Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
TPHA0J026005.437ON44144121190.0
Kpol_1016.45.437ON4133346096e-74
KAFR0E038205.437ON3963835624e-67
Smik_4.6365.437ON4463625561e-65
Skud_4.6395.437ON4423415472e-64
YDR370C5.437ON4423565454e-64
NDAI0B056905.437ON4233515182e-60
Suva_2.5425.437ON4423425202e-60
TDEL0B021805.437ON4182785025e-58
ZYRO0F10098g5.437ON3733354891e-56
TBLA0A028005.437ON4533424914e-56
NCAS0F034005.437ON4153754702e-53
CAGL0A02860g5.437ON4023254193e-46
KNAG0C048905.437ON4053413625e-38
SAKL0G02596g5.437ON4003483415e-35
KLLA0E02245g5.437ON4033043204e-32
KLTH0F15994g5.437ON3903252871e-27
AER404C5.437ON3863622852e-27
Kwal_55.214155.437ON3893322792e-26
Skud_13.3586.280ON37356750.94
NDAI0I032603.570ON37744741.2
Kwal_47.192763.570ON386128731.9
KLLA0E12893g3.570ON384105722.4
NDAI0D020405.174ON1147239705.3
KAFR0C021706.191ON79785696.7
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= TPHA0J02600
         (441 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

TPHA0J02600 Chr10 complement(577310..578635) [1326 bp, 441 aa] {...   820   0.0  
Kpol_1016.4 s1016 (8493..9362,9366..9737) [1242 bp, 413 aa] {ON}...   239   6e-74
KAFR0E03820 Chr5 (758469..759659) [1191 bp, 396 aa] {ON} Anc_5.4...   221   4e-67
Smik_4.636 Chr4 complement(1137846..1139186) [1341 bp, 446 aa] {...   218   1e-65
Skud_4.639 Chr4 complement(1140646..1141974) [1329 bp, 442 aa] {...   215   2e-64
YDR370C Chr4 complement(1217782..1219110) [1329 bp, 442 aa] {ON}...   214   4e-64
NDAI0B05690 Chr2 (1387153..1388424) [1272 bp, 423 aa] {ON} Anc_5...   204   2e-60
Suva_2.542 Chr2 complement(968396..969724) [1329 bp, 442 aa] {ON...   204   2e-60
TDEL0B02180 Chr2 (388145..389401) [1257 bp, 418 aa] {ON} Anc_5.4...   197   5e-58
ZYRO0F10098g Chr6 complement(818672..819793) [1122 bp, 373 aa] {...   192   1e-56
TBLA0A02800 Chr1 (675150..676511) [1362 bp, 453 aa] {ON} Anc_5.4...   193   4e-56
NCAS0F03400 Chr6 complement(686480..687727) [1248 bp, 415 aa] {O...   185   2e-53
CAGL0A02860g Chr1 complement(300736..301944) [1209 bp, 402 aa] {...   166   3e-46
KNAG0C04890 Chr3 (945616..946833) [1218 bp, 405 aa] {ON} Anc_5.4...   144   5e-38
SAKL0G02596g Chr7 complement(214675..215877) [1203 bp, 400 aa] {...   135   5e-35
KLLA0E02245g Chr5 complement(210001..211212) [1212 bp, 403 aa] {...   127   4e-32
KLTH0F15994g Chr6 (1298649..1299821) [1173 bp, 390 aa] {ON} weak...   115   1e-27
AER404C Chr5 complement(1412412..1413572) [1161 bp, 386 aa] {ON}...   114   2e-27
Kwal_55.21415 s55 (826461..827630) [1170 bp, 389 aa] {ON} YDR370...   112   2e-26
Skud_13.358 Chr13 (619721..620842) [1122 bp, 373 aa] {ON} YMR191...    33   0.94 
NDAI0I03260 Chr9 (765221..766354) [1134 bp, 377 aa] {ON} Anc_3.570     33   1.2  
Kwal_47.19276 s47 (1168248..1169408) [1161 bp, 386 aa] {ON} YGL2...    33   1.9  
KLLA0E12893g Chr5 complement(1140409..1141563) [1155 bp, 384 aa]...    32   2.4  
NDAI0D02040 Chr4 complement(478943..482386) [3444 bp, 1147 aa] {...    32   5.3  
KAFR0C02170 Chr3 (431896..434289) [2394 bp, 797 aa] {ON} Anc_6.1...    31   6.7  

>TPHA0J02600 Chr10 complement(577310..578635) [1326 bp, 441 aa] {ON}
           Anc_5.437 YDR370C
          Length = 441

 Score =  820 bits (2119), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 403/441 (91%), Positives = 403/441 (91%)

Query: 1   MENANEGKNNTSLPEDNACILVEGLEKLSIDGTTNVXXXXXXXXXXXXXXXXXXYSDDII 60
           MENANEGKNNTSLPEDNACILVEGLEKLSIDGTTNV                  YSDDII
Sbjct: 1   MENANEGKNNTSLPEDNACILVEGLEKLSIDGTTNVSRKNKAKKGKDKKKSRGKYSDDII 60

Query: 61  ARIPFKHFSYSNAHIGKSQPNIFQEAKGVALYYDKRITKITNNEAELINESNPPFLTKDI 120
           ARIPFKHFSYSNAHIGKSQPNIFQEAKGVALYYDKRITKITNNEAELINESNPPFLTKDI
Sbjct: 61  ARIPFKHFSYSNAHIGKSQPNIFQEAKGVALYYDKRITKITNNEAELINESNPPFLTKDI 120

Query: 121 SNLSEISLLDSKKFKLPYMGYNLYDEIEKFGPMDSTLLDSTVPCFEYLRTLKISEEDKLY 180
           SNLSEISLLDSKKFKLPYMGYNLYDEIEKFGPMDSTLLDSTVPCFEYLRTLKISEEDKLY
Sbjct: 121 SNLSEISLLDSKKFKLPYMGYNLYDEIEKFGPMDSTLLDSTVPCFEYLRTLKISEEDKLY 180

Query: 181 NTPYTFMTPRHHLTELMMTVYESRESELTGKSWLFTRIKDDLIVISEDLAKENNPSPQNH 240
           NTPYTFMTPRHHLTELMMTVYESRESELTGKSWLFTRIKDDLIVISEDLAKENNPSPQNH
Sbjct: 181 NTPYTFMTPRHHLTELMMTVYESRESELTGKSWLFTRIKDDLIVISEDLAKENNPSPQNH 240

Query: 241 KLQNSFSKKVINSGFTFEELVIENFQECHKPYFYISENRLTPKSTFIIRSEMDSYNNKTE 300
           KLQNSFSKKVINSGFTFEELVIENFQECHKPYFYISENRLTPKSTFIIRSEMDSYNNKTE
Sbjct: 241 KLQNSFSKKVINSGFTFEELVIENFQECHKPYFYISENRLTPKSTFIIRSEMDSYNNKTE 300

Query: 301 TFTELKCFNKLHLGVAQHRKKLLKTWFQTGLSPNCDIVIGIRDTSSGILEDLLWYSRENM 360
           TFTELKCFNKLHLGVAQHRKKLLKTWFQTGLSPNCDIVIGIRDTSSGILEDLLWYSRENM
Sbjct: 301 TFTELKCFNKLHLGVAQHRKKLLKTWFQTGLSPNCDIVIGIRDTSSGILEDLLWYSRENM 360

Query: 361 YQKLQDPSLPKFKNSFDFKPHIGIQWLNHCIHAIESAFTKDTSDTASNPMTYXXXXXXXX 420
           YQKLQDPSLPKFKNSFDFKPHIGIQWLNHCIHAIESAFTKDTSDTASNPMTY        
Sbjct: 361 YQKLQDPSLPKFKNSFDFKPHIGIQWLNHCIHAIESAFTKDTSDTASNPMTYKVIIDKHK 420

Query: 421 XXXXXXXXXXXXNVEIPTDFL 441
                       NVEIPTDFL
Sbjct: 421 SIIIKKLSIVPKNVEIPTDFL 441

>Kpol_1016.4 s1016 (8493..9362,9366..9737) [1242 bp, 413 aa] {ON}
           (8493..9362,9366..9737) [1242 nt, 414 aa]
          Length = 413

 Score =  239 bits (609), Expect = 6e-74,   Method: Compositional matrix adjust.
 Identities = 133/334 (39%), Positives = 208/334 (62%), Gaps = 15/334 (4%)

Query: 58  DIIARIPFKHFSYSNAH-IGKSQPNIFQEAKGVALYYDKRITKITNNEAELINESNPPFL 116
           ++I  IPF  F +SNA    +   ++F E+K VA ++ K    I   +A L      P L
Sbjct: 36  NVINIIPFHRFVHSNARSFPQKTKDLFLESKTVA-FFQKDQLFINVEDAAL------PLL 88

Query: 117 TKDISNLSEISLLDSKKFKLPYMGYNLYDEIEKFGPMDSTLLDSTVPCFEYLRTLKISEE 176
            KDI+N+S  S+L+SKK+KLPY+G +LY   +K+GP+   +LDS  PCF+++R  +    
Sbjct: 89  KKDIANISGKSVLNSKKYKLPYLGSDLYASTDKYGPLPEDVLDSPKPCFDFIRHWENEHR 148

Query: 177 DKLY--NTPYTFMTPRHHLTELMMTVYESRESELTGKSWLFTRIKDDLIVISEDLAKENN 234
            + Y  +  YT ++PRHH+TE++M+++E  ++       L T +K+ +I++S+D A  ++
Sbjct: 149 GEHYGAHADYTILSPRHHITEIVMSLFEDEKN--CSVYLLCTYLKNGIILLSKDDASSSS 206

Query: 235 PSPQNH-KLQNSFSKKVINSGFTFEELVIENFQECHKPYFYISENRLTPKSTFIIRSEMD 293
            S        N  ++K+  SGF FE+LV+E+  E  +P F + E++LT     ++R+E+D
Sbjct: 207 NSNTTGLNSSNPMTRKICYSGFAFEDLVLEDIAENARPIFSVVESKLTESINLLLRNELD 266

Query: 294 SYNNKTETFTELKCFNKLHLGVAQHRKKLLKTWFQTGLSPNCDIVIGIRDTSSGILEDLL 353
            YNN T  FTELKCF  L    +   K++LKTW QTGL P  DIVIGIRDT SG+LEDL+
Sbjct: 267 GYNNVTNMFTELKCFAPLKCMFSA--KEVLKTWVQTGLIPESDIVIGIRDTQSGLLEDLV 324

Query: 354 WYSRENMYQKLQDPSLPKFKNSFDFKPHIGIQWL 387
           WY+R+++ +   +PSLP   + F+F  +I ++WL
Sbjct: 325 WYNRKDLCRTFNNPSLPPAPSHFNFNANIAVEWL 358

>KAFR0E03820 Chr5 (758469..759659) [1191 bp, 396 aa] {ON} Anc_5.437
           YDR370C
          Length = 396

 Score =  221 bits (562), Expect = 4e-67,   Method: Compositional matrix adjust.
 Identities = 126/383 (32%), Positives = 208/383 (54%), Gaps = 22/383 (5%)

Query: 64  PFKHFSY-SNAHIGKSQPNIFQEAKGVALYYDKRITKITNNEAELINESNPPFLTKDISN 122
           PFK F + S A+      N FQ ++ VA Y+D RI +      +++     P L KDIS 
Sbjct: 31  PFKRFQHRSIAYFPNHPANFFQISREVATYHDGRIYEPNETSQDIL-----PLLNKDISK 85

Query: 123 LSE-ISLLDSKKFKLPYMGYNLYDEIEKFGPMDSTLLDSTVPCFEYLRTLKISEEDKLY- 180
           +++ +S +D++K+K+ Y+G +LY   E F  M    LDS +PCF Y++  +     K   
Sbjct: 86  IAQGVSAIDARKYKVKYIGSDLYQGFENFESMSREELDSALPCFAYIKKWEAHHHCKYTE 145

Query: 181 NTPYTFMTPRHHLTELMMTVYESRESELTGKSWLFTRIKDDLIVISEDLAKENNPSPQNH 240
           N  YT ++ RHH+  L+M+++++ +  +   ++L     + L+  S+D +   +P   N 
Sbjct: 146 NKKYTIVSARHHIVNLIMSIFDTSKETIVNSTYL----GNGLLTFSQDTS---DPMTMNE 198

Query: 241 KL--QNSFSKKVINSGFTFEELVIENFQECHKPYFYISENRLTPKSTFIIRSEMDSYNNK 298
            +  +N   KK+  SGF  E+L+ ++ +E   P F I+EN+L    T ++R EMD+YN  
Sbjct: 199 GIFTKNKNLKKICYSGFALEDLLTKSQKE---PLFSITENQLDDNITLLLRCEMDAYNQL 255

Query: 299 TETFTELKCFNKLHLGVAQHRKKLLKTWFQTGLSPNCDIVIGIRDTSSGILEDLLWYSRE 358
           T+ +TELKC+  L +   QHRKKLLKTW QTG+ P+ D++ GIR   +G L D+ WYSR+
Sbjct: 256 TQNYTELKCYAPLKMASPQHRKKLLKTWIQTGVLPSSDLMFGIRSPYNGELLDIEWYSRD 315

Query: 359 NMYQKLQDPSLPKFKNSFDFKPHIGIQWLNHCIHAIESAFTKDTSDTASNPMTYXXXXXX 418
            +Y++  + +LP+ K S +F  +I ++W +HCI  I    + +    A  P  +      
Sbjct: 316 GLYRRFNNRNLPENKKSLNFNANIAVEWSHHCIKTICELISDNLQGDA--PQAFQIKVDT 373

Query: 419 XXXXXXXXXXXXXXNVEIPTDFL 441
                         N +IP  +L
Sbjct: 374 FRNISIRNLSKIPQNAQIPRQYL 396

>Smik_4.636 Chr4 complement(1137846..1139186) [1341 bp, 446 aa] {ON}
           YDR370C (REAL)
          Length = 446

 Score =  218 bits (556), Expect = 1e-65,   Method: Compositional matrix adjust.
 Identities = 126/362 (34%), Positives = 200/362 (55%), Gaps = 22/362 (6%)

Query: 62  RIPFKHFSYSNAHIGKSQP--NIFQEAKGVALYYDKRITKITNNEA-ELINESNPPFLTK 118
           R+ +  FS+S  H   ++P  +IF E+K VAL+        TN +A   + +   P L  
Sbjct: 65  RVSYTSFSHSGMHKFPAKPPRDIFHESKEVALF--------TNGQAYTTVRKDILPNLKG 116

Query: 119 DISNLSEISLLDSKKFKLPYMGYNLYDEIEKFGPMDSTLLDSTVPCFEYLRTLKISE--E 176
           DI+ L E SLLD+++ KLPY+G++L+  I +F PM  + LDS +PC  Y+   +++   E
Sbjct: 117 DIAELCERSLLDARERKLPYLGHDLFANIGQFVPMTISELDSILPCISYIENWRLNNHGE 176

Query: 177 DKLYNTPYTFMTPRHHLTELMMTVYESRESELTGKSWLFTRIKDDLIVISEDLAKENNPS 236
           D      +T +T RHH+ ++ M +++ R  +   +S + T +   LI  S +   ++  S
Sbjct: 177 DFKIGRKFTVVTTRHHIVDMTMHLFDRRNKK---RSLVATYMGAGLISFSRNQKNDSRMS 233

Query: 237 PQNHKLQNSFSKKVINSGFTFEELVIENFQEC-----HKPYFYISENRLTPKSTFIIRSE 291
            +     +   KK+  SGF FE  V E  +         P F + E++L+ +   +IR E
Sbjct: 234 KEGIYSSDPNMKKICYSGFEFENWVTEGIKAADLNGSKLPVFSVVESKLSEEIGLLIRCE 293

Query: 292 MDSYNNKTETFTELKCFNKLHLGVAQHRKKLLKTWFQTGLSPNCDIVIGIRDTSSGILED 351
           MD++N  +   TELKCF  L +  + HR+KLLKTW QTGLSPN DI+IG+RD+ SG L D
Sbjct: 294 MDAFNPVSGANTELKCFAPLSMHNSNHRRKLLKTWIQTGLSPNSDIMIGLRDSHSGQLLD 353

Query: 352 LLWYSRENMYQKLQDPSLPKFKNSFDFKPHIGIQWLNHCIHAIESAFTKDTSD-TASNPM 410
           + WYSR+++  K     LP  K   ++   + ++W NHCI +I      + SD +  NP 
Sbjct: 354 IQWYSRDSLCMKFNHSGLPSNKRELNYNAKVAVEWCNHCIKSICELLGANISDYSCKNPE 413

Query: 411 TY 412
           ++
Sbjct: 414 SF 415

>Skud_4.639 Chr4 complement(1140646..1141974) [1329 bp, 442 aa] {ON}
           YDR370C (REAL)
          Length = 442

 Score =  215 bits (547), Expect = 2e-64,   Method: Compositional matrix adjust.
 Identities = 122/341 (35%), Positives = 191/341 (56%), Gaps = 19/341 (5%)

Query: 63  IPFKHFSYSNAHIGKSQP--NIFQEAKGVALYYDKRITKITNNEAELINESNPPFLTKDI 120
           +P+  F +++ H    +P  +IFQ++K VAL+ + +    T    +LI     P L   I
Sbjct: 66  VPYTSFVHTSIHDLSRKPPGDIFQDSKEVALFTNYQ--AYTTARKDLI-----PSLRDGI 118

Query: 121 SNLSEISLLDSKKFKLPYMGYNLYDEIEKFGPMDSTLLDSTVPCFEYLRTLKISEEDKLY 180
           + L E SLL++++ K+PY+G++L+  I++F PM  + LDS  PC  Y+   K+S   K +
Sbjct: 119 TELYESSLLEARRRKVPYLGHDLFANIDQFVPMTISELDSISPCISYVENWKLSNHGKNF 178

Query: 181 --NTPYTFMTPRHHLTELMMTVYESRESELTGKSWLFTRIKDDLIVISEDLAKENNPSPQ 238
                +T ++ RHH+ +L M  ++ R      KS + T +   LI  S +   +   S +
Sbjct: 179 KIGKKFTIVSARHHIVDLTMHRFDRRNKR---KSLIVTYMGAGLISFSRNPKNDFQMSKE 235

Query: 239 NHKLQNSFSKKVINSGFTFEELVIENFQEC-----HKPYFYISENRLTPKSTFIIRSEMD 293
                +   KK+  SGF FE  V E+ +         P F + E++L+     ++R E+D
Sbjct: 236 GIYSSDPNMKKICYSGFEFEHWVTEDIKATDLNGPKHPIFSVVESKLSEDIGLLMRCEID 295

Query: 294 SYNNKTETFTELKCFNKLHLGVAQHRKKLLKTWFQTGLSPNCDIVIGIRDTSSGILEDLL 353
           ++N  + T TELKCF  L +  + HRKKLLKTW QTGL PN DIVIG+RD+ SG L D+ 
Sbjct: 296 AFNPVSRTNTELKCFGPLSMHNSNHRKKLLKTWIQTGLLPNSDIVIGLRDSHSGQLLDIQ 355

Query: 354 WYSRENMYQKLQDPSLPKFKNSFDFKPHIGIQWLNHCIHAI 394
           WYSR+++Y+K   P LP  K   +F   + ++W NHCI +I
Sbjct: 356 WYSRDSLYKKFNHPGLPPSKKELNFNAKVAVEWCNHCIKSI 396

>YDR370C Chr4 complement(1217782..1219110) [1329 bp, 442 aa] {ON}
           Putative protein of unknown function
          Length = 442

 Score =  214 bits (545), Expect = 4e-64,   Method: Compositional matrix adjust.
 Identities = 128/356 (35%), Positives = 199/356 (55%), Gaps = 23/356 (6%)

Query: 63  IPFKHFSYSNAHIGKSQP--NIFQEAKGVALYYDKRITKITNNEAELINESNPPFLTKDI 120
           IP+  F ++  H   ++P  +IF E+K VAL+ + R   I     +LI     P L + I
Sbjct: 66  IPYTSFLHTGMHNFLTKPPRDIFHESKEVALFTNGRAYTIL--RKDLI-----PNLKESI 118

Query: 121 SNLSEISLLDSKKFKLPYMGYNLYDEIEKFGPMDSTLLDSTVPCFEYLRTLKISEEDKLY 180
           + L E SLL++KK K+PY+G++L+  I++F PM  + LDS  PCF Y+    +    K +
Sbjct: 119 AELYESSLLEAKKRKVPYLGHDLFANIDEFVPMTISELDSVSPCFSYIENWILDNPGKDF 178

Query: 181 --NTPYTFMTPRHHLTELMMTVYESRESELTGKSWLFTRIKDDLIVISEDLAKENNPSPQ 238
                +T +T RHH+ +L M ++  R  +    S + T +   L+    ++ K++  S +
Sbjct: 179 KIGKKFTVVTTRHHIVDLTMHLFNRRNRQ---TSLIVTYMGAGLLSFCRNVKKDSQMSKE 235

Query: 239 NHKLQNSFSKKVINSGFTFEELVIENFQ-------ECHKPYFYISENRLTPKSTFIIRSE 291
                +   KK+  SGF FE  V EN +       +C  P F + E++L+ +   +IR E
Sbjct: 236 GIYSNDPNMKKICYSGFEFENWVTENSKVADLTGSKC--PIFSLVESKLSEEIGLLIRCE 293

Query: 292 MDSYNNKTETFTELKCFNKLHLGVAQHRKKLLKTWFQTGLSPNCDIVIGIRDTSSGILED 351
           MD++N  +ET TELKCF  L +  + HR+KLLKTW QTGL PN DI+IG+RD+ SG L D
Sbjct: 294 MDAFNPVSETNTELKCFAPLSMHNSNHRRKLLKTWVQTGLLPNSDIMIGLRDSHSGQLLD 353

Query: 352 LLWYSRENMYQKLQDPSLPKFKNSFDFKPHIGIQWLNHCIHAIESAFTKDTSDTAS 407
           + WYSR+ + +K   P LP  K   ++   I ++W ++CI AI      + SD +S
Sbjct: 354 IQWYSRDLLCKKFNHPGLPTNKKELNYNAQIAVEWCHYCIEAICKLVEANISDYSS 409

>NDAI0B05690 Chr2 (1387153..1388424) [1272 bp, 423 aa] {ON}
           Anc_5.437 YDR370C
          Length = 423

 Score =  204 bits (518), Expect = 2e-60,   Method: Compositional matrix adjust.
 Identities = 118/351 (33%), Positives = 198/351 (56%), Gaps = 26/351 (7%)

Query: 60  IARIPFKHFSY-SNAHIGKSQPNIFQEAKGVALYYDKRITKITNNEAELINESNPPFLTK 118
           I  IPFK F + S +   K+  + F+ +K VALY++K++   ++++  LI     P L  
Sbjct: 36  ITTIPFKQFKHCSISTYPKTPSSFFETSKDVALYHNKQL--YSSDDTNLI-----PQLEP 88

Query: 119 DISNLS--EISLLDSKKFKLPYMGYNLYDEIEKFGPMDSTLLDSTVPCFEYLRTLKI-SE 175
            I+ L+    SL +++  KLPY+G +LYD  E F PMD   LDS  PCF+Y+ + ++ ++
Sbjct: 89  AIAKLANPSCSLNEARDLKLPYLGSDLYDGYESFIPMDPDELDSIEPCFKYIESWELQNK 148

Query: 176 EDKLYNTPYTFMTPRHHLTELMMTVYESRESELTGKSWLFTRIKDDLIVISEDLAKENNP 235
            D      +T ++ RHH+ E+ M ++  R+ +    +  +    + +++ S D+ K+++ 
Sbjct: 149 HDYQLGNKFTIVSARHHIVEMTMCIFNKRKMDDFILNVTYKGGSNGMLLFSRDVNKKDDG 208

Query: 236 SPQNHKLQNSFSKKVINSGFTFEELVIENFQECH------------KPYFYISENRLTPK 283
              +   ++   +K+  SGF  E+L+  N  + +            K  F I EN+L   
Sbjct: 209 GIYS---KDGVVRKISYSGFALEDLLTTNKNDHNADNSDVTLVGGDKAVFAIIENKLNDD 265

Query: 284 STFIIRSEMDSYNNKTETFTELKCFNKLHLGVAQHRKKLLKTWFQTGLSPNCDIVIGIRD 343
            + ++R EMDSYN   + FTE+KCF +L +    HR+KLLK W QTG+ PN DI+IGIRD
Sbjct: 266 ISLLLRCEMDSYNPVNKCFTEMKCFARLKMNNHNHRRKLLKAWVQTGVIPNSDILIGIRD 325

Query: 344 TSSGILEDLLWYSRENMYQKLQDPSLPKFKNSFDFKPHIGIQWLNHCIHAI 394
              G L D+ W+SR N+Y+++ + +LP+ K   ++   I +QW  HCI +I
Sbjct: 326 PMFGELNDIEWFSRMNLYRQINNRNLPEAKLDLNYNAEIAVQWSQHCIKSI 376

>Suva_2.542 Chr2 complement(968396..969724) [1329 bp, 442 aa] {ON}
           YDR370C (REAL)
          Length = 442

 Score =  204 bits (520), Expect = 2e-60,   Method: Compositional matrix adjust.
 Identities = 115/342 (33%), Positives = 188/342 (54%), Gaps = 19/342 (5%)

Query: 62  RIPFKHFSYSNAH--IGKSQPNIFQEAKGVALYYDKRITKITNNEAELINESNPPFLTKD 119
           R+P+  F +++      K  P+IF E+K VAL+ D ++      +         P L +D
Sbjct: 65  RVPYSSFLHTSIRNFPTKPPPDIFYESKEVALFTDNQLYVAARKDVI-------PNLKED 117

Query: 120 ISNLSEISLLDSKKFKLPYMGYNLYDEIEKFGPMDSTLLDSTVPCFEYLRTLKISEEDKL 179
           IS+L E  LL+++K K  Y+G +L+  I++  PM  + LD+  PC  Y+   +++   K 
Sbjct: 118 ISHLYESPLLEARKLKTLYLGLDLFANIDELVPMTISELDTIAPCISYIEDWRLNNSGKP 177

Query: 180 Y--NTPYTFMTPRHHLTELMMTVYESRESELTGKSWLFTRIKDDLIVISEDLAKENNPSP 237
           +     +T +T RHH+ +L M  ++ R  +   KS + T + +  I +S +   ++  S 
Sbjct: 178 FKIGKKFTVVTTRHHIVDLTMHPFDRRNKQ---KSIIATYMGNGFISLSRNPKYDHKASK 234

Query: 238 QNHKLQNSFSKKVINSGFTFEELVIENFQECHK-----PYFYISENRLTPKSTFIIRSEM 292
           +     +   KK+ +SGF FE  + EN +         P F I E +L+     ++R EM
Sbjct: 235 EGIYSGDPNIKKICHSGFEFENCLTENTKNSGSSASKCPVFSIVEGKLSEDIGLLMRCEM 294

Query: 293 DSYNNKTETFTELKCFNKLHLGVAQHRKKLLKTWFQTGLSPNCDIVIGIRDTSSGILEDL 352
           D++N  ++T TELKCF  L +  + HRKKLLKTW QTGL PN DI++G+RD+ SG L D+
Sbjct: 295 DAFNPVSKTNTELKCFGPLSMQNSSHRKKLLKTWIQTGLLPNSDIMVGLRDSYSGQLLDI 354

Query: 353 LWYSRENMYQKLQDPSLPKFKNSFDFKPHIGIQWLNHCIHAI 394
            WYSR+ +++K   P LP  K   ++   + ++W  HCI +I
Sbjct: 355 QWYSRDTLFRKFNHPGLPLNKKEMNYNAKVAVEWCKHCIKSI 396

>TDEL0B02180 Chr2 (388145..389401) [1257 bp, 418 aa] {ON} Anc_5.437
           YDR370C
          Length = 418

 Score =  197 bits (502), Expect = 5e-58,   Method: Compositional matrix adjust.
 Identities = 99/278 (35%), Positives = 164/278 (58%), Gaps = 9/278 (3%)

Query: 133 KFKLPYMGYNLYDEIEKFGPMDSTLLDSTVPCFEYLRTLKISEEDKLYNT-PYTFMTPRH 191
           K KLPY+G +LY   E++ P+ S+ LDS++ CFEY++  +  +  K +N+   T ++PRH
Sbjct: 113 KNKLPYIGCDLYQGHERYKPLPSSELDSSIACFEYIKKWERRKISKSFNSGKVTIISPRH 172

Query: 192 HLTELMMTVYESRESELTGKSWLFTRIKDDLIVISEDLAKENNPSPQNHKLQNSFSKKVI 251
           H+ +L+M ++   E  +     + T I    ++ S D +KE      +   +NS ++K+ 
Sbjct: 173 HVVDLVMALFHDDEVSI-----ICTNIGKGKLIFSGDRSKEERNGLNS---KNSMTRKIC 224

Query: 252 NSGFTFEELVIENFQECHKPYFYISENRLTPKSTFIIRSEMDSYNNKTETFTELKCFNKL 311
            SGF  E+ +  +  E   P++ I E ++  + + ++R EMD+YN     +TELKCF KL
Sbjct: 225 YSGFALEDKLTTSHDERMGPFYSIVEGKINERLSLLLRCEMDAYNPIFNRYTELKCFTKL 284

Query: 312 HLGVAQHRKKLLKTWFQTGLSPNCDIVIGIRDTSSGILEDLLWYSRENMYQKLQDPSLPK 371
           ++    HR+KLLKTW Q GL P+ D++IG RDT  G LEDL WYSR ++Y+K  +PS+ +
Sbjct: 285 NVQDTAHRRKLLKTWVQIGLIPDSDLIIGTRDTQVGQLEDLTWYSRGSLYKKFNNPSIAR 344

Query: 372 FKNSFDFKPHIGIQWLNHCIHAIESAFTKDTSDTASNP 409
                +F  +I ++W  HCI +I     K++  +  +P
Sbjct: 345 NNKYLNFNANIAVEWCFHCIESICDLVMKNSLSSPDDP 382

>ZYRO0F10098g Chr6 complement(818672..819793) [1122 bp, 373 aa] {ON}
           similar to uniprot|Q06349 Saccharomyces cerevisiae
           YDR370C Hypothetical ORF
          Length = 373

 Score =  192 bits (489), Expect = 1e-56,   Method: Compositional matrix adjust.
 Identities = 108/335 (32%), Positives = 184/335 (54%), Gaps = 23/335 (6%)

Query: 63  IPFKHFSYSNAHIGKSQP-NIFQEAKGVALYYDKRITKITNNEAELINESNPPFLTKDIS 121
           +PF  F +S+A    S+P N+F + K  + YY  ++    ++   L +  N     +  S
Sbjct: 16  VPFNQFQHSSAFRFPSEPRNLFTKYKEASYYYGGQLHDSISDSIGLKSPGNKLSHDRSCS 75

Query: 122 NLSEISLLDSKKFKLPYMGYNLYDEIEKFGPMDSTLLDSTVPCFEYLRTLKISEEDKL-Y 180
           N            K  ++G +LY   E F P+   +LDS+  C++++   +         
Sbjct: 76  N------------KRDFLGSDLYQGWEDFLPLSPEILDSSRGCYQWINKWENDNHTSYSQ 123

Query: 181 NTPYTFMTPRHHLTELMMTVYESRESELTGKSWLFTRIKDDLIVISEDLAKENNPSPQNH 240
            +P+  ++PRH+L EL M +++      +  S L T + D  IV+S+    EN+     H
Sbjct: 124 RSPFVVISPRHYLVELTMQLFQQ-----SKYSILCTHLGDGKIVLSQ---VENDKKSHQH 175

Query: 241 KLQNS-FSKKVINSGFTFEELVIENFQECHKPYFYISENRLTPKSTFIIRSEMDSYNNKT 299
             +N+  +KK+++SG+  E+L+    +    P+F I E  L    + ++R E+DSYN  T
Sbjct: 176 TSRNTTMTKKILHSGYALEDLLTRGPRVEDDPFFAIIEAELDANISLVLRCELDSYNELT 235

Query: 300 ETFTELKCFNKLHLGVAQHRKKLLKTWFQTGLSPNCDIVIGIRDTSSGILEDLLWYSREN 359
           ETFTELKC+  L++  A HR+KLLKTW Q  +SP CD++IG+R+T  G+L+DL +++ + 
Sbjct: 236 ETFTELKCYAPLNMHNAYHREKLLKTWIQLAISPRCDLLIGVRNTHMGLLQDLQYFTNKE 295

Query: 360 MYQKLQDPSLPKFKNSFDFKPHIGIQWLNHCIHAI 394
           +Y+K+ D +LPK    F++   + +QW  HCI +I
Sbjct: 296 LYRKINDRNLPKSPKRFNYNADLAVQWCQHCIRSI 330

>TBLA0A02800 Chr1 (675150..676511) [1362 bp, 453 aa] {ON} Anc_5.437
           YDR370C
          Length = 453

 Score =  193 bits (491), Expect = 4e-56,   Method: Compositional matrix adjust.
 Identities = 117/342 (34%), Positives = 193/342 (56%), Gaps = 28/342 (8%)

Query: 81  NIFQEAKGVALYYDKRITKITNNEAELINESNPPFLTKDISNLSEISLLDSKKFKLPYMG 140
           ++++ +K VA Y+   +    N +  + +    P L  DI  ++  SLLDSKK+K  Y+G
Sbjct: 58  DLYRTSKEVATYHLGNLN--INTDPTIEHTKGVPCLKDDICQIAGKSLLDSKKYKAKYIG 115

Query: 141 YNLYDEIEKFGPMDSTLLDSTVPCFEYLRTL--KISEEDKLY--NTPYTFMTPRHHLTEL 196
            +L+ + EK+  M+   L   + CF+Y++    K + E K Y  +  +  +T RHH+ +L
Sbjct: 116 ADLFKDYEKYHAMEKEPLHDPISCFKYIQYYDKKHANEKKKYGMDKEFVIITSRHHINDL 175

Query: 197 MMTVYES-RESELTGKSWLFTRIKDDLIVISEDLAKENNPSPQNHKLQNSFSKKVINSGF 255
           ++  ++   + E+   S L T + D+ I++S+D A E     +N +  NS  +K++NSGF
Sbjct: 176 VLAPFKKISDPEV---SVLLTYLGDNRILLSQDYAHEPPDWRENKQFYNSM-RKIVNSGF 231

Query: 256 TFEELVIENF-----------QECHKP-----YFYISENRLTPKSTFIIRSEMDSYNNKT 299
            FE+LVI+++           Q+   P     YF + EN ++PK T ++RSEMD YN  T
Sbjct: 232 AFEDLVIKDYTSSKLTPSLEEQQKKDPSITNNYFSVVENDISPKLTILLRSEMDGYNPLT 291

Query: 300 ETFTELKCFNKLHLGVAQHRKKLLKTWFQTGLSPNCDIVIGIRDTSSGILEDLLWYSREN 359
            ++TELKCF +L++G   HR+KLLKTW Q G  PN D+++G RDT +G+L D+ W+SR++
Sbjct: 292 NSYTELKCFTRLNMGSPFHRQKLLKTWVQIGQLPNSDLLVGSRDTQTGLLNDITWFSRDD 351

Query: 360 MYQKLQDPSLPKFKNSFDFKPHIGIQWLNHCIHAIESAFTKD 401
           +  K      P+ +   +  P     W  H + AI S  T+D
Sbjct: 352 LVTKCDSYYSPRLRFHQNTTPTNASAWYYHVLSAITS-LTRD 392

>NCAS0F03400 Chr6 complement(686480..687727) [1248 bp, 415 aa] {ON}
           Anc_5.437 YDR370C
          Length = 415

 Score =  185 bits (470), Expect = 2e-53,   Method: Compositional matrix adjust.
 Identities = 112/375 (29%), Positives = 193/375 (51%), Gaps = 30/375 (8%)

Query: 60  IARIPFKHFSYSNAHI--GKSQPNIFQEAKGVALYYDKRITKITNNEAELINESNPPFLT 117
           I R+PF  FS+S+  +    +QP  ++ +  VALY++ ++   +  + ++I     P L 
Sbjct: 23  ITRVPFGEFSHSSISLFPTCTQP-FYESSNQVALYHNHKLYPAS--QYDII-----PHLK 74

Query: 118 KDISNLSEISLLDSKKFKLPYMGYNLYDEIEKFGPMDSTLLDSTVPCFEYLRTLKISEED 177
            DI+ L + S  +++  K  Y+G +LYD  E F PM +  LDS  PC  +++  +     
Sbjct: 75  NDIAQLPKKSASEARTLKRSYLGSDLYDGFETFVPMSAKDLDSLEPCMSFIKDWERKAST 134

Query: 178 KLY-NTPYTFMTPRHHLTELMMTVYESRESELTGK--------SWLFTRIKDDLIVISED 228
           K      +  ++ RHH+ E+ M ++  + +             + ++T  +   ++ ++D
Sbjct: 135 KYKPGRKFNIVSTRHHIVEMTMKLFTGKTNNYNNTKKVQDYVLNVVYTGDETGRLLFTKD 194

Query: 229 LAKENNPSPQNHKLQNSFSKKVINSGFTFEELVIENFQECHK----------PYFYISEN 278
            +   N   +    +N   K++  SGF  E+L+ E   E  K            F + EN
Sbjct: 195 WSNTGNSMNEGIYSKNIILKRICYSGFALEDLMTETTSELEKEGEKLTGGEKAVFAVVEN 254

Query: 279 RLTPKSTFIIRSEMDSYNNKTETFTELKCFNKLHLGVAQHRKKLLKTWFQTGLSPNCDIV 338
           +L      ++R E+D++N   + FTELKCF+ L +    HR+KLLK W QTG+ P+ DI+
Sbjct: 255 KLDDDICILLRCELDAFNGAEKKFTELKCFSPLKMSNFSHRRKLLKAWVQTGVLPDSDIL 314

Query: 339 IGIRDTSSGILEDLLWYSRENMYQKLQDPSLPKFKNSFDFKPHIGIQWLNHCIHAIESAF 398
           IGIRD+S G LED+ WYSR+ +  K+ + +LP+ K  ++F   +  QW  HCI +I    
Sbjct: 315 IGIRDSSFGELEDVEWYSRDRLRSKINNRNLPESKIDWNFNAQVATQWSQHCIRSICKLV 374

Query: 399 TKDTSDTA-SNPMTY 412
            ++    A SNP  +
Sbjct: 375 DENLDQKAISNPQGF 389

>CAGL0A02860g Chr1 complement(300736..301944) [1209 bp, 402 aa] {ON}
           similar to uniprot|Q06349 Saccharomyces cerevisiae
           YDR370c
          Length = 402

 Score =  166 bits (419), Expect = 3e-46,   Method: Compositional matrix adjust.
 Identities = 100/325 (30%), Positives = 171/325 (52%), Gaps = 14/325 (4%)

Query: 77  KSQPNIFQEAKGVALYYDKRITKITNNEAELINESNPPFLTKDISNLSEISLLDSKKFKL 136
           K+ P  +  AK + +++D ++ ++  N  +L      P L   I+++++ +  +  +   
Sbjct: 57  KNMPQFYDSAKTLGIFHDHKLYEM--NRMDLF-----PQLKDPIAHIAKSTPAEKTQLVR 109

Query: 137 PYMGYNLYDEIEKFGPMDSTLLDSTVPCFEYLRTLKISEEDKL-YNTPYTFMTPRHHLTE 195
           P++G +LY+  +K+ PM +  LD+T  C  YL   + S   K   +  +  +T RHH+ +
Sbjct: 110 PFLGISLYENHDKYSPMTAKELDTTEACSTYLDQYENSHGQKYGEDRDFVIVTARHHMID 169

Query: 196 LMMTVYESRESELTGKSWLFTRIKDDLIVISEDLAKENNPSPQNHKLQNSFSKKVINSGF 255
           L +  +     + T  + L      +L+ IS+D A +N          N   KK+  SGF
Sbjct: 170 LAILPFSR---QFTNVNLLCAYTPGNLLEISQDPA-DNTNDKVGVNTDNPILKKICFSGF 225

Query: 256 TFEELVIENFQ-ECHKPYFYISENRLTPKSTFIIRSEMDSYNNKTETFTELKCFNKLHLG 314
             E+++ E+   E   P F I EN +   +  ++R E+D+YN  T  +TELKC+ K + G
Sbjct: 226 ALEDILTESANDEERNPTFLIVENEIA-NTRLLMRCEIDAYNPITSHYTELKCYAKYNFG 284

Query: 315 VAQHRKKLLKTWFQTGLSPNCDIVIGIRDTSSGILEDLLWYSRENMYQKLQDPSLPKFKN 374
              HR+KLLK+W QTG+ P  DIVIG+RDT SG L+D+  Y+R  +Y KL   SLP+  +
Sbjct: 285 NPNHRRKLLKSWIQTGVIPTTDIVIGVRDTESGCLQDVRCYNRNLLYNKLISKSLPRCDS 344

Query: 375 SFDFKPHIGIQWLNHCIHAIESAFT 399
             ++ P I + W    I+ + +   
Sbjct: 345 ELNYDPAISVVWYRSLINTLTTTIA 369

>KNAG0C04890 Chr3 (945616..946833) [1218 bp, 405 aa] {ON} Anc_5.437
           YDR370C
          Length = 405

 Score =  144 bits (362), Expect = 5e-38,   Method: Compositional matrix adjust.
 Identities = 103/341 (30%), Positives = 177/341 (51%), Gaps = 18/341 (5%)

Query: 62  RIPFKHFSYSNAHIGKSQP-NIFQEAKGVALYYDKRITKITNNEAELINESNPPFLTKDI 120
           R+ FK F + +     S+P +IFQ++K VA Y      K+  N+    N +  P L +DI
Sbjct: 27  RVRFKEFHHHDPGKYVSKPAHIFQKSKEVACYTG---GKLYINDGNTTNLTILPLLKEDI 83

Query: 121 SNLSEI-SLLDSKKFKLPYMGYNLYDEIEKFG-PMDSTLLDSTVPCFEYLRTL-KISEED 177
           + L++  +   S  FK  Y+G +LY   E +   M   +LDS  PC +Y+    + S+ +
Sbjct: 84  AALAQSKNTQKSGSFKSKYLGLSLYAGFEDYVFTMSPDMLDSAKPCLDYINEWNRGSKGE 143

Query: 178 KLYNTPY--TFMTPRHHLTELMMTVYESRESELTGKSWLFTRIKDDLIVISE-DLAKENN 234
           K +   Y    + PRHHL EL M ++ + +S+      + T ++   IV+S+ D   + N
Sbjct: 144 KKFGESYRHIIVGPRHHLVELTMALF-ANDSDY---KLVCTVLRGKFIVLSQFDDGSQRN 199

Query: 235 PSPQNHKLQNSFSKKVINSGFTFEELVIENFQECHKPYFYISEN-RLTPKSTFIIRSEMD 293
            + +   L +  ++ +  SGF   ++   N       +FY     R    +TF    EMD
Sbjct: 200 RN-EGITLSDRRTRMLCYSGFVICKIWSLNRGIIPSQFFYYGTPIRRGHLATFT--CEMD 256

Query: 294 SYNNKTETFTELKCFNKLHLGVAQHRKKLLKTWFQTGLSPNCDIVIGIRDTSSGILEDLL 353
           +YN     +TELKC+  L++  + H+ KLL+TW QT +SP+ D+VIG R+   G L+D+ 
Sbjct: 257 AYNQIENHYTELKCYGPLNMKSSYHKSKLLRTWVQTEVSPDTDVVIGCRNAYDGTLQDIT 316

Query: 354 WYSRENMYQKLQDPSLPKFKNSFDFKPHIGIQWLNHCIHAI 394
             SRE++Y+K  +   P+   +F++   + ++W  + + AI
Sbjct: 317 QLSRESLYRKFNNKHQPRAHTNFNYNAQVAVEWSQYAMKAI 357

>SAKL0G02596g Chr7 complement(214675..215877) [1203 bp, 400 aa] {ON}
           weakly similar to uniprot|Q06349 Saccharomyces
           cerevisiae YDR370C Hypothetical ORF
          Length = 400

 Score =  135 bits (341), Expect = 5e-35,   Method: Compositional matrix adjust.
 Identities = 99/348 (28%), Positives = 174/348 (50%), Gaps = 25/348 (7%)

Query: 66  KHFSYSNAHIGKSQP-NIFQEAKGVALYYDKRITKITNNEAELINES---NPPFLTKDIS 121
           K F +SN     S P   FQE++ +  +     T++ ++   L ++     P  L  DI 
Sbjct: 28  KGFVHSNVSHFPSVPCKFFQESREIGTF-----TRMVSSGKYLFDDKLGLRP--LKDDIC 80

Query: 122 NLSEISLLDSKKFKLPYMGYNLYDEIEKFGPMDSTLLDSTVPCFEYLRTLKISEEDKLYN 181
                   ++ K K  Y+GY+L +  E + P+    L++      ++   +  +  K Y 
Sbjct: 81  EYIHNPAKNASKIKTQYLGYDLLNGFEDYIPLSEDELNNMDGILNFIGNWE-EKNGKKYG 139

Query: 182 T--PYTFMTPRHHLTELMMTVYESRESELTGKSWLFTRIKDDLIVISEDLAKENNPSPQN 239
           +   +T ++ RHHL +L+M  +   E+ L     + T + D L++IS D +K    S   
Sbjct: 140 SENKFTIVSNRHHLIDLIMCPFSLEEANL-----IVTHL-DGLLIISSDKSKPKVDSGIR 193

Query: 240 HKLQNSFSKKVINSGFTFEELVIENFQEC---HKPYFYISENRLTPKSTFIIRSEMDSYN 296
            K  ++  +K+  +GF  E LV +   +    H  ++ I EN+LT   + ++++EMDSYN
Sbjct: 194 SK--DTRVRKLCYTGFELENLVTKGKVDSPGMHTCFYSIVENKLTEGVSLLLQAEMDSYN 251

Query: 297 NKTETFTELKCFNKLHLGVAQHRKKLLKTWFQTGLSPNCDIVIGIRDTSSGILEDLLWYS 356
            KT+ + ELKC     L  + HR+KLL+ W QTGL P  D+++G RD     L+ L  Y+
Sbjct: 252 PKTDNYVELKCSVNFQLKNSNHRRKLLRMWIQTGLVPRTDLLVGFRDPYYNQLDALKPYT 311

Query: 357 RENMYQKLQDPSLPKFKNSFDFKPHIGIQWLNHCIHAIESAFTKDTSD 404
           R+ +Y+K    +L + +  ++F   + +QW +H I  I     K+ +D
Sbjct: 312 RDEIYKKFSTRNLNENRKYYNFNSTVAVQWSHHVIAKITELVDKNLTD 359

>KLLA0E02245g Chr5 complement(210001..211212) [1212 bp, 403 aa] {ON}
           weakly similar to uniprot|Q06349 Saccharomyces
           cerevisiae YDR370C Hypothetical ORF
          Length = 403

 Score =  127 bits (320), Expect = 4e-32,   Method: Compositional matrix adjust.
 Identities = 96/304 (31%), Positives = 154/304 (50%), Gaps = 21/304 (6%)

Query: 100 ITNNEAELINE-SNPPFLTKDISNLSEISLLDSKKFKLPYMGYNLYDEIEKFGPMDSTLL 158
           I N+   L NE S  P L  ++    + S  ++K  K  ++G +L    + + P+D  +L
Sbjct: 75  IINDATLLWNEASRKPRLRPEVCTYIKDSKWENKAVKDSFIGIDLTKGYDDYVPLDRNVL 134

Query: 159 DSTVPCFE-YLRTLKISEEDKLYNTPYTFMTPRHHLTELMMTVYESRESELTGKSWLFTR 217
           +S V   E Y R  K    +K      TF++ RHH+ +++M  +      L     L T 
Sbjct: 135 NSLVILKEAYQRYEKTLNPEKT-----TFVSLRHHIIDIIMCPFLDEPLSL-----LMTV 184

Query: 218 IKDDLIVISEDLAKENNPSPQN-HKLQNSFSKKVINSGFTFEELVIENFQECH----KPY 272
             D  I+IS D +K+    P   H+ +NSF+KK+  +GF  E+L+IE+  E H    + Y
Sbjct: 185 QPDKNILISVDKSKD---KPNGIHETRNSFNKKICYTGFALEDLLIESPTEGHILEHELY 241

Query: 273 FYISENRLTPKSTFIIRSEMDSYNNKTETFTELKCFNKLHLGVAQHRKKLLKTWFQTGLS 332
           + I    L  +   +I++EMDS N  T+T+TE+K      LG   HR+KLL+ W QT L 
Sbjct: 242 YSIVHGSLNDEIDLLIQAEMDSINTLTDTYTEIKSSVHFKLGNTYHRRKLLRMWIQTNLL 301

Query: 333 PNCDIVIGIRDTSSGILEDLLWYSRENMYQKLQDPSLPKFKNSF-DFKPHIGIQWLNHCI 391
           P  D++IG R++ S  LE L  Y  +++Y K+ + S+      F  F P++   W  H  
Sbjct: 302 PKSDLLIGFRNSYSNELEQLKAYKIQDIYHKINNSSIVGKPGKFYKFNPNVANDWFQHIF 361

Query: 392 HAIE 395
             ++
Sbjct: 362 QVLK 365

>KLTH0F15994g Chr6 (1298649..1299821) [1173 bp, 390 aa] {ON} weakly
           similar to uniprot|Q06349 Saccharomyces cerevisiae
           YDR370C Hypothetical ORF
          Length = 390

 Score =  115 bits (287), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 82/325 (25%), Positives = 151/325 (46%), Gaps = 33/325 (10%)

Query: 100 ITNNEAELINESNPPFLTKDISNLSEISLLDSKKFKLPYMGYNLYDEIEKFGPMDSTLLD 159
           I +++ EL  + + P L KD+   +    L        Y+G++L +  + F P+    L+
Sbjct: 53  IDSDKFELGRKQSAPHLKKDLGLFTITKKLAKTN---SYVGHDLLEHYDDFQPLTPNQLE 109

Query: 160 STVPCFEYLRTLKISEEDKLYNTP--YTFMTPRHHLTELMMTVYESRESE-----LTGKS 212
                FE+L   +  +  K Y++   +T +  RH+L +L+M  +   +       + G  
Sbjct: 110 DMSGVFEFLNKWE-GDHGKPYSSGSDFTIVCSRHNLIDLIMAPFSDEDVHFNVKYINGYL 168

Query: 213 WLFT----RIKDDLIVISEDLAKENNPSPQNHKLQNSFSKKVINSGFTFEELVIENFQEC 268
            +F     + KDD I  SE                 S  +++  +GF  E+LV E     
Sbjct: 169 HIFPDKQFQKKDDGIYSSE-----------------SNIRRICYTGFELEDLVTETQPGA 211

Query: 269 HKPYFY-ISENRLTPKSTFIIRSEMDSYNNKTETFTELKCFNKLHLGVAQHRKKLLKTWF 327
            K  FY + + +++     + ++EMD +N    ++TE+KC   L +  A HR+KLL+ W 
Sbjct: 212 PKSAFYSLVQGKISKNIKLLFKAEMDCFNPAKRSYTEIKCTTGLKVKSAFHRRKLLRMWV 271

Query: 328 QTGLSPNCDIVIGIRDTSSGILEDLLWYSRENMYQKLQDPSLPKFKNSFDFKPHIGIQWL 387
           QT L P+ D++IG+RD     L     Y+R+ +YQK  + +L   K  +++  +I +QW 
Sbjct: 272 QTSLVPSTDLLIGLRDPYYHQLSSFECYTRQELYQKFNNRNLSLLKKKYNYNANISVQWF 331

Query: 388 NHCIHAIESAFTKDTSDTASNPMTY 412
            H +  +    T     T +  +++
Sbjct: 332 RHLVKRLCQTITPYVEKTPTEAVSF 356

>AER404C Chr5 complement(1412412..1413572) [1161 bp, 386 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDR370C
          Length = 386

 Score =  114 bits (285), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 95/362 (26%), Positives = 172/362 (47%), Gaps = 29/362 (8%)

Query: 58  DIIARIPFKHFSYSN-AHIGKSQP-NIFQEAKGVALYYDKRITKITNNEAELINESNPPF 115
           D+I  +  K F +      GK +   IF E++ V   + + +        +L ++ N P 
Sbjct: 20  DLIVNVNMKKFPHGPITRRGKERSIRIFSESREVGTAFRQGLV------YDLDDKKNLPL 73

Query: 116 LTKDISNLSEISLLDSKKFKLPYMGYNLYDEIEKFGPMDSTLLDSTVPCFEYLRTLKISE 175
           L  +I    E     SK   + Y+G +L  E E F P+ S  L       +++   +   
Sbjct: 74  LNDEIC---EYISHRSKSKLIGYVGSDLSVESETFHPVTSEELHCLHGLLKFIAKWEADN 130

Query: 176 E-DKLYNTPYTFMTPRHHLTELMMTVYESRESELTGKSWLFTRIKDDLIVISEDLAKENN 234
           E +    + +T ++PRHH+ +++M  + +    L     +FT  +  L VI+  LA    
Sbjct: 131 EVNYASRSKFTIVSPRHHILDILMIPFGNERCRL-----VFTAHRG-LFVIT--LAPSQR 182

Query: 235 PSPQNHKLQNSFSKKVINSGFTFEELVIENFQECHKPYFYISENRLTPKSTFIIRSEMDS 294
           P+  N    +S ++K+  +GF  E L+          ++   E +L P  T +++ EMD+
Sbjct: 183 PTGINSP--SSATRKICYTGFELERLLTATSGTERGSFYSFIEAKLEPDITILLQCEMDA 240

Query: 295 YNNKTETFTELKCFNKLHLGVAQHRKKLLKTWFQTGLSPNCDIVIGIRDTSSGILEDLLW 354
           YN K + +TE+K     ++   +H  KLLK W QT L P+ DI++G RD S+ +L+ ++ 
Sbjct: 241 YNPKRQKYTEIKSSVDFNVRNVRHLSKLLKIWAQTALLPSTDILVGFRDPSTHVLKTVVP 300

Query: 355 YSRENMYQKL----QDPSLPKFKNSFDFKPHIGIQWLNHCIHAIESAFTKDTSDTASNPM 410
           YS + + +KL    +  S P +   F+F P +   W ++ I  I    +     T+S+P 
Sbjct: 301 YSVDQIAEKLYIRDRTRSHPSY---FNFNPEVAKDWTHYAIREICERLSSLVDATSSSPQ 357

Query: 411 TY 412
           ++
Sbjct: 358 SF 359

>Kwal_55.21415 s55 (826461..827630) [1170 bp, 389 aa] {ON} YDR370C -
           Hypothetical ORF [contig 130] FULL
          Length = 389

 Score =  112 bits (279), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 80/332 (24%), Positives = 158/332 (47%), Gaps = 22/332 (6%)

Query: 69  SYSNAHIGKSQPNI---FQEAKGVALYYDKRITKITNNEAELINES-NPPFLTKDISNLS 124
           ++ +A I +   N+   F E + VA      IT + + +  L+++    P L +D+   +
Sbjct: 23  NFQHAQINQFPKNVLPFFDEVQEVA-----TITHLLDTDEFLLDDKLGMPELVQDLCEFT 77

Query: 125 EISLLDSKKFKLPYMGYNLYDEIEKFGPMDSTLLDSTVPCFEYL-RTLKISEEDKLYNTP 183
           E   L +K     Y+G++L D  +++ P+    L+       +L R  ++       N  
Sbjct: 78  ESGKLANKG---KYIGHDLLDHFDEYVPITPKQLEDMAGVQAFLERWKQLHGRSFCDNAD 134

Query: 184 YTFMTPRHHLTELMMTVYESRESELTGKSWLFTRIKDDLIVISEDLAKENNPSPQNHKLQ 243
           +T +  RH+L +L+M  +   +  L        +  +  + +S D   +   + Q     
Sbjct: 135 FTIVCSRHNLIDLIMMPFSDEDVHLK------IQFSNGYLNLSPD--AQYQKTDQGIHSG 186

Query: 244 NSFSKKVINSGFTFEELVIENFQECHKPYFY-ISENRLTPKSTFIIRSEMDSYNNKTETF 302
           ++  KK+  +GF  E L+    +   +  FY + E +L      ++++EMD +N+ T ++
Sbjct: 187 DTKIKKICYTGFELENLITATSKPDVRSSFYSLVEGKLGDGIKLLLKAEMDCFNSSTRSY 246

Query: 303 TELKCFNKLHLGVAQHRKKLLKTWFQTGLSPNCDIVIGIRDTSSGILEDLLWYSRENMYQ 362
           TE+KC + L +    HR+KLL+ W QT L P+ ++++GIRD     L     Y+R  +Y+
Sbjct: 247 TEIKCSSGLKVKSTYHRRKLLRMWVQTSLVPSTNLLVGIRDPYYHQLTSFECYTRSQLYR 306

Query: 363 KLQDPSLPKFKNSFDFKPHIGIQWLNHCIHAI 394
           K  +  L   + ++++   I +QW  H I  +
Sbjct: 307 KFNNQRLTVMRKNYNYNATISVQWFRHVIQQL 338

>Skud_13.358 Chr13 (619721..620842) [1122 bp, 373 aa] {ON} YMR191W
           (REAL)
          Length = 373

 Score = 33.5 bits (75), Expect = 0.94,   Method: Compositional matrix adjust.
 Identities = 19/56 (33%), Positives = 30/56 (53%), Gaps = 2/56 (3%)

Query: 65  FKHFSYSNAHIGKSQPNIFQE--AKGVALYYDKRITKITNNEAELINESNPPFLTK 118
           F+H SY ++     QP  F++   K +    D  + KI   + ++INESNP F+ K
Sbjct: 165 FQHASYVDSCQNDVQPVAFKKLSQKDIKFIRDLELFKIMKTQNQMINESNPCFVEK 220

>NDAI0I03260 Chr9 (765221..766354) [1134 bp, 377 aa] {ON} Anc_3.570
          Length = 377

 Score = 33.1 bits (74), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 17/44 (38%), Positives = 22/44 (50%), Gaps = 2/44 (4%)

Query: 302 FTELKCFNKLHLGVAQHR--KKLLKTWFQTGLSPNCDIVIGIRD 343
           + ELKC  ++      HR  +KL KTW Q  L     I+ G RD
Sbjct: 227 YAELKCSTQIITAADAHRFERKLFKTWLQCFLVGIPRIIYGFRD 270

>Kwal_47.19276 s47 (1168248..1169408) [1161 bp, 386 aa] {ON} YGL246C
           (RAI1) - Product of gene unknown [contig 344] FULL
          Length = 386

 Score = 32.7 bits (73), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 34/128 (26%), Positives = 50/128 (39%), Gaps = 28/128 (21%)

Query: 227 EDLAKENNPSPQNHKLQ-NSFSKKVINSGFTFEELVIENFQECHKPYFYISENRLTPKST 285
           E LA  + P PQ  +      SKK+ N+G  F  +V      C                 
Sbjct: 166 ESLATLSKPLPQTPRSSLEKRSKKICNNGDQFVTVVRSGVGNCK---------------- 209

Query: 286 FIIRSEMDSY-------NNKTETFTELKCFNKLHLGVAQHR---KKLLKTWFQTGLSPNC 335
            ++ +E+D         +N  + + ELKC   +    A+ R   +KL KTW Q  L    
Sbjct: 210 LVLGAEVDCVFDFAEDTSNNLKHYAELKCTKGVST-FAEARSFERKLFKTWLQCFLVGIN 268

Query: 336 DIVIGIRD 343
            I+ G RD
Sbjct: 269 RIIYGFRD 276

>KLLA0E12893g Chr5 complement(1140409..1141563) [1155 bp, 384 aa]
           {ON} similar to uniprot|P53063 Saccharomyces cerevisiae
           YGL246C RAI1 Nuclear protein that binds to and
           stabilizes the exoribonuclease Rat1p required for
           pre-rRNA processing
          Length = 384

 Score = 32.3 bits (72), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 27/105 (25%), Positives = 43/105 (40%), Gaps = 25/105 (23%)

Query: 248 KKVINSGFTFEELVIENFQECHKPYFYISENRLTPKSTFIIRSEMDSY-------NNKTE 300
           KK+IN+G  F  +V     +C                  +I +E+D         ++  +
Sbjct: 190 KKIINNGDQFISMVRTGIGKCK----------------ILIGAEVDCIFDFKEDSDDNLK 233

Query: 301 TFTELKCFNKLHLGVAQHR--KKLLKTWFQTGLSPNCDIVIGIRD 343
            + ELKC   ++     H+  +KL KTW Q  L     I+ G RD
Sbjct: 234 HYAELKCTTMVNTVSDAHKFERKLFKTWLQCFLVGINRIIYGFRD 278

>NDAI0D02040 Chr4 complement(478943..482386) [3444 bp, 1147 aa] {ON}
           Anc_5.174 YGR170W
          Length = 1147

 Score = 31.6 bits (70), Expect = 5.3,   Method: Compositional matrix adjust.
 Identities = 51/239 (21%), Positives = 89/239 (37%), Gaps = 33/239 (13%)

Query: 68  FSYSNAHIGKSQPNIFQEAKGVALYYDKRITKITNNEAELINESNPPFLTKDISNLSEIS 127
            +Y    +G +  NI  E +   +  +++I+        +I         K  S L  +S
Sbjct: 778 LTYGKYVLGSNNANILVEDRDTGIIIEEKISAHVKLGMRIIYNGKGKESKKFKSLLKSMS 837

Query: 128 LLDSKKFKLPYMGYNLYDEIEKFGPMD-STLLDSTVPCFE--YLRTLKISEEDKLYNTPY 184
           +   +KF  P     +   IE F  +D S  LD+    F   + R LK        N P 
Sbjct: 838 IRQGRKFDSPVSVKQIKPFIE-FHSLDLSDCLDTEYKTFNEFFYRKLKPGSRLPESNDPR 896

Query: 185 TFMTPRHHLTELMMTVYESRESELTGKSWLFTRIKDDLIVISEDLAKENNPSPQNHKLQN 244
             ++P      +  TV++S+E  + G  +   R+                   QNH+L +
Sbjct: 897 VLISPADSRCTMFSTVHQSKEIWIKGDKFSIGRLT------------------QNHRL-D 937

Query: 245 SFSKKVINSGFTFEELVIENFQECHKPY-------FYISENRLTPKSTFIIRSEMDSYN 296
            F+ K  + G     L  +++   H P         Y+  N  T  +   +RSE+D + 
Sbjct: 938 MFNDKSCSLGIF--RLAPQDYHRFHSPCNGKILKPIYVEGNYYTV-NPMAVRSELDIFG 993

>KAFR0C02170 Chr3 (431896..434289) [2394 bp, 797 aa] {ON} Anc_6.191
           YGL083W
          Length = 797

 Score = 31.2 bits (69), Expect = 6.7,   Method: Compositional matrix adjust.
 Identities = 25/85 (29%), Positives = 36/85 (42%), Gaps = 11/85 (12%)

Query: 250 VINSGFTFEELVIENFQECHKPYF---------YISENRL--TPKSTFIIRSEMDSYNNK 298
           ++N  +T  E+V EN   C   YF         Y  +N +     S+   RSE   +  K
Sbjct: 222 ILNLNYTAPEIVFENTISCKNDYFSLGLLINFLYSGKNDIINAENSSSQYRSEYTKFERK 281

Query: 299 TETFTELKCFNKLHLGVAQHRKKLL 323
             T +   CFNKL   + Q   KL+
Sbjct: 282 ISTMSWDNCFNKLPSKLQQLMPKLM 306

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.316    0.133    0.393 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 49,516,016
Number of extensions: 2277843
Number of successful extensions: 6727
Number of sequences better than 10.0: 45
Number of HSP's gapped: 6921
Number of HSP's successfully gapped: 45
Length of query: 441
Length of database: 53,481,399
Length adjustment: 113
Effective length of query: 328
Effective length of database: 40,524,141
Effective search space: 13291918248
Effective search space used: 13291918248
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 67 (30.4 bits)