKKD
Sbjct: 61  EDANISDGNILFLSLHYTLDKDKEIIDDFLVDNFPNVDLSNIVIREICNNNINSEHFKKD 120

Query: 121 HETYYMVIDSLNKLLTTSIEEVSVSCHRDDTSNIDRYKEQNSEFEYVNQSTQAKDLDEEG 180
           HETYYMVIDSLNKLLTTSIEEVSVSCHRDDTSNIDRYKEQNSEFEYVNQSTQAKDLDEEG
Sbjct: 121 HETYYMVIDSLNKLLTTSIEEVSVSCHRDDTSNIDRYKEQNSEFEYVNQSTQAKDLDEEG 180

Query: 181 SYVSSSENDSGLSIELNFKTKFNRNKFQNSTTEIAKAEANHAVVKPSNNASIYSRSDIES 240
           SYVSSSENDSGLSIELNFKTKFNRNKFQNSTTEIAKAEANHAVVKPSNNASIYSRSDIES
Sbjct: 181 SYVSSSENDSGLSIELNFKTKFNRNKFQNSTTEIAKAEANHAVVKPSNNASIYSRSDIES 240

Query: 241 IDSYSDLNSRNLNTHYDGQSLKLTHHKDNLLKNTTSSLDSGQNDKAVERLDDEATSDSMI 300
           IDSYSDLNSRNLNTHYDGQSLKLTHHKDNLLKNTTSSLDSGQNDKAVERLDDEATSDSMI
Sbjct: 241 IDSYSDLNSRNLNTHYDGQSLKLTHHKDNLLKNTTSSLDSGQNDKAVERLDDEATSDSMI 300

Query: 301 VSDVFSSGAYSMSNLSINSQDRLLSLLPSIEMQNSYGEFKLVLQSMILINFESGESFTAV 360
           VSDVFSSGAYSMSNLSINSQDRLLSLLPSIEMQNSYGEFKLVLQSMILINFESGESFTAV
Sbjct: 301 VSDVFSSGAYSMSNLSINSQDRLLSLLPSIEMQNSYGEFKLVLQSMILINFESGESFTAV 360

Query: 361 RQSNSLIHEATEDDEWLLYDSKFSMDNLEIVTLNYLMDIYADFVKIFFYSMVIINLEYPQ 420
           RQSNSLIHEATEDDEWLLYDSKFSMDNLEIVTLNYLMDIYADFVKIFFYSMVIINLEYPQ
Sbjct: 361 RQSNSLIHEATEDDEWLLYDSKFSMDNLEIVTLNYLMDIYADFVKIFFYSMVIINLEYPQ 420

Query: 421 AITFATDKHINNNLINSDGSSANLSLDSNISPLASNFLSVNDKEVAVSVRNPLLPYIPXX 480
           AITFATDKHINNNLINSDGSSANLSLDSNISPLASNFLSVNDKEVAVSVRNPLLPYIP  
Sbjct: 421 AITFATDKHINNNLINSDGSSANLSLDSNISPLASNFLSVNDKEVAVSVRNPLLPYIPNS 480

Query: 481 XXXXXXXXXKTTFEKPSSNRDDEDSDCDSVLEYPIPEIFSPDTIASNKATALRSVTTNNS 540
                    KTTFEKPSSNRDDEDSDCDSVLEYPIPEIFSPDTIASNKATALRSVTTNNS
Sbjct: 481 DDNQHNNNNKTTFEKPSSNRDDEDSDCDSVLEYPIPEIFSPDTIASNKATALRSVTTNNS 540

Query: 541 ESTYKVLSRTYTGDKSIGRXXXXXXXXXXXXXXLLKLLTITPTNHFDTDLSKYSXXXXXX 600
           ESTYKVLSRTYTGDKSIGR              LLKLLTITPTNHFDTDLSKYS      
Sbjct: 541 ESTYKVLSRTYTGDKSIGRNTTVTDGGDNNNETLLKLLTITPTNHFDTDLSKYSTTLTTM 600

Query: 601 XXVERSIXXXXXXXXXXXXXXXXXXXXXXXXXGHFDNKADTVVNNLKGIKQQIHKQGHAS 660
             VERSI                         GHFDNKADTVVNNLKGIKQQIHKQGHAS
Sbjct: 601 TTVERSISQKSSTNNDKQKSSSKSSIKSKSKQGHFDNKADTVVNNLKGIKQQIHKQGHAS 660

Query: 661 KTKSSQLKDSKCVLM 675
           KTKSSQLKDSKCVLM
Sbjct: 661 KTKSSQLKDSKCVLM 675

>ZYRO0D12540g Chr4 (1059795..1061441) [1647 bp, 548 aa] {ON} some
           similarities with uniprot|Q04233 Saccharomyces
           cerevisiae YML006C GIS4 CAAX box containing protein of
           unknown function proposed to be involved in the RAS/cAMP
           signaling pathway
          Length = 548

 Score =  120 bits (302), Expect = 4e-28,   Method: Compositional matrix adjust.
 Identities = 120/421 (28%), Positives = 195/421 (46%), Gaps = 71/421 (16%)

Query: 14  SLWTWYLNCIRNGEFEELLKEEDKYRSILNKIRETLQTHARNIEMEEEDANISDGNILFL 73
            LW+WYL  IRNG+FEEL + + K+ S+  +    L+T+      E +D       +L +
Sbjct: 17  GLWSWYLTNIRNGDFEELTRNQLKH-SLFKRF---LRTYLEPTLNERKDT-----KVLIV 67

Query: 74  SLHYTLDKDKEIIDDFLVD--NFPNVDLSNIVIREICNNNINSEHFKKDHETYYMVIDSL 131
           S+   + +D  +++ FL D  N  N++++ +    I N           HE +Y+V+D  
Sbjct: 68  SIPEDVRRDITLLEYFLGDYLNLDNMEITKLTTSRIYN-----------HENHYVVMDKE 116

Query: 132 NKLLTTSIEEVSVSCHRDDTSNIDRYKE-QNSEFEYVNQSTQA-KDLD-------EEGSY 182
           N    ++    +       ++NI   K     E      + QA K++          G  
Sbjct: 117 NNFKNSNFLHFA-------STNIQTGKGFTGGELAGTTVAAQAEKNISPTESAKFRAGQG 169

Query: 183 VSSSENDSGLSIELNFKTKFNRNKFQNSTTEIAKAEANHAVVKPSNNASIYSR------- 235
           +  S++  G    L F      +   +      K +     V PS N     R       
Sbjct: 170 LEPSDDTEGDEESLVFNFTHRDHHLTHPLRANGKEQEEAVGVSPSWNPQQQQRLQEHNAS 229

Query: 236 -SDIESIDSYS-DLNSRNLNTHYDGQSLKLTHHKDNLLKNTTSSLDSGQNDKAVERLDDE 293
             ++ SIDSY+   NS  +   + G+ L LT                      + R +D 
Sbjct: 230 NDEMASIDSYNLGSNSSRVVESFKGEPLTLT----------------------MTRTEDF 267

Query: 294 ATSDSMIVSDVFSSGAYSMSNLSINSQDRLLSLLPSIEMQNSYGEFKLVLQSMILINFES 353
           ++SD      + SS + S ++LS      L+S+LPSI + +S+G F+LVLQS++ IN  S
Sbjct: 268 SSSDEY--DSLASSPSSSDTDLSSFESCSLMSILPSISIADSFGHFRLVLQSVLFINPTS 325

Query: 354 GESFTAVRQSNSLIHEATEDDEWLLYDSKFSMDNLEIVTLNYLMDIYADFVKIFFYSMVI 413
            E FTA+RQSN+   +A  DD+WLLYDS+FSM NL+++TL  L ++     K+ FYS+V 
Sbjct: 326 NEIFTAIRQSNNKPTKADVDDDWLLYDSQFSMHNLQMLTLQDLSELNKGCPKVLFYSLVE 385

Query: 414 I 414
           +
Sbjct: 386 V 386

>SAKL0G04906g Chr7 (403654..405480) [1827 bp, 608 aa] {ON} some
           similarities with uniprot|Q04233 Saccharomyces
           cerevisiae YML006C GIS4 CAAX box containing protein of
           unknown function proposed to be involved in the RAS/cAMP
           signaling pathway
          Length = 608

 Score =  119 bits (297), Expect = 3e-27,   Method: Compositional matrix adjust.
 Identities = 155/561 (27%), Positives = 251/561 (44%), Gaps = 103/561 (18%)

Query: 9   DDKYSSLWTWYLNCIRNGEFEELLKEEDKYRSILNKIRETLQTHARNIEMEEEDANISDG 68
           ++ Y+ LW+WYL+ +R+G FEEL     K+  +   + E L           +D    + 
Sbjct: 12  ENDYNGLWSWYLSNLRDGHFEELTNNVLKFTLLKRFLNEHLM----------QDIVQFNK 61

Query: 69  NILFLSLHYTLDKDKEIIDDFLVDNFPNVDLSNIVIREICNNNINSEHFKKDHETYYMVI 128
            +L +S+   + +D  I+++FL   F   DL  I I+++ ++ I       +HE +Y++ 
Sbjct: 62  KMLLVSIPDNIHQDITILENFLRSYFHLDDLQYIQIKKLTDSQI------YNHENHYLIS 115

Query: 129 DSLNKL-----------------LTTSIEEVSVSCHRDDTSNIDRYKEQNSE------FE 165
           D+LN                      S    SV       +++   +EQN         E
Sbjct: 116 DNLNNFHDRSFLGFGQKKHDNVRPQLSYNGYSVLSGETGYASLRTTEEQNGTHRPSGVVE 175

Query: 166 YVNQSTQAKDLDEEG-SYVSSSEND----SGLSIELNFKTKFNRNKFQNSTTEIAKAEAN 220
             N ++ A   D      V SSE++    SG  I LNF  K  +N       E       
Sbjct: 176 QCNGNSPATPRDVTAVEPVKSSEDEEDQESG-EIVLNFPHKPPKNIINQREQE------- 227

Query: 221 HAVVKPSNNASIYSRSDIESIDSYSDLNSRNLNTHYDGQSLKLTHHKDNLLKNTTSSLDS 280
             VV  S + SI S       D+ S          YDG++L  T  +D   ++ +S+ + 
Sbjct: 228 --VVTTSEDVSINSE------DASS----------YDGEALIQTITRD---EDASSADED 266

Query: 281 GQNDKAVERLDDEATSDSMIVSDVFSSGAYSMSNLSINSQDRLLSLLPSIEMQNSYGEFK 340
             N   +  +D    S S   SD+ SS  YSM+           S+ P+I + +++G F+
Sbjct: 267 NSNISELSSVDHSLNSLSY-NSDI-SSDDYSMA-----------SIFPAISISDTFGTFR 313

Query: 341 LVLQSMILINFESGESFTAVRQSNSLIHEATEDDEWLLYDSKFSMDNLEIVTLNYLMDIY 400
           LVLQS+++ N ++ E FTAVRQSN+  + A  +D+WLLYD KFSM NL++++L+ +++I 
Sbjct: 314 LVLQSILIQNPDTREIFTAVRQSNNDPNVAHINDDWLLYDEKFSMHNLQMLSLHDVLEIN 373

Query: 401 ADFVKIFFYSMVIINLEYPQAITFATDKHINNNLINSDGSSANLSLDSNISPLASNFLSV 460
             F KI FY+MV+++ E    I      +I N+  +    S  ++  S +S      L  
Sbjct: 374 RFFPKILFYTMVMLDTE---EIADEAHAYIPND-PHLPPPSQGIASTSTLSQNTLRLLPT 429

Query: 461 NDKEVAVSVRNPLLPYIPXXXXXXXXXXXKTTFEKPSSNRDDE-DSDCDSVLEYPIPEIF 519
               V  +  N LL               +  F  P  N DDE D + + V+      ++
Sbjct: 430 ATSNVTYTRHNELL-----NAAATSAQDAENYF--PEDNHDDEDDQEVNGVM-----PLY 477

Query: 520 SPDTIASNKATALRSVTTNNS 540
           +P    SN  TA RS+ T NS
Sbjct: 478 APTRTNSNSTTAHRSILTVNS 498

>KLTH0G03740g Chr7 (295985..297880) [1896 bp, 631 aa] {ON} similar
           to uniprot|Q04233 Saccharomyces cerevisiae YML006C GIS4
           CAAX box containing protein of unknown function proposed
           to be involved in the RAS/cAMP signaling pathway
          Length = 631

 Score =  114 bits (285), Expect = 8e-26,   Method: Compositional matrix adjust.
 Identities = 118/463 (25%), Positives = 211/463 (45%), Gaps = 104/463 (22%)

Query: 2   VLFDEIKDDKYSSLWTWYLNCIRNGEFEELLKEEDKYRSILNKIRETLQTHARNIEMEEE 61
           V  D+  D+  + LW+WYL  +R+G FEEL   + K+  +   + E L +          
Sbjct: 6   VKVDDYFDNDENGLWSWYLCNLRHGNFEELNNNQLKFALLRRFLNEQLLS---------- 55

Query: 62  DANISDGNILFLSLHYTLDKDKEIIDDFLVDNFPNVDLSNIVIREICNNNINSEHFKKDH 121
           D+ + +  +L +S+   + ++  ++++FL D F   DL  I I+++  +         +H
Sbjct: 56  DSVLFNKKLLLVSIPDAIHENTNLLENFLRDYFNLDDLQFIQIQKLTQDRC------YNH 109

Query: 122 ETYYMVIDSLNKLLTTSIEEVSVSCHR--DDTSNIDRYKEQNSEFEYVNQSTQAKD---- 175
           E +Y++ DSL+     S  E      R  DDT  +   ++ N+++  ++  T+A      
Sbjct: 110 ENHYLISDSLSNFNDKSFLEFGAKSRRPRDDTEILG--QDSNNQYSIISGETEADPALPA 167

Query: 176 ---------------------------------LDEEGSYVSSSENDSG---LSIELNFK 199
                                            +D +    S+ E+D     L ++   +
Sbjct: 168 AISSESPASVHLSKVVQEDVPLRTHNSSSRLLIVDNQECASSTDESDDASTELVLKFEHR 227

Query: 200 TKFNRNKFQNSTTEIAKAEANHAVVKPSNNASIYSRSDIESIDSYSDLNSRNLNTHYDGQ 259
               + +      ++A  E   A+  PS   S+  RSD        D++S      YDG+
Sbjct: 228 GMLGKQRLHPEVRKMASTE--EAIDTPSTGVSL--RSD--------DVSS------YDGE 269

Query: 260 SLKLTHHKDNLLKNTTSSLDSGQNDKAVERLDDEATSDSMIVSDVFSSGAYSMSNLSINS 319
            L  T  +D               D     ++D++ S+        SS  +S+ +LS +S
Sbjct: 270 VLTQTITRDE--------------DSVSLMIEDDSISE-------LSSVDHSLKSLSYDS 308

Query: 320 Q-----DRLLSLLPSIEMQNSYGEFKLVLQSMILINFESGESFTAVRQSNSLIHEATEDD 374
           +       L S+ PSI +   +G F+LVLQS+++   ++ + FTAVRQSN+    A  +D
Sbjct: 309 EYSQGSSSLTSIFPSISISEKFGRFRLVLQSILVHQPDTRQLFTAVRQSNNDPTVAHVND 368

Query: 375 EWLLYDSKFSMDNLEIVTLNYLMDIYADFVKIFFYSMVIINLE 417
           +WLLYD KFSM+NL+I+ L+ ++++   F KI FYS+V+I+ E
Sbjct: 369 DWLLYDDKFSMNNLQILALHDVLEMNKFFPKILFYSLVMISEE 411

>Kwal_47.18646 s47 complement(909622..911529) [1908 bp, 635 aa] {ON}
           YML006C (GIS4) - CAAX box containing protein [contig
           191] FULL
          Length = 635

 Score =  114 bits (284), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 132/502 (26%), Positives = 223/502 (44%), Gaps = 111/502 (22%)

Query: 14  SLWTWYLNCIRNGEFEELLKEEDKYRSILNKIRETLQTHARNIEMEEEDANISDGNILFL 73
            LW+WYL  +R+G FEEL           N+++  L     N ++  E     +  +L +
Sbjct: 18  GLWSWYLCNLRHGNFEELNN---------NQLKSALLRRFLNEQLMSETVPF-NKKLLLV 67

Query: 74  SLHYTLDKDKEIIDDFLVDNFPNVDLSNIVIREICNNNINSEHFKKDHETYYMVIDSLNK 133
           S+   + ++  ++++FL D F   DL  I IR++            +HE +Y++ D+L+ 
Sbjct: 68  SIPDAIHENTNLLENFLRDYFHLDDLQYIQIRKLTQEKC------YNHENHYLICDNLSN 121

Query: 134 LLTTSIEEVSV----SCHRD----DTSN---------------------------IDRYK 158
               S  E  +    +C+ +    +TSN                           I   K
Sbjct: 122 FNDKSFLEFGIKRVGACNGNELSGETSNNQYSIISGETSTDVTKSSLEIPLSPEFIRDSK 181

Query: 159 EQNSEFEYVNQSTQAKDLDEE--GSYVSSSENDSGLS-IELNFKTKFNRNKFQNSTTEIA 215
               +     QST ++ L  E  GS  SS E+D   S I L FK +    K Q  +    
Sbjct: 182 VTQEDPALQTQSTSSRSLRIENSGSLNSSDESDDTESEIVLRFKPRGTVGKRQLYSEVKR 241

Query: 216 KAEANHAVVKPSNNASIYSRSDIESIDSYSDLNSRNLNTHYDGQSLKLTHHKDNLLKNTT 275
              AN  +  PS   S+ S  D+ S               YDG+ L     +D       
Sbjct: 242 SPLANDYIDTPSTGMSLRSE-DVSS---------------YDGEELAHIASRD------- 278

Query: 276 SSLDSGQNDKAVERLDDEATSDSMIVSDVFSSGAYSMSNLSINSQ-----DRLLSLLPSI 330
                   D A    D++  S+        SS  +S+++LS +S+       + S+ PSI
Sbjct: 279 -------EDSASLSADEDNISE-------LSSVDHSLNSLSYDSECTPGSSSMTSIFPSI 324

Query: 331 EMQNSYGEFKLVLQSMILINFESGESFTAVRQSNSLIHEATEDDEWLLYDSKFSMDNLEI 390
            +   +G F+LVLQS+++   ++ + +TAVRQSN+    A  +D+WLLYD KFSM+NL+I
Sbjct: 325 SISEKFGRFRLVLQSILIQQTDTRQLYTAVRQSNNDPTVAHVNDDWLLYDDKFSMNNLQI 384

Query: 391 VTLNYLMDIYADFVKIFFYSMVIINLE--------YPQAITFATDKHINNNLINSDGSSA 442
           + L+ +++I   F K+ FYS++++  E        YP A   + ++ ++ +L+    S  
Sbjct: 385 LALHDVLEINKFFPKVLFYSLIVVTDEVAIDAQEYYPSASHQSPERTVSTSLL----SEN 440

Query: 443 NLSLDSNISPLASN---FLSVN 461
            L L + ++P  +N   FLS+ 
Sbjct: 441 TLKLQTTLTPSLTNTNSFLSMG 462

>TDEL0A03900 Chr1 (698940..700955) [2016 bp, 671 aa] {ON} Anc_5.526
           YML006C
          Length = 671

 Score =  109 bits (272), Expect = 5e-24,   Method: Compositional matrix adjust.
 Identities = 112/389 (28%), Positives = 188/389 (48%), Gaps = 70/389 (17%)

Query: 187 ENDSGLSIELNFKTKFNRNKFQNSTTEIAK-------AEANHAVV------KPSNNASIY 233
           ++D   SI L+F     R + +   ++  +       A+ N  +       K +N + IY
Sbjct: 229 QDDENESIVLDFSHSLLRKQMEEKKSQAQRIRQQEYSADTNQTITNLHTNDKDTNASDIY 288

Query: 234 SRSDIE--SIDSYSDLNSRN------LNTHYDGQSLKLT--HHKDNLLKNTTSSLDSGQN 283
           S +  E  SI+SY D + R+          Y GQ L LT  H+KD+    T  S D  Q 
Sbjct: 289 SPAISENVSINSYEDESMRDGSDSITAKDSYSGQPLALTTTHYKDD----TQGSSDDSQ- 343

Query: 284 DKAVERLDDEATSDSMIVSDVFSSGAYSMSNLSINSQDRLLSLLPSIEMQNSYGEFKLVL 343
           ++ +  L   + S   + S           N S +S   ++S+LPSI + ++ G ++LV+
Sbjct: 344 EENISELSSVSRSMKSLGSQTSLGDNNDYENNSDSSDYSVVSILPSISISDARGHYRLVM 403

Query: 344 QSMILINFESGESFTAVRQSNSLIHEATEDDEWLLYDSKFSMDNLEIVTLNYLMDIYADF 403
           QS +L + E+ E +TA+RQSN+    A  DD+WLLYDS+FSM+NL+++TL  L+D+   F
Sbjct: 404 QSSLLQDPETKEIYTAIRQSNNQPTVADVDDDWLLYDSQFSMNNLQMLTLQELLDMNRSF 463

Query: 404 VKIFFYSMVIINLEYPQAITFATDKHINNNLINSDGSSANLSLDSNISPLASNFLSVNDK 463
            KI FYSM++++ E  + + ++     N      D + A+ S+     P A ++ S++  
Sbjct: 464 PKIIFYSMIVVSDEQQELLQWS-----NGMTQKEDTADASSSI-----PRADSYASMS-- 511

Query: 464 EVAVSVRNPLLPYIPXXXXXXXXXXXKTTFEKPSSNRDDEDSDCDSVLEYPIPEIFSPDT 523
                 R+P   Y                     +N DD+D+   S+ E   P +++P  
Sbjct: 512 ------RDPQQFY---------------------ANMDDDDT---SLSEQSGPMMYAPTR 541

Query: 524 IASNKATALRSVTTNNSESTYKVLSRTYT 552
           + SN +TA RS+ T NS   +  + +  T
Sbjct: 542 LQSNTSTAHRSIRTVNSIGDWAFVHKNET 570

 Score = 53.1 bits (126), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 37/132 (28%), Positives = 69/132 (52%), Gaps = 16/132 (12%)

Query: 2   VLFDEIKDDKYSSLWTWYLNCIRNGEFEELLKEEDKYRSILNKIRETLQTHARNIEMEEE 61
           +  D+  D+  + LW+WYL+ IR+G+FEE  +         NK++ TL     N   +  
Sbjct: 5   IKVDDYFDNDDNGLWSWYLSHIRSGDFEEFSR---------NKLKVTLLRRFLNSHFDSN 55

Query: 62  DANIS-DGNILFLSLHYTLDKDKEIIDDFLVDNFPNVDLSNIVIREICNNNINSEHFKKD 120
            ++   +  ILF+S+   + +D  ++++FL D F    L +I I ++  + +       +
Sbjct: 56  RSHYGQNTKILFVSIPDKVHRDLSLLENFLRDYFHLEHLEHIEITKLTQSPV------YN 109

Query: 121 HETYYMVIDSLN 132
           HE +Y++ID LN
Sbjct: 110 HENHYILIDKLN 121

>CAGL0K07271g Chr11 complement(712294..714624) [2331 bp, 776 aa]
           {ON} similar to uniprot|Q04233 Saccharomyces cerevisiae
           YML006c
          Length = 776

 Score =  103 bits (258), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 64/137 (46%), Positives = 92/137 (67%), Gaps = 5/137 (3%)

Query: 280 SGQNDKAVERLDDEATSDSMIVSDVFSSGAYSMSNLSINSQD-RLLSLLPSIEMQNSYGE 338
            GQND+A    D+E  S+SM  SD+ S     M + + +  D  LLS+LPSI + ++ G 
Sbjct: 411 GGQNDQA-SFSDNE--SESMYSSDLESEDG-EMDHYNASGSDITLLSILPSISIFDTLGY 466

Query: 339 FKLVLQSMILINFESGESFTAVRQSNSLIHEATEDDEWLLYDSKFSMDNLEIVTLNYLMD 398
           F+LVLQS+++ + ++ E FTAVRQSN+    A   D+WLLYD++FSM NL+I+TL  +M 
Sbjct: 467 FRLVLQSILIQDPQTKEVFTAVRQSNNKPTIADITDDWLLYDAEFSMHNLQILTLQDIMT 526

Query: 399 IYADFVKIFFYSMVIIN 415
           I  D+ KI FY+MV+IN
Sbjct: 527 IKKDYPKILFYTMVVIN 543

 Score = 45.8 bits (107), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 37/150 (24%), Positives = 72/150 (48%), Gaps = 10/150 (6%)

Query: 14  SLWTWYLNCIRNGEFEELLKEEDKYRSILNKIRETLQTHARNIEMEEEDANISDGNILFL 73
            +W+WYL+ +R+G+FEE+++ + KY ++L +    L ++       E      +  ++F+
Sbjct: 17  GVWSWYLSNLRSGDFEEIIENKLKY-TLLKRF---LNSNLLGNFSPESPTRFINKKLIFV 72

Query: 74  SLHYTLDKDKEIIDDFLVDNFPNVDLSNIVIREICNNNINSEHFKKDHETYYMVIDSLNK 133
           S+   + +D  I++ FL D F    L N  I ++  + +        HE +Y ++D LN 
Sbjct: 73  SIPEDVHQDISILELFLRDYFHLKVLDNNQIHKLTQDKV------YHHENHYFLMDELNN 126

Query: 134 LLTTSIEEVSVSCHRDDTSNIDRYKEQNSE 163
               +  E   S  + + +    Y  QN E
Sbjct: 127 FEDPTFLEFGKSNWKMEGTAGTVYDPQNKE 156

>YML006C Chr13 complement(256092..258416) [2325 bp, 774 aa] {ON}
           GIS4CAAX box containing protein of unknown function,
           proposed to be involved in the RAS/cAMP signaling
           pathway
          Length = 774

 Score =  103 bits (256), Expect = 5e-22,   Method: Compositional matrix adjust.
 Identities = 59/129 (45%), Positives = 84/129 (65%), Gaps = 4/129 (3%)

Query: 323 LLSLLPSIEMQNSYGEFKLVLQSMILINFESGESFTAVRQSNSLIHEATEDDEWLLYDSK 382
           +LS+LPSI + +S G F+LVLQS+++ + ++ E FTA+RQSN+    A+  D+WLLYDS 
Sbjct: 433 VLSILPSISICDSLGYFRLVLQSILIQDPDTKEIFTAIRQSNNKPTMASVTDDWLLYDSN 492

Query: 383 FSMDNLEIVTLNYLMDIYADFVKIFFYSMVIINLEYPQAITFATDKHINNNLINSDGSSA 442
           FSM+NL+I+TL  L+DI   F KI FY+MVI+     Q      ++  N N  N +G S 
Sbjct: 493 FSMNNLQILTLQDLLDIKRSFPKILFYTMVIVTNSGKQ----VEEEFKNPNYDNREGISK 548

Query: 443 NLSLDSNIS 451
              LDS +S
Sbjct: 549 EQPLDSELS 557

 Score = 48.5 bits (114), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 38/124 (30%), Positives = 65/124 (52%), Gaps = 19/124 (15%)

Query: 14  SLWTWYLNCIRNGEFEELLKEEDKYRSILNKIRETLQTHARNIEMEEEDANIS---DGNI 70
            LW+WYL  +R G+FEEL+  + KY ++L +    L +H         D NIS   +  I
Sbjct: 17  GLWSWYLTNLRLGDFEELIGNQLKY-TLLKRF---LNSHFYG------DNNISARPNKKI 66

Query: 71  LFLSLHYTLDKDKEIIDDFLVDNFPNVDLSNIVIREICNNNINSEHFKKDHETYYMVIDS 130
           L +S+   + +D  I++ FL D F    L +I I ++ +++        +HE +Y++ D+
Sbjct: 67  LLVSIPENVHEDISILEIFLKDYFHLEKLEHIQISKLTHSHC------YNHENHYLLTDN 120

Query: 131 LNKL 134
           LN  
Sbjct: 121 LNNF 124

>NDAI0C01070 Chr3 complement(209024..211297) [2274 bp, 757 aa] {ON}
           Anc_5.526 YML006C
          Length = 757

 Score =  102 bits (255), Expect = 5e-22,   Method: Compositional matrix adjust.
 Identities = 85/231 (36%), Positives = 117/231 (50%), Gaps = 24/231 (10%)

Query: 323 LLSLLPSIEMQN-SYGEFKLVLQSMILINFESGESFTAVRQSNSLIHEATEDDEWLLYDS 381
           +LS+LPSI + + + G F+LVLQS ++ N  + E FTA+RQSN+    A   D+WLLYDS
Sbjct: 458 VLSILPSISISDRNEGHFRLVLQSTLIQNPITKEIFTAIRQSNNEPTIAHITDDWLLYDS 517

Query: 382 KFSMDNLEIVTLNYLMDIYADFVKIFFYSMVIINLEYPQAITFATDKHINNNLINSDGSS 441
           KF+MDNL+I+TL  L+D    F KI FYSMVI+N   P          IN++  N +G +
Sbjct: 518 KFAMDNLQILTLQDLLDSNRTFPKILFYSMVIVNESSPP---------INDDQHNYNGMT 568

Query: 442 A-NLSLDSNISPLASNFLSVNDKEVAVSVRNPLLPY--IPXXXXXXXXXXXKTTFEKPSS 498
           A N    SN         S   K +      P LP   I            +  F  P S
Sbjct: 569 ALNSEYLSNKLESLEKTSSEEGKSINRYKYYPTLPKAGITAKNGEMIADVPEQFFPGPPS 628

Query: 499 NRDDEDSDC---------DSVLEYPIPEIFSPDTIASNKATALRSVTTNNS 540
             DDE+            +S++E   PE++ P  + +N  TA RS+ T NS
Sbjct: 629 --DDENGKGEDYDDDYDDESLMEQHGPEMYLPTRMQTNVTTAHRSIRTANS 677

 Score = 46.2 bits (108), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 37/130 (28%), Positives = 62/130 (47%), Gaps = 15/130 (11%)

Query: 14  SLWTWYLNCIRNGEFEELLKEEDKYRSILNKIRETLQTHARNIEMEEEDANISDG----- 68
            LW+WYL  IR G+FEEL   + KY  +   +     ++A   +   +D N ++      
Sbjct: 17  GLWSWYLRNIRLGDFEELTGNQLKYTLLKRFLNSHFYSNATTTDTAIDDNNNTNSVNDIK 76

Query: 69  ----NILFLSLHYTLDKDKEIIDDFLVDNFPNVDLSNIVIREICNNNINSEHFKKDHETY 124
                IL +S+   +  D  +++ FL D F   DL NI I ++      SE +  +HE +
Sbjct: 77  PTVKKILLVSIPDKVHSDISLLELFLRDYFHLEDLENIQITKLT----QSECY--NHENH 130

Query: 125 YMVIDSLNKL 134
           Y++ D +N  
Sbjct: 131 YLLTDKVNNF 140

>Smik_13.145 Chr13 complement(244766..247090) [2325 bp, 774 aa] {ON}
           YML006C (REAL)
          Length = 774

 Score =  101 bits (251), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 49/92 (53%), Positives = 70/92 (76%)

Query: 323 LLSLLPSIEMQNSYGEFKLVLQSMILINFESGESFTAVRQSNSLIHEATEDDEWLLYDSK 382
           +LS+LPSI + +S G F+LVLQS+++ + ++ E FTA+RQSN+    A+  D+WLLYDS 
Sbjct: 436 VLSILPSISICDSLGYFRLVLQSILIQDPDTKEIFTAIRQSNNRPTIASVTDDWLLYDSN 495

Query: 383 FSMDNLEIVTLNYLMDIYADFVKIFFYSMVII 414
           FSM+NL+I+TL  L+DI   F KI FY+MVI+
Sbjct: 496 FSMNNLQILTLQDLLDIKRSFPKILFYTMVIV 527

 Score = 46.6 bits (109), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 35/124 (28%), Positives = 66/124 (53%), Gaps = 13/124 (10%)

Query: 9   DDKYSSLWTWYLNCIRNGEFEELLKEEDKYRSILNKIRETLQTHARNIEMEEEDANISDG 68
           D+  + LW+WYL  +R G+FEEL+  + KY ++L +   +      +I +       S+ 
Sbjct: 12  DNDDNGLWSWYLTNLRLGDFEELIGNQLKY-TLLKRFLNSHFYGDNSISVR------SNK 64

Query: 69  NILFLSLHYTLDKDKEIIDDFLVDNFPNVDLSNIVIREICNNNINSEHFKKDHETYYMVI 128
            IL +S+   + +D  I++ FL D F    L +I I ++ +++        +HE +Y++ 
Sbjct: 65  KILLVSIPENVHEDISILEIFLKDYFHLEKLEHIQISKLTHSHC------YNHENHYLLT 118

Query: 129 DSLN 132
           D+LN
Sbjct: 119 DNLN 122

>NCAS0H02550 Chr8 (506755..508986) [2232 bp, 743 aa] {ON} Anc_5.526
           YML006C
          Length = 743

 Score =  101 bits (251), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 79/241 (32%), Positives = 118/241 (48%), Gaps = 22/241 (9%)

Query: 323 LLSLLPSIEMQNSY-GEFKLVLQSMILINFESGESFTAVRQSNSLIHEATEDDEWLLYDS 381
           +LS+LPSI + ++  G F+LVLQS+++ +  + E +TA+RQSN+    A   D+WLLYDS
Sbjct: 419 VLSILPSISISDAIEGHFRLVLQSILIQHPVTKEIYTAIRQSNNEPTIADIMDDWLLYDS 478

Query: 382 KFSMDNLEIVTLNYLMDIYADFVKIFFYSMVIINLEYPQAITFATDKHINNNLINSDGSS 441
           +FSMDNL+I+TL  L+D    F KI FYSMVI+   + Q I                G +
Sbjct: 479 QFSMDNLQILTLQDLLDTNRSFPKILFYSMVIVTDAHHQPI---------------QGPT 523

Query: 442 ANLSLDSNISPLASNFLSVNDKEVAVSVRNPLLPYIPXXXXXXXXXXXKTTFEKPSSNRD 501
           +    D   S L++   S+   E      N    Y P           +   ++   + D
Sbjct: 524 STAGPDLTTSYLSNKLESIAGDETNQRFENR---YYPMADDQVEDQPQQFFPQEDDHDDD 580

Query: 502 DEDSDCDSVLEYPIPEIFSPDTIASNKATALRSVTTNNSESTYKVLSRTYTGDKS---IG 558
           +     DS++E   PE++ P  + +N  TA RS+ T NS   +        G  S   IG
Sbjct: 581 NMYDTDDSLMEEAGPEMYLPTRMETNNTTAHRSIRTVNSIGEWAFNRNNTNGSSSKSAIG 640

Query: 559 R 559
           R
Sbjct: 641 R 641

 Score = 43.9 bits (102), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 78/313 (24%), Positives = 121/313 (38%), Gaps = 56/313 (17%)

Query: 14  SLWTWYLNCIRNGEFEELLKEEDKY---RSILNK---------IRETLQTHARNIEMEEE 61
            LW+WYL  IR G+FEE+   + KY   +  LN            E+ Q H  N      
Sbjct: 17  GLWSWYLTNIRLGDFEEVTGNQLKYTLLKRFLNSHFYSNSDVTATESPQQHNNNNNTNNN 76

Query: 62  DANISDGN---ILFLSLHYTLDKDKEIIDDFLVDNFPNVDLSNIVIREICNNNINSEHFK 118
           +      N   IL +S+   + +D  I++ FL D F    L  I I+ +  +        
Sbjct: 77  NTQQLKPNFRKILLVSIPDKVHRDLSILETFLRDYFHLEHLEGIQIQRLTQSKC------ 130

Query: 119 KDHETYYMVIDSLNKLLTTSIEEVSVSC--------------HRDD----TSNIDRYKEQ 160
            +HE +Y++ D++N        E + S               HRDD      +ID +   
Sbjct: 131 YNHENHYLLTDTINNFDDPVFLEFAGSNWQARKNLHLNNHLDHRDDDRISPQSIDTHSAL 190

Query: 161 NSEFEYVNQSTQAKDLDEEGSYVSSSEN-----DSGLSIELNFKTKFNRNKFQNSTTEIA 215
           N   + +   TQ  D           EN       G SI LNF       K ++    + 
Sbjct: 191 NKNDDQI-LVTQPIDSTLVTPETREKENLDDIDVGGSSIVLNFSHTREHRKDKDPLNMVK 249

Query: 216 KAEANHAVVKPSNNASIYSRSDIESIDSYSDLNSRNLNTHYDGQSLKLTHHKDNLLKNTT 275
           + E ++      N      +S++ SI+S+ D +S N    Y+G  LKLT     L +   
Sbjct: 250 QEEQSNKFS--PNMMFTPPQSELVSINSFDDGDSMN----YNGHPLKLT-----LTRQDE 298

Query: 276 SSLDSGQNDKAVE 288
            S+   + DK  E
Sbjct: 299 ESIAQLEQDKQAE 311

>Suva_13.156 Chr13 complement(246662..248980) [2319 bp, 772 aa] {ON}
           YML006C (REAL)
          Length = 772

 Score =  100 bits (250), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 49/92 (53%), Positives = 69/92 (75%)

Query: 323 LLSLLPSIEMQNSYGEFKLVLQSMILINFESGESFTAVRQSNSLIHEATEDDEWLLYDSK 382
           +LS+LPSI + +S G F+LVLQS+++ N ++ E FTA+RQSN+    A+  D+WLLYDS 
Sbjct: 432 ILSILPSISICDSLGYFRLVLQSILIQNPDTKEIFTAIRQSNNEPTVASVTDDWLLYDSN 491

Query: 383 FSMDNLEIVTLNYLMDIYADFVKIFFYSMVII 414
           FSM+NL+I+TL  L+DI   F KI  Y+MVI+
Sbjct: 492 FSMNNLQILTLQDLLDIKRSFPKILLYTMVIV 523

 Score = 46.2 bits (108), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 39/133 (29%), Positives = 66/133 (49%), Gaps = 19/133 (14%)

Query: 14  SLWTWYLNCIRNGEFEELLKEEDKYRSILNKIRETLQTHARNIEMEEEDANIS---DGNI 70
            LW+WYL  +R G+FEEL+  + KY ++L +    L +H         D N S   +  I
Sbjct: 17  GLWSWYLTNLRLGDFEELIGNQLKY-TLLKRF---LNSHFYG------DNNTSIRPNKKI 66

Query: 71  LFLSLHYTLDKDKEIIDDFLVDNFPNVDLSNIVIREICNNNINSEHFKKDHETYYMVIDS 130
           L +S+   + +D  I++ FL D F    L +I I ++ +++        +HE +Y++ D 
Sbjct: 67  LLVSIPENVHEDISILEIFLKDYFHLEKLEHIQISKLTHSHC------YNHENHYLLTDY 120

Query: 131 LNKLLTTSIEEVS 143
           LN     S  E +
Sbjct: 121 LNNFQDPSFLEFA 133

>Skud_13.148 Chr13 complement(242351..244690) [2340 bp, 779 aa] {ON}
           YML006C (REAL)
          Length = 779

 Score =  100 bits (250), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 49/92 (53%), Positives = 70/92 (76%)

Query: 323 LLSLLPSIEMQNSYGEFKLVLQSMILINFESGESFTAVRQSNSLIHEATEDDEWLLYDSK 382
           +LS+LPSI + +S G F+LVLQS+++ + ++ E FTA+RQSN+    A+  D+WLLYDS 
Sbjct: 440 VLSILPSISICDSLGYFRLVLQSILIQDPDTKEIFTAIRQSNNKPTMASVTDDWLLYDSN 499

Query: 383 FSMDNLEIVTLNYLMDIYADFVKIFFYSMVII 414
           FSM+NL+I+TL  L+DI   F KI FY+MVI+
Sbjct: 500 FSMNNLQILTLQDLLDIKRSFPKILFYTMVIV 531

 Score = 46.2 bits (108), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 38/127 (29%), Positives = 67/127 (52%), Gaps = 19/127 (14%)

Query: 9   DDKYSSLWTWYLNCIRNGEFEELLKEEDKYRSILNKIRETLQTHARNIEMEEEDANIS-- 66
           D+  + LW+WYL  +R G+FEEL+  + KY ++L +    L +H         D N S  
Sbjct: 12  DNDDNGLWSWYLTNLRLGDFEELIGNQLKY-TLLKRF---LNSHFYG------DYNTSAR 61

Query: 67  -DGNILFLSLHYTLDKDKEIIDDFLVDNFPNVDLSNIVIREICNNNINSEHFKKDHETYY 125
            +  IL +S+   + +D  I++ FL D F    L +I I ++ +++        +HE +Y
Sbjct: 62  PNKKILLVSIPENVHEDISILEIFLKDYFHLEKLEHIQISKLTHSHC------YNHENHY 115

Query: 126 MVIDSLN 132
           ++ D+LN
Sbjct: 116 LLTDNLN 122

>Ecym_4061 Chr4 (133342..135333) [1992 bp, 663 aa] {ON} similar to
           Ashbya gossypii ADR198C
          Length = 663

 Score = 97.1 bits (240), Expect = 4e-20,   Method: Compositional matrix adjust.
 Identities = 109/449 (24%), Positives = 200/449 (44%), Gaps = 86/449 (19%)

Query: 10  DKYSSLWTWYLNCIRNGEFEELLKEEDKYRSILNKIRETLQTHARNIEMEEEDANISDGN 69
           D  + LW+WYL+ +R GEFEEL  +  K R +   ++E                 +S  N
Sbjct: 10  DDCNGLWSWYLHNLRCGEFEELSSDIVKCRLMKRLVKEY------------SGGTMSASN 57

Query: 70  -ILFLSLHYTLDKDKEIIDDFLVDNFPNVDLSNIVIREICNNNINSEHFKKD---HETYY 125
            +L +S+   + +   I+++FL  + P        +RE+ + NI     +KD    E +Y
Sbjct: 58  RVLLVSVPDDIRQGASILEEFLRSSLPG-------MREVRDGNITKLTGRKDLLNGEDHY 110

Query: 126 MVIDSLNKLLTTSIEEVSVSCHRDD---TSNIDRYKEQNSEFEYVNQSTQAKD-LDEEGS 181
           ++ D+        +  V ++ +R      S+  R  + ++EF + + +   ++ L+    
Sbjct: 111 LINDT-----KGGVAGVGLTANRPVESFGSHFQRQDQCDNEFSFGHSNASLEETLNVSLC 165

Query: 182 YVSSSENDSGLSIEL---NFKTKFNRNKFQNSTTEIAKAE----------ANHAVVKPSN 228
             +  EN +G+S +L    F    N   +     ++ + E             A  KP N
Sbjct: 166 ANTGLENVAGISTQLKGIGFDPVSNDISYMQQNIDVDRREHTLDGGGVGDTEVASEKPRN 225

Query: 229 -----------------NASIY----SRSDIESIDSYSDLNSRNLNTH--YDGQSLKLTH 265
                            N+ ++    S S I +  +  +++ R+  ++  YDG+ L  T 
Sbjct: 226 GERFTTSFKANSLTAVDNSKLFTFGLSSSAISTCKNSEEVSIRSSESYQSYDGEVLARTL 285

Query: 266 HKDNLLKNTTSSLDSGQNDKAVERLDDEATSDSMIVSDVFSSGAYSMSNLSINSQDRLLS 325
            ++  ++ +    +        E L +E  S S + S             + NS     S
Sbjct: 286 TREEHIQGSCCPTEHRH-----EELYNEGDSTSELSS-------------ACNSVSSDCS 327

Query: 326 LLPSIEMQNSYGEFKLVLQSMILINFESGESFTAVRQSNSLIHEATEDDEWLLYDSKFSM 385
           + PSI +    G+F++VLQS+++ N    +  TAVRQSN+    A  +D+WLLYD +FSM
Sbjct: 328 IFPSISISGDEGDFRIVLQSILIYNTTLDQLLTAVRQSNNDTTVADINDDWLLYDERFSM 387

Query: 386 DNLEIVTLNYLMDIYADFVKIFFYSMVII 414
           +N+++V+L  + ++   F KI FYS+V I
Sbjct: 388 NNIQMVSLIDIFEMNGVFPKILFYSVVAI 416

>Kpol_1023.99 s1023 complement(232194..233849) [1656 bp, 551 aa]
           {ON} complement(232194..233849) [1656 nt, 552 aa]
          Length = 551

 Score = 96.3 bits (238), Expect = 4e-20,   Method: Compositional matrix adjust.
 Identities = 46/90 (51%), Positives = 66/90 (73%)

Query: 325 SLLPSIEMQNSYGEFKLVLQSMILINFESGESFTAVRQSNSLIHEATEDDEWLLYDSKFS 384
           ++LP++ + + Y  F+LVLQS+++ N +S E  TA+RQSN+    A  DD+WLLYDSKFS
Sbjct: 246 TVLPTVNLPDPYANFQLVLQSILIYNSDSDELITAIRQSNNEQDSADIDDDWLLYDSKFS 305

Query: 385 MDNLEIVTLNYLMDIYADFVKIFFYSMVII 414
           M NL+I++LN L+ I  D+ KI FYS+V I
Sbjct: 306 MTNLQILSLNELLHINKDYPKILFYSLVSI 335

 Score = 43.9 bits (102), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 16/31 (51%), Positives = 22/31 (70%)

Query: 15 LWTWYLNCIRNGEFEELLKEEDKYRSILNKI 45
          +WTWYL  +RNG FEE+L  ED Y+ + N +
Sbjct: 15 VWTWYLCHVRNGSFEEILGNEDYYKLLKNNL 45

>TBLA0D01660 Chr4 complement(409692..412292) [2601 bp, 866 aa] {ON}
           Anc_5.526 YML006C
          Length = 866

 Score = 95.1 bits (235), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 45/90 (50%), Positives = 65/90 (72%)

Query: 326 LLPSIEMQNSYGEFKLVLQSMILINFESGESFTAVRQSNSLIHEATEDDEWLLYDSKFSM 385
           +LPSI + +S G F+LVLQ +++ +  + +++TA+RQS+S    A   D+WLLYD KFSM
Sbjct: 499 ILPSISISDSLGHFRLVLQCILIYHPHAEKTYTAIRQSDSNRDVADIQDDWLLYDLKFSM 558

Query: 386 DNLEIVTLNYLMDIYADFVKIFFYSMVIIN 415
           DNLEI+TL  L+D   D+ KI FY++V IN
Sbjct: 559 DNLEILTLQELLDFNRDYPKILFYTLVAIN 588

 Score = 48.9 bits (115), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 38/131 (29%), Positives = 62/131 (47%), Gaps = 10/131 (7%)

Query: 9   DDKYSSLWTWYLNCIRNGEFEELLKEEDKYRSILNKIRETLQTHARNIEMEEEDANISDG 68
           D+  + LW+WYL+ IRNG FEEL +   K   +   ++E  Q    +      +      
Sbjct: 16  DNDNNGLWSWYLSNIRNGMFEELTENILKITLLKRFLKENFQQDINSTSQHSTNC----T 71

Query: 69  NILFLSLHYTLDKDKEIIDDFLVDNFPNVDLSNIVIREICNNNINSEHFKKDHETYYMVI 128
            ILF S+   + +D  I+++ L D F   +L NI I ++  N         +HE +Y++ 
Sbjct: 72  KILFTSIPDNIHQDLPILENLLKDYFDLDNLDNIQILKLTQNRC------YNHENHYILK 125

Query: 129 DSLNKLLTTSI 139
           D L+    TS 
Sbjct: 126 DILDNFGNTSF 136

>KLLA0A01782g Chr1 complement(157216..158802) [1587 bp, 528 aa] {ON}
           some similarities with uniprot|Q04233 Saccharomyces
           cerevisiae YML006C GIS4 CAAX box containing protein of
           unknown function proposed to be involved in the RAS/cAMP
           signaling pathway
          Length = 528

 Score = 93.2 bits (230), Expect = 4e-19,   Method: Compositional matrix adjust.
 Identities = 104/408 (25%), Positives = 179/408 (43%), Gaps = 67/408 (16%)

Query: 12  YSSLWTWYLNCIRNGEFEELLKEEDKYRSILNKIRETLQTHARNIEMEEEDANISDGNIL 71
           Y+ LW+WYL+ +RNGEFEEL   E K+  +   +R+  Q                +  +L
Sbjct: 15  YNGLWSWYLSNLRNGEFEELTGNELKHGLLKRFLRDQFQA-----------TGPLNKKLL 63

Query: 72  FLSLHYTLDKDKEIIDDFLVDNFP-NVDLSNIVIREICNNNINSEHFKKDHETYYMVIDS 130
            +S+   + +D +++++FL + F    D +NIVI ++    +    +K  HE +Y++ D 
Sbjct: 64  LVSIPDEIHQDIKVLEEFLSEYFHLKDDHTNIVIDKLTRGTV----YK--HENHYLIQDK 117

Query: 131 L----NKLLTTSIEEVSVSCH--RDDTSNIDRYKEQNSEFEYVNQSTQAKDLDEEGSYVS 184
           L    ++      ++VS+S +  +D T   D  +    E E  +    +   D       
Sbjct: 118 LTNFNDEWFLEMKKDVSISGNSSKDAT---DSAENCGQEMEDDSPRRDSDSSDSYSILTG 174

Query: 185 SSENDSGLSIELNFKTKFNRNKFQNSTTEIAKAEANHAVVKPSNNASIYSRSDIESIDSY 244
            + +    SI LNFK        +     I K       + P NN    + S +  +   
Sbjct: 175 DTFDTESHSIVLNFKHP------EVMVKPITKTTQRIVRISPGNNIGSPAESQVSIVTHG 228

Query: 245 SDLNSRNLNTHYDGQSLKLTHHKDNLLKNTTSSLDSGQNDKAVERLDDEATSDSMIVSDV 304
            DL S      Y G++L  T  +   +       D   +   VE  DD  + D  I    
Sbjct: 229 DDLES------YRGEALVQTVTR--AIDEDEEDEDDDDHHHDVESADDMKSKDISIPP-- 278

Query: 305 FSSGAYSMSNLSINSQDRLLSLLPSIEMQNSYGEFKLVLQSMILINFESGESFTAVRQSN 364
                                   SI + +++G F+LVLQS+++ N E+ + FT +RQS 
Sbjct: 279 ------------------------SISISDNFGTFRLVLQSILITNKETEQIFTGIRQSE 314

Query: 365 SLIHEATEDDEWLLYDSKFSMDNLEIVTLNYLMDIYADFVKIFFYSMV 412
           +    A  +D+WLLYD+ F++ NL++++L  ++D      KI FYSM+
Sbjct: 315 NDRSNADINDDWLLYDTDFNLGNLQMLSLYDILDFSKFLPKILFYSMI 362

>KNAG0B03710 Chr2 complement(710003..712138) [2136 bp, 711 aa] {ON}
           Anc_5.526 YML006C
          Length = 711

 Score = 91.3 bits (225), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 44/91 (48%), Positives = 65/91 (71%), Gaps = 1/91 (1%)

Query: 325 SLLPSIEMQNSYGEFKLVLQSMILINFESGESFTAVRQSNSLIHEATEDDEWLLYDSKFS 384
           S+LPSI ++++ G F+LVLQS +L+  E    FTA+RQSN+ +  AT  D+W+LYDS FS
Sbjct: 460 SILPSITIKDTEGHFRLVLQS-VLLQREDKAIFTAIRQSNNKVDRATVQDDWILYDSDFS 518

Query: 385 MDNLEIVTLNYLMDIYADFVKIFFYSMVIIN 415
           M+NL ++TL  L +   +  KI FYSM+I++
Sbjct: 519 MNNLMMMTLRGLFNFSENMSKILFYSMIIVD 549

 Score = 61.2 bits (147), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 41/124 (33%), Positives = 68/124 (54%), Gaps = 17/124 (13%)

Query: 9   DDKYSSLWTWYLNCIRNGEFEELLKEEDKYRSILNKIRETLQTHARNIEMEEEDANISDG 68
           D+  + LW+WYL  IR+G+FEEL   E KY ++L +    L+ H  ++E         + 
Sbjct: 12  DNDDNGLWSWYLQNIRSGDFEELTHNELKY-TLLKRF---LKNHFTSLEG-------INS 60

Query: 69  NILFLSLHYTLDKDKEIIDDFLVDNFPNVDLSNIVIREICNNNINSEHFKKDHETYYMVI 128
            ILF+S+   +  D  +++ FL D F   DL NI I+++  +N        +HE +Y++ 
Sbjct: 61  KILFISIPDKVHSDISVLETFLKDYFHLEDLQNIKIQKLTTSNC------YNHENHYLLT 114

Query: 129 DSLN 132
           D+LN
Sbjct: 115 DTLN 118

>KAFR0C05390 Chr3 (1080797..1082164) [1368 bp, 455 aa] {ON}
           Anc_5.526 YML006C
          Length = 455

 Score = 81.3 bits (199), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 45/93 (48%), Positives = 65/93 (69%), Gaps = 2/93 (2%)

Query: 325 SLLPSIEMQN-SYGEFKLVLQSMILINFESGESFTAVRQSNSLIHEATEDDEWLLYDSKF 383
           S+LP + + N + G ++LVLQSM++ N E+ +  T VRQSN+LI+ A  +D+W+LYD KF
Sbjct: 251 SILPCVSINNEAIGHYRLVLQSMLICNKENLDLQTGVRQSNNLINYANINDDWMLYDEKF 310

Query: 384 SMDNLEIVTLNYLMDIY-ADFVKIFFYSMVIIN 415
           SM NL I++L  L  I   D +KI FYSM+ +N
Sbjct: 311 SMRNLNILSLKDLSIIGNVDSIKILFYSMIDVN 343

>NDAI0H01590 Chr8 (385963..387078) [1116 bp, 371 aa] {ON} 
          Length = 371

 Score = 75.9 bits (185), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 37/91 (40%), Positives = 59/91 (64%)

Query: 324 LSLLPSIEMQNSYGEFKLVLQSMILINFESGESFTAVRQSNSLIHEATEDDEWLLYDSKF 383
           + ++PSI   + YG+ + VLQS++  +  + E  TA+RQS++    AT  DEWLLYDS F
Sbjct: 280 VPVVPSISCHHPYGQIRFVLQSIVFKSVRTAELLTAIRQSSADRIVATSSDEWLLYDSDF 339

Query: 384 SMDNLEIVTLNYLMDIYADFVKIFFYSMVII 414
           S++NLEI TL  ++    +  +I FY+M ++
Sbjct: 340 SLNNLEISTLQDILYPNYENPRILFYTMSVV 370

>NCAS0F01080 Chr6 (214243..215382) [1140 bp, 379 aa] {ON} Anc_5.526
           YML006C
          Length = 379

 Score = 64.7 bits (156), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 32/67 (47%), Positives = 46/67 (68%)

Query: 327 LPSIEMQNSYGEFKLVLQSMILINFESGESFTAVRQSNSLIHEATEDDEWLLYDSKFSMD 386
           +P+       G+ + VL S+++ N +S E+FTA+RQ +S  + A   DEWLLYDSKFS+D
Sbjct: 290 IPTQTFSYKSGQLRFVLHSLLIQNAQSKETFTAIRQRSSDPNTANILDEWLLYDSKFSLD 349

Query: 387 NLEIVTL 393
           NLE+ TL
Sbjct: 350 NLEMGTL 356

>ADR198C Chr4 complement(1046482..1048131) [1650 bp, 549 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YML006C
           (GIS4)
          Length = 549

 Score = 58.2 bits (139), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 45/136 (33%), Positives = 73/136 (53%), Gaps = 3/136 (2%)

Query: 311 SMSNLSINSQDRLLSLLPSIEMQNSYGEFKLVLQSMILINFESGESFTAVRQSNSLIHEA 370
           S S++S  SQ    S+ PS+ + N + +F++VLQS+++ + E     TAVRQ N+  + A
Sbjct: 221 SYSDISSLSQFSNHSVFPSLSITNDFSKFRVVLQSILVYDCEKDRINTAVRQYNNNPNIA 280

Query: 371 TEDDEWLLYDSKFSMDNLEIVTLNYLMDIYADFVKIFFYSMVIINLEYPQ---AITFATD 427
              D+ LLYD+K S+    I++L  LM++     K+ FYS+  I    P+   A   A  
Sbjct: 281 NCSDDCLLYDNKISLITFRILSLVDLMELNRAHPKMLFYSVAEIFNSSPRCSAAGCCAQV 340

Query: 428 KHINNNLINSDGSSAN 443
            H    L+  +  SA+
Sbjct: 341 HHSQPQLLQRNSFSAS 356

 Score = 42.4 bits (98), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 21/79 (26%), Positives = 39/79 (49%), Gaps = 11/79 (13%)

Query: 12 YSSLWTWYLNCIRNGEFEELLKEEDKYRSILNKIRETLQTHARNIEMEEEDANISDGNIL 71
          Y  LW+WYL  +R G FE+L+ +E +Y  +   +R+    H+   E            + 
Sbjct: 5  YHGLWSWYLGNLRKGRFEQLVGDEARYSQLKAFLRDCF-AHSTGQERR----------LQ 53

Query: 72 FLSLHYTLDKDKEIIDDFL 90
           LS   ++  D +I+++F+
Sbjct: 54 LLSFPASVPCDYKILEEFI 72

>TBLA0G00940 Chr7 complement(228909..231257) [2349 bp, 782 aa] {ON} 
          Length = 782

 Score = 46.2 bits (108), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 25/73 (34%), Positives = 43/73 (58%), Gaps = 8/73 (10%)

Query: 340 KLVLQSMIL--INFESGESFTAVRQSNSLIHEATEDDEWLLYDSKFSMDNLEIVTLNYLM 397
           ++ L  +IL  I   +G+ FTA+++ N L        +WL++DS F  +  ++V+ + L+
Sbjct: 564 RMNLNCIILKKIGNTNGDFFTAIKEYNELY------SKWLIFDSTFQTEKSQLVSFDKLL 617

Query: 398 DIYADFVKIFFYS 410
           +I   F KIFFYS
Sbjct: 618 EIAKSFSKIFFYS 630

>YNL242W Chr14 (191324..196102) [4779 bp, 1592 aa] {ON}
           ATG2Peripheral membrane protein required for vesicle
           formation during autophagy, pexophagy, and the
           cytoplasm-to-vaucole targeting (Cvt) pathway; involved
           in Atg9p cycling between the phagophore assembly site
           and mitochondria
          Length = 1592

 Score = 37.0 bits (84), Expect = 0.23,   Method: Compositional matrix adjust.
 Identities = 39/140 (27%), Positives = 65/140 (46%), Gaps = 20/140 (14%)

Query: 299 MIVSDVFSSGAYSMSNLSINSQDRLLSLLPSIEMQNSYGEFKLVLQS--MILINFESGES 356
           +IV D  ++G  S        Q +LLS   ++ + + Y  FK+        LINF +G+ 
Sbjct: 804 VIVLDNLTTGGSSFI-----PQAKLLSKANTLFLIDDYQNFKIQKDKNWPSLINFYAGQG 858

Query: 357 FTAVRQSNSLIHEATEDDEWLLYDSKFSMDNLEIVTLNYLMDIYADFVKIFFYSMVIINL 416
           F+A+ + ++L     + D  LL D K     +E V L+   D +  F ++       I+L
Sbjct: 859 FSAIGKIDTLNFLINKSDGALLLDCK-----IEQVGLSLCADSFQTFCQL------CIDL 907

Query: 417 EYPQAITFATDKHINNNLIN 436
           +YPQ  TF  ++     L N
Sbjct: 908 KYPQ--TFPDEEKFRTQLKN 925

>KNAG0C03240 Chr3 complement(634593..635567) [975 bp, 324 aa] {ON} 
          Length = 324

 Score = 34.7 bits (78), Expect = 0.76,   Method: Compositional matrix adjust.
 Identities = 17/41 (41%), Positives = 26/41 (63%), Gaps = 8/41 (19%)

Query: 353 SGESFTAVRQSNSLIHEATEDDEWLLYDSKFSMDNLEIVTL 393
           SG+ + AVRQ         +DD+W++YD+ FS++NLE   L
Sbjct: 271 SGKLWHAVRQ--------LQDDDWVIYDADFSLNNLENCKL 303

>YJR098C Chr10 complement(613186..615156) [1971 bp, 656 aa] {ON}
           Putative protein of unknown function; the authentic,
           non-tagged protein is detected in highly purified
           mitochondria in high-throughput studies
          Length = 656

 Score = 33.5 bits (75), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 21/65 (32%), Positives = 36/65 (55%), Gaps = 4/65 (6%)

Query: 79  LDKDKEIIDDFLVDNFPNVDLSNIVIREI-CNNNINSEHFKKDHETYYMVIDSLNKLLTT 137
           L   KEI+ D ++ +   VD+S  +I+ +  N N+N + F  D   + + +D   K LTT
Sbjct: 286 LKTQKEIVPDGMLTHIGPVDISKRLIKRLDANPNLNVQQFGYD---WRLSLDISAKHLTT 342

Query: 138 SIEEV 142
            +EE+
Sbjct: 343 KLEEI 347

>Suva_14.100 Chr14 (186040..190794) [4755 bp, 1584 aa] {ON} YNL242W
           (REAL)
          Length = 1584

 Score = 33.5 bits (75), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 32/119 (26%), Positives = 56/119 (47%), Gaps = 15/119 (12%)

Query: 320 QDRLLSLLPSIEMQNSYGEFKLVLQSMI--LINFESGESFTAVRQSNSLIHEATEDDEWL 377
           Q +LLS + ++ + + Y  FK+        LINF + + F+A+ + ++L     + +E L
Sbjct: 813 QVKLLSKVNTLFLIDDYSNFKIQKDKNWPNLINFYANQGFSAIGKIDTLNFMINKSNETL 872

Query: 378 LYDSKFSMDNLEIVTLNYLMDIYADFVKIFFYSMVIINLEYPQAITFATDKHINNNLIN 436
           L D K        V L+   D +  F ++       ++L+YPQ  TF  +K     L N
Sbjct: 873 LLDCKIGQ-----VGLSLCADSFQTFCQL------CVDLKYPQ--TFPDEKKFKTELRN 918

>Skud_14.97 Chr14 (180038..184807) [4770 bp, 1589 aa] {ON} YNL242W
           (REAL)
          Length = 1589

 Score = 33.5 bits (75), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 32/117 (27%), Positives = 56/117 (47%), Gaps = 15/117 (12%)

Query: 320 QDRLLSLLPSIEMQNSYGEFKLVLQS--MILINFESGESFTAVRQSNSLIHEATEDDEWL 377
           Q +LLS + ++ + + Y  FK+        LI+F + + F+A+ + ++L     +  E L
Sbjct: 819 QVKLLSKMNTLFLIDDYANFKIQKDKNWPTLISFYANQGFSAIGKIDTLNFLINKSHETL 878

Query: 378 LYDSKFSMDNLEIVTLNYLMDIYADFVKIFFYSMVIINLEYPQAITFATDKHINNNL 434
           L D K     +E V L+   D +  F ++       I+L+YPQ  TF  +K     L
Sbjct: 879 LLDCK-----IEQVGLSLCADSFQSFCQL------CIDLKYPQ--TFPDEKKFKTEL 922

>ABR203W Chr2 (782704..783783) [1080 bp, 359 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YDR459C
          Length = 359

 Score = 32.0 bits (71), Expect = 5.4,   Method: Compositional matrix adjust.
 Identities = 20/54 (37%), Positives = 30/54 (55%), Gaps = 2/54 (3%)

Query: 8   KDDKYSSLWTWYLNCIRN-GEFEELLKEEDKYRSILNKIRETLQTHARNIEMEE 60
           KD   SS+W W++    N  EF+    E+D Y +IL   +E L +H R+I M+ 
Sbjct: 286 KDFLGSSIWRWFIPIGSNIPEFQTSAWEDD-YNAILGPYKEELGSHYRDILMQR 338

>NDAI0D00720 Chr4 complement(157493..159010) [1518 bp, 505 aa] {ON}
           Anc_7.321
          Length = 505

 Score = 32.0 bits (71), Expect = 5.9,   Method: Compositional matrix adjust.
 Identities = 36/149 (24%), Positives = 66/149 (44%), Gaps = 10/149 (6%)

Query: 201 KFNRNKFQNSTTEIAKAEANHAVVKPSNNASIYSRSDIESIDSYSDLNSRNLNTHYDGQS 260
           +F+RN F  +T +I K +    + + SNN   Y   D+  I   ++LN R +  H  G  
Sbjct: 87  QFDRNSFPKNTIDIEKKKTPLLIRRYSNNER-YHNLDMAPIVDTTNLNDR-MELHKRG-- 142

Query: 261 LKLTHHKDNLLKNTTSSLDSGQNDKAVERLDDEATSDSMIVSDVFSSGAYSMSNLSINSQ 320
             L HH + L+ N  S +++ ++ K    +   +TS    + D+        +   I S 
Sbjct: 143 --LFHHTNYLVTN--SEVEAKEHSKMYNFIYSGSTSIDPNLGDIVLGMPKRTTGSQIAST 198

Query: 321 DRLLSLLPSIEMQNSYGEFKLVLQSMILI 349
            + L     + M+   G  + V+  ++LI
Sbjct: 199 KQFLYGKAKVRMRT--GRSRGVVTGLVLI 225

>NDAI0A05620 Chr1 (1268907..1270622) [1716 bp, 571 aa] {ON} 
          Length = 571

 Score = 31.6 bits (70), Expect = 8.7,   Method: Compositional matrix adjust.
 Identities = 18/53 (33%), Positives = 28/53 (52%)

Query: 299 MIVSDVFSSGAYSMSNLSINSQDRLLSLLPSIEMQNSYGEFKLVLQSMILINF 351
           ++VS  FS G   + +LS+N Q+      P+   Q+ Y    + L +MILI F
Sbjct: 255 ILVSAYFSYGGAELFSLSVNEQENPRKSTPAAAKQSIYRILIIYLATMILIGF 307

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.311    0.128    0.351 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 72,198,695
Number of extensions: 3400175
Number of successful extensions: 16153
Number of sequences better than 10.0: 551
Number of HSP's gapped: 16886
Number of HSP's successfully gapped: 649
Length of query: 675
Length of database: 53,481,399
Length adjustment: 116
Effective length of query: 559
Effective length of database: 40,180,143
Effective search space: 22460699937
Effective search space used: 22460699937
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.8 bits)
S2: 69 (31.2 bits)