Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
TPHA0J027805.475ON63163132590.0
Kpol_543.95.475ON64264916910.0
TDEL0A033905.475ON62263514640.0
Suva_8.1905.475ON66664414190.0
Skud_15.3025.475ON67866113960.0
Smik_15.3185.475ON67266513940.0
YOR138C (RUP1)5.475ON67164813740.0
SAKL0G03564g5.475ON60564512441e-164
NCAS0H022705.475ON69668511791e-153
KAFR0E025405.475ON65966211701e-152
Kwal_55.212675.475ON60462011021e-142
KLTH0F15004g5.475ON59763810971e-142
NDAI0C013905.475ON70971110891e-139
TBLA0A025405.475ON67868810861e-139
TBLA0B022305.475ON79071410321e-130
ZYRO0D11264g5.475ON5476209801e-125
CAGL0I07205g5.475ON6036459191e-115
KNAG0B040505.475ON6736869051e-112
KLLA0E03169g5.475ON5444985961e-68
NDAI0C058908.185ON46236840.16
KAFR0C004103.270ON76958830.25
YER143W (DDI1)8.185ON42836800.41
Skud_5.2808.185ON42836800.43
Kpol_1028.897.488ON87736800.56
NCAS0I016203.270ON79545790.71
Suva_2.707.488ON138034780.89
Ecym_71787.488ON126936781.00
ZYRO0G17996g7.488ON145534781.0
Smik_5.3088.185ON42836742.2
YBL047C (EDE1)7.488ON138134752.2
NCAS0A039208.185ON47233732.9
Skud_2.557.488ON139034733.3
CAGL0F04609g7.488ON131134733.6
NDAI0J005307.488ON138934734.1
AGR023C3.270ON78058724.1
KLLA0E10341g8.185ON41433724.4
NDAI0E023908.668ON88388724.6
Smik_2.677.488ON137734724.8
NCAS0A032005.702ON178862724.9
YMR012W (CLU1)2.559ON1277179725.4
Suva_5.2718.185ON42836706.5
KAFR0G006701.214ON589103699.0
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= TPHA0J02780
         (631 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

TPHA0J02780 Chr10 complement(619045..620940) [1896 bp, 631 aa] {...  1259   0.0  
Kpol_543.9 s543 complement(22643..24571) [1929 bp, 642 aa] {ON} ...   655   0.0  
TDEL0A03390 Chr1 complement(603062..604930) [1869 bp, 622 aa] {O...   568   0.0  
Suva_8.190 Chr8 complement(339480..341480) [2001 bp, 666 aa] {ON...   551   0.0  
Skud_15.302 Chr15 complement(538346..540382) [2037 bp, 678 aa] {...   542   0.0  
Smik_15.318 Chr15 complement(545721..547739) [2019 bp, 672 aa] {...   541   0.0  
YOR138C Chr15 complement(584309..586324) [2016 bp, 671 aa] {ON} ...   533   0.0  
SAKL0G03564g Chr7 complement(294308..296125) [1818 bp, 605 aa] {...   483   e-164
NCAS0H02270 Chr8 complement(445144..447234) [2091 bp, 696 aa] {O...   458   e-153
KAFR0E02540 Chr5 (519567..521546) [1980 bp, 659 aa] {ON} Anc_5.4...   455   e-152
Kwal_55.21267 s55 (757685..759499) [1815 bp, 604 aa] {ON} YOR138...   429   e-142
KLTH0F15004g Chr6 (1228654..1230447) [1794 bp, 597 aa] {ON} weak...   427   e-142
NDAI0C01390 Chr3 (290301..292430) [2130 bp, 709 aa] {ON} Anc_5.4...   424   e-139
TBLA0A02540 Chr1 (613560..615596) [2037 bp, 678 aa] {ON} Anc_5.4...   422   e-139
TBLA0B02230 Chr2 (521358..523730) [2373 bp, 790 aa] {ON} Anc_5.4...   402   e-130
ZYRO0D11264g Chr4 complement(948942..950585) [1644 bp, 547 aa] {...   382   e-125
CAGL0I07205g Chr9 (694434..696245) [1812 bp, 603 aa] {ON} simila...   358   e-115
KNAG0B04050 Chr2 (776430..778451) [2022 bp, 673 aa] {ON} Anc_5.4...   353   e-112
KLLA0E03169g Chr5 complement(292918..294552) [1635 bp, 544 aa] {...   234   1e-68
NDAI0C05890 Chr3 (1349126..1350514) [1389 bp, 462 aa] {ON} Anc_8...    37   0.16 
KAFR0C00410 Chr3 complement(85302..87611) [2310 bp, 769 aa] {ON}...    37   0.25 
YER143W Chr5 (456319..457605) [1287 bp, 428 aa] {ON}  DDI1DNA da...    35   0.41 
Skud_5.280 Chr5 (446952..448238) [1287 bp, 428 aa] {ON} YER143W ...    35   0.43 
Kpol_1028.89 s1028 complement(197927..200560) [2634 bp, 877 aa] ...    35   0.56 
NCAS0I01620 Chr9 complement(299269..301656) [2388 bp, 795 aa] {O...    35   0.71 
Suva_2.70 Chr2 complement(125732..129874) [4143 bp, 1380 aa] {ON...    35   0.89 
Ecym_7178 Chr7 (363600..367409) [3810 bp, 1269 aa] {ON} similar ...    35   1.00 
ZYRO0G17996g Chr7 (1477518..1481885) [4368 bp, 1455 aa] {ON} wea...    35   1.0  
Smik_5.308 Chr5 (461464..462750) [1287 bp, 428 aa] {ON} YER143W ...    33   2.2  
YBL047C Chr2 complement(127895..132040) [4146 bp, 1381 aa] {ON} ...    33   2.2  
NCAS0A03920 Chr1 complement(793999..795417) [1419 bp, 472 aa] {O...    33   2.9  
Skud_2.55 Chr2 complement(111625..115797) [4173 bp, 1390 aa] {ON...    33   3.3  
CAGL0F04609g Chr6 (463702..467637) [3936 bp, 1311 aa] {ON} simil...    33   3.6  
NDAI0J00530 Chr10 complement(102751..106920) [4170 bp, 1389 aa] ...    33   4.1  
AGR023C Chr7 complement(756961..759303) [2343 bp, 780 aa] {ON} S...    32   4.1  
KLLA0E10341g Chr5 complement(911148..912392) [1245 bp, 414 aa] {...    32   4.4  
NDAI0E02390 Chr5 complement(496256..498907) [2652 bp, 883 aa] {O...    32   4.6  
Smik_2.67 Chr2 complement(121714..125847) [4134 bp, 1377 aa] {ON...    32   4.8  
NCAS0A03200 Chr1 complement(627997..633363) [5367 bp, 1788 aa] {...    32   4.9  
YMR012W Chr13 (291134..294967) [3834 bp, 1277 aa] {ON}  CLU1eIF3...    32   5.4  
Suva_5.271 Chr5 (427633..428919) [1287 bp, 428 aa] {ON} YER143W ...    32   6.5  
KAFR0G00670 Chr7 complement(168288..170057) [1770 bp, 589 aa] {O...    31   9.0  

>TPHA0J02780 Chr10 complement(619045..620940) [1896 bp, 631 aa] {ON}
           Anc_5.475 YOR138C
          Length = 631

 Score = 1259 bits (3259), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 618/631 (97%), Positives = 618/631 (97%)

Query: 1   MNDNKNSVKSIVDMGIPEDVAIDALNRVNGDLEAAVNFIFSNELPDNNMGESVGNEKYTT 60
           MNDNKNSVKSIVDMGIPEDVAIDALNRVNGDLEAAVNFIFSNELPDNNMGESVGNEKYTT
Sbjct: 1   MNDNKNSVKSIVDMGIPEDVAIDALNRVNGDLEAAVNFIFSNELPDNNMGESVGNEKYTT 60

Query: 61  SEHVNISNDNNFQAGDLSEVMNVSNYGYDNRFETDSGDLSSDEVSDPEIVENDISNNLKL 120
           SEHVNISNDNNFQAGDLSEVMNVSNYGYDNRFETDSGDLSSDEVSDPEIVENDISNNLKL
Sbjct: 61  SEHVNISNDNNFQAGDLSEVMNVSNYGYDNRFETDSGDLSSDEVSDPEIVENDISNNLKL 120

Query: 121 PAYNIVKHEVEKTSLSDPTVVMPLPHNSIIESYFGLFSMFISIYLPHLLLKPDFKDLNYD 180
           PAYNIVKHEVEKTSLSDPTVVMPLPHNSIIESYFGLFSMFISIYLPHLLLKPDFKDLNYD
Sbjct: 121 PAYNIVKHEVEKTSLSDPTVVMPLPHNSIIESYFGLFSMFISIYLPHLLLKPDFKDLNYD 180

Query: 181 NEWYNGLKFVAPKFGIKVHNEESLKDDLHTSIEPLTCVDRDLDDQPKLLWQLQKLSTIMN 240
           NEWYNGLKFVAPKFGIKVHNEESLKDDLHTSIEPLTCVDRDLDDQPKLLWQLQKLSTIMN
Sbjct: 181 NEWYNGLKFVAPKFGIKVHNEESLKDDLHTSIEPLTCVDRDLDDQPKLLWQLQKLSTIMN 240

Query: 241 STMSERSYVSSKLFSLCLDRNAKMKLQDAEHLYEVLPSFIKYLTSNLEMCPDFRPDEIRN 300
           STMSERSYVSSKLFSLCLDRNAKMKLQDAEHLYEVLPSFIKYLTSNLEMCPDFRPDEIRN
Sbjct: 241 STMSERSYVSSKLFSLCLDRNAKMKLQDAEHLYEVLPSFIKYLTSNLEMCPDFRPDEIRN 300

Query: 301 ELISSAYYLPSDDEPPVKTLLTLFHFLPDEYESNLYKMFNILLYXXXXXXXXXXXXXNSL 360
           ELISSAYYLPSDDEPPVKTLLTLFHFLPDEYESNLYKMFNILLY             NSL
Sbjct: 301 ELISSAYYLPSDDEPPVKTLLTLFHFLPDEYESNLYKMFNILLYADDEDGDGAIDEGNSL 360

Query: 361 NYLAPNLTIIFDEIDELSSMTPLPEGVSIPLEFYPQLYTKECKDQLIKHIIGKRQDAQKE 420
           NYLAPNLTIIFDEIDELSSMTPLPEGVSIPLEFYPQLYTKECKDQLIKHIIGKRQDAQKE
Sbjct: 361 NYLAPNLTIIFDEIDELSSMTPLPEGVSIPLEFYPQLYTKECKDQLIKHIIGKRQDAQKE 420

Query: 421 SRQHLKDLNSLKSFQGKDILKFLNSTLDFLDRDGQRQNGLTEGNGKLMEGLTDIKEQLTK 480
           SRQHLKDLNSLKSFQGKDILKFLNSTLDFLDRDGQRQNGLTEGNGKLMEGLTDIKEQLTK
Sbjct: 421 SRQHLKDLNSLKSFQGKDILKFLNSTLDFLDRDGQRQNGLTEGNGKLMEGLTDIKEQLTK 480

Query: 481 KKTEKMNAYKDLTQKLNTSWNLSNPEVSIIATAKKLGLIDEPYHLSMAVMSPNLYYIKKR 540
           KKTEKMNAYKDLTQKLNTSWNLSNPEVSIIATAKKLGLIDEPYHLSMAVMSPNLYYIKKR
Sbjct: 481 KKTEKMNAYKDLTQKLNTSWNLSNPEVSIIATAKKLGLIDEPYHLSMAVMSPNLYYIKKR 540

Query: 541 DGTWYLVQITENGDDFDIRKCSSGVEIQDCVRQYTRHGSETPLMFVYTKEGSIPDDDSVQ 600
           DGTWYLVQITENGDDFDIRKCSSGVEIQDCVRQYTRHGSETPLMFVYTKEGSIPDDDSVQ
Sbjct: 541 DGTWYLVQITENGDDFDIRKCSSGVEIQDCVRQYTRHGSETPLMFVYTKEGSIPDDDSVQ 600

Query: 601 KILEANTGCLQFLKDDQKLLNEMVMNESDDV 631
           KILEANTGCLQFLKDDQKLLNEMVMNESDDV
Sbjct: 601 KILEANTGCLQFLKDDQKLLNEMVMNESDDV 631

>Kpol_543.9 s543 complement(22643..24571) [1929 bp, 642 aa] {ON}
           complement(22643..24571) [1929 nt, 643 aa]
          Length = 642

 Score =  655 bits (1691), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 336/649 (51%), Positives = 454/649 (69%), Gaps = 35/649 (5%)

Query: 4   NKNSVKSIVDMGIPEDVAIDALNRVNGDLEAAVNFIFSNELPDNNMGESVGNEKYT-TSE 62
           N+NS+ S+++MGIP D+AIDAL+R NG+LEAAVNFIFSNELP       +    Y   + 
Sbjct: 5   NENSINSLIEMGIPRDIAIDALSRANGNLEAAVNFIFSNELPAEAENSDIEIISYKEKAN 64

Query: 63  HVNISNDNNFQAGDLSEVM--------NVSNYGYDNRFETDSGDLSSDEV--------SD 106
           HV ISN  +FQ GDL+EV+           NY  DN    DS    SD++        SD
Sbjct: 65  HVEISNKESFQPGDLTEVIANQQPLQPEFQNYVNDNSENIDSNCYVSDKIVDNMDYYSSD 124

Query: 107 PEIVENDISNNLKLPAYNIVKHEVEKTSLSDPTVVMPLPHNSIIESYFGLFSMFISIYLP 166
            + + N +++NL  P+Y IVKH   K+ L DPTV++PLP NS+IE+YF L+S+ I+ YLP
Sbjct: 125 SDYITNSVTDNLLPPSYQIVKHSDHKSRLRDPTVILPLPPNSMIENYFALYSLCITNYLP 184

Query: 167 HLLLKPDFKDLNYDNEWYNGLKFVAPKFGIK-VHNEESLKDDLHTSIEPLTCVDRDLDDQ 225
           H++++PDFKDL++  +W+ G  F  PK  +K V +E + K  +   I P+  +++D DDQ
Sbjct: 185 HIIMRPDFKDLSFTEDWFKGSSFSKPKNVLKSVTDETTSKSTMK--ICPIEDMNQD-DDQ 241

Query: 226 PKLLWQLQKLSTIMNSTMSERSYVSSKLFSLCLDRNAKMKLQDAEHLYEVLPSFIKYLTS 285
           P+LLWQLQKLS+I+NSTMSER+YV +K+FS+ LD+ ++++L +A+HL EVLPSFIKYL  
Sbjct: 242 PELLWQLQKLSSIVNSTMSERAYVCAKIFSVILDQQSQIRLAEADHLNEVLPSFIKYLVV 301

Query: 286 NLEMCPDFRPDEIRNELISSAYYLPSDDEPPVKTLLTLFHFLPDEYESNLYKMFNILLY- 344
           NLE CP F  DEIR   ISSA+Y PSDD+ P+ TLL+LFHFLPDEY+SNLYKMFN+LLY 
Sbjct: 302 NLESCPGFEEDEIRKLFISSAFYTPSDDQAPITTLLSLFHFLPDEYDSNLYKMFNVLLYP 361

Query: 345 ---XXXXXXXXXXXXXNSLNYLAPNLTIIFDEIDELSSMTPLPEGVSIPLEFYPQLYTKE 401
                           NSL  ++P L+I+FDE +E SS   LPEGV +PLEF+PQ+YTK+
Sbjct: 362 DENDSDYESGDESEQGNSLGDISPILSIVFDEAEEGSSGISLPEGVEVPLEFFPQIYTKD 421

Query: 402 CKDQLIKHIIGKRQDAQKESRQHLKDLNSLKSFQGKDILKFLNSTLDFLDRDGQRQNGLT 461
           CK++LIKHII KR+DAQ +S++ L D+NS+KSFQGKDILKF+NS+L++L+RD +  N   
Sbjct: 422 CKNKLIKHIIAKRKDAQFKSKEILNDINSIKSFQGKDILKFINSSLEYLERDNKSDN--- 478

Query: 462 EGNGKLMEGLTDIKEQLTKKKTEKMNAYKDLTQKLNTSWNLSNPEVSIIATAKKLGLIDE 521
                + E L  IK  +   KT+KMN Y+DL QKL   WN+SNPE  I+ T +KLGLI E
Sbjct: 479 -----ITEELLKIKNDMAIVKTQKMNEYRDLAQKLQNEWNISNPETHIVETGRKLGLIGE 533

Query: 522 PYHLSMAVMSPNLYYIKKRDGTWYLVQITENGDDFDIRKCSSGVEIQDCVRQYTRHGSET 581
           PY L MAV+SP  YYI++R G W LVQ +  G DFD+R+CSS +E++D ++Q TRH SET
Sbjct: 534 PYLLVMAVLSPYSYYIRERTGKWNLVQCSTTGGDFDVRECSSELEVKDTIKQATRHASET 593

Query: 582 PLMFVYTKEGSIPDDDSVQKILEANTGCLQFLKDDQKLLNEMVMNESDD 630
           PLMF+Y +   IP++  ++K  E+N+GCL F K+DQ +LN+  MN SD+
Sbjct: 594 PLMFMYCRRDVIPEEYEIRKSFESNSGCLNFFKEDQLVLNK--MNNSDE 640

>TDEL0A03390 Chr1 complement(603062..604930) [1869 bp, 622 aa] {ON}
           Anc_5.475 YOR138C
          Length = 622

 Score =  568 bits (1464), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 294/635 (46%), Positives = 417/635 (65%), Gaps = 44/635 (6%)

Query: 1   MNDNKNSVKSIVDMGIPEDVAIDALNRVNGDLEAAVNFIFSNELPDNNMGESVGNEKYTT 60
           MND  ++V+S+V+MGI +DVA DAL R NGD+EAA NFIF N+ P   + E+V    +  
Sbjct: 1   MNDT-DAVRSLVEMGISKDVAEDALRRTNGDVEAAGNFIFCNDAP-AQISENVEQRAHI- 57

Query: 61  SEHVNISNDNNFQAGDLSEVMNVSNYGYDNRFETDSGDLSSDEVSDPEIVENDISNNLKL 120
              +   + + FQ GDL+E +            +++ D  S++  + ++ E+ +     L
Sbjct: 58  --ELPAGSASGFQPGDLNEYI------------SNAPDTESEDFEEIDVEEDSVETGPSL 103

Query: 121 PAYNIVKHEVEKTSLSDPTVVMPLPHNSIIESYFGLFSMFISIYLPHLLLKPDFKDLNYD 180
                      K  +SDPTVV+PLP N + E YF LF +F++ Y+PHLL +PDF DLNYD
Sbjct: 104 ECSG------RKGQISDPTVVLPLPPNFLFEGYFALFCLFVANYMPHLLARPDFIDLNYD 157

Query: 181 NEWYNGLKFVAPKFGIKVHNEESLKDDLHTSIEP---LTCVDRDLDDQPKLLWQLQKLST 237
             WY G  +   ++ +K  ++    DD    I P   LT  D D   Q +LLWQLQKL++
Sbjct: 158 KNWYRGDSYTNAEYRLKYLSKNG-SDDEQIEIVPKDELTQEDGDYTLQSELLWQLQKLAS 216

Query: 238 IMNSTMSERSYVSSKLFSLCLDRNAKMKLQDAEHLYEVLPSFIKYLTSNLEMCPDFRPDE 297
           + NS MS+R+YV +K+F++ ++   +  + +AEHL+EVLPSFIK +  +LEMCP+F+ +E
Sbjct: 217 VANSRMSDRAYVRAKMFAIAVEPQVQRNMAEAEHLHEVLPSFIKSVAVDLEMCPNFQDNE 276

Query: 298 IRNELISSAYYLPSDDEP----PVKTLLTLFHFLPDEYESNLYKMFNILLYXXXXXXXXX 353
           +R   ISSA++ PS+  P     +KT L+LFHFLP+EYE+NLY+MFN LL+         
Sbjct: 277 VRECFISSAFHTPSNSAPQEESTMKTWLSLFHFLPEEYETNLYRMFNALLFADDSVESDQ 336

Query: 354 XXX-----XNSLNYLAPNLTIIFDEIDELSSMTPLPEGVSIPLEFYPQLYTKECKDQLIK 408
                    NSL+ +AP  TI+FDE++E +   PL EGV +PLEFYPQLYTKECKD+LIK
Sbjct: 337 SDSPDGEGENSLSEIAPVFTIVFDEMEETTEAVPLAEGVEMPLEFYPQLYTKECKDKLIK 396

Query: 409 HIIGKRQDAQKESRQHLKDLNSLKSFQGKDILKFLNSTLDFLDRDGQRQNGLTEGNGKLM 468
           HII KR+ +Q +SR  L+++  LKSFQGKD+ KF+NS+LD+L +D        E + +L+
Sbjct: 397 HIIAKRRQSQTDSRAILQEITDLKSFQGKDLSKFINSSLDYLQKD--------EKSPELI 448

Query: 469 EGLTDIKEQLTKKKTEKMNAYKDLTQKLNTSWNLSNPEVSIIATAKKLGLIDEPYHLSMA 528
           +GL D+K+Q+T KKT+KMN YK++  +L + WNLS PE+ I+ TAK+LGLID+ Y L+MA
Sbjct: 449 KGLLDLKDQITNKKTKKMNEYKEIAHRLQSEWNLSLPEIQIVKTAKELGLIDDSYLLTMA 508

Query: 529 VMSPNLYYIKKRDGTWYLVQITENGDDFDIRKCSSGVEIQDCVRQYTRHGSETPLMFVYT 588
           V+SP +YY + RDG W+ VQ T     +++R CSS +EIQD ++Q+TR  SE PLMF+Y 
Sbjct: 509 VISPYMYYTRNRDGQWFFVQSTPYEASYNVRACSSPLEIQDAIKQHTRRPSEAPLMFIYC 568

Query: 589 KEGSIPDDDSVQKILEANTGCLQFLKDDQKLLNEM 623
           K+G IPDDD+V K LE N GC +F KDDQ  LN+M
Sbjct: 569 KKGFIPDDDTVLKALENNQGCHRFAKDDQLQLNKM 603

>Suva_8.190 Chr8 complement(339480..341480) [2001 bp, 666 aa] {ON}
           YOR138C (REAL)
          Length = 666

 Score =  551 bits (1419), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 298/644 (46%), Positives = 403/644 (62%), Gaps = 38/644 (5%)

Query: 1   MNDNKNSVKSIVDMGIPEDVAIDALNRVNGDLEAAVNFIFSNELPD-----------NNM 49
           M DN+ +VKS+++MGIP +VA+DAL R  G+LEAAVNFIFSNELP+           N +
Sbjct: 1   MMDNQ-AVKSLLEMGIPHEVAVDALQRTGGNLEAAVNFIFSNELPEQVATGQPRISENRV 59

Query: 50  GESVGNEKYTTSEHVNISNDNNFQAGDLSEVMNVSNYGYDNRFETDSGDLSSDEVSDPEI 109
               G   Y     V  S D +    D+       +    +    D    SS     P+ 
Sbjct: 60  VPDAGAGAY----DVPNSGDQDIDMPDVVGGGGDGDGDGYDDLTDDRSGSSSSNGRGPD- 114

Query: 110 VENDIS-NNLKLPAYNIVKHEVEKTSLSDPTVVMPLPHNSIIESYFGLFSMFISIYLPHL 168
               IS  +L  P+Y+IV+H   K+++ DPTVV+PLP NS+IESYFGLF++  S+Y PH+
Sbjct: 115 -HYSISETSLPPPSYSIVQHNQFKSAVDDPTVVLPLPLNSLIESYFGLFALLASMYFPHV 173

Query: 169 LLKPDFKDLNYDNEWYNGLKFVAPKFGIKVHNEESLKDDLHTSIEPLTCVDRDLDDQPKL 228
            LKPDF+DLNY  +W+ G  F  P++ +  + E S   D  T+ E +       D QP L
Sbjct: 174 FLKPDFQDLNYRPDWFKGSSFAEPRYRL-AYRESS---DGSTTSEIVVASGPSKDVQPHL 229

Query: 229 LWQLQKLSTIMNSTMSERSYVSSKLFSLCLDRNAKMKLQDAEHLYEVLPSFIKYLTSNLE 288
           LWQLQKL +++N+ M ER++VS+KLF+L L+   K KL D+EHLYEVLP+FIK L  +LE
Sbjct: 230 LWQLQKLISVVNTKMCERAFVSAKLFTLSLEPQLKAKLADSEHLYEVLPTFIKSLAVDLE 289

Query: 289 MCPDFRPDEIRNELISSAYYLPSDDEPPVKTLLTLFHFLPDEYESNLYKMFNILLYXXXX 348
           MCP  R  E RN  ISSA + P  +EPP++T L+LFHFLP+EY+SNLYKMFN+LLY    
Sbjct: 290 MCPGIRDRETRNLFISSALHTPDKNEPPMETFLSLFHFLPEEYDSNLYKMFNVLLYPEEE 349

Query: 349 XXX---------XXXXXXNSLNYLAPNLTIIFDEIDELSSMTPLPEGVSIPLEFYPQLYT 399
                             N+L  +AP LTI+F+E++  +    LP GV +PLEFYPQLYT
Sbjct: 350 EEEGEVVYGGDGAHQEPENTLKEVAPVLTILFNELETNTESVTLPNGVDVPLEFYPQLYT 409

Query: 400 KECKDQLIKHIIGKRQDAQKESRQHLKDLNSLKSFQGKDILKFLNSTLDFLDRDGQRQNG 459
           K CKDQLI+HII KR+ A+ +SR  L+++N+LKS+QGK+I   L STL +L  D +    
Sbjct: 410 KRCKDQLIRHIISKRKQARVKSRSLLQEINNLKSYQGKNISTILESTLAYLQADTK---- 465

Query: 460 LTEGNGKLMEGLTDIKEQLTKKKTEKMNAYKDLTQKLNTSWNLSNPEVSIIATAKKLGLI 519
             + + +  + +  +K+ L   +  KM  YKDL  KL+  WNLS+PE+ II TAK+LGLI
Sbjct: 466 --DADNEASKQIASLKDTLNSSRAAKMEEYKDLASKLHGEWNLSHPEIHIINTAKQLGLI 523

Query: 520 DEPYHLSMAVMSPNLYYIKKRDGTWYLVQITENGDDFDIRKCSSGVEIQDCVRQYTRHGS 579
           + PY LSMAV+SP  Y+ + RDG W  +Q    G +F I KCSS   +Q+ +R  T++ S
Sbjct: 524 ENPYILSMAVLSPYSYFTRDRDGEWSWIQSNTLGTEFKINKCSSPSVVQEAIRHGTKYAS 583

Query: 580 ETPLMFVYTKEGSIPDDDSVQKILEANTGCLQFLKDDQKLLNEM 623
           E PLMF+Y +EG IP DD V K LE NTGC++F KDDQ  LN +
Sbjct: 584 EMPLMFIYCEEGRIPTDDEVSKALENNTGCVKFAKDDQSTLNTL 627

>Skud_15.302 Chr15 complement(538346..540382) [2037 bp, 678 aa] {ON}
           YOR138C (REAL)
          Length = 678

 Score =  542 bits (1396), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 291/661 (44%), Positives = 413/661 (62%), Gaps = 43/661 (6%)

Query: 1   MNDNKNSVKSIVDMGIPEDVAIDALNRVNGDLEAAVNFIFSNELPDN-NMGESVGNEKYT 59
           M DN+ +VKS+++MGIP +VA+DAL+R  G+LEAAVNFIFSNELP+  + G   G  +  
Sbjct: 1   MMDNQ-AVKSLLEMGIPHEVAMDALHRTGGNLEAAVNFIFSNELPEQADTGGEGGAGQPR 59

Query: 60  TSEHVNISNDNNF---QAGDLSEVMNVSNYGYDNRF---------ETDSGDLSSDEVSDP 107
            SE+  ++  N++    +GD  ++      G +  +         E  SG  SS+E   P
Sbjct: 60  ISENRMMAGSNSYDVPNSGDQEDIDMADVAGGEADYDDEDDEDITENHSGSSSSNE-RGP 118

Query: 108 EIVEND---IS-NNLKLPAYNIVKHEVEKTSLSDPTVVMPLPHNSIIESYFGLFSMFISI 163
              + D   IS  ++  P+YNIV+    K ++ DPTVV+PLP NS+IESYFGLF++ +S+
Sbjct: 119 AARDYDHYSISETSIAPPSYNIVQQNEFKCAVDDPTVVLPLPLNSLIESYFGLFALLVSV 178

Query: 164 YLPHLLLKPDFKDLNYDNEWYNGLKFVAPKFGIKVHNEESLKDDLHTSIEPLTCVDRDLD 223
           Y PH+ LKPDF+DLNY  +W+ G  F  PK+ +         DD   + E +       D
Sbjct: 179 YFPHVFLKPDFQDLNYSPDWFKGSSFTGPKYRLAYRE----ADDGSATSEIVLASGSSDD 234

Query: 224 DQPKLLWQLQKLSTIMNSTMSERSYVSSKLFSLCLDRNAKMKLQDAEHLYEVLPSFIKYL 283
            QP+LLWQLQKL +++N+ M ER++VS++LF+L L+   K KL D+EHLYEVLP+FIK L
Sbjct: 235 LQPRLLWQLQKLISVINTRMCERAFVSARLFTLSLEPQLKSKLADSEHLYEVLPTFIKSL 294

Query: 284 TSNLEMCPDFRPDEIRNELISSAYYLPSDDEPPVKTLLTLFHFLPDEYESNLYKMFNILL 343
             +LEMCP  R  E RN  ISSA + P+ +EPP++T L+LFHFLP+EY+SNLYKMFN+LL
Sbjct: 295 AVDLEMCPGIRDRETRNLFISSALHTPNKNEPPMETFLSLFHFLPEEYDSNLYKMFNVLL 354

Query: 344 YXXXXXXXXXXXX--------------XNSLNYLAPNLTIIFDEIDELSSMTPLPEGVSI 389
           Y                           N+L  +AP LTI+F+E++  +    LP GV I
Sbjct: 355 YPEEENDEEDATRNGGGGQEDEEFAEPENTLKEVAPVLTILFNELETNTESMTLPNGVDI 414

Query: 390 PLEFYPQLYTKECKDQLIKHIIGKRQDAQKESRQHLKDLNSLKSFQGKDILKFLNSTLDF 449
           PLEFYPQLYTK CKDQLI+H+I KR+ A+  SR  L+++N+LKS+QGK+I   L STL +
Sbjct: 415 PLEFYPQLYTKRCKDQLIRHVISKRKQARIRSRTLLQEINNLKSYQGKNISTVLESTLAY 474

Query: 450 LDRDGQRQNGLTEGNGKLMEGLTDIKEQLTKKKTEKMNAYKDLTQKLNTSWNLSNPEVSI 509
           L      Q    + N K    +  +K+ L   ++ KM  YKDL  K++  W+LS+PE  I
Sbjct: 475 L------QASPNDANNKAARQIASLKDTLNSTRSAKMEEYKDLASKVHGEWDLSHPETHI 528

Query: 510 IATAKKLGLIDEPYHLSMAVMSPNLYYIKKRDGTWYLVQITENGDDFDIRKCSSGVEIQD 569
           I TAK+L LI+ PY L++A +SP  Y+++ R+G W  VQ    G +F I+ C S   +Q+
Sbjct: 529 IKTAKQLRLIENPYILTLAALSPYSYFLRNRNGVWSWVQSNALGTEFKIKNCPSPSVVQE 588

Query: 570 CVRQYTRHGSETPLMFVYTKEGSIPDDDSVQKILEANTGCLQFLKDDQKLLNEMVMNESD 629
            ++  T++ SETPLMF+Y +EG IP ++ V K L+ NTGC +F KDD+  L  +  + +D
Sbjct: 589 AIKHGTKYASETPLMFIYCEEGKIPTEEEVSKALQNNTGCSKFAKDDENSLRTLRSHFND 648

Query: 630 D 630
           D
Sbjct: 649 D 649

>Smik_15.318 Chr15 complement(545721..547739) [2019 bp, 672 aa] {ON}
           YOR138C (REAL)
          Length = 672

 Score =  541 bits (1394), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 289/665 (43%), Positives = 407/665 (61%), Gaps = 69/665 (10%)

Query: 1   MNDNKNSVKSIVDMGIPEDVAIDALNRVNGDLEAAVNFIFSNELPDNNMGESVGNEKYTT 60
           M DN+ +VKS+++MGIP +VA++AL R  G+LEAAVNFIFSNELPD              
Sbjct: 1   MMDNQ-AVKSLLEMGIPHEVAVEALQRTGGNLEAAVNFIFSNELPDQG------------ 47

Query: 61  SEHVNISNDNNFQAGDLSE--VMNVSNYGYDNRFETD----------------------- 95
               ++S +NN +   +SE  +M  ++Y   N  E D                       
Sbjct: 48  ----SMSTENNVELPRISENRIMAGNSYDVPNNGEQDVDMPDVGGVDVDYDDDEDITDDR 103

Query: 96  SGDLSSDEV--SDPEIVENDIS-NNLKLPAYNIVKHEVEKTSLSDPTVVMPLPHNSIIES 152
           SG  S++E   +  E     +S  ++  P+YNIV+H   K+++ DPTVV+PLP NS+IES
Sbjct: 104 SGSNSTNEYRRAAQEYDHYSVSETSIPPPSYNIVQHNEFKSTMDDPTVVLPLPLNSLIES 163

Query: 153 YFGLFSMFISIYLPHLLLKPDFKDLNYDNEWYNGLKFVAPKFGIKVHNEESLKDDLHTSI 212
           YFGLF++ +S+Y PH+ LKPDF+DLN+  +W+ G  F  PK+ I         DD  T+ 
Sbjct: 164 YFGLFALLVSVYFPHVFLKPDFQDLNFRPDWFKGTSFTEPKYRIAYRE----ADDGSTTS 219

Query: 213 EPLTCVDRDLDDQPKLLWQLQKLSTIMNSTMSERSYVSSKLFSLCLDRNAKMKLQDAEHL 272
           + +       + QP LLWQLQKL +++N+ M ER++VS+KLF+L L+   K KL ++EHL
Sbjct: 220 DIVLASGPSDELQPHLLWQLQKLISVVNTRMCERAFVSAKLFTLSLEPQLKSKLANSEHL 279

Query: 273 YEVLPSFIKYLTSNLEMCPDFRPDEIRNELISSAYYLPSDDEPPVKTLLTLFHFLPDEYE 332
           YEVLP+FIK L  +LEMCP  R  E RN  ISSA + P+ +EPP++T L+LFHFLP+EY+
Sbjct: 280 YEVLPAFIKSLAVDLEMCPGIRDQETRNLFISSALHTPNKNEPPMETFLSLFHFLPEEYD 339

Query: 333 SNLYKMFNILLY--------------XXXXXXXXXXXXXNSLNYLAPNLTIIFDEIDELS 378
           SNLYKMFN+LLY                           N+L  +AP LTI+F+E++  +
Sbjct: 340 SNLYKMFNVLLYPEEEEEEEEVIRRGGTGQEEERYVEPENTLKEVAPVLTILFNELETNT 399

Query: 379 SMTPLPEGVSIPLEFYPQLYTKECKDQLIKHIIGKRQDAQKESRQHLKDLNSLKSFQGKD 438
               LP GV +PLEFYPQLYTK CKDQLI+HII KR+ A+  SR  L+++++LKS+QGK+
Sbjct: 400 ESVTLPNGVDMPLEFYPQLYTKRCKDQLIRHIISKRKQARVRSRYLLEEISALKSYQGKN 459

Query: 439 ILKFLNSTLDFLDRDGQRQNGLTEGNGKLMEGLTDIKEQLTKKKTEKMNAYKDLTQKLNT 498
               L STL +L      Q    + N +    +  +K+ L   ++ KM  YKDL  KL+ 
Sbjct: 460 TFTILESTLAYL------QESPDDANNEAASQIASLKDTLNSMRSAKMEEYKDLASKLHG 513

Query: 499 SWNLSNPEVSIIATAKKLGLIDEPYHLSMAVMSPNLYYIKKRDGTWYLVQITENGDDFDI 558
            WNLS+PE  II TAK+LGLI+ PY L+MA +SP  Y+I+ R+G W  +Q    G +F +
Sbjct: 514 EWNLSHPETHIINTAKQLGLIENPYVLTMAAISPYSYFIRNRNGVWSWIQSNTLGTEFKV 573

Query: 559 RKCSSGVEIQDCVRQYTRHGSETPLMFVYTKEGSIPDDDSVQKILEANTGCLQFLKDDQK 618
            KCSS   +Q+ +R  T++ SE PLMF+Y +EG IP ++ V+K L++N GC +F KDDQ 
Sbjct: 574 NKCSSASVVQEAIRHGTKYASEMPLMFIYCEEGKIPTEEVVEKALDSNNGCSKFAKDDQS 633

Query: 619 LLNEM 623
            L  +
Sbjct: 634 SLRTL 638

>YOR138C Chr15 complement(584309..586324) [2016 bp, 671 aa] {ON}
           RUP1Protein involved in regulation of Rsp5p, which is an
           essential HECT ubiquitin ligase; has a WW domain
           consensus motif of PPPSY (residues 131-135) that
           mediates binding of Rsp5p to Ubp2p; contains an UBA
           domain
          Length = 671

 Score =  533 bits (1374), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 287/648 (44%), Positives = 406/648 (62%), Gaps = 36/648 (5%)

Query: 1   MNDNKNSVKSIVDMGIPEDVAIDALNRVNGDLEAAVNFIFSNELPDN-NMGESVGNEKYT 59
           M DN+ +VKS+++MGIP +VA+DAL R  G+LEAAVNFIFSNELP+   MGE     +  
Sbjct: 1   MMDNQ-AVKSLLEMGIPHEVAVDALQRTGGNLEAAVNFIFSNELPEQAEMGEENDGSQPR 59

Query: 60  TSEHVNISN-------DNNFQAGDLSEVMNVSNYGYDNRF----ETDSGDLSSDEVSDPE 108
            SE+  ++        +N  Q  D+ +V  V     D+       + S   S   V+   
Sbjct: 60  ISENKIVAGTKPCDVPNNGDQDIDMPDVSGVDVDYDDDEDITDERSGSNSTSGCRVTAQN 119

Query: 109 IVENDIS-NNLKLPAYNIVKHEVEKTSLSDPTVVMPLPHNSIIESYFGLFSMFISIYLPH 167
                IS  ++  P+Y+IV+H   K+++ DPTVV+PLP NS+IESYFGLF++  ++Y PH
Sbjct: 120 YDRYSISETSIPPPSYSIVQHNEFKSNVGDPTVVLPLPLNSLIESYFGLFALLTAVYFPH 179

Query: 168 LLLKPDFKDLNYDNEWYNGLKFVAPKFGIKVHNEESLKDDLHTSIEPLTCVDRDLDDQPK 227
           + LKPDFKDLNY  +W+ G  F  PK+ +     E    D  T+ E +     +   QP 
Sbjct: 180 VFLKPDFKDLNYRADWFKGSSFTEPKYRLAYCEAE----DGSTTSEIVLASGPNEGLQPH 235

Query: 228 LLWQLQKLSTIMNSTMSERSYVSSKLFSLCLDRNAKMKLQDAEHLYEVLPSFIKYLTSNL 287
           LLWQLQKL +++N+   ER++VS+K+F+  L+   + KL D+EHLYEVLP+FIK L  +L
Sbjct: 236 LLWQLQKLISVVNTRKCERAFVSAKVFTSSLEPQLRSKLADSEHLYEVLPAFIKSLAVDL 295

Query: 288 EMCPDFRPDEIRNELISSAYYLPSDDEPPVKTLLTLFHFLPDEYESNLYKMFNILLY--- 344
           EMCP  R  E R+  ISSA + P+ +EPP++T L+LFHFLP+EY+SNLYKMFN+LLY   
Sbjct: 296 EMCPGIRDRETRSLFISSALHTPNKNEPPMETFLSLFHFLPEEYDSNLYKMFNVLLYPEE 355

Query: 345 ---------XXXXXXXXXXXXXNSLNYLAPNLTIIFDEIDELSSMTPLPEGVSIPLEFYP 395
                                 N+L  +AP LTI+F+E++  +    LP GV IPLEFYP
Sbjct: 356 EEEEEDVIRGGEQEEARYVEPENTLKEVAPVLTILFNELETNTESVSLPNGVDIPLEFYP 415

Query: 396 QLYTKECKDQLIKHIIGKRQDAQKESRQHLKDLNSLKSFQGKDILKFLNSTLDFLDRDGQ 455
           QLYTK+CKDQLI+HII KR+ A+  SR  L+++N LKS+QGK+I   L STL +L     
Sbjct: 416 QLYTKQCKDQLIRHIISKRKQARTRSRCLLQEINELKSYQGKNISTILESTLAYL----- 470

Query: 456 RQNGLTEGNGKLMEGLTDIKEQLTKKKTEKMNAYKDLTQKLNTSWNLSNPEVSIIATAKK 515
            Q    + N +  + +  +K+ L   +  KM  YKDL  KL+  WNLS+PE  II TAK+
Sbjct: 471 -QTIPDDANNEAAKQIASLKDTLNSARAAKMEEYKDLASKLHGEWNLSHPETHIINTAKQ 529

Query: 516 LGLIDEPYHLSMAVMSPNLYYIKKRDGTWYLVQITENGDDFDIRKCSSGVEIQDCVRQYT 575
           LGLI+ PY L+MA +SP  Y+I+ R+G W  +Q    G +F ++KCSS   +Q+ ++  T
Sbjct: 530 LGLIENPYILTMAALSPYSYFIRSRNGAWSWIQSNTLGTEFKVKKCSSPSVVQEAIKHGT 589

Query: 576 RHGSETPLMFVYTKEGSIPDDDSVQKILEANTGCLQFLKDDQKLLNEM 623
           ++ SETPLMF+Y +EG IP ++ V + L++N+GCL+F +DDQ  L  +
Sbjct: 590 KYASETPLMFIYCEEGKIPTEEVVAEALKSNSGCLKFAEDDQNSLKTL 637

>SAKL0G03564g Chr7 complement(294308..296125) [1818 bp, 605 aa] {ON}
           similar to uniprot|Q12242 Saccharomyces cerevisiae
           YOR138C RUP1
          Length = 605

 Score =  483 bits (1244), Expect = e-164,   Method: Compositional matrix adjust.
 Identities = 277/645 (42%), Positives = 402/645 (62%), Gaps = 58/645 (8%)

Query: 1   MNDNKNSVKSIVDMGIPEDVAIDALNRVNGDLEAAVNFIFSNELPDNNMGESVGNEKYTT 60
           M     S++ ++DMGI  +VA+DAL+R NGDLEA+VN+IFS EL               T
Sbjct: 1   MEQANQSIQPLLDMGISHEVAVDALSRTNGDLEASVNYIFSGEL-------------QAT 47

Query: 61  SEHVNISND-----NNFQAGDLSEVMNVSNYGYDNRFETDSGDLSSDEVSDPEIVENDIS 115
           +EHV+++ D     N  + G L++V+             ++ ++++ E  +   VEN I 
Sbjct: 48  TEHVDLTQDDSDSENGIKPGMLNDVI------------PNTDNVTTVETRE---VENTIP 92

Query: 116 NNLKLPAYNIVKHEVE--KTSLSDPTVVMPLPHNSIIESYFGLFSMFISIYLPHLLLKPD 173
           +++  P+  I+    +  K SL+DPTVV+PLP N+++E+YF LF + + I  PH  LKPD
Sbjct: 93  DDVLAPS-GIMDSTTQLLKDSLNDPTVVLPLPPNALLENYFALFCLSVGISFPHHFLKPD 151

Query: 174 FKDLNYDNEWYNGLKFVAPKFGIKVHNEESLKDDLHTSIEP---LTCVDRDLDDQPKLLW 230
           F+DLNY+  W+ G  +  P++ ++  +  ++      SI P   LT  D  L  QP+LLW
Sbjct: 152 FQDLNYNRNWFKGY-YSKPEYRLQFSSNNNV------SIVPKAQLTIQDS-LTLQPELLW 203

Query: 231 QLQKLSTIMNSTMSERSYVSSKLFSLCLDRNAKMKLQDAEHLYEVLPSFIKYLTSNLEMC 290
           Q QK   ++NS++S+R +VS+K+F   L+     KL   +HL+EVLPSFIK L +++EMC
Sbjct: 204 QFQKFIAVLNSSISDRKFVSAKIFHKVLEPLVLDKLGSCDHLFEVLPSFIKSLANDVEMC 263

Query: 291 ---PDFRPDEIRNELISSAYYLPSDDEPPVKTLLTLFHFLPDEYESNLYKMFNILLYXXX 347
               D R  +IR   IS+AY+ PS DE  ++TL++L HFLP+EY++NLY+MFN LLY   
Sbjct: 264 LLKEDAR--DIRGLFISTAYHKPSKDEKTIETLVSLLHFLPEEYDTNLYRMFNTLLYPEE 321

Query: 348 XXXXXXXXXXNSLNYLAPNLTIIFDEIDELSSMTPLPEGVSIPLEFYPQLYTKECKDQLI 407
                     NSL  LAP LT++FDE+DE +    L +GV +PL+FYPQ+YTK  KD LI
Sbjct: 322 DEDGEEVE--NSLGNLAPMLTVVFDEMDESTENVSLQQGVDVPLKFYPQIYTKSSKDSLI 379

Query: 408 KHIIGKRQDAQKESRQHLKDLNSLKSFQGKDILKFLNSTLDFLDRDGQRQNGLTEGNGKL 467
            H+I KR++AQ  S   L+DLN LKSFQGK I  FLNST+DF  +D   QN   +   +L
Sbjct: 380 NHVIAKRKEAQSASHAILQDLNGLKSFQGKHINSFLNSTVDFAAKDPLFQND--KDTEEL 437

Query: 468 MEGLTDIKEQLTKKKTEKMNAYKDLTQKLNTSWNLSNPEVSIIATAKKLGLIDEPYHLSM 527
           ++ L  IKEQ+T KKT KM  YK+++  ++  WNLS+P++ ++  AKK+GLIDEPY L+ 
Sbjct: 438 LKSLVSIKEQITTKKTNKMEEYKNISHMIHNKWNLSHPDLYVVDAAKKMGLIDEPYLLTS 497

Query: 528 AVMSPNLYYIKKRDGTWYLVQITENGDDFDIRKCSSGVEIQDCVRQYTRHGSETPLMFVY 587
           A++SP  YYI+KRDG WY V    NG D +    +   E+ + ++  TRH SETPLMF Y
Sbjct: 498 AILSPYHYYIRKRDGIWYRVISEANGSDLE-ASITEPHEVSESIKLATRHASETPLMFTY 556

Query: 588 TKEGSIPDDDSVQKILEANTGCLQFLKDDQKLLNEMVMNE-SDDV 631
            KE  I +++S++K LE N G  +F+K DQ  L  +  N+ SDD+
Sbjct: 557 CKESKIGNENSIRKSLEDNQGVSKFVKMDQTELEALQNNKVSDDI 601

>NCAS0H02270 Chr8 complement(445144..447234) [2091 bp, 696 aa] {ON}
           Anc_5.475 YOR138C
          Length = 696

 Score =  458 bits (1179), Expect = e-153,   Method: Compositional matrix adjust.
 Identities = 273/685 (39%), Positives = 385/685 (56%), Gaps = 73/685 (10%)

Query: 3   DNKNSVKSIVDMGIPEDVAIDALNRVNGDLEAAVNFIFSNELPDNNMGES---------- 52
           +N  +VK++++MGIP +VA+DAL R  G+LE AV FIFSNELP     +           
Sbjct: 2   ENNETVKTLLEMGIPREVAVDALMRTGGNLEDAVAFIFSNELPQTEQEQPYIPININDQD 61

Query: 53  -------VGNEKYTTS---EHVNISND-----NNFQAGDLSEVMNVSN------------ 85
                  + N+ Y +S     V  SN+     NN+   +  E   V              
Sbjct: 62  PLPSEQDLANQDYRSSNTPSSVPGSNNPFRESNNYLGDEYVEGQEVQRELIDVDSSDDED 121

Query: 86  ----YGYDNRFETDSGDLSSDEVSDPEI-----VENDISNNLKLPAYNIVKHEVEKTSLS 136
                G D  + ++S  +S    + PE        N +S  +  P YN+V     K  L 
Sbjct: 122 EDEDDGMDG-YRSESRSISQQNGNVPESFHIESATNSMSQEMIPPKYNLVAKGPLKDELD 180

Query: 137 DPTVVMPLPHNSIIESYFGLFSMFISIYLPHLLLKPDFKDLNYDNEWYNGLKFVAPKFGI 196
            PT+++PLP NS+IE+Y  LF++   I +P   LK DFKDLNY+  WY G  F  PKF +
Sbjct: 181 QPTIILPLPLNSMIENYLSLFALNAVINIPQFFLKTDFKDLNYNKNWYKGTSFEMPKFIL 240

Query: 197 KVH--------NEESLKDDLH---TSIEPLTCVDRDLDDQPKLLWQLQKLSTIMNSTMSE 245
           +          NE + + D +     I P+   D+    QP LLWQLQKL+ I + +MSE
Sbjct: 241 EFDSSNDTTTINENAERGDQYRKAVDIIPIGTSDKVEKQQPFLLWQLQKLAAINSFSMSE 300

Query: 246 RSYVSSKLFSLCLDRNAKMKLQDAEHLYEVLPSFIKYLTSNLEMCPDFRPDEIRNEL-IS 304
           R+Y S+++FSL  +   +  L  +++L +VLP FIK +T++L++CP    DE   +L I+
Sbjct: 301 RAYASARIFSLVFNGQVRSVLSKSDNLIDVLPLFIKSITTDLQLCPSNSDDESPQDLFIT 360

Query: 305 SAYYLPSDDEPPVKTLLTLFHFLPDEYESNLYKMFNILLY------XXXXXXXXXXXXXN 358
           SA++LP   +  V+T L  FHF+P+EY  NLYKMFN+LLY                   N
Sbjct: 361 SAFHLPEKSQSLVETKLAFFHFMPEEYNENLYKMFNVLLYPDDPSENNEDNGEQEEVYNN 420

Query: 359 SLNYLAPNLTIIFDEIDELSSMTPLPEGVSIPLEFYPQLYTKECKDQLIKHIIGKRQDAQ 418
           SLN  A  +T+IF+E D  +       GV IPL FYPQLY K+CKDQLIKHI+ KR+ A 
Sbjct: 421 SLNKAAHIITVIFNEADAYTPEMTSNSGVEIPLTFYPQLYFKKCKDQLIKHILEKRRQAL 480

Query: 419 KESRQHLKDLNSLKSFQGKDILKFLNSTLDFLDRDGQRQNGLTEGNGK-LMEGLTDIKEQ 477
             S+Q L ++  LKSF+GKDI   L S  ++L ++   +N +    GK L E +T I+  
Sbjct: 481 ARSKQLLDEIRQLKSFEGKDISMTLESAKEYLQKE---ENPM----GKNLHETITKIEMM 533

Query: 478 LTKKKTEKMNAYKDLTQKLNTSWNLSNPEVSIIATAKKLGLIDEPYHLSMAVMSPNLYYI 537
           + +KK  KM  YK L+ +L+  WNLS+PE+ II TAK LGLIDEPY L+  ++SP LYYI
Sbjct: 534 IAEKKNSKMEEYKILSSQLHKDWNLSHPELQIIETAKTLGLIDEPYLLTTVIISPYLYYI 593

Query: 538 KKRDGTWYLVQITENGDDFDIRKCSSGVEIQDCVRQYTRHGSETPLMFVYTKEGSIPDDD 597
           +K+DG WY VQ    G DF + +  SG  +Q+ ++  T   +ETPLMF++ +E  IPD+D
Sbjct: 594 RKKDGIWYSVQCNTLGTDFQVSQLESGAAVQEIIKAQTSRPNETPLMFLFCRESIIPDED 653

Query: 598 SVQKILEANTGCLQFLKDDQKLLNE 622
           +V+K +E N GCLQF K DQ  L E
Sbjct: 654 TVRKAMEENLGCLQFAKQDQLSLEE 678

>KAFR0E02540 Chr5 (519567..521546) [1980 bp, 659 aa] {ON} Anc_5.475
           YOR138C
          Length = 659

 Score =  455 bits (1170), Expect = e-152,   Method: Compositional matrix adjust.
 Identities = 265/662 (40%), Positives = 394/662 (59%), Gaps = 53/662 (8%)

Query: 1   MNDNKNSVKSIVDMGIPEDVAIDALNRVNGDLEAAVNFIFSNELP-DNNMGESVGNEKYT 59
           MN  ++S+ S+++MGI ++VAIDAL + +G+LEAA+N+IFSN++  ++       N    
Sbjct: 1   MNGEESSLNSLLEMGISKNVAIDALQKFDGNLEAAINYIFSNDMSMESIQTHPQPNNNPF 60

Query: 60  TSEHVNISNDNNFQAGDLSEVMNVSNYGYDNR--FETDSGDLSSDEVSDP-EIVENDIS- 115
             EH    +D+ F+ GDL  V+     G D +   +  S D     + +P + V  +   
Sbjct: 61  LEEHTVELSDSKFKPGDLDTVI-TPRAGGDEKDLIQLSSSDEEEGSLQNPDQTVAGETEK 119

Query: 116 ----------------------NNLKL--------PAYNIVKHEVEKTSLSDPTVVMPLP 145
                                 N L++        P Y+ V+H   K+ ++DPT+V+PLP
Sbjct: 120 VNIPIDSQSSSYSSFSTSLSNENELRMSENTYNNPPEYSTVQHSERKSDIADPTIVLPLP 179

Query: 146 HNSIIESYFGLFSMFISIYLPHLLLKPDFKDLNYDNEWYNGLKFVAPKFGIKVHNEESLK 205
            NS+IE+Y  L+++ I+ +     LKPDFKDLNY  EWY       P + +K +  +  +
Sbjct: 180 PNSLIENYLALYALSIANFFAIDFLKPDFKDLNYRKEWYRSSSIDEPFYRVKFNKADETE 239

Query: 206 DDLHTSIEPLTCVDRDLDDQPKLLWQLQKLSTIMNSTMSERSYVSSKLFSLCLDRNAKMK 265
           +++  + E LT  D     QPKLLWQLQKL  ++NS +SER+YVS+K+F+   ++  + K
Sbjct: 240 NEIVPAAE-LTETDHP---QPKLLWQLQKLIAVVNSDLSERAYVSAKIFNSSSNQQLQSK 295

Query: 266 LQDAEHLYEVLPSFIKYLTSNLEMCPDFRPDEIRNELISSAYYLPSDDEPPVKTLLTLFH 325
           L DAEHL EVLP FIK L  +LE C   +  +I+   ISSA+Y PS +EP  +T L+ FH
Sbjct: 296 LGDAEHLNEVLPYFIKALAVDLESCYGDKSSDIKKLFISSAFYKPSQNEPLQETYLSFFH 355

Query: 326 FLPDEYESNLYKMFNILLY----XXXXXXXXXXXXXNSLNYLAPNLTIIFDEIDELS--S 379
           FLP+EY++NLYKMFN+LL                  NSLN ++P LTI+F+E+DE +  +
Sbjct: 356 FLPEEYDTNLYKMFNVLLIPDEDDEESGESDEDQPDNSLNIISPFLTIVFNEMDESTDDN 415

Query: 380 MTPLP--EGVSIPLEFYPQLYTKECKDQLIKHIIGKRQDAQKESRQHLKDLNSLKSFQGK 437
           MT     +GV IP EFYPQLYTK+CKD+LIKHI+ KR++++ + +  L+++N+LKS+ GK
Sbjct: 416 MTTSASFQGVDIPFEFYPQLYTKKCKDELIKHILSKRKESKSKLKVILQEINALKSYHGK 475

Query: 438 DILKFLNSTLDFLDRDGQRQNGLTEGNGKLMEGLTDIKEQLTKKKTEKMNAYKDLTQKLN 497
           DIL FLNST+DFL +D    N  +  + ++ + L D++ Q+  +K    + YK+L+QKL+
Sbjct: 476 DILMFLNSTIDFLQKDS---NAESTDHLEVAQELNDLRAQINGRKAGLKDEYKELSQKLH 532

Query: 498 TSWNLSNPEVSIIATAKKLGLIDEPYHLSMAVMSPNLYYIKKRDGT--WYLVQITENGDD 555
             WNLS P++ II TAK LGLID PY L+  V+SP  Y+++ R     W LVQ    G D
Sbjct: 533 NEWNLSYPDLHIIQTAKTLGLIDTPYLLTTVVISPYFYFMRDRKKVDQWCLVQSNGLGTD 592

Query: 556 FDIRKCSSGVEIQDCVRQYTRHGSETPLMFVYTKEGSIPDDDSVQKILEANTGCLQFLKD 615
           F I        +   ++QYT+  +E+PLMF+Y KE  I   D + K++E N GC  F+K 
Sbjct: 593 FHITNFLDKENVSTTIKQYTKVPNESPLMFIYCKENYIASQDDIWKLIEENEGCSSFIKA 652

Query: 616 DQ 617
           DQ
Sbjct: 653 DQ 654

>Kwal_55.21267 s55 (757685..759499) [1815 bp, 604 aa] {ON} YOR138C -
           Hypothetical ORF [contig 130] FULL
          Length = 604

 Score =  429 bits (1102), Expect = e-142,   Method: Compositional matrix adjust.
 Identities = 250/620 (40%), Positives = 363/620 (58%), Gaps = 34/620 (5%)

Query: 4   NKNSVKSIVDMGIPEDVAIDALNRVNGDLEAAVNFIFSNELPDNNMGESVGNEKYTTSEH 63
           +++++KS++DMGI  DVAI+AL++ NGD+E +VN+IFS ELP            +  +E 
Sbjct: 2   SESAIKSLLDMGITRDVAIEALSKTNGDVENSVNYIFSGELPQQGPESKPLQPLHADAEQ 61

Query: 64  VNISNDNNFQAGDLSEVMNVSNYGYDNRFETDSGDLSSDEVSDPEIVENDISNNLKLPAY 123
                ++   +  L                T+   +S+  + +PE    D + + +  A 
Sbjct: 62  GPQKEEDREDSALLEH--------------TEYASVSNGPLEEPERY-RDYTLSTQEEAA 106

Query: 124 NIVKHEVEKTSLSDPTVVMPLPHNSIIESYFGLFSMFISIYLPHLLLKPDFKDLNYDNEW 183
           N VK++ E     DP VV P   N++ E+YF LF + + +  PH  L PDFKDLNY  +W
Sbjct: 107 NEVKNDQE-----DPLVVKPESSNALFENYFALFCLAVGLGFPHYFLGPDFKDLNYGPDW 161

Query: 184 YNGLKFVAPKFGIKVHNEESLKDDLHTSIEPLTCVDRDLDDQPKLLWQLQKLSTIMNSTM 243
             G +F+ P+F IK    E   D      E LT  D +L  QP+LLWQ QK   + +S  
Sbjct: 162 ARG-QFLKPQFRIKFETNE---DVTIVPRETLTSQD-NLTLQPELLWQFQKFLAVQHSPS 216

Query: 244 SERSYVSSKLFSLCLDRNAKMKLQDAEHLYEVLPSFIKYLTSNLEMCPDFRPDEIRNELI 303
           S R  VS++  +  L+     KL +AEHL++VLPSFI+ L +++E+CP  +   I+   I
Sbjct: 217 SYRKQVSARYLTKALEPQVVEKLNNAEHLHDVLPSFIRSLANDVELCPGSQ--SIKELFI 274

Query: 304 SSAYYLPSDDEPPVKTLLTLFHFLPDEYESNLYKMFNILLY-XXXXXXXXXXXXXNSLNY 362
           S+AYY P+ +  P++TL++L HF+P+EY+SN+YKMFN LLY              NSL  
Sbjct: 275 STAYYKPASEPVPIETLVSLLHFMPEEYDSNIYKMFNALLYPNDADDDDDVEETQNSLGN 334

Query: 363 LAPNLTIIFDEIDELSSMTPLPEGVSIPLEFYPQLYTKECKDQLIKHIIGKRQDAQKESR 422
           LA  +TI+FDE+DE +    LP GV +P++FYPQLYT++ K  LIK +     + Q+ + 
Sbjct: 335 LASMITIVFDEMDESTDDIRLPHGVEVPMKFYPQLYTEDAKQSLIKDVTKHAGEGQQRAH 394

Query: 423 QHLKDLNSLKSFQGKDILKFLNSTLDFLDRDGQRQNGLTEGN--GKLMEGLTDIKEQLTK 480
             LK LN LKSFQGK I  FLNSTLDF+ RD    + +TE      L++ L  IK+ L+K
Sbjct: 395 SILKTLNELKSFQGKHIHSFLNSTLDFIARDS---SAVTENPQINDLVDTLQHIKQDLSK 451

Query: 481 KKTEKMNAYKDLTQKLNTSWNLSNPEVSIIATAKKLGLIDEPYHLSMAVMSPNLYYIKKR 540
           KKT+ M  YK ++ KLN  WNLS+PE+ II   +KLGLIDEPY L+ AV+SP  Y+I+KR
Sbjct: 452 KKTDGMAEYKAISHKLNNDWNLSHPELGIIEQGEKLGLIDEPYILTTAVISPFNYFIRKR 511

Query: 541 DGTWYLVQITENGDDFDIRKCSSGVEIQDCVRQYTRHGSETPLMFVYTKEGSIPDDDSVQ 600
           D  WY V   ++ D  ++ K  +   + + +R  TR  SETPLMF Y KE +I  ++++ 
Sbjct: 512 DSQWYHVLGKQHNDALNVAKTDAET-VTNTIRLNTRTASETPLMFTYFKESAIDTNETLT 570

Query: 601 KILEANTGCLQFLKDDQKLL 620
           + +E NTG   F + DQ  L
Sbjct: 571 EAIEKNTGVTSFAEQDQSSL 590

>KLTH0F15004g Chr6 (1228654..1230447) [1794 bp, 597 aa] {ON} weakly
           similar to uniprot|Q12242 Saccharomyces cerevisiae
           YOR138C RUP1
          Length = 597

 Score =  427 bits (1097), Expect = e-142,   Method: Compositional matrix adjust.
 Identities = 246/638 (38%), Positives = 365/638 (57%), Gaps = 55/638 (8%)

Query: 4   NKNSVKSIVDMGIPEDVAIDALNRVNGDLEAAVNFIFSNELPDNNMGESVG-----NEKY 58
           ++N+++S++DMGI  +VAI+AL + NGD+E +VN+IFS ELP      +        EK 
Sbjct: 2   SENAIQSLLDMGITREVAIEALAKTNGDVENSVNYIFSGELPQQGPPPAPEETPEDREKE 61

Query: 59  TTSEHVNISNDNNFQAGDLSEVMNVSNYGYDNRFETDSGDLSSDEVSDPEIVENDISNNL 118
             SE     N    +    SE               ++ D     VS  E +   + N  
Sbjct: 62  PESESELPENPEFIEEAPPSE--------------DEATDQQGVAVSPREQIACQLKNRP 107

Query: 119 KLPAYNIVKHEVEKTSLSDPTVVMPLPHNSIIESYFGLFSMFISIYLPHLLLKPDFKDLN 178
           +                 DP VV P   N++ E+YF LF + + +  PH  L+PDF+DL 
Sbjct: 108 E-----------------DPLVVRPASGNALFENYFALFCLAVGLGFPHHFLEPDFQDLT 150

Query: 179 YDNEWYNGLKFVAPKFGIKVHNEESLKDDLHTSIEP---LTCVDRDLDDQPKLLWQLQKL 235
           Y  +WY G +F+ P + +K  N     DD+  SI P   LT  D +L  QP+LLWQ QK 
Sbjct: 151 YGQDWYKG-QFLKPAYRVKFEN----NDDV--SIVPQETLTSQD-NLILQPELLWQFQKF 202

Query: 236 STIMNSTMSERSYVSSKLFSLCLDRNAKMKLQDAEHLYEVLPSFIKYLTSNLEMCPDFRP 295
             + NS    R YV+++  +  L+     KL +++HL+E LPSFIK L +++E+CP    
Sbjct: 203 LAVQNSPQCRRKYVTARYLTKVLEPQVVEKLNNSDHLHEALPSFIKSLANDVELCPGAH- 261

Query: 296 DEIRNELISSAYYLPSDDEPPVKTLLTLFHFLPDEYESNLYKMFNILLYXXXXXXXXXXX 355
             ++   IS+AYY P  +  P++TL++L HF+P+EY++N+YKMFN LLY           
Sbjct: 262 -SVKELFISTAYYKPVSEPEPIETLVSLLHFMPEEYDTNIYKMFNALLYPDSNEDAEMDD 320

Query: 356 XXNSLNYLAPNLTIIFDEIDELSSMTPLPEGVSIPLEFYPQLYTKECKDQLIKHIIGKRQ 415
             NSL  LAP +TI+FDE+DE +    LP GV +PLEFYPQLYT+E K+ LIK +     
Sbjct: 321 IQNSLGNLAPMITIVFDEMDESTEQATLPHGVDVPLEFYPQLYTEEAKNLLIKEVTKLSA 380

Query: 416 DAQKESRQHLKDLNSLKSFQGKDILKFLNSTLDFLDRDGQRQNGLTEGNG--KLMEGLTD 473
           D+Q ++R  L++LN LKSFQGK I  FLNS LDF+ +D    +G++E +G  +L++ L +
Sbjct: 381 DSQTQARSILRNLNDLKSFQGKQIHSFLNSALDFITKD---MSGVSEQSGVQELVDSLQE 437

Query: 474 IKEQLTKKKTEKMNAYKDLTQKLNTSWNLSNPEVSIIATAKKLGLIDEPYHLSMAVMSPN 533
           +K+QL  KKTEKM  YK ++ +LN   NLS+PE+ II  AK LGLIDEPY L+ AV+S +
Sbjct: 438 VKQQLGSKKTEKMAQYKAVSHRLNNELNLSHPELGIIQRAKDLGLIDEPYLLTSAVISAS 497

Query: 534 LYYIKKRDGTWYLVQITENGDDFDIRKCSSGVEIQDCVRQYTRHGSETPLMFVYTKEGSI 593
            Y+I++ +G W+ V    N +  D+ K  +   +   +R +TR  SE+PLMF Y K  +I
Sbjct: 498 NYFIRQNNGQWFHVVGRSNSEHMDVTKTDAST-VSSAIRFHTRCASESPLMFTYFKPSAI 556

Query: 594 PDDDSVQKILEANTGCLQFLKDDQKLLNEMVMNESDDV 631
             +  V++ +  N G   F + DQK +N +   + +D+
Sbjct: 557 DTEAQVKEAVGHNKGAKLFAEQDQKHINTLSAPDEEDL 594

>NDAI0C01390 Chr3 (290301..292430) [2130 bp, 709 aa] {ON} Anc_5.475
           YOR138C
          Length = 709

 Score =  424 bits (1089), Expect = e-139,   Method: Compositional matrix adjust.
 Identities = 266/711 (37%), Positives = 387/711 (54%), Gaps = 93/711 (13%)

Query: 3   DNKNSVKSIVDMGIPEDVAIDALNRVNGDLEAAVNFIFSNELP-----------DNNMG- 50
           ++ +SV S+++MGIP +VA++AL R NG+LEAAV FIFSNE+P           DN+ G 
Sbjct: 2   ESNDSVSSLMEMGIPREVAVNALIRANGNLEAAVAFIFSNEIPPENNETSTVANDNDTGQ 61

Query: 51  ----------ESVGNEKYTT----SEHVNISNDNNF---QAGDLSEVMNVSN-------Y 86
                     E+ G + Y T     EH  + ++ N    Q+ +  E +  SN       +
Sbjct: 62  QEPSQLPPRSEASGADPYQTHSPTPEHYYMKDERNAPSSQSYEQQEYIPTSNQENVTSQH 121

Query: 87  GYDNRFETDSGD--LSSDEVSDPEIVENDISNNLKLPAYNIVKHEVEKTSLSDPTVVMPL 144
           G D     D GD    +DE +      +  S     P YN+V +   K  ++DPT+++P+
Sbjct: 122 GED---RDDDGDNIQENDESTFSSSSTSSQSPAPSPPNYNVVTYTQLKARVTDPTIILPV 178

Query: 145 PHNSIIESYFGLFSMFISIYLPHLLLKPDFKDLNYDNEWYNGLKFVAPKFGIKVHNEESL 204
           P NS++E+Y  L  + I+I +P   L+PDFKDLNY+N+WY G     P +G+K+ N+   
Sbjct: 179 PMNSLLENYLALIMLAIAINIPTPFLRPDFKDLNYENDWYKGNSLSIPNYGLKIQNDHDA 238

Query: 205 KDDLHTSIEPLTCVD--------RDLDDQPKLLWQLQKLSTIMNSTMSERSYVSSKLFSL 256
            D+  +       +D        R+ D QPKLLWQLQKL +++NST+SERSY+S+K+FSL
Sbjct: 239 DDEGVSEPSDTNILDGEGEKNNQRNDDIQPKLLWQLQKLISVVNSTLSERSYISTKVFSL 298

Query: 257 CLDRNAKMKLQDAEHLYEVLPSFIKYLTSNLEMCPDF----------------------R 294
            L  + +  L + E+L +VLP F K L + +E C                          
Sbjct: 299 GLTPDVRYTLANYENLADVLPVFYKSLATEMEKCVAIFGSDITENDKVDNADNDNNNGNS 358

Query: 295 PDEIRNEL----ISSAYYLPSDDEPPVKTLLTLFHFLPDEYESNLYKMFNILLY------ 344
            + +R E+    +S+A Y  +     +KT +T   F P+EYESNLYKMFN LL+      
Sbjct: 359 EERMRGEMESLFVSTASYEDAATGERLKTPVTTLSFSPEEYESNLYKMFNTLLFPEIDNP 418

Query: 345 XXXXXXXXXXXXXNSLNYLAPNLTIIFDEIDELSSMTPLPEGVSIPLEFYPQLYTKECKD 404
                          L+Y+AP  T++F  +D  +    LP GV +P+EFYPQLYT  C+D
Sbjct: 419 SKTAVSEGDVPGTGCLDYIAPIFTVVFHAMDSTTDEVDLPGGVDMPMEFYPQLYTSTCRD 478

Query: 405 QLIKHIIGKRQDAQKESRQHLKDLNSLKSFQGKDILKFLNSTLDFLDRD-GQRQNGLTEG 463
            L++ +  +R++A + S++ L+  N L+SFQGKDI  FL ST+D+L +D G     L E 
Sbjct: 479 ALVRDVFPRRKEAHRLSKELLQKFNQLRSFQGKDITMFLKSTMDYLTKDCGSETKALEE- 537

Query: 464 NGKLMEGLTDIKEQLTKKKTEKMNAYKDLTQKLNTSWNLSNPEVSIIATAKKLGLI-DEP 522
             K++E L      +   K   M  YK L+  L    N+S+PEVSII  AK   LI DEP
Sbjct: 538 -MKILETL------INNAKNTIMEDYKALSADLQGPLNVSHPEVSIIDQAKASNLIDDEP 590

Query: 523 YHLSMAVMSPNLYYIKKRDGTWYLVQITENGDDFDIRKCSSGVEIQDCVRQYTRHGSETP 582
           Y L+MAV+SP  Y+I+ R G WYLV+      +F I +C S   +Q  ++Q T H +E P
Sbjct: 591 YLLTMAVISPLAYFIRNRQGKWYLVRFNMISTEFQITECESIRNVQTAIKQCTIHANEEP 650

Query: 583 LMFVYTKEGSIPDDDSVQKILEANTGCLQFLKDDQKLLNEMVMN--ESDDV 631
           LMF+Y ++ +I DD  +QK LE N GCLQF KDDQ  L+ +      SDD+
Sbjct: 651 LMFIYCRKSAILDDLIIQKYLEDNKGCLQFSKDDQIALDVLRQQIFSSDDI 701

>TBLA0A02540 Chr1 (613560..615596) [2037 bp, 678 aa] {ON} Anc_5.475
           YOR138C
          Length = 678

 Score =  422 bits (1086), Expect = e-139,   Method: Compositional matrix adjust.
 Identities = 251/688 (36%), Positives = 380/688 (55%), Gaps = 89/688 (12%)

Query: 14  MGIPEDVAIDALNRVNGDLEAAVNFIFSNELPDNNMGESVGNEKYTTSE----------- 62
           MGI +DVA   LN+V G+LEAA+N IF  + PD    E++      T++           
Sbjct: 1   MGIAKDVATSTLNKVGGNLEAAINHIFL-DTPDTQEREAISTSDLLTAQKTISSNNYNND 59

Query: 63  ---------------HVNISNDNNFQAGD-----------LSEVMNVSNYGYDNRFETDS 96
                          H+ +S  N+ +              +S   N +N         +S
Sbjct: 60  NSNSSFDSDSQATSCHIELSRKNSRKVNSNTSNLPSNTFIISGGSNSNNILSRENLSENS 119

Query: 97  GDLSSDE----------------VSDPEIVENDISNNLKLP-AYNIVKHEVEKTSLSDPT 139
            D S D                   D  +  ND S  + +P  Y+   ++V+K+   DPT
Sbjct: 120 SDSSIDSKEEYQPLYLTDTQPPTYQDFTMTSNDNSQQIFVPPVYSKGTYKVQKSLPDDPT 179

Query: 140 VVMPLPHNSIIESYFGLFSMFISIYLPHLLLKPDFKDLNYDNEWYNGLKFVAPKFGIK-V 198
           V++ L  + ++ +YFGLFSM ++++ P L + PDF +LN+++ W  GL+   P++ +K  
Sbjct: 180 VLLSLEPSKLLSNYFGLFSMSLALFAPDLFMGPDFVNLNFNDNWNKGLQIDTPEYEVKYT 239

Query: 199 HNEESLKDDLHTSIEPLTCV-----DRDLDDQPKLLWQLQKLSTIMNSTMSERSYVSSKL 253
           HN   L+  L   IE +  +     +R+L  QP +LWQLQK+ +IMNS +S R+Y+SS +
Sbjct: 240 HN---LEPGLEDRIEIVNAINLSEKERELTYQPYILWQLQKVISIMNSQISSRAYISSGI 296

Query: 254 FSLCLDRNAKMKLQDAEHLYEVLPSFIKYLTSNLEMCPDFRPDEIRNELISSAYYLPSDD 313
           +SLCLD N + KL +  HLY++LP+FI+ L ++ +  PD   + ++N  +S A++     
Sbjct: 297 YSLCLDDNTQKKLMETSHLYDILPTFIRSLMNDCKHVPDLDQNRMKNMFVSKAFHQIPIH 356

Query: 314 EPPVKTLLTLFHFLPDEYESNLYKMFNILLYXXXXXXXXXXXXXN--------------- 358
           + P K  L LFHFLP+EY+SNLYKMFN LLY             N               
Sbjct: 357 KEPTKVSLFLFHFLPEEYDSNLYKMFNSLLYRSYDEPIYPRTNQNSADSSSSDDEISNEE 416

Query: 359 --SLNYLAPNLTIIFDEIDELSSMTPLPEGVSIPLEFYPQLYTKECKDQLIKHIIGKRQD 416
             SL+ ++  LT+IFDE+D+ + +   P+GV IP EFYP+LYTK+CK++LI  I+  R  
Sbjct: 417 ESSLDEISTILTVIFDELDQDTELITQPDGVEIPFEFYPELYTKKCKEKLINGILHTRYQ 476

Query: 417 AQKESRQHLKDLNSLKSFQGKDILKFLNSTLDFLDRDGQRQNGLTEGNGKLMEGLTDIKE 476
            + + ++ L DLNSLKSF+GKDIL+FLNSTL++L RDG+         G ++  L+ +KE
Sbjct: 477 NKLKMKEVLNDLNSLKSFEGKDILRFLNSTLEYLQRDGKE--------GPMVNKLSYVKE 528

Query: 477 QLTKKKTEKMNAYKDLTQKLNTSWNLSNPEVSIIATAKKLGLIDEPYHLSMAVMSPNLYY 536
           QL++ KTEKM  YK +++ L   WN+  PE+SII  A+ LGLI +P+ L MAV+SP LY+
Sbjct: 529 QLSRAKTEKMLEYKTISRSLQNEWNIDKPELSIIEQAQDLGLIGDPHLLVMAVLSPYLYF 588

Query: 537 IKKRDGTWYLVQITENGDDFDIRKCSSGVEIQDCVRQYTRHGSETPLMFVYTKEGSIPDD 596
            + R   W+  Q +  G DF+I K  S   +QD ++  T+  SETP+MFVY K+ +IP+D
Sbjct: 589 FRDRRNRWFKFQSSIMGTDFEITKYESDKTVQDEIKLNTKSASETPIMFVYCKKDAIPND 648

Query: 597 DSVQKILEANTGCLQFLKDDQKLLNEMV 624
             V +    N GC  F + D+  L + V
Sbjct: 649 SLVLQKFAKNQGCSAFAQADEMSLKKNV 676

>TBLA0B02230 Chr2 (521358..523730) [2373 bp, 790 aa] {ON} Anc_5.475
           YOR138C
          Length = 790

 Score =  402 bits (1032), Expect = e-130,   Method: Compositional matrix adjust.
 Identities = 261/714 (36%), Positives = 383/714 (53%), Gaps = 135/714 (18%)

Query: 3   DNKNSVKSIVDMGIPEDVAIDALNRVNGDLEAAVNFIFSNELP----------------- 45
           +++  +++++DMGIP DVA +AL   NG++EAAVN+IFSNELP                 
Sbjct: 2   EDQEKIQTLIDMGIPPDVANNALRAANGNVEAAVNYIFSNELPPQASQMPELPPRIDENS 61

Query: 46  DNNMGESVGNEKYTTSEHVNISNDNNFQAGDLSEVMNVSNYGYDNRFETDSGD------- 98
           DNN   +V N+   T   + IS  N FQ GDL++ +   N       ++ S +       
Sbjct: 62  DNNTNTNVYNDN--TGNTIPISGSNGFQPGDLNKYLTDKNNAIVQDTDSTSHNATINTSF 119

Query: 99  ---------------------LSSDEV-------SDPEIVENDISNNLKLPAYNIVKHEV 130
                                +S  ++       S  E+  +  S + K  A     H++
Sbjct: 120 INNTTTTTSNSNSNSNPNTNYMSESDIDIDMMTSSTRELSTDIRSQSFKPQASYTSTHKL 179

Query: 131 EKTSLSDPTVVMPLPHNSIIESYFGLFSMFISIYLP-HLLLKPDFKDLNYDNEWYNGLKF 189
           +   +SDPTV++PL  N ++E+Y  LF   + +  P  +     F DL Y+ +WY     
Sbjct: 180 Q---ISDPTVLLPLSQNCLLENYLSLFLYSLCMLCPLQIFETQQFNDLMYNKKWY----- 231

Query: 190 VAPKFGIKVHNEESLKDDLHTSIEPLTCVDRDLDDQPKLLWQLQKLSTIMNSTMSERSYV 249
                 I  +NE +  D                     L  QLQ++++I+NS MSER+++
Sbjct: 232 -----SISNNNENTTTD--------------------SLFLQLQRVTSIINSRMSERAFI 266

Query: 250 SSKLFSLCLDRNAKMKLQDAEHLYEVLPSFIKYLTSNLEMCPDFRPDEIRNELISSAYYL 309
           S+K+FS   +++    L  ++HL E+   FI+ L + +       P   ++ L+++A   
Sbjct: 267 STKMFSFAFNKDLNYLLSQSDHLNEIFNPFIESLVTTV------LPPIFKDILVTTAINK 320

Query: 310 PSDDEPPVKTLLTLFHFLPDEYESNLYKMFNILLYXXXXXXXXXXXXXNSLNY------- 362
            S      ++ +++ +FLP+EYESNLYKMFN L+Y              SL         
Sbjct: 321 DSQTNEIFRSPISMINFLPEEYESNLYKMFNNLVYPNEYGRNDDEQSDESLQTDDDDNDD 380

Query: 363 --------LAPNLTIIFDEIDEL-SSMTPLPEGVSIPLEFYPQLYTKECKDQLIKHIIGK 413
                   ++P  TI+F+E DE  SS T LPEGV IPL+FYPQLY+K+  DQLIKHII K
Sbjct: 381 ANDSALEEISPIFTILFEEYDESDSSSTTLPEGVEIPLQFYPQLYSKKVNDQLIKHIISK 440

Query: 414 RQDAQKESRQHLKDLNSLKSFQGKDILKFLNSTLDFLDRDGQRQNGLTEGNGKLMEGLTD 473
           R++AQ +SR  L ++NSLKSFQGKDI+K L ST+D++++D QR+        K    LT+
Sbjct: 441 RKEAQSKSRSLLNEINSLKSFQGKDIMKILQSTIDYIEKDSQRE-------TKSANNLTN 493

Query: 474 IKEQLTKKKTEKMNAYKDLTQKLNTSWNLSNPEVSIIATAKKLGLIDEPYHLSMAVMSPN 533
           I  ++   K  KM+ YK+LT+KL++ WNLS+PE SII TAK+L LID PY+LSM + SP+
Sbjct: 494 ILTEMKNCKNLKMDQYKELTRKLHSEWNLSHPEGSIIETAKQLNLIDSPYNLSMVIFSPD 553

Query: 534 LYYIKKRDGTWYLVQI----------------TENGDDFDIRKCSSGVEIQDCVRQYTRH 577
           LY IKK +  WYL+                    N D F +RKC+S +EIQD ++Q TR+
Sbjct: 554 LYLIKKANVDWYLIDCRSINQMQNKNRNNNNNNNNPDLFVLRKCNSEIEIQDIIKQKTRN 613

Query: 578 GSETPLMFVYTKEGSIPDDDSVQKILEANTGCLQFLKDDQKLLNEMVMN--ESD 629
            SETPLMF+Y KE  +P++D V K  E+N  C +FLK+DQ  LNE  MN  ESD
Sbjct: 614 PSETPLMFIYCKESFLPNEDDVMKSFESNMACTKFLKEDQLTLNESNMNSGESD 667

>ZYRO0D11264g Chr4 complement(948942..950585) [1644 bp, 547 aa] {ON}
           similar to uniprot|Q12242 Saccharomyces cerevisiae
           YOR138C RUP1
          Length = 547

 Score =  382 bits (980), Expect = e-125,   Method: Compositional matrix adjust.
 Identities = 243/620 (39%), Positives = 348/620 (56%), Gaps = 78/620 (12%)

Query: 6   NSVKSIVDMGIPEDVAIDALNRVNGDLEAAVNFIFSNELPDNNMGESVGNEKYTTSEHVN 65
           N+ +S+++MGI  +VA  AL + +G+LEAAVN+IFS E+ D+              + VN
Sbjct: 2   NAQQSLIEMGITPEVAQRALQQTHGNLEAAVNYIFSGEVSDD--------------QPVN 47

Query: 66  ISNDN---NFQAGDLSEVMNVSNYGYDNRFETDSGDLSSDEVSDPEIVENDISNNLKLPA 122
                    F  G LS VM        +  E D    S  E+S P    +    +     
Sbjct: 48  QPQSAPMPGFAPGSLSGVMT----NQIDDDEDDDSSSSERELSPPLPPRDSPGFSGMSEG 103

Query: 123 YNIVKHEVEKTSLSDPTVVMPLPHNSIIESYFGLFSMFISIYLPHLLLKPDFKDLNYDNE 182
             I     +K+ ++DPTVV+PLPH S+ E+YF LFS+ +  YLPHL+ KP+  DL Y+ +
Sbjct: 104 VEIEIQSPKKSLVTDPTVVIPLPH-SLFENYFALFSLSMCQYLPHLMAKPELGDLMYNPK 162

Query: 183 WYNGLKFVAPKFGIKVHNEESLKDDLHTSIEPLTCVDRDLDDQPKLLWQLQKLSTIMNST 242
           W  G                        S +P T            + QLQ+L +++N++
Sbjct: 163 WAQG------------------------SSDPST----------SFIQQLQRLCSVVNAS 188

Query: 243 MSERSYVSSKLFSLCLDRNAKMKLQDAEHLYEVLPSFIKYLTSNLEMCPDFRPDEIRNEL 302
            S+R YVS+KLF+  LD   K KL +AEHL+EVLPSFI+ L   LE C  +  D+IR+  
Sbjct: 189 FSDRCYVSAKLFAAVLDAPLKRKLAEAEHLHEVLPSFIRSLIHALEECGCYAEDQIRSLF 248

Query: 303 ISSAYYLPSDDEPPVKTLLTLFHFLPDEYESNLYKMFNILLYXXXXXXXXXXXXXNSLNY 362
           +SSA  L S+     K+LL++  F+P+EYES+LY MFN LLY             NSL  
Sbjct: 249 VSSA--LSSE----CKSLLSVLQFMPEEYESSLYAMFNALLYPELEEGEESG---NSLLD 299

Query: 363 LAPNLTIIFDEIDELSSMTPLPEGVSIPLEFYPQLYTKECKDQLIKHIIGKRQDAQKESR 422
           LAP LTI+FDE+D  + +T    GV +PLEFYPQLYTK  KD +++ +  +R+ AQ+ SR
Sbjct: 300 LAPVLTIVFDEMDADTEVTS-NRGVDVPLEFYPQLYTKSVKDAIVRPLQQQRKAAQERSR 358

Query: 423 QHLKDLNSLKSFQGKDILKFLNSTLDFLDRDGQRQNGLTEGNGKLMEGLTDIKEQLTKKK 482
           Q L ++N LKS+QGKD LKF+NSTLD+L RD Q +        ++++ L  +K  +   K
Sbjct: 359 QVLAEMNGLKSYQGKDTLKFINSTLDYLQRDNQSK--------EIIDKLESLKNSIADHK 410

Query: 483 TEKMNAYKDLTQKLNTSWNLSNPEVSIIATAKKLGLIDEPYHLSMAVMSPNLYYIKKRDG 542
           T++ N YK+L+QKL+  WNLS+P   +I  A + GLIDEPY L+M V+SP  Y  + R G
Sbjct: 411 TQRKNEYKELSQKLHGEWNLSHP-TYLINEAMERGLIDEPYLLAMVVLSPGHYLQRSRSG 469

Query: 543 TWYLVQITENGDDFDIRKCSSGVEIQDCVRQYTRHGSETPLMFVYTKEGSIPDDDSVQKI 602
            W +++   N     I  C+   ++Q  +RQ+T   S+TPLM +Y K   +  D  V K 
Sbjct: 470 QWKMIRTDSNM--IRISDCAPS-QVQATIRQHTTFPSKTPLMLLYVKSSHVSVDTIVSKS 526

Query: 603 LEANTGCLQFLKDDQKLLNE 622
           LE+N G   FL+ DQ+ LN+
Sbjct: 527 LESNEGITNFLRIDQEELNK 546

>CAGL0I07205g Chr9 (694434..696245) [1812 bp, 603 aa] {ON} similar
           to uniprot|Q12242 Saccharomyces cerevisiae YOR138c
          Length = 603

 Score =  358 bits (919), Expect = e-115,   Method: Compositional matrix adjust.
 Identities = 244/645 (37%), Positives = 353/645 (54%), Gaps = 84/645 (13%)

Query: 3   DNKNSVKSIVDMGIPEDVAIDALNRVNGDLEAAVNFIFS--NELPDNNMGES------VG 54
           D + +V+S+++MGI  DVA  AL   NGD+EAA+N+IF+  NE+ ++ M         VG
Sbjct: 2   DFEGNVQSLLEMGIARDVAEQALRECNGDVEAALNYIFNTPNEIDNDAMAGQQMGSVPVG 61

Query: 55  NEKYTTSEHVNISNDNNFQAGDLSEVMNVSNYGYDNRFETDSGDLSSDEVSDPEIVENDI 114
            +         I  +N  Q+   SE   V     DN F +DS   S  + S         
Sbjct: 62  TQGIFDDSAFKIQENNPPQSQSYSEQQLVQENLPDNTFRSDSDTNSDSDSS--------- 112

Query: 115 SNNLKLPAYNIVKHEVE---KTSLSDPTVVMPLPHNSIIESYFGLFSMFISIYLPHLLLK 171
            ++L+   Y  +   +    K ++  PTVV+P P       Y  LF++FISI+LPH  +K
Sbjct: 113 -SSLEQSQYTSIDDLIPQQFKNTMDYPTVVIPAPAVPNHIYYCALFALFISIHLPHYFVK 171

Query: 172 PDFKD--LNYDNEWYNGLKFVAPKFGIKVHNEESLKDDLHTSIEPLTCVDRDLDDQPKLL 229
            D  D  L +  +W+N                                +DR+ +D+P L+
Sbjct: 172 ADHDDMPLLFSPDWFND-------------------------------IDREPEDEPLLV 200

Query: 230 W--QLQKLSTIMNST-MSERSYVSSKLFSL----CLDRNAKMKLQ-DAEHLYEVLPSFIK 281
              QL KL  + NS   S R++V+SK+F +     +  N  M    +  HLY++LPSFIK
Sbjct: 201 LRDQLHKLIAVQNSNDHSARAFVTSKMFDVDLQSVIQSNEPMLTNPNYFHLYQILPSFIK 260

Query: 282 YLTSNLEMCPDFRPDEIRNELISSAYYLPSDDEPPVKTLLTLFHFLPDEYESNLYKMFNI 341
            + +NL           +N  ISSA     +     ++LL+LFHFLP+EYESNLYKMFN+
Sbjct: 261 TI-ANLSYTE-------KNLFISSAIQGGEEASSSKESLLSLFHFLPEEYESNLYKMFNV 312

Query: 342 LLY---XXXXXXXXXXXXXNSLNYLAPNLTIIFDEIDELSSMTPLPEGVSIPLEFYPQLY 398
           LLY                NSL  LAP +TIIF+E + +    P+  GV +PL+FYPQLY
Sbjct: 313 LLYPDDDHDIGEDEDEVSENSLKELAPVMTIIFNEAENIDENAPVTNGVEVPLKFYPQLY 372

Query: 399 TKECKDQLIKHIIGKRQDAQKESRQHLKDLNSLKSFQGKDILKFLNSTLDFLDRDGQRQN 458
           TK+CKDQLI H++ KR+D +KE +Q LKD+ +LKS+QGKDIL F+NS+LD+L +D     
Sbjct: 373 TKKCKDQLISHVLSKRKDGRKELKQILKDIGNLKSYQGKDILSFINSSLDYLTKD----- 427

Query: 459 GLTEGNGKLMEGLTDIKEQLTKKKTEKMNAYKDLTQKLNTSWNLSNPEVSIIATAKKLGL 518
              + +  + E L  +K++LT KKTEKMN+YK +++K++T WN+ NPE+ I+ TA KLGL
Sbjct: 428 ---KDDSGIAEELHKLKDELTAKKTEKMNSYKQISEKMHTEWNIQNPELKIVETATKLGL 484

Query: 519 IDEPYHLSMAVMSPNLYYIKKRDGTWYLVQ---ITENGDDFDIRKCSSGVEIQDCVRQYT 575
           IDEPY L++AV+SP  Y+++ R   WY V+        D   + KC    E+   V+  T
Sbjct: 485 IDEPYFLNLAVVSPFFYFVRNRKDEWYEVRFNPFNTAEDKISVGKCDGPGEVIQHVKNST 544

Query: 576 RHGSETPLMFVYTKEGSIPDDDSVQKILEANTGCLQFLKDDQKLL 620
              + TPLMFVY+K+  + DD  +Q++L  N   L F K DQ  L
Sbjct: 545 TVPNSTPLMFVYSKDSYMADDTEMQELLSQNKTLLDFFKQDQIYL 589

>KNAG0B04050 Chr2 (776430..778451) [2022 bp, 673 aa] {ON} Anc_5.475
           YOR138C
          Length = 673

 Score =  353 bits (905), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 230/686 (33%), Positives = 341/686 (49%), Gaps = 88/686 (12%)

Query: 1   MNDNKNSVKSIVDMGIPEDVAIDALNRVNGDLEAAVNFIFSNELPDNNMGESVGNEKYTT 60
           M + +++V S+ +MGIPEDVA+DAL R NG+L AAVN+IFSN++P               
Sbjct: 1   MGEEQDAVASLGEMGIPEDVALDALRRANGNLSAAVNYIFSNDMP--------------A 46

Query: 61  SEHVNISN---DNNFQAGDLSEVMNVSNY---------------GYDNRFETDSGDLSSD 102
            EHV +      ++ + GDL +V+  S                   D   E   G++  D
Sbjct: 47  GEHVELPQPRESSDLKPGDLDQVLRESQRTGPQLNQLVQLDSHPAADTNDEDTGGNIYLD 106

Query: 103 EVSDPEIVE---NDISNNLKLPA-----------------YNIVKHEVEKTSLSDPTVVM 142
           E  + E+     N++S    +P                  Y   K    +     P    
Sbjct: 107 EDDNIEVGSVQLNEVSPATSIPPNSDIGSSPDDGTGDPPEYGGCKVPAAEEGAERPDSGA 166

Query: 143 PLPHNSIIESYFGLFSMFISIYLPHLLLKPDFKDLNYDNEWYNGLKFVAPKFGIKVHNEE 202
                    +Y  LF+  ++ Y P   ++ DFK+LNYD EWY G     P   +     +
Sbjct: 167 APAAERYATNYLVLFAFAVATYAPLQFVQQDFKNLNYDAEWYAGDAIQQPLCIVS----D 222

Query: 203 SLKDDLHTSIEPLTCVDRDLDDQPKLLWQLQKLSTIMNSTMSERSYVSSKLFSLCLDRNA 262
              D     I P   V  D   QP++LWQLQ++ ++ +S +SERSYVS+K+F+   D   
Sbjct: 223 VGADGGSRQIVPEEEVTSDTPVQPEMLWQLQRVISVCHSKLSERSYVSAKVFTKVFDTEV 282

Query: 263 KMKLQDAEHLYEVLPSFIKYLTSNLEMCPDFRPD-EIRNELISSAYYLPSDDEPPVKTLL 321
           +  ++D++HLYE LPSFIK +  + EMCP    + ++++  +SSA         P +T L
Sbjct: 283 ESCIRDSDHLYEALPSFIKSIIRDAEMCPAQHSNTDVKSMFLSSAIQDAEQGAEPEETFL 342

Query: 322 TLFHFLPDEYESNLYKMFNILLY-----------XXXXXXXXXXXXXNSLNYLAPNLTII 370
            LFHF P+EY +NLYKMFN LLY                         SL  LAP LTII
Sbjct: 343 FLFHFPPEEYNANLYKMFNALLYPEDDTIDDNSSDTDSSNDTDVQVEGSLKELAPLLTII 402

Query: 371 FDEID--ELSSMTP-----LPEGVSIPLEFYPQLYTKECKDQLIKHIIGKRQDAQKESRQ 423
           F+E D  +LS+         P+GV +P  FYPQLYT+E K+Q++K I+ +R+ A+ E RQ
Sbjct: 403 FNEADPGQLSAGAQDTCINSPQGVEVPFSFYPQLYTREVKEQVVKPILRQRKAARAELRQ 462

Query: 424 HLKDLNSLKSFQGKDILKFLNSTLDFLDR-------DGQRQNGLTEGNGKLMEGLTDIKE 476
            L  +N LKS++GK    FL    + L           + +N + E    +++ +T IK 
Sbjct: 463 CLARMNQLKSYEGKGCCAFLEQYAEVLAGRPCVSAVRSRTKNEMKE----VIQKVTSIKL 518

Query: 477 QLTKKKTEKMNAYKDLTQKLNTSWNLSNPEVSIIATAKKLGLIDEPYHLSMAVMSPNLYY 536
           QL +++ +    Y DL+ KL   WN+SNPE  +I  AK+LGL+D+P+ LSM V+SP  Y 
Sbjct: 519 QLNEERAKLKKQYVDLSNKLQNEWNISNPERKVIGEAKRLGLLDKPHLLSMVVLSPYFYL 578

Query: 537 IKKRDGT--WYLVQITENGDDFDIRKCSSGVEIQDCVRQYTRHGSETPLMFVYTKEGSIP 594
           ++   G   W LVQ    G D  I K  +  ++Q  +R  T+  ++ PLMF+Y +E    
Sbjct: 579 MRDSSGGSDWTLVQSNSYGTDGLITKHVTEEKVQQYIRDCTKTANDNPLMFIYCREDFFV 638

Query: 595 DDDSVQKILEANTGCLQFLKDDQKLL 620
             +     +E N GC +F K DQ  L
Sbjct: 639 SQEETWSAIEKNMGCSEFNKADQLYL 664

>KLLA0E03169g Chr5 complement(292918..294552) [1635 bp, 544 aa] {ON}
           weakly similar to uniprot|Q12242 Saccharomyces
           cerevisiae YOR138C RUP1
          Length = 544

 Score =  234 bits (596), Expect = 1e-68,   Method: Compositional matrix adjust.
 Identities = 159/498 (31%), Positives = 263/498 (52%), Gaps = 41/498 (8%)

Query: 141 VMPLPHNSIIESYFGLFSMFISIYLPHLLLKPDFKDLNYDNEWYNGLKFVAPKFGIKVHN 200
           ++P   ++++ESYF LF++ +++ +P   L  DFK+L Y+  W+ G + V   + +    
Sbjct: 57  ILPKGSSALLESYFPLFALCMAVNVPTKFLNVDFKELVYNPHWFKG-ELVQSDYRL---- 111

Query: 201 EESLKDDLHTSIEPLTCVDRDLDD------QPKLLWQLQKLSTIMNSTMSERSYVSSKLF 254
                  +H +  PL    R+L        QP+L+ ++Q L  I N   S R +V+S+L 
Sbjct: 112 -------VHRNAGPLLIHKRELTGSEYLEMQPELIPRMQLLIGIANDPESMRRFVASELI 164

Query: 255 SLCLDRNAKMKLQDAEHLYEVLPSFIKYLTSNLEMCPDFRPDEIRNEL-ISSAYYLPSDD 313
           +   D N    L + +HL EV P FIK L +++++C   + D+  ++L +S A + P+  
Sbjct: 165 NKGTDFNVSRALSECDHLSEVFPQFIKNLHNDMDLC--LKDDKSTSKLFLSKALHRPNVL 222

Query: 314 EPPVKTLLTLFHFLPDEYESNLYKMFNILLYXXXXXXXXXXXXXNSLNYLAPNLTIIFDE 373
           EP   T L++ +F P+ Y   LY+MFN +L              N+ ++LAP  TIIFD+
Sbjct: 223 EPFQPTSLSVLNFSPENYAYTLYEMFNPMLLPEDSGRGYEIE--NAFDFLAPVFTIIFDD 280

Query: 374 IDELSSMTPLPEGVSIPLEFYPQLYTKECKDQLIKHIIGKRQDAQKESRQHLKDLNSLKS 433
           +D+ +    L  GV IP+EFYPQLYTK   ++++  ++ +    +  ++  +  ++SL+S
Sbjct: 281 MDDTTEEVNLSHGVQIPIEFYPQLYTKNALEKVVVPVLEETDALRNTNKLKVDQMSSLQS 340

Query: 434 FQGKDILKFLNSTLDFLDRDGQRQNGLTEGNGKLMEGLTDIKEQLTKKKTEKMNAYKDLT 493
           FQGK I  FLNS++++L+   +   G  + + +L++ L  IK QL+ KK E M  Y + T
Sbjct: 341 FQGKQISSFLNSSINYLE---EIPLGDEDKSKELVDTLEKIKYQLSNKKREMMADYTE-T 396

Query: 494 QKLNTSWNLSNPEVSIIATAKKLGLIDEPYHLSMAVMSPNLYYIKKR----DGT------ 543
           Q+     +   P   II  AK++G+IDEPY L + V SPN Y I +     DG       
Sbjct: 397 QRQIDLLSFEGPSEKIIDLAKQVGIIDEPYLLRLVVFSPNDYIIARGISADDGNTGMETG 456

Query: 544 ----WYLVQITENGDDFDIRKCSSGVEIQDCVRQYTRHGSETPLMFVYTKEGSIPDDDSV 599
                Y+  I E G     ++  +  E QD  + +TRH SETP++FVY K+  I     +
Sbjct: 457 NNNLQYIRNIIEFGSSSLTQEELTAQETQDITKSHTRHASETPILFVYIKKDHIDAPQDI 516

Query: 600 QKILEANTGCLQFLKDDQ 617
              +  N     FLK++ 
Sbjct: 517 LASISENETLTNFLKEEH 534

>NDAI0C05890 Chr3 (1349126..1350514) [1389 bp, 462 aa] {ON}
           Anc_8.185 YER143W
          Length = 462

 Score = 37.0 bits (84), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 14/36 (38%), Positives = 23/36 (63%)

Query: 5   KNSVKSIVDMGIPEDVAIDALNRVNGDLEAAVNFIF 40
           +N++K ++D+G P +  I ALNR  G+ E A   +F
Sbjct: 426 ENTIKQLMDLGFPRNQVITALNRTGGNAEYAAALLF 461

>KAFR0C00410 Chr3 complement(85302..87611) [2310 bp, 769 aa] {ON}
           Anc_3.270 YBR058C
          Length = 769

 Score = 36.6 bits (83), Expect = 0.25,   Method: Compositional matrix adjust.
 Identities = 18/58 (31%), Positives = 34/58 (58%), Gaps = 5/58 (8%)

Query: 4   NKNSVKSIVDMGIPEDVAIDALNRVNGDLEAAVNFIFSN-----ELPDNNMGESVGNE 56
           N+ S+ S++ MG+ ++++  AL   NGD+ A++ ++F+N     ELP+ N       E
Sbjct: 641 NEESLNSMISMGLAQNLSRKALILNNGDINASIEWVFNNMDDNGELPEENTASQGAKE 698

>YER143W Chr5 (456319..457605) [1287 bp, 428 aa] {ON}  DDI1DNA
           damage-inducible v-SNARE binding protein with a role in
           suppression of protein secretion; may play a role in
           S-phase checkpoint control; has ubiquitin-associated
           (UBA), ubiquitin-like (UBL), and retroviral-like
           proteinase (RVP) domains
          Length = 428

 Score = 35.4 bits (80), Expect = 0.41,   Method: Compositional matrix adjust.
 Identities = 12/36 (33%), Positives = 23/36 (63%)

Query: 5   KNSVKSIVDMGIPEDVAIDALNRVNGDLEAAVNFIF 40
           + ++K ++D+G P D  + AL + NG+ E A + +F
Sbjct: 392 EQTIKQLMDLGFPRDAVVKALKQTNGNAEFAASLLF 427

>Skud_5.280 Chr5 (446952..448238) [1287 bp, 428 aa] {ON} YER143W
           (REAL)
          Length = 428

 Score = 35.4 bits (80), Expect = 0.43,   Method: Compositional matrix adjust.
 Identities = 12/36 (33%), Positives = 23/36 (63%)

Query: 5   KNSVKSIVDMGIPEDVAIDALNRVNGDLEAAVNFIF 40
           + ++K ++D+G P D  + AL + NG+ E A + +F
Sbjct: 392 EQTIKQLMDLGFPRDAVVTALKQTNGNAEFAASLLF 427

>Kpol_1028.89 s1028 complement(197927..200560) [2634 bp, 877 aa]
           {ON} complement(197927..200560) [2634 nt, 878 aa]
          Length = 877

 Score = 35.4 bits (80), Expect = 0.56,   Method: Compositional matrix adjust.
 Identities = 15/36 (41%), Positives = 23/36 (63%)

Query: 7   SVKSIVDMGIPEDVAIDALNRVNGDLEAAVNFIFSN 42
           +++ +  MG  ED A+ AL + N DL+AA NF+  N
Sbjct: 841 AIEELCGMGFTEDEAVKALEKHNWDLDAATNFLLDN 876

>NCAS0I01620 Chr9 complement(299269..301656) [2388 bp, 795 aa] {ON}
           Anc_3.270 YBR058C
          Length = 795

 Score = 35.0 bits (79), Expect = 0.71,   Method: Compositional matrix adjust.
 Identities = 16/45 (35%), Positives = 32/45 (71%), Gaps = 2/45 (4%)

Query: 4   NKNSVKSIVDMGIPEDVAIDALNRVNGDLEAAVNFIFSNELPDNN 48
           ++ S+ +++DMG+ E ++I AL    GD+ A++ ++F+N  PD+N
Sbjct: 666 DQESLSNMIDMGLNEKLSIKALVLNKGDINASIEWVFNN--PDDN 708

>Suva_2.70 Chr2 complement(125732..129874) [4143 bp, 1380 aa] {ON}
            YBL047C (REAL)
          Length = 1380

 Score = 34.7 bits (78), Expect = 0.89,   Method: Compositional matrix adjust.
 Identities = 16/34 (47%), Positives = 22/34 (64%)

Query: 7    SVKSIVDMGIPEDVAIDALNRVNGDLEAAVNFIF 40
            +V+ +  MG  E+ A +AL R N DLEAA NF+ 
Sbjct: 1344 AVEELSGMGFTEEEAHNALERSNWDLEAATNFLL 1377

>Ecym_7178 Chr7 (363600..367409) [3810 bp, 1269 aa] {ON} similar to
            Ashbya gossypii ABR149W
          Length = 1269

 Score = 34.7 bits (78), Expect = 1.00,   Method: Compositional matrix adjust.
 Identities = 14/36 (38%), Positives = 23/36 (63%)

Query: 7    SVKSIVDMGIPEDVAIDALNRVNGDLEAAVNFIFSN 42
            +++ + +MG  E+ A+ AL +   DLEAA NF+  N
Sbjct: 1233 AIEELSNMGFSEEEAVKALEKCKWDLEAATNFLLDN 1268

>ZYRO0G17996g Chr7 (1477518..1481885) [4368 bp, 1455 aa] {ON} weakly
            similar to uniprot|P34216 Saccharomyces cerevisiae
            YBL047C EDE1 Key endocytic protein involved in a network
            of interactions with other endocytic proteins binds
            membranes in a ubiquitin-dependent manner may also bind
            ubiquitinated membrane-associated proteins
          Length = 1455

 Score = 34.7 bits (78), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 15/34 (44%), Positives = 21/34 (61%)

Query: 7    SVKSIVDMGIPEDVAIDALNRVNGDLEAAVNFIF 40
            +V+ +  MG  E  A+DAL R   DLEAA N++ 
Sbjct: 1419 AVEELSGMGFTEQEAVDALERCKWDLEAATNYLL 1452

>Smik_5.308 Chr5 (461464..462750) [1287 bp, 428 aa] {ON} YER143W
           (REAL)
          Length = 428

 Score = 33.1 bits (74), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 11/36 (30%), Positives = 22/36 (61%)

Query: 5   KNSVKSIVDMGIPEDVAIDALNRVNGDLEAAVNFIF 40
           + ++K ++D+G P D  + AL +  G+ E A + +F
Sbjct: 392 EQTIKQLMDLGFPRDTVVKALKQTGGNAEFAASLLF 427

>YBL047C Chr2 complement(127895..132040) [4146 bp, 1381 aa] {ON}
            EDE1Endocytic protein; involved in a network of
            interactions with other endocytic proteins, binds
            membranes in a ubiquitin-dependent manner, may also bind
            ubiquitinated membrane-associated proteins; interacts
            with Cmk2 and functions upstream of CMK2 in regulating
            non-apoptotic cell death
          Length = 1381

 Score = 33.5 bits (75), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 15/34 (44%), Positives = 22/34 (64%)

Query: 7    SVKSIVDMGIPEDVAIDALNRVNGDLEAAVNFIF 40
            +V+ +  MG  E+ A +AL + N DLEAA NF+ 
Sbjct: 1345 AVEELSGMGFTEEEAHNALEKCNWDLEAATNFLL 1378

>NCAS0A03920 Chr1 complement(793999..795417) [1419 bp, 472 aa] {ON}
           Anc_8.185 YER143W
          Length = 472

 Score = 32.7 bits (73), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 13/33 (39%), Positives = 19/33 (57%)

Query: 8   VKSIVDMGIPEDVAIDALNRVNGDLEAAVNFIF 40
           +K + D+G     AI+ALNR  G+ E A   +F
Sbjct: 439 IKQVTDLGFTRTEAINALNRTGGNAELAAALLF 471

>Skud_2.55 Chr2 complement(111625..115797) [4173 bp, 1390 aa] {ON}
            YBL047C (REAL)
          Length = 1390

 Score = 32.7 bits (73), Expect = 3.3,   Method: Compositional matrix adjust.
 Identities = 14/34 (41%), Positives = 22/34 (64%)

Query: 7    SVKSIVDMGIPEDVAIDALNRVNGDLEAAVNFIF 40
            +++ +  MG  E+ A +AL + N DLEAA NF+ 
Sbjct: 1354 AIEELSGMGFTEEEAHNALEKCNWDLEAATNFLL 1387

>CAGL0F04609g Chr6 (463702..467637) [3936 bp, 1311 aa] {ON} similar to
            uniprot|P34216 Saccharomyces cerevisiae YBL047c
          Length = 1311

 Score = 32.7 bits (73), Expect = 3.6,   Method: Compositional matrix adjust.
 Identities = 14/34 (41%), Positives = 21/34 (61%)

Query: 7    SVKSIVDMGIPEDVAIDALNRVNGDLEAAVNFIF 40
            +V+ ++ MG  ED A+ AL + N DLE A N + 
Sbjct: 1275 AVEELMGMGFKEDEAVKALEKSNWDLETATNLLL 1308

>NDAI0J00530 Chr10 complement(102751..106920) [4170 bp, 1389 aa] {ON}
            Anc_7.488 YBL047C
          Length = 1389

 Score = 32.7 bits (73), Expect = 4.1,   Method: Compositional matrix adjust.
 Identities = 13/34 (38%), Positives = 22/34 (64%)

Query: 7    SVKSIVDMGIPEDVAIDALNRVNGDLEAAVNFIF 40
            +++ +  MG  E+ A +AL + N DL+AA NF+ 
Sbjct: 1353 AIEELSGMGFSEEEATNALKKCNWDLDAATNFLL 1386

>AGR023C Chr7 complement(756961..759303) [2343 bp, 780 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YBR058C
           (UBP14)
          Length = 780

 Score = 32.3 bits (72), Expect = 4.1,   Method: Compositional matrix adjust.
 Identities = 20/58 (34%), Positives = 33/58 (56%), Gaps = 1/58 (1%)

Query: 1   MNDNKNSVKSIVDMGIPEDVAIDALNRVNGDLEAAVNFIFSN-ELPDNNMGESVGNEK 57
            N +++ V SI+ MG  ++ A+ AL     ++E A+N+IF + E P+ N   SV   K
Sbjct: 581 FNPDEDKVISIISMGFSKNAALRALYNTGSEVERALNWIFEHMEDPELNAEFSVPGTK 638

>KLLA0E10341g Chr5 complement(911148..912392) [1245 bp, 414 aa] {ON}
           similar to uniprot|P40087 Saccharomyces cerevisiae
           YER143W DDI1 DNA damage-inducible v-SNARE binding
           protein contains a ubiquitin-associated (UBA) domain may
           act as a negative regulator of constitutive exocytosis
           may play a role in S-phase checkpoint control
          Length = 414

 Score = 32.3 bits (72), Expect = 4.4,   Method: Compositional matrix adjust.
 Identities = 12/33 (36%), Positives = 22/33 (66%)

Query: 8   VKSIVDMGIPEDVAIDALNRVNGDLEAAVNFIF 40
           +K +VD+G     AI+ALN+  G+++ A + +F
Sbjct: 381 IKKLVDLGFSRKEAINALNKTGGNVDYAASLLF 413

>NDAI0E02390 Chr5 complement(496256..498907) [2652 bp, 883 aa] {ON}
           Anc_8.668
          Length = 883

 Score = 32.3 bits (72), Expect = 4.6,   Method: Compositional matrix adjust.
 Identities = 28/88 (31%), Positives = 42/88 (47%), Gaps = 1/88 (1%)

Query: 32  LEAAVNFIFSNELPDNNMGESVGNEKYTTSEHVNISNDNNFQAGDLSEVMNVSNYGYDNR 91
           L++ V+  FS     N   ESV N  +  +E        + +A  LS V  +SN  Y++ 
Sbjct: 571 LKSIVSSDFSRSSLANYDSESVDNSYFLPNEDKRAGRSGSGRARPLSFVSQISNDTYNSE 630

Query: 92  FETDSGDLSSDEVSDPEIVENDISNNLK 119
           + TD G+ SS +  DP    ND S  L+
Sbjct: 631 YSTD-GNTSSIKFEDPMKGTNDTSGTLQ 657

>Smik_2.67 Chr2 complement(121714..125847) [4134 bp, 1377 aa] {ON}
            YBL047C (REAL)
          Length = 1377

 Score = 32.3 bits (72), Expect = 4.8,   Method: Compositional matrix adjust.
 Identities = 14/34 (41%), Positives = 21/34 (61%)

Query: 7    SVKSIVDMGIPEDVAIDALNRVNGDLEAAVNFIF 40
            +++ +  MG  E+ A  AL + N DLEAA NF+ 
Sbjct: 1341 AIEELSGMGFTEEEAHSALEKCNWDLEAATNFLL 1374

>NCAS0A03200 Chr1 complement(627997..633363) [5367 bp, 1788 aa] {ON}
           Anc_5.702 YIL149C
          Length = 1788

 Score = 32.3 bits (72), Expect = 4.9,   Method: Compositional matrix adjust.
 Identities = 22/62 (35%), Positives = 33/62 (53%), Gaps = 11/62 (17%)

Query: 185 NGLKFVAPKFGIKVHNEESLKDDLHTSIEPLTCVDRDLDDQPKLLWQLQKLST----IMN 240
           N L ++  +  I   NE+SLKDD       +T V ++ ++  +L+ QLQ L T    I N
Sbjct: 726 NELNYIQSQLNISKTNEKSLKDD-------ITIVSKERNELKELVSQLQSLQTEREQIFN 778

Query: 241 ST 242
           ST
Sbjct: 779 ST 780

>YMR012W Chr13 (291134..294967) [3834 bp, 1277 aa] {ON}  CLU1eIF3
           component of unknown function; deletion causes defects
           in mitochondrial organization but not in growth or
           translation initiation, can rescue cytokinesis and
           mitochondrial organization defects of the Dictyostelium
           cluA- mutant
          Length = 1277

 Score = 32.3 bits (72), Expect = 5.4,   Method: Compositional matrix adjust.
 Identities = 41/179 (22%), Positives = 76/179 (42%), Gaps = 29/179 (16%)

Query: 407 IKHIIGKRQDAQKESRQHLKDLNSLKSFQGKDILKFLNSTLDFLDRDGQRQNGLTE---- 462
           IK I+G++ +        LK    LK +  ++ LK + +  DF+    +  +GL+E    
Sbjct: 89  IKEIVGEKSE--------LKLQLILKPYSAREALKHVITVRDFIGFAQETSDGLSEFAIS 140

Query: 463 -GNGKLMEGLTDIKEQLTKKKT-------EKMNAYKDLTQKLNTSWN---------LSNP 505
            G+      L  IKE+  +++        EK N +KD+T +    +N           N 
Sbjct: 141 TGSSFSSLPLGPIKERSKQEEKDEKSDPEEKKNTFKDVTDEEKLKFNEMVHEVFSSFKNS 200

Query: 506 EVSIIATAKKLGLIDEPYHLSMAVMSPNLYYIKKRDGTWYLVQITENGDDFDIRKCSSG 564
            ++ + T++   +      LS A  +P   + + +   +YL  +T  G+ F I    SG
Sbjct: 201 SINKLLTSESNIITPCVRSLSFAPYNPVPPFYRSKGHLFYLQIVTLEGESFYITAIPSG 259

>Suva_5.271 Chr5 (427633..428919) [1287 bp, 428 aa] {ON} YER143W
           (REAL)
          Length = 428

 Score = 31.6 bits (70), Expect = 6.5,   Method: Compositional matrix adjust.
 Identities = 11/36 (30%), Positives = 23/36 (63%)

Query: 5   KNSVKSIVDMGIPEDVAIDALNRVNGDLEAAVNFIF 40
           + ++K ++D+G P D  + AL + NG+ + A + +F
Sbjct: 392 EKTIKQLMDLGFPRDDVVKALKQTNGNADFAASLLF 427

>KAFR0G00670 Chr7 complement(168288..170057) [1770 bp, 589 aa] {ON}
           Anc_1.214 YKR056W
          Length = 589

 Score = 31.2 bits (69), Expect = 9.0,   Method: Compositional matrix adjust.
 Identities = 28/103 (27%), Positives = 43/103 (41%), Gaps = 8/103 (7%)

Query: 473 DIKEQLTKKKTEKMNAYKDLTQKLNTSWNLSNPEVSIIA------TAKKLGLIDEPYHLS 526
           D KEQL  K+   +NAYK    +L T   L   + ++ +        K     D P  + 
Sbjct: 211 DYKEQLKLKRETIVNAYKHFAPRLVTEKLLPQVDDTVASPLEYSYRTKITPHFDVPRKVK 270

Query: 527 MAVMSPNLYYIKKRDGTWY--LVQITENGDDFDIRKCSSGVEI 567
           +    P L + +K   TW    +++  NG   DI + S   EI
Sbjct: 271 VLEYRPPLGFSQKGRPTWRKEALEVGGNGSILDIEESSLATEI 313

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.315    0.134    0.385 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 74,614,176
Number of extensions: 3669838
Number of successful extensions: 11720
Number of sequences better than 10.0: 153
Number of HSP's gapped: 12145
Number of HSP's successfully gapped: 156
Length of query: 631
Length of database: 53,481,399
Length adjustment: 116
Effective length of query: 515
Effective length of database: 40,180,143
Effective search space: 20692773645
Effective search space used: 20692773645
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (22.0 bits)
S2: 69 (31.2 bits)