Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
TPHA0J016008.773ON46146121230.0
Smik_13.4468.773ON45846215890.0
YMR238W (DFG5)8.773ON45844515860.0
Suva_13.4228.773ON45845415650.0
Skud_13.4078.773ON45846215630.0
NCAS0C008108.773ON45146115430.0
Kpol_1030.208.773ON45146215320.0
CAGL0M05049g8.773ON45346315300.0
SAKL0B05412g8.773ON45146315170.0
NDAI0K008408.773ON45946215140.0
TDEL0B033608.773ON43644714680.0
TBLA0B033208.773ON45045614610.0
KNAG0J007008.773ON46344814590.0
KLLA0F24926g8.773ON45145814470.0
KAFR0B034908.773ON45145014330.0
Kwal_55.202668.773ON45746814160.0
KLTH0E04048g8.773ON45445814150.0
ZYRO0F12210g8.773ON45346414150.0
NCAS0A08740singletonON43437413560.0
AFR530W8.773ON45938313330.0
Ecym_14748.773ON45445913300.0
NCAS0A08730singletonON63136813301e-179
ACL200WsingletonON46338112671e-172
ACL201WsingletonON44838112581e-171
TBLA0C03850singletonON56737012581e-169
ACL202WsingletonON45037811941e-161
SAKL0D13574g2.570ON45137610801e-144
KLTH0D08008g2.570ON44836910691e-142
KAFR0A021702.570ON44937510571e-140
TPHA0I024702.570ON45238110571e-140
CAGL0L01727g2.570ON44638010511e-139
KLLA0E07723g2.570ON45038210491e-139
YKL046C (DCW1)2.570ON44937710471e-139
Suva_11.1802.570ON45038510431e-138
KAFR0I017402.570ON44837710401e-138
Smik_11.2022.570ON44938510401e-138
NDAI0C006802.570ON45236410371e-137
Kwal_26.82252.570ON44937010341e-137
Skud_11.1832.570ON44938410341e-137
NDAI0B015102.570ON44737710291e-136
NCAS0H029002.570ON45337310261e-135
KNAG0A071802.570ON46337710271e-135
NCAS0A127502.570ON44736510241e-135
TBLA0H02590singletonON45038810211e-135
TBLA0H02580singletonON44938610161e-134
Kpol_1056.42.570ON4503849951e-131
TDEL0B065802.570ON4473829891e-130
TBLA0H026002.570ON4493839861e-129
Ecym_45772.570ON4503829741e-128
ABR060W2.570ON4513679471e-124
ZYRO0E06380g2.570ON4533759461e-123
Smik_12.1818.308ON86091800.30
Suva_10.2068.308ON86266780.65
Skud_12.1878.308ON86166761.2
TPHA0C009208.308ON82292741.8
YLR115W (CFT2)8.308ON85966723.4
TBLA0G01510singletonON214365705.0
Kpol_1036.598.308ON82166688.7
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= TPHA0J01600
         (461 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

TPHA0J01600 Chr10 complement(371534..372919) [1386 bp, 461 aa] {...   822   0.0  
Smik_13.446 Chr13 (730295..731671) [1377 bp, 458 aa] {ON} YMR238...   616   0.0  
YMR238W Chr13 (746353..747729) [1377 bp, 458 aa] {ON}  DFG5Putat...   615   0.0  
Suva_13.422 Chr13 (727776..729152) [1377 bp, 458 aa] {ON} YMR238...   607   0.0  
Skud_13.407 Chr13 (720539..721915) [1377 bp, 458 aa] {ON} YMR238...   606   0.0  
NCAS0C00810 Chr3 complement(144534..145889) [1356 bp, 451 aa] {O...   598   0.0  
Kpol_1030.20 s1030 complement(37060..38049,38052..38417) [1356 b...   594   0.0  
CAGL0M05049g Chr13 (547489..548850) [1362 bp, 453 aa] {ON} simil...   593   0.0  
SAKL0B05412g Chr2 (466158..467513) [1356 bp, 451 aa] {ON} highly...   588   0.0  
NDAI0K00840 Chr11 complement(190148..191527) [1380 bp, 459 aa] {...   587   0.0  
TDEL0B03360 Chr2 complement(601081..602391) [1311 bp, 436 aa] {O...   570   0.0  
TBLA0B03320 Chr2 complement(774913..776265) [1353 bp, 450 aa] {O...   567   0.0  
KNAG0J00700 Chr10 complement(121298..122689) [1392 bp, 463 aa] {...   566   0.0  
KLLA0F24926g Chr6 complement(2321928..2323283) [1356 bp, 451 aa]...   561   0.0  
KAFR0B03490 Chr2 (723671..725026) [1356 bp, 451 aa] {ON} Anc_8.7...   556   0.0  
Kwal_55.20266 s55 complement(327537..328910) [1374 bp, 457 aa] {...   550   0.0  
KLTH0E04048g Chr5 complement(369100..370464) [1365 bp, 454 aa] {...   549   0.0  
ZYRO0F12210g Chr6 (992529..993890) [1362 bp, 453 aa] {ON} simila...   549   0.0  
NCAS0A08740 Chr1 (1727048..1728352) [1305 bp, 434 aa] {ON}            526   0.0  
AFR530W Chr6 (1388049..1389428) [1380 bp, 459 aa] {ON} Syntenic ...   518   0.0  
Ecym_1474 Chr1 (976393..977757) [1365 bp, 454 aa] {ON} similar t...   516   0.0  
NCAS0A08730 Chr1 (1724401..1726296) [1896 bp, 631 aa] {ON}            516   e-179
ACL200W Chr3 (12145..13536) [1392 bp, 463 aa] {ON} Non-syntenic ...   492   e-172
ACL201W Chr3 (10277..11623) [1347 bp, 448 aa] {ON} Non-syntenic ...   489   e-171
TBLA0C03850 Chr3 (921692..923395) [1704 bp, 567 aa] {ON}              489   e-169
ACL202W Chr3 (8390..9742) [1353 bp, 450 aa] {ON} Non-syntenic ho...   464   e-161
SAKL0D13574g Chr4 (1125011..1126366) [1356 bp, 451 aa] {ON} high...   420   e-144
KLTH0D08008g Chr4 (680735..682081) [1347 bp, 448 aa] {ON} highly...   416   e-142
KAFR0A02170 Chr1 (454336..455685) [1350 bp, 449 aa] {ON} Anc_2.5...   411   e-140
TPHA0I02470 Chr9 (550108..551466) [1359 bp, 452 aa] {ON} Anc_2.5...   411   e-140
CAGL0L01727g Chr12 complement(184249..185589) [1341 bp, 446 aa] ...   409   e-139
KLLA0E07723g Chr5 complement(691980..693332) [1353 bp, 450 aa] {...   408   e-139
YKL046C Chr11 complement(351275..352624) [1350 bp, 449 aa] {ON} ...   407   e-139
Suva_11.180 Chr11 complement(334319..335671) [1353 bp, 450 aa] {...   406   e-138
KAFR0I01740 Chr9 complement(352631..353977) [1347 bp, 448 aa] {O...   405   e-138
Smik_11.202 Chr11 complement(337711..339060) [1350 bp, 449 aa] {...   405   e-138
NDAI0C00680 Chr3 complement(132980..134338) [1359 bp, 452 aa] {O...   404   e-137
Kwal_26.8225 s26 (696173..697522) [1350 bp, 449 aa] {ON} YKL046C...   402   e-137
Skud_11.183 Chr11 complement(330975..332324) [1350 bp, 449 aa] {...   402   e-137
NDAI0B01510 Chr2 complement(354643..355986) [1344 bp, 447 aa] {O...   400   e-136
NCAS0H02900 Chr8 (566940..568301) [1362 bp, 453 aa] {ON} Anc_2.570    399   e-135
KNAG0A07180 Chr1 (1127961..1129352) [1392 bp, 463 aa] {ON}            400   e-135
NCAS0A12750 Chr1 (2516616..2517959) [1344 bp, 447 aa] {ON} Anc_2...   399   e-135
TBLA0H02590 Chr8 complement(612543..613895) [1353 bp, 450 aa] {O...   397   e-135
TBLA0H02580 Chr8 complement(610287..611636) [1350 bp, 449 aa] {O...   395   e-134
Kpol_1056.4 s1056 complement(6537..7889) [1353 bp, 450 aa] {ON} ...   387   e-131
TDEL0B06580 Chr2 (1164804..1166147) [1344 bp, 447 aa] {ON} Anc_2...   385   e-130
TBLA0H02600 Chr8 complement(614887..616236) [1350 bp, 449 aa] {O...   384   e-129
Ecym_4577 Chr4 complement(1128622..1129974) [1353 bp, 450 aa] {O...   379   e-128
ABR060W Chr2 (504045..505400) [1356 bp, 451 aa] {ON} Syntenic ho...   369   e-124
ZYRO0E06380g Chr5 (484736..486097) [1362 bp, 453 aa] {ON} simila...   369   e-123
Smik_12.181 Chr12 (359296..361878) [2583 bp, 860 aa] {ON} YLR115...    35   0.30 
Suva_10.206 Chr10 (385842..388430) [2589 bp, 862 aa] {ON} YLR115...    35   0.65 
Skud_12.187 Chr12 (360900..363485) [2586 bp, 861 aa] {ON} YLR115...    34   1.2  
TPHA0C00920 Chr3 complement(192829..195297) [2469 bp, 822 aa] {O...    33   1.8  
YLR115W Chr12 (377985..380564) [2580 bp, 859 aa] {ON}  CFT2Subun...    32   3.4  
TBLA0G01510 Chr7 (401330..407761) [6432 bp, 2143 aa] {ON}              32   5.0  
Kpol_1036.59 s1036 (166830..169295) [2466 bp, 821 aa] {ON} (1668...    31   8.7  

>TPHA0J01600 Chr10 complement(371534..372919) [1386 bp, 461 aa] {ON}
           Anc_8.773 YMR238W
          Length = 461

 Score =  822 bits (2123), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 410/461 (88%), Positives = 410/461 (88%)

Query: 1   MFYLTLLGLISQILYASAITLDVDSKDSVCEATALIQKGMLDYYQGTRYGGTVGMFQPPY 60
           MFYLTLLGLISQILYASAITLDVDSKDSVCEATALIQKGMLDYYQGTRYGGTVGMFQPPY
Sbjct: 1   MFYLTLLGLISQILYASAITLDVDSKDSVCEATALIQKGMLDYYQGTRYGGTVGMFQPPY 60

Query: 61  YWWEAGEAFGGMLENWYLCQNDTFESLISDALIYQAGSNYDYIPSNQTLVEGNDDQGVWG 120
           YWWEAGEAFGGMLENWYLCQNDTFESLISDALIYQAGSNYDYIPSNQTLVEGNDDQGVWG
Sbjct: 61  YWWEAGEAFGGMLENWYLCQNDTFESLISDALIYQAGSNYDYIPSNQTLVEGNDDQGVWG 120

Query: 121 LTVLGAVERNLPDRDGVPGWLAISQAVFNTMYARWDTAYCGGGLRWQIYTWNSGYNYKNT 180
           LTVLGAVERNLPDRDGVPGWLAISQAVFNTMYARWDTAYCGGGLRWQIYTWNSGYNYKNT
Sbjct: 121 LTVLGAVERNLPDRDGVPGWLAISQAVFNTMYARWDTAYCGGGLRWQIYTWNSGYNYKNT 180

Query: 181 ISNACLFQIAARLGRYTGNNTYLEVAEKVFDWMVDVEYIVLKDVANVYDGATTNYNCSDI 240
           ISNACLFQIAARLGRYTGNNTYLEVAEKVFDWMVDVEYIVLKDVANVYDGATTNYNCSDI
Sbjct: 181 ISNACLFQIAARLGRYTGNNTYLEVAEKVFDWMVDVEYIVLKDVANVYDGATTNYNCSDI 240

Query: 241 VQYEWSYNHGVVLGGLAYMYNATNGTSKWETALTQVLSGATTYFFKNNIMYESACQEAKT 300
           VQYEWSYNHGVVLGGLAYMYNATNGTSKWETALTQVLSGATTYFFKNNIMYESACQEAKT
Sbjct: 241 VQYEWSYNHGVVLGGLAYMYNATNGTSKWETALTQVLSGATTYFFKNNIMYESACQEAKT 300

Query: 301 CNTDQRSFKSIFSRMLGYTRVLAPYTAATLDTLIETSAKAAAGSCDGGTDGVTCGLSWFD 360
           CNTDQRSFKSIFSRMLGYTRVLAPYTAATLDTLIETSAKAAAGSCDGGTDGVTCGLSWFD
Sbjct: 301 CNTDQRSFKSIFSRMLGYTRVLAPYTAATLDTLIETSAKAAAGSCDGGTDGVTCGLSWFD 360

Query: 361 STNDGYYGLGEQMSALEIINQLLVXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXLN 420
           STNDGYYGLGEQMSALEIINQLLV                                  LN
Sbjct: 361 STNDGYYGLGEQMSALEIINQLLVSSSGAAAEAASSGSASSPYTSSSGGNSTGDASAGLN 420

Query: 421 TTSTNVLQNNLDIESKDKXXXXXXXXXXXXXXXXXSVWMLF 461
           TTSTNVLQNNLDIESKDK                 SVWMLF
Sbjct: 421 TTSTNVLQNNLDIESKDKAGAAVATAVILAVLVGGSVWMLF 461

>Smik_13.446 Chr13 (730295..731671) [1377 bp, 458 aa] {ON} YMR238W
           (REAL)
          Length = 458

 Score =  616 bits (1589), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 296/462 (64%), Positives = 355/462 (76%), Gaps = 13/462 (2%)

Query: 1   MFYLTLLGLISQILYASAITLDVDSKDSVCEATALIQKGMLDYYQGTRYGGTVGMFQPPY 60
           M  L    L+S      A+ LD  SK S+C+ATALIQ GMLDYY+GTRYGG VGMFQ PY
Sbjct: 9   MIPLICFTLLSFFRICHAMELDSTSKTSICDATALIQDGMLDYYEGTRYGGAVGMFQSPY 68

Query: 61  YWWEAGEAFGGMLENWYLCQNDTFESLISDALIYQAGSNYDYIPSNQTLVEGNDDQGVWG 120
           YWW AGEAFGGMLENW+LC+NDT++ L+ DAL+ Q GSNYDYIP+NQT+VEGNDDQG+WG
Sbjct: 69  YWWHAGEAFGGMLENWFLCENDTYQELLYDALLAQTGSNYDYIPANQTMVEGNDDQGIWG 128

Query: 121 LTVLGAVERNLPD-RDGVPGWLAISQAVFNTMYARWDTAYCGGGLRWQIYTWNSGYNYKN 179
           +TV+GAVERN  D  DG PGWLA+ QAVFNTMY+RWD+ +CGGGLRWQI+TWNSGYNYKN
Sbjct: 129 ITVMGAVERNFTDPSDGKPGWLAMVQAVFNTMYSRWDSEHCGGGLRWQIFTWNSGYNYKN 188

Query: 180 TISNACLFQIAARLGRYTGNNTYLEVAEKVFDWMVDVEYIVLKDVANVYDGATTNYNCSD 239
           TISNACLFQIAARLGRYTGN TYL+VAE+VFDW+VDV Y+VL D ANV+DGA  + NC+D
Sbjct: 189 TISNACLFQIAARLGRYTGNTTYLDVAEQVFDWLVDVGYVVLNDTANVFDGAEIDTNCTD 248

Query: 240 IVQYEWSYNHGVVLGGLAYMYNATNGTSKWETALTQVLSGATTYFFKNNIMYESACQEAK 299
           I + EW+YNHG+VLGGLAYMYNATNGTS+WET+LT++L+GA +YFFK++IMYESACQ+  
Sbjct: 249 ITKIEWTYNHGIVLGGLAYMYNATNGTSEWETSLTKILNGAKSYFFKDSIMYESACQDYS 308

Query: 300 TCNTDQRSFKSIFSRMLGYTRVLAPYTAATLDTLIETSAKAAAGSCDGGTDGVTCGLSWF 359
           TCNTDQR+FKSIFSRMLG T V+APYT+ T+D LI+TSA+AAA SCDGG DG TCGL+W 
Sbjct: 309 TCNTDQRTFKSIFSRMLGLTSVMAPYTSDTIDDLIKTSAEAAAKSCDGGRDGHTCGLNWG 368

Query: 360 DSTNDGYYGLGEQMSALEIINQLLVXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXL 419
             TNDGYYGLGEQM+ALE+I  LL+                                  +
Sbjct: 369 KQTNDGYYGLGEQMNALEVIQNLLI------------HDRPAPYKESNGGTSKGDANAGM 416

Query: 420 NTTSTNVLQNNLDIESKDKXXXXXXXXXXXXXXXXXSVWMLF 461
           N+++TNVLQNNL+I++ D+                 +VWMLF
Sbjct: 417 NSSTTNVLQNNLNIKNGDRAGAAIITAIILSVLIGGAVWMLF 458

>YMR238W Chr13 (746353..747729) [1377 bp, 458 aa] {ON}  DFG5Putative
           mannosidase, essential glycosylphosphatidylinositol
           (GPI)-anchored membrane protein required for cell wall
           biogenesis in bud formation, involved in filamentous
           growth, homologous to Dcw1p
          Length = 458

 Score =  615 bits (1586), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 293/445 (65%), Positives = 349/445 (78%), Gaps = 13/445 (2%)

Query: 18  AITLDVDSKDSVCEATALIQKGMLDYYQGTRYGGTVGMFQPPYYWWEAGEAFGGMLENWY 77
           A+ LD  SK S+C+ATALIQ GMLDYY+GTRYGGTVGMFQ PYYWW AGEAFGGMLENW+
Sbjct: 26  AMDLDTTSKTSICDATALIQGGMLDYYEGTRYGGTVGMFQSPYYWWHAGEAFGGMLENWF 85

Query: 78  LCQNDTFESLISDALIYQAGSNYDYIPSNQTLVEGNDDQGVWGLTVLGAVERNLPDR-DG 136
           LC+NDT++ L+ DAL+ Q GSNYDYIPSNQT+VEGNDDQG+WG+TV+GAVERN  D  DG
Sbjct: 86  LCENDTYQELLYDALLAQTGSNYDYIPSNQTMVEGNDDQGIWGITVMGAVERNFTDPGDG 145

Query: 137 VPGWLAISQAVFNTMYARWDTAYCGGGLRWQIYTWNSGYNYKNTISNACLFQIAARLGRY 196
            PGWLA+ QAVFNTMY+RWD+ +CGGGLRWQI+TWNSGYNYKNT+SNACLFQIAARLGRY
Sbjct: 146 KPGWLAMVQAVFNTMYSRWDSEHCGGGLRWQIFTWNSGYNYKNTVSNACLFQIAARLGRY 205

Query: 197 TGNNTYLEVAEKVFDWMVDVEYIVLKDVANVYDGATTNYNCSDIVQYEWSYNHGVVLGGL 256
           TGN TYLEVAE+VFDW+VDV Y+VL D ANV+DGA  + NC+DI + EW+YNHG+VLGGL
Sbjct: 206 TGNTTYLEVAEQVFDWLVDVGYVVLNDTANVFDGAEIDTNCTDITKIEWTYNHGIVLGGL 265

Query: 257 AYMYNATNGTSKWETALTQVLSGATTYFFKNNIMYESACQEAKTCNTDQRSFKSIFSRML 316
           AYMYNATNGT +WET+LT++L+GA +YFFK++IMYESACQ+  TCNTDQR+FKSIFSRML
Sbjct: 266 AYMYNATNGTGEWETSLTKILNGAKSYFFKDSIMYESACQDYGTCNTDQRTFKSIFSRML 325

Query: 317 GYTRVLAPYTAATLDTLIETSAKAAAGSCDGGTDGVTCGLSWFDSTNDGYYGLGEQMSAL 376
           G T V+AP+T  T+D LI+TSA+AAA SC+GGTDG TCGL+W   TNDGYYGLGEQMSAL
Sbjct: 326 GLTSVMAPFTRDTIDDLIKTSAEAAAKSCNGGTDGHTCGLNWQKQTNDGYYGLGEQMSAL 385

Query: 377 EIINQLLVXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXLNTTSTNVLQNNLDIESK 436
           E+I  LL+                                  +N+++TNVLQNNL+I+  
Sbjct: 386 EVIQNLLI------------HDRPAPYKEDNGGTSKGDANAGMNSSTTNVLQNNLNIKKG 433

Query: 437 DKXXXXXXXXXXXXXXXXXSVWMLF 461
           D+                 +VWMLF
Sbjct: 434 DRAGAAIITAVILSVLTGGAVWMLF 458

>Suva_13.422 Chr13 (727776..729152) [1377 bp, 458 aa] {ON} YMR238W
           (REAL)
          Length = 458

 Score =  607 bits (1565), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 292/454 (64%), Positives = 348/454 (76%), Gaps = 13/454 (2%)

Query: 9   LISQILYASAITLDVDSKDSVCEATALIQKGMLDYYQGTRYGGTVGMFQPPYYWWEAGEA 68
           L+S      A+ LD  S  S+C+ATALIQ GMLDYY+GTRYGGTVGMFQ PYYWW AGEA
Sbjct: 17  LLSFFKATDAMDLDTTSATSICDATALIQDGMLDYYEGTRYGGTVGMFQSPYYWWHAGEA 76

Query: 69  FGGMLENWYLCQNDTFESLISDALIYQAGSNYDYIPSNQTLVEGNDDQGVWGLTVLGAVE 128
           FGGM+ENWYLCQNDT++ L+ DAL+ Q G++YDYIP+NQT+VEGNDDQG+WG+TV+GAVE
Sbjct: 77  FGGMVENWYLCQNDTYQVLLYDALLAQTGADYDYIPANQTMVEGNDDQGIWGITVMGAVE 136

Query: 129 RNLPDRD-GVPGWLAISQAVFNTMYARWDTAYCGGGLRWQIYTWNSGYNYKNTISNACLF 187
           RN  + D G PGWLA+ QAVFNTMY+RWD+  CGGGLRWQI+TWNSGYNYKNTISNACLF
Sbjct: 137 RNFTNPDNGAPGWLAMVQAVFNTMYSRWDSENCGGGLRWQIFTWNSGYNYKNTISNACLF 196

Query: 188 QIAARLGRYTGNNTYLEVAEKVFDWMVDVEYIVLKDVANVYDGATTNYNCSDIVQYEWSY 247
           QIAARLGRYTGN TYL+VAE+VFDW+VDV Y+VL D ANVYDGA  + NC+DI + EW+Y
Sbjct: 197 QIAARLGRYTGNTTYLDVAEQVFDWLVDVGYVVLNDTANVYDGAEIDTNCTDITKIEWTY 256

Query: 248 NHGVVLGGLAYMYNATNGTSKWETALTQVLSGATTYFFKNNIMYESACQEAKTCNTDQRS 307
           NHG+VLGG+AYMYNATNGTS+W+T+L QVL+GA +YFFK+ IMYESACQ+  TCNTDQR+
Sbjct: 257 NHGIVLGGMAYMYNATNGTSEWKTSLQQVLNGAASYFFKDGIMYESACQDYGTCNTDQRT 316

Query: 308 FKSIFSRMLGYTRVLAPYTAATLDTLIETSAKAAAGSCDGGTDGVTCGLSWFDSTNDGYY 367
           FKSIFSRMLG T V+AP+T+ T+D LI+TSA+AAA SCDGGTDG TCGL W   TNDGYY
Sbjct: 317 FKSIFSRMLGLTSVMAPFTSDTIDALIKTSAEAAAKSCDGGTDGHTCGLDWEKETNDGYY 376

Query: 368 GLGEQMSALEIINQLLVXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXLNTTSTNVL 427
           GLGEQMSALE+I  LL+                                  +N+++T+VL
Sbjct: 377 GLGEQMSALEVIQNLLI------------HDRPAPYKEDNGGTSKGDANAGMNSSTTSVL 424

Query: 428 QNNLDIESKDKXXXXXXXXXXXXXXXXXSVWMLF 461
           QNNL+I   D+                 +VWMLF
Sbjct: 425 QNNLNITKGDRAGAAIITAVILSVLIGGAVWMLF 458

>Skud_13.407 Chr13 (720539..721915) [1377 bp, 458 aa] {ON} YMR238W
           (REAL)
          Length = 458

 Score =  606 bits (1563), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 291/462 (62%), Positives = 349/462 (75%), Gaps = 13/462 (2%)

Query: 1   MFYLTLLGLISQILYASAITLDVDSKDSVCEATALIQKGMLDYYQGTRYGGTVGMFQPPY 60
           M        +S +  + A+ LD  SK S+C+ATALIQ GMLDYY GTRYGG VGMFQ PY
Sbjct: 9   MIPFICFTFLSFVGISHAMDLDTTSKTSICDATALIQDGMLDYYDGTRYGGAVGMFQSPY 68

Query: 61  YWWEAGEAFGGMLENWYLCQNDTFESLISDALIYQAGSNYDYIPSNQTLVEGNDDQGVWG 120
           YWW AGEAFGGMLENW+LC+N+T++ L+ DAL+ Q GSNYDYIP+NQT+VEGNDDQG+WG
Sbjct: 69  YWWHAGEAFGGMLENWFLCENETYQELLYDALLAQTGSNYDYIPANQTMVEGNDDQGIWG 128

Query: 121 LTVLGAVERNLPDRD-GVPGWLAISQAVFNTMYARWDTAYCGGGLRWQIYTWNSGYNYKN 179
           +TV+GAVERN  D D G PGWLA+ QAVFNTMY+RWD+ +CGGGLRWQI+TWNSGYNYKN
Sbjct: 129 ITVMGAVERNFTDPDEGKPGWLAMVQAVFNTMYSRWDSEHCGGGLRWQIFTWNSGYNYKN 188

Query: 180 TISNACLFQIAARLGRYTGNNTYLEVAEKVFDWMVDVEYIVLKDVANVYDGATTNYNCSD 239
           T+SNACLFQIAARLGRYTGN+TYL+VAE+VFDW+VDV Y+VL D ANV+DGA  + NC+D
Sbjct: 189 TVSNACLFQIAARLGRYTGNSTYLDVAEQVFDWLVDVGYVVLNDTANVFDGAEIDTNCTD 248

Query: 240 IVQYEWSYNHGVVLGGLAYMYNATNGTSKWETALTQVLSGATTYFFKNNIMYESACQEAK 299
           I + EW+YNHG+VLGGLAYMYNATNGTS+WET LTQ+L+GA  YFFK+ IMYESACQ+  
Sbjct: 249 ITKIEWTYNHGIVLGGLAYMYNATNGTSEWETRLTQILNGAKAYFFKDTIMYESACQDYS 308

Query: 300 TCNTDQRSFKSIFSRMLGYTRVLAPYTAATLDTLIETSAKAAAGSCDGGTDGVTCGLSWF 359
           TCNTDQR+FKSIFSRMLG T V+AP+T+ T+D LI+TSA+AAA SC+GGTDG TCGL W 
Sbjct: 309 TCNTDQRTFKSIFSRMLGLTSVMAPFTSDTIDDLIKTSAEAAAKSCNGGTDGHTCGLDWG 368

Query: 360 DSTNDGYYGLGEQMSALEIINQLLVXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXL 419
             T+DGYYGLGEQMSALE+I  LL+                                  +
Sbjct: 369 KQTHDGYYGLGEQMSALEVIQNLLI------------HDRPAPYKESNGGTSKGDANAGM 416

Query: 420 NTTSTNVLQNNLDIESKDKXXXXXXXXXXXXXXXXXSVWMLF 461
           N+++TNVLQNNL+I    +                 +VWMLF
Sbjct: 417 NSSTTNVLQNNLNITKGGRAGAAIITAIILSVLIGGAVWMLF 458

>NCAS0C00810 Chr3 complement(144534..145889) [1356 bp, 451 aa] {ON}
           Anc_8.773
          Length = 451

 Score =  598 bits (1543), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 291/461 (63%), Positives = 342/461 (74%), Gaps = 19/461 (4%)

Query: 3   YLTLLGLISQILYASAITLDVDSKDSVCEATALIQKGMLDYYQGTRYGGTVGMFQPPYYW 62
           ++ LL L+ Q     +I LDV SKDS+C ATALIQKGMLDYY+G RYGG VGMFQPPYYW
Sbjct: 8   FVLLLPLLVQ-----SIDLDVTSKDSICAATALIQKGMLDYYEGERYGGAVGMFQPPYYW 62

Query: 63  WEAGEAFGGMLENWYLCQNDTFESLISDALIYQAGSNYDYIPSNQTLVEGNDDQGVWGLT 122
           W  G AFGGMLEN YLC+N+TFESL+ DAL+ Q G NYDYIPSNQ++VEGNDDQGVWGLT
Sbjct: 63  WNGGVAFGGMLENMYLCENNTFESLLMDALVAQTGDNYDYIPSNQSMVEGNDDQGVWGLT 122

Query: 123 VLGAVERNL--PDRDGVPGWLAISQAVFNTMYARWDTAYCGGGLRWQIYTWNSGYNYKNT 180
           ++ AVERN   P++ GVPGWLA++QAVFNTMYARWD  +CGGGLRWQI+TWNSGYNYKNT
Sbjct: 123 IMDAVERNFTAPNKSGVPGWLAMAQAVFNTMYARWDPDHCGGGLRWQIFTWNSGYNYKNT 182

Query: 181 ISNACLFQIAARLGRYTGNNTYLEVAEKVFDWMVDVEYIVLKDVANVYDGATTNYNCSDI 240
           I+NACLFQ+AARLGRYTGN TYL+VAEKVFDWMVD+ YIVL D ANV+DGA  + NC+DI
Sbjct: 183 IANACLFQMAARLGRYTGNQTYLDVAEKVFDWMVDINYIVLNDKANVFDGADIDENCTDI 242

Query: 241 VQYEWSYNHGVVLGGLAYMYNATNGTSKWETALTQVLSGATTYFFKNNIMYESACQEAKT 300
              EW+YNHGVVLGG AYMYNATNG+S WET + ++L+GA  YFF++N+M ESACQ   T
Sbjct: 243 TTLEWTYNHGVVLGGCAYMYNATNGSSTWETRVNKILAGAQEYFFQDNVMLESACQSYNT 302

Query: 301 CNTDQRSFKSIFSRMLGYTRVLAPYTAATLDTLIETSAKAAAGSCDGGTDGVTCGLSWFD 360
           CN DQR FKSIFSRMLG+T VLAP+TA T+D LI+ SA+AAA SC GG DG TCGL W  
Sbjct: 303 CNNDQRCFKSIFSRMLGFTSVLAPFTAETIDPLIKASAEAAATSCTGGKDGHTCGLDWTK 362

Query: 361 STNDGYYGLGEQMSALEIINQLLVXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXLN 420
            +NDGYYGLGEQM+ALEI++ LL+                                  LN
Sbjct: 363 GSNDGYYGLGEQMNALEIMSNLLI------------HDRPAPLTANTGGTSEGDASAGLN 410

Query: 421 TTSTNVLQNNLDIESKDKXXXXXXXXXXXXXXXXXSVWMLF 461
           +T+TNVL+N L I   D+                 +VWMLF
Sbjct: 411 STTTNVLENKLKITQGDRAGAAIVTAVILGIFVGGAVWMLF 451

>Kpol_1030.20 s1030 complement(37060..38049,38052..38417) [1356 bp,
           451 aa] {ON} complement(37060..38049,38052..38417) [1356
           nt, 452 aa]
          Length = 451

 Score =  594 bits (1532), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 297/462 (64%), Positives = 342/462 (74%), Gaps = 14/462 (3%)

Query: 1   MFYLTLLGLISQILYASAITLDVDSKDSVCEATALIQKGMLDYYQGTRYGGTVGMFQPPY 60
           +    LL   + I   +AI LDV+SKDS+C AT+LIQ GMLDYY+GTRYGGTVGMFQPPY
Sbjct: 3   LLLTVLLQAFNFITTVTAIDLDVNSKDSICAATSLIQGGMLDYYEGTRYGGTVGMFQPPY 62

Query: 61  YWWEAGEAFGGMLENWYLCQNDTFESLISDALIYQAGSNYDYIPSNQTLVEGNDDQGVWG 120
           YWWEAGEAFGGM+ENW+LCQNDT+  +I DAL+ Q GSNYDY+P+NQT VE    + V+G
Sbjct: 63  YWWEAGEAFGGMIENWFLCQNDTYHDIIYDALLAQTGSNYDYVPANQTFVEVMMIK-VFG 121

Query: 121 LTVLGAVERNL-PDRDGVPGWLAISQAVFNTMYARWDTAYCGGGLRWQIYTWNSGYNYKN 179
            TV+ A ERN     DG P WLA++QAVFNTMYARWD+A CGGGLRWQIYTWNSGYNYKN
Sbjct: 122 GTVMDAAERNFTAPSDGKPDWLAMAQAVFNTMYARWDSANCGGGLRWQIYTWNSGYNYKN 181

Query: 180 TISNACLFQIAARLGRYTGNNTYLEVAEKVFDWMVDVEYIVLKDVANVYDGATTNYNCSD 239
           T+SNACLFQIAARLGRYTGN+TYLEVAEKVFDW+VDV ++VL D ANV+DGA    NCS 
Sbjct: 182 TVSNACLFQIAARLGRYTGNDTYLEVAEKVFDWLVDVNFVVLNDEANVFDGANITSNCSA 241

Query: 240 IVQYEWSYNHGVVLGGLAYMYNATNGTSKWETALTQVLSGATTYFFKNNIMYESACQEAK 299
           +V+ EWSYNHG+VLGGLAYMYNATNGTSKWE+ LT+VL+GA + FFKNNIMYE ACQ+  
Sbjct: 242 VVKLEWSYNHGIVLGGLAYMYNATNGTSKWESGLTKVLNGAKSIFFKNNIMYEQACQDHN 301

Query: 300 TCNTDQRSFKSIFSRMLGYTRVLAPYTAATLDTLIETSAKAAAGSCDGGTDGVTCGLSWF 359
           TCNTDQRSFKSIFSRMLG T VLAPYT+ T+  LI+ SA+ AA SCDGGTDG TCGL+W 
Sbjct: 302 TCNTDQRSFKSIFSRMLGLTSVLAPYTSDTITPLIQASAEGAAKSCDGGTDGHTCGLNWN 361

Query: 360 DSTNDGYYGLGEQMSALEIINQLLVXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXL 419
             TNDG YGLGEQM ALEI++ LL+                                  L
Sbjct: 362 LGTNDGKYGLGEQMCALEIMSNLLI------------LNRPAPYTMHNGGTSVGDPSAGL 409

Query: 420 NTTSTNVLQNNLDIESKDKXXXXXXXXXXXXXXXXXSVWMLF 461
           N TST+VL NNLDI+ KD+                 SVWMLF
Sbjct: 410 NATSTSVLSNNLDIKQKDRAGAAIVTAVILFVLLGGSVWMLF 451

>CAGL0M05049g Chr13 (547489..548850) [1362 bp, 453 aa] {ON} similar
           to uniprot|P36091 Saccharomyces cerevisiae YKL046c or
           uniprot|Q05031 Saccharomyces cerevisiae YMR238w DFG5
          Length = 453

 Score =  593 bits (1530), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 297/463 (64%), Positives = 340/463 (73%), Gaps = 15/463 (3%)

Query: 1   MFYLTLLGLISQILY-ASAITLDVDSKDSVCEATALIQKGMLDYYQGTRYGGTVGMFQPP 59
           +F L L  LI  +   A AI L  D+KDS+C ATALIQ GMLDYY+GTRYGGTVGMFQPP
Sbjct: 4   LFSLQLWVLIGTLFPDAGAINLQ-DNKDSICAATALIQGGMLDYYEGTRYGGTVGMFQPP 62

Query: 60  YYWWEAGEAFGGMLENWYLCQNDTFESLISDALIYQAGSNYDYIPSNQTLVEGNDDQGVW 119
           YYWW+AG AFGGMLENW+LCQNDT++ L+ +AL+ Q G NYDYIP+NQT VEGNDDQGVW
Sbjct: 63  YYWWQAGVAFGGMLENWFLCQNDTYKDLLMNALVAQTGPNYDYIPANQTTVEGNDDQGVW 122

Query: 120 GLTVLGAVERNLPDR-DGVPGWLAISQAVFNTMYARWDTAYCGGGLRWQIYTWNSGYNYK 178
           GLT+L AVERN     DG PGWLA+SQ +FNTMYARWD   C GGLRWQI+TWNSGYNYK
Sbjct: 123 GLTILDAVERNFSAPIDGKPGWLAMSQGIFNTMYARWDMQSCNGGLRWQIFTWNSGYNYK 182

Query: 179 NTISNACLFQIAARLGRYTGNNTYLEVAEKVFDWMVDVEYIVLKDVANVYDGATTNYNCS 238
           NTISNACLFQIAARLGRYTGN TYL+VAE+VFDW+V V YIVL +  NVYDGA    NC+
Sbjct: 183 NTISNACLFQIAARLGRYTGNTTYLDVAERVFDWLVGVGYIVLSEKGNVYDGAKVEDNCT 242

Query: 239 DIVQYEWSYNHGVVLGGLAYMYNATNGTSKWETALTQVLSGATTYFFKNNIMYESACQEA 298
           DI   EW+YNHGVVLGGLAYMYNATNG+S W++ LT VL GAT YFF+++IMYESACQ  
Sbjct: 243 DITAIEWTYNHGVVLGGLAYMYNATNGSSVWQSRLTSVLGGATAYFFQDDIMYESACQPY 302

Query: 299 KTCNTDQRSFKSIFSRMLGYTRVLAPYTAATLDTLIETSAKAAAGSCDGGTDGVTCGLSW 358
           KTCN DQR FKSIFSRMLG+T VLAP+T+ T+D L++ SA AAAGSCDGGTDG TCGL W
Sbjct: 303 KTCNNDQRCFKSIFSRMLGFTSVLAPFTSDTIDPLLKASAMAAAGSCDGGTDGHTCGLDW 362

Query: 359 FDSTNDGYYGLGEQMSALEIINQLLVXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX 418
              TNDGYYGLGEQMSALE+I QLL+                                  
Sbjct: 363 QLKTNDGYYGLGEQMSALEVIQQLLI------------HERPAPYRADNGGTSVGDAAAG 410

Query: 419 LNTTSTNVLQNNLDIESKDKXXXXXXXXXXXXXXXXXSVWMLF 461
           LN+T+TNVL+NNL I   D+                 + WM+F
Sbjct: 411 LNSTTTNVLKNNLKITGGDRAGAAIVTTIVLGIIIGGAAWMMF 453

>SAKL0B05412g Chr2 (466158..467513) [1356 bp, 451 aa] {ON} highly
           similar to uniprot|Q05031 Saccharomyces cerevisiae
           YMR238W DFG5 Mannosidase essential
           glycosylphosphatidylinositol (GPI)-anchored membrane
           protein required for cell wall biogenesis involved in
           filamentous growth homologous to Dcw1p
          Length = 451

 Score =  588 bits (1517), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 288/463 (62%), Positives = 342/463 (73%), Gaps = 19/463 (4%)

Query: 6   LLGLISQILYAS-----AITLDVDSKDSVCEATALIQKGMLDYYQGTRYGGTVGMFQPPY 60
           ++ L+  ++Y S     AI LD  SKDS+C AT+LIQKGMLDYY+GT+YGGTVGMFQPPY
Sbjct: 1   MISLLISLIYMSLNIVHAIDLDTSSKDSICYATSLIQKGMLDYYEGTKYGGTVGMFQPPY 60

Query: 61  YWWEAGEAFGGMLENWYLCQNDTFESLISDALIYQAGSNYDYIPSNQTLVEGNDDQGVWG 120
           YWW+AGEAFGGML+N YLC N+T++ LI DA+I Q G NYDYIP+NQ++VEGNDDQGVWG
Sbjct: 61  YWWQAGEAFGGMLDNIYLCDNETYKDLIYDAMIAQTGENYDYIPANQSMVEGNDDQGVWG 120

Query: 121 LTVLGAVERNL--PDRDGVPGWLAISQAVFNTMYARWDTAYCGGGLRWQIYTWNSGYNYK 178
           +T++GAVERN   P ++GVPGWLA+ QAVFNTMYARWD+ +CGGGLRWQI+TWNSGYNYK
Sbjct: 121 ITIMGAVERNFTNPTKEGVPGWLAMVQAVFNTMYARWDSQHCGGGLRWQIFTWNSGYNYK 180

Query: 179 NTISNACLFQIAARLGRYTGNNTYLEVAEKVFDWMVDVEYIVLKDVANVYDGATTNYNCS 238
           NTI+N CLFQIAARLGRYTGN+TYLEVA KV+DW+ DV ++VL+D ANV+DGA    NCS
Sbjct: 181 NTIANGCLFQIAARLGRYTGNDTYLEVASKVWDWLEDVGFVVLQDKANVFDGANIENNCS 240

Query: 239 DIVQYEWSYNHGVVLGGLAYMYNATNGTSKWETALTQVLSGATTYFFKNNIMYESACQEA 298
            IV+ EW+YNHGVVLGG AYMYNATNG+  W+T LTQVL GA  +FF N+IMYE ACQ +
Sbjct: 241 SIVKIEWTYNHGVVLGGAAYMYNATNGSDIWQTRLTQVLDGAVEFFFNNSIMYERACQGS 300

Query: 299 KTCNTDQRSFKSIFSRMLGYTRVLAPYTAATLDTLIETSAKAAAGSCDGGTDGVTCGLSW 358
            TCN DQRSFKSIFSRMLG T VLAP+T  T+D LI+ SA+ AA SC GGTDG TCGL W
Sbjct: 301 GTCNNDQRSFKSIFSRMLGLTSVLAPFTRDTIDPLIKASAEGAARSCTGGTDGHTCGLDW 360

Query: 359 FDSTNDGYYGLGEQMSALEIINQLLVXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX 418
               +DGYYGLGEQMSALEI+  LL+                                  
Sbjct: 361 TLGHHDGYYGLGEQMSALEIMQNLLI------------DDIPGPFTADNGGSSVGDPNAG 408

Query: 419 LNTTSTNVLQNNLDIESKDKXXXXXXXXXXXXXXXXXSVWMLF 461
           LN++S NVL+NNL I  KD+                 SVWM+F
Sbjct: 409 LNSSSANVLENNLSITHKDRVGAAIITAIVLGVMIGGSVWMVF 451

>NDAI0K00840 Chr11 complement(190148..191527) [1380 bp, 459 aa] {ON}
           Anc_8.773
          Length = 459

 Score =  587 bits (1514), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 287/462 (62%), Positives = 345/462 (74%), Gaps = 14/462 (3%)

Query: 2   FYLTLLGLISQILYASAITLDVDSKDSVCEATALIQKGMLDYYQGTRYGGTVGMFQPPYY 61
            Y     L+  +    AI LD+ SK+S+C+AT+LIQ GM+DYY GT+YGGTVGMFQPPYY
Sbjct: 10  LYFHFFQLLLTVHNTQAIDLDITSKESICDATSLIQGGMMDYYWGTQYGGTVGMFQPPYY 69

Query: 62  WWEAGEAFGGMLENWYLCQNDTFESLISDALIYQAGSNYDYIPSNQTLVEGNDDQGVWGL 121
           WWEAGEAFGGM+ENWYLCQNDT+E ++  AL+ Q GSNYDYIP+NQ++VEGNDDQGVWGL
Sbjct: 70  WWEAGEAFGGMIENWYLCQNDTYEDMLKSALLAQTGSNYDYIPANQSMVEGNDDQGVWGL 129

Query: 122 TVLGAVERNLPDRD-GVPGWLAISQAVFNTMYARWDTAYCGGGLRWQIYTWNSGYNYKNT 180
           T++GA ERN  D D G PGWLA++QAVFNTM ARWD+A+CGGGLRWQI+TWNSGYNYKNT
Sbjct: 130 TLMGAAERNFTDPDDGTPGWLAMTQAVFNTMNARWDSAHCGGGLRWQIFTWNSGYNYKNT 189

Query: 181 ISNACLFQIAARLGRYTGNNTYLEVAEKVFDWMVDVEYIVLKDVANVYDGATTNYNCSDI 240
           ISNACLFQ+AARLGRYTGN TYLEVAEKVF W+VDV Y++L D ANV+DGA  + NC+D+
Sbjct: 190 ISNACLFQLAARLGRYTGNTTYLEVAEKVFTWLVDVGYVLLDDTANVFDGAEIDSNCTDM 249

Query: 241 VQYEWSYNHGVVLGGLAYMYNATNGTSKWETALTQVLSGATTYFFKNN-IMYESACQEAK 299
            Q EW+YNHGVVLGG AYMYNATNG+S WE+ +T++L GATTYFF +N IM+E+ACQE  
Sbjct: 250 TQIEWTYNHGVVLGGAAYMYNATNGSSDWESRVTKLLKGATTYFFDSNGIMFENACQEYN 309

Query: 300 TCNTDQRSFKSIFSRMLGYTRVLAPYTAATLDTLIETSAKAAAGSCDGGTDGVTCGLSWF 359
           TCN DQRSFKSIFSRMLG T VLAP+T+ T+D LI+TSA AAA SC GGTDG TCGL+W 
Sbjct: 310 TCNNDQRSFKSIFSRMLGLTSVLAPFTSDTVDPLIKTSAAAAAKSCTGGTDGHTCGLNWA 369

Query: 360 DSTNDGYYGLGEQMSALEIINQLLVXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXL 419
             ++DGYYGLGEQM ALE++  LL+                                  L
Sbjct: 370 KGSHDGYYGLGEQMCALEVMQNLLI------------HDRPAPLTGNTGGSSKGDALAGL 417

Query: 420 NTTSTNVLQNNLDIESKDKXXXXXXXXXXXXXXXXXSVWMLF 461
           N+T+TNVL+N + I + D+                 +VWM F
Sbjct: 418 NSTTTNVLENKMTITNGDRAGAAIVTAIILGVLTGGAVWMFF 459

>TDEL0B03360 Chr2 complement(601081..602391) [1311 bp, 436 aa] {ON}
           Anc_8.773 YMR238W
          Length = 436

 Score =  570 bits (1468), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 283/447 (63%), Positives = 335/447 (74%), Gaps = 15/447 (3%)

Query: 18  AITLDVDSKDSVCEATALIQKGMLDYYQGTRYGGTVGMFQPPYYWWEAGEAFGGMLENWY 77
            + LD  SKDS+C ATALIQKGMLDYY+GTR GGTVGMFQ PYYWW+AGEAFGGM++NWY
Sbjct: 2   GLDLDPSSKDSICYATALIQKGMLDYYEGTRIGGTVGMFQSPYYWWQAGEAFGGMIDNWY 61

Query: 78  LCQNDTFESLISDALIYQAGSNYDYIPSNQTLVEGNDDQGVWGLTVLGAVERNLPDR-DG 136
            C+N TFESLI D ++ Q G +YDY+P NQT+VEGNDDQGVWGLT++GAVERN  +  +G
Sbjct: 62  FCENTTFESLIYDGMLAQTGPHYDYMPENQTMVEGNDDQGVWGLTLMGAVERNFTNPTNG 121

Query: 137 VPGWLAISQAVFNTMYARWDTAYCGGGLRWQIYTWNSGYNYKNTISNACLFQIAARLGRY 196
            PGWLA++QA+FN + +RWDTA CGGGLRWQI+TWN GYNYKNTISNACLFQIAARLGRY
Sbjct: 122 APGWLAMAQAIFNQLNSRWDTANCGGGLRWQIFTWNGGYNYKNTISNACLFQIAARLGRY 181

Query: 197 TGNNTYLEVAEKVFDWMVDVEYIVLKDVANVYDGATTNYNCSDIVQYEWSYNHGVVLGGL 256
           TGN+TYLEVAE VFDW+VDV Y+VLKDV NV+DGA  + NC+ I + EWSYNHGVVLGGL
Sbjct: 182 TGNDTYLEVAENVFDWLVDVGYVVLKDVGNVFDGAEIDNNCTSINKLEWSYNHGVVLGGL 241

Query: 257 AYMYNATNGTSKWETALTQVLSGATTYFFKNNIMYESACQ--EAKTCNTDQRSFKSIFSR 314
           A+MYNATNG+S+WET +TQ+L GA +YFFK++IMYES CQ     TCN+DQRSFK+IFSR
Sbjct: 242 AFMYNATNGSSEWETRVTQILGGAESYFFKDSIMYESLCQGDGTSTCNSDQRSFKAIFSR 301

Query: 315 MLGYTRVLAPYTAATLDTLIETSAKAAAGSCDGGTDGVTCGLSWFDSTNDGYYGLGEQMS 374
           MLG T VL P T + +D L++ SA AAA SC GGTDG TCGL+W    NDGYYGLGEQMS
Sbjct: 302 MLGLTSVLVPSTQSKVDDLLKQSALAAAASCSGGTDGHTCGLNWNKQANDGYYGLGEQMS 361

Query: 375 ALEIINQLLVXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXLNTTSTNVLQNNLDIE 434
           ALE++ QLL+                                  LNT+S NVLQN LDI+
Sbjct: 362 ALEVMQQLLI------------HQKAAPFTEQTGGSSAGDANAGLNTSSANVLQNQLDIQ 409

Query: 435 SKDKXXXXXXXXXXXXXXXXXSVWMLF 461
           +KD+                 S+WMLF
Sbjct: 410 TKDRAGAAIITAVILMVLVGGSIWMLF 436

>TBLA0B03320 Chr2 complement(774913..776265) [1353 bp, 450 aa] {ON}
           Anc_8.773 YMR238W
          Length = 450

 Score =  567 bits (1461), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 278/456 (60%), Positives = 333/456 (73%), Gaps = 12/456 (2%)

Query: 6   LLGLISQILYASAITLDVDSKDSVCEATALIQKGMLDYYQGTRYGGTVGMFQPPYYWWEA 65
           +L  +S + +  A+ LD  SK+S+C AT+LI KGMLDYY GT+YGGTVGMFQPPYYWWEA
Sbjct: 7   ILSALSFVSFTFAMDLDTSSKESICGATSLIIKGMLDYYWGTQYGGTVGMFQPPYYWWEA 66

Query: 66  GEAFGGMLENWYLCQNDTFESLISDALIYQAGSNYDYIPSNQTLVEGNDDQGVWGLTVLG 125
           GEAFGGMLENWYLCQNDT+  L+ DAL  Q G +YDYIP NQT+VEGNDDQ +WGLTV+ 
Sbjct: 67  GEAFGGMLENWYLCQNDTYADLLFDALTAQTGPDYDYIPQNQTMVEGNDDQCIWGLTVMD 126

Query: 126 AVERNLPDRDGVPGWLAISQAVFNTMYARWDTAYCGGGLRWQIYTWNSGYNYKNTISNAC 185
           AVERN  +    PGWLA+ QAVFNTM++RWD A CGGGLRWQI+TWNSGY+YKNTISNAC
Sbjct: 127 AVERNFTNPTEGPGWLAMGQAVFNTMWSRWDAADCGGGLRWQIFTWNSGYDYKNTISNAC 186

Query: 186 LFQIAARLGRYTGNNTYLEVAEKVFDWMVDVEYIVLKDVANVYDGATTNYNCSDIVQYEW 245
           LFQ+AARLGRYTGNNTYL+VA  VFDW+  V Y+ + + A VYDGA  + NC+DI +Y+W
Sbjct: 187 LFQMAARLGRYTGNNTYLDVANDVFDWLTGVGYVNMDNAAEVYDGADISENCTDITKYQW 246

Query: 246 SYNHGVVLGGLAYMYNATNGTSKWETALTQVLSGATTYFFKNNIMYESACQEAKTCNTDQ 305
           SYN+G +LGG AYMYNATNG+S WET +TQ+L+GA  YFF+++IMYESACQ AKTCN DQ
Sbjct: 247 SYNNGCMLGGAAYMYNATNGSSIWETRVTQLLNGAKAYFFQDDIMYESACQTAKTCNNDQ 306

Query: 306 RSFKSIFSRMLGYTRVLAPYTAATLDTLIETSAKAAAGSCDGGTDGVTCGLSWFDSTNDG 365
           RSFKS+FSRMLG+T VL P T   +D LI  SA+ AA +C+GGTDG TCGL+W  ST+DG
Sbjct: 307 RSFKSLFSRMLGFTSVLVPSTRDIIDPLILASAQGAARTCNGGTDGHTCGLNWQASTHDG 366

Query: 366 YYGLGEQMSALEIINQLLVXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXLNTTSTN 425
           YYGLGEQMSALE+I  LL+                                  LN TS N
Sbjct: 367 YYGLGEQMSALEVIQNLLI------------HDRPAPYTSIDGGSSEGDANAGLNKTSKN 414

Query: 426 VLQNNLDIESKDKXXXXXXXXXXXXXXXXXSVWMLF 461
           VL N+LDI++ DK                 ++WMLF
Sbjct: 415 VLSNDLDIKTGDKVGAAILTAGVLAILVGGAIWMLF 450

>KNAG0J00700 Chr10 complement(121298..122689) [1392 bp, 463 aa] {ON}
           Anc_8.773 YMR238W
          Length = 463

 Score =  566 bits (1459), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 279/448 (62%), Positives = 334/448 (74%), Gaps = 19/448 (4%)

Query: 16  ASAITLDVDSKDSVCEATALIQKGMLDYYQGTRYGGTVGMFQPPYYWWEAGEAFGGMLEN 75
           ASA++LD      VC ATAL+  G+LDYY GTRYGGTVGMFQPPYYWW AGEAFGGM+EN
Sbjct: 33  ASALSLD-----PVCSATALVTDGLLDYYSGTRYGGTVGMFQPPYYWWHAGEAFGGMIEN 87

Query: 76  WYLCQNDTFESLISDALIYQAGSNYDYIPSNQTLVEGNDDQGVWGLTVLGAVERNL--PD 133
           W+LCQN T+E+L+ DA I Q G+NYDYIP NQT+VEGNDDQG+WGLT++ AVERN   P 
Sbjct: 88  WFLCQNSTYETLLMDAFIAQTGNNYDYIPENQTMVEGNDDQGIWGLTIMDAVERNFTKPT 147

Query: 134 RDGVPGWLAISQAVFNTMYARWDTAYCGGGLRWQIYTWNSGYNYKNTISNACLFQIAARL 193
           +DGVPGWLA+SQAVFNTM+ARWDT +CGGGLRWQI+TWNSGYNYKNTISNACLF +AARL
Sbjct: 148 KDGVPGWLAMSQAVFNTMWARWDTQHCGGGLRWQIFTWNSGYNYKNTISNACLFNLAARL 207

Query: 194 GRYTGNNTYLEVAEKVFDWMVDVEYIVLKDVANVYDGATTNYNCSDIVQYEWSYNHGVVL 253
           GRYTGN+TYL+VA++VFDWMV V Y+VL D ANV+DGA    NC+ I  +EWSYNHGVVL
Sbjct: 208 GRYTGNSTYLDVADQVFDWMVSVGYVVLGDTANVFDGANIEDNCTTITTFEWSYNHGVVL 267

Query: 254 GGLAYMYNATNGTSKWETALTQVLSGATTYFFKNNIMYESACQEAKTCNTDQRSFKSIFS 313
           GG A+MYNATNG+S WE  + ++L GATTYFF+++IM+ESACQ+   CN DQR+FK+IFS
Sbjct: 268 GGTAFMYNATNGSSVWEDRVNRILKGATTYFFRDSIMFESACQDTGKCNNDQRTFKAIFS 327

Query: 314 RMLGYTRVLAPYTAATLDTLIETSAKAAAGSCDGGTDGVTCGLSWFDSTNDGYYGLGEQM 373
           RML +T VL P TA+T+D L+++SA+AAA SC GGTDG TCGL+W  S  DG YGLGEQM
Sbjct: 328 RMLSFTAVLVPSTASTIDPLMQSSAQAAAQSCSGGTDGHTCGLNWQHSGWDGMYGLGEQM 387

Query: 374 SALEIINQLLVXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXLNTTSTNVLQNNLDI 433
           SALE++N LLV                                  LN+T+TNV  N+L+I
Sbjct: 388 SALEVMNYLLV------------HDRPAPYTAAAGGSSVGDASAGLNSTATNVFANSLNI 435

Query: 434 ESKDKXXXXXXXXXXXXXXXXXSVWMLF 461
             KDK                 S+WMLF
Sbjct: 436 RGKDKAGAAIVTTVILGTLAGGSIWMLF 463

>KLLA0F24926g Chr6 complement(2321928..2323283) [1356 bp, 451 aa]
           {ON} similar to uniprot|Q05031 Saccharomyces cerevisiae
           YMR238W DFG5 Mannosidase essential
           glycosylphosphatidylinositol (GPI)-anchored membrane
           protein required for cell wall biogenesis involved in
           filamentous growth homologous to Dcw1p
          Length = 451

 Score =  561 bits (1447), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 277/458 (60%), Positives = 331/458 (72%), Gaps = 14/458 (3%)

Query: 6   LLGLISQILYASAITLDVDSKDSVCEATALIQKGMLDYYQGTRYGGTVGMFQPPYYWWEA 65
           L  L   ++   AI LD  SK S+C ATALIQ+G+ DYY+G  YGGTVGMF  PYYWWEA
Sbjct: 6   LYSLFLTVVSVLAIDLDTSSKSSICTATALIQQGISDYYEGDVYGGTVGMFVSPYYWWEA 65

Query: 66  GEAFGGMLENWYLCQNDTFESLISDALIYQAGSNYDYIPSNQTLVEGNDDQGVWGLTVLG 125
           G  FGGM+ENWYLCQN ++E ++ DAL+ Q GS+YDY+PSNQT+VEGNDDQGVW LTV+ 
Sbjct: 66  GLVFGGMIENWYLCQNTSYEDMLYDALMAQTGSDYDYMPSNQTMVEGNDDQGVWALTVMT 125

Query: 126 AVERNL--PDRDGVPGWLAISQAVFNTMYARWDTAYCGGGLRWQIYTWNSGYNYKNTISN 183
           AVERN   P  DG PGWLA+ QAVFN MY+RWD+ +C GGLRWQI+TWNSGYNYKNTISN
Sbjct: 126 AVERNFTNPKEDGTPGWLAMVQAVFNQMYSRWDSDHCNGGLRWQIFTWNSGYNYKNTISN 185

Query: 184 ACLFQIAARLGRYTGNNTYLEVAEKVFDWMVDVEYIVLKDVANVYDGATTNYNCSDIVQY 243
            CLFQ+AARLGRYTGN TYLEVAEKVFDW+VD++++V+K+ ANV+DGAT + NC+ IV+Y
Sbjct: 186 GCLFQLAARLGRYTGNTTYLEVAEKVFDWLVDIDFVVMKEEANVFDGATIDDNCTSIVKY 245

Query: 244 EWSYNHGVVLGGLAYMYNATNGTSKWETALTQVLSGATTYFFKNNIMYESACQEAKTCNT 303
           EWSYNHGVVLGG AYMYNATNG+  W+T   Q+L GAT++FF+++IMYES CQ +  CNT
Sbjct: 246 EWSYNHGVVLGGCAYMYNATNGSDVWQTRTEQILGGATSFFFEDDIMYESTCQASNKCNT 305

Query: 304 DQRSFKSIFSRMLGYTRVLAPYTAATLDTLIETSAKAAAGSCDGGTDGVTCGLSWFDSTN 363
           DQR FK+IFSRMLGYT VLAP+T  T+  LI+TSA AAA SC GGTDG TCGL+WF    
Sbjct: 306 DQRVFKAIFSRMLGYTSVLAPFTTDTITPLIDTSAAAAAKSCSGGTDGHTCGLNWFTGDW 365

Query: 364 DGYYGLGEQMSALEIINQLLVXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXLNTTS 423
           DG YGLGEQ  ALEIINQLLV                                  LN ++
Sbjct: 366 DGQYGLGEQACALEIINQLLV------------HDLPAPLTESTGGSSSGDASAGLNVST 413

Query: 424 TNVLQNNLDIESKDKXXXXXXXXXXXXXXXXXSVWMLF 461
           TNVLQ N++I + DK                 +VWM+ 
Sbjct: 414 TNVLQKNINITAGDKAGAGIITTIVLGVLVLGTVWMVL 451

>KAFR0B03490 Chr2 (723671..725026) [1356 bp, 451 aa] {ON} Anc_8.773
           YMR238W
          Length = 451

 Score =  556 bits (1433), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 273/450 (60%), Positives = 331/450 (73%), Gaps = 16/450 (3%)

Query: 16  ASAITLDVDSKDSVCEATALIQKGMLDYYQGTRYGGTVGMFQPPYYWWEAGEAFGGMLEN 75
           A AI LD  SK S+C+ATALIQ GMLDYY+G RYGGTVGMFQ PYYWWEAGEAFGGMLEN
Sbjct: 14  AKAIDLDTSSKTSICDATALIQDGMLDYYEGIRYGGTVGMFQSPYYWWEAGEAFGGMLEN 73

Query: 76  WYLCQNDTFESLISDALIYQAGSNYDYIPSNQTLVEGNDDQGVWGLTVLGAVERNLPDR- 134
           W+LC+NDTF+ +I DA++ Q GS+YD++P NQT+VEGNDDQ VWGLT++ AVERN  D  
Sbjct: 74  WFLCENDTFKEIIYDAILAQTGSDYDFMPENQTMVEGNDDQCVWGLTIMDAVERNFTDPT 133

Query: 135 DGVPGWLAISQAVFNTMYARWDTAYCGGGLRWQIYTWNSGYNYKNTISNACLFQIAARLG 194
           DG PGWL ++QA+FN M++RWD+A CGGGLRWQI+TWNSGY+YK+TISN CLFQ+A+RLG
Sbjct: 134 DGSPGWLYMTQAIFNEMWSRWDSANCGGGLRWQIFTWNSGYDYKSTISNVCLFQLASRLG 193

Query: 195 RYTGNNTYLEVAEKVFDWMVDVEYI-VLKDVANVYDGATTNYNCSDIVQYEWSYNHGVVL 253
           RYTGN+TYL+VAE V+DW+VDV +I V    A VYDGA  + NC+DI   +WSYNHG++L
Sbjct: 194 RYTGNDTYLDVAESVYDWLVDVGFINVANGTAYVYDGADISENCTDITTIDWSYNHGILL 253

Query: 254 GGLAYMYNATNGTSKWETALTQVLSGATTYFFKNNIMYESACQEAKTCNTDQRSFKSIFS 313
           GG AY YNATNG+S WE+ +T ++ GA + FF + IMYESACQ+  TCN DQRSFKSIFS
Sbjct: 254 GGAAYAYNATNGSSVWESRVTDIVEGAKSIFFSDGIMYESACQDYDTCNNDQRSFKSIFS 313

Query: 314 RMLGYTRVLAPYTAATLDTLIETSAKAAAGSCDGGTDGVTCGLSWFDSTNDGYYGLGEQM 373
           RMLG+T VLAP+TA+T+D LI++SA A A SCDGGTDG TCGL+W D T DG YGLGEQM
Sbjct: 314 RMLGFTSVLAPFTASTIDPLIKSSAAACALSCDGGTDGHTCGLNWQDKTCDGNYGLGEQM 373

Query: 374 SALEIINQLLVXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXLNTT--STNVLQNNL 431
           SALE+I  LL+                                  LNTT  S +VL+NNL
Sbjct: 374 SALEVIQNLLI------------HDRPAPYTASTGGSSVGDASAGLNTTTSSADVLENNL 421

Query: 432 DIESKDKXXXXXXXXXXXXXXXXXSVWMLF 461
            I SKD+                 ++WMLF
Sbjct: 422 TITSKDRAGAAIITAVILGCMAGGAIWMLF 451

>Kwal_55.20266 s55 complement(327537..328910) [1374 bp, 457 aa] {ON}
           YMR238W (DFG5) - involved in pseudohyphal growth [contig
           152] FULL
          Length = 457

 Score =  550 bits (1416), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 269/468 (57%), Positives = 331/468 (70%), Gaps = 19/468 (4%)

Query: 1   MFYLTLLGLISQILYA--SAITLDVDSKDSVCEATALIQKGMLDYYQGTRYGGTVGMFQP 58
           +  L  LG +  +  +  SAI LD  SKDS+C+AT+LIQKG++DYY+G R+GGTVGMFQ 
Sbjct: 2   VLQLMALGALGAVFTSQVSAIDLDTSSKDSICDATSLIQKGVMDYYEGNRFGGTVGMFQQ 61

Query: 59  PYYWWEAGEAFGGMLENWYLCQNDTFESLISDALIYQAGSNYDYIPSNQTLVEGNDDQGV 118
           PYYWWEAGE FGGM+ENW+LCQNDT+E  + DA+I QAG +YD++PSNQ++VEGNDDQGV
Sbjct: 62  PYYWWEAGEVFGGMMENWFLCQNDTYEKTLYDAMIAQAGPDYDFMPSNQSMVEGNDDQGV 121

Query: 119 WGLTVLGAVERNL--PDRDGVPGWLAISQAVFNTMYARWDTAYCGGGLRWQIYTWNSGYN 176
           WGLT++ AVERN   P   GVPGWLA+ Q VFNTM++RWD+ +CGGGLRWQI+TWNSGYN
Sbjct: 122 WGLTLMSAVERNFTNPTEKGVPGWLAMVQGVFNTMWSRWDSDHCGGGLRWQIFTWNSGYN 181

Query: 177 YKNTISNACLFQIAARLGRYTGNNTYLEVAEKVFDWMVDVEYIVLKDV--ANVYDGATTN 234
           YKNT+SNACLFQ+AARLGRYTGN TYL  AE V++W+VD+ ++   +   ANVYDGAT +
Sbjct: 182 YKNTVSNACLFQLAARLGRYTGNETYLTKAETVWNWLVDIGFVRFNESGNANVYDGATID 241

Query: 235 YNCSDIVQYEWSYNHGVVLGGLAYMYNAT-NGTSKWETALTQVLSGATTYFFKNNIMYES 293
            NC+DIV+ EWSYN G+VLGG AYMYNAT NGTS WE+ L Q++ G+T  FF+N IMYE+
Sbjct: 242 KNCTDIVEIEWSYNQGIVLGGAAYMYNATHNGTSDWESRLNQIVGGSTDIFFRNKIMYEA 301

Query: 294 ACQEAKTCNTDQRSFKSIFSRMLGYTRVLAPYTAATLDTLIETSAKAAAGSCDGGTDGVT 353
            CQ++  CN DQRSFKSIFSRML  TR LAPYTA  +D L++ SA+ AA SC GGTDG T
Sbjct: 302 TCQDSGKCNQDQRSFKSIFSRMLSLTRTLAPYTADKIDPLMKASAEGAAKSCTGGTDGHT 361

Query: 354 CGLSWFDSTNDGYYGLGEQMSALEIINQLLVXXXXXXXXXXXXXXXXXXXXXXXXXXXXX 413
           CGL+W    +DG+YGLGEQ  ALE I   L                              
Sbjct: 362 CGLNWEKGEHDGWYGLGEQACALEGIQSQLY------------SMRPAPYTADNGGTSVG 409

Query: 414 XXXXXLNTTSTNVLQNNLDIESKDKXXXXXXXXXXXXXXXXXSVWMLF 461
                LN TSTNVL ++L+I  KDK                 S+WM+F
Sbjct: 410 DTEAGLNKTSTNVLHSDLNITQKDKVGASIITAVLLAVLVGGSIWMIF 457

>KLTH0E04048g Chr5 complement(369100..370464) [1365 bp, 454 aa] {ON}
           similar to uniprot|Q05031 Saccharomyces cerevisiae
           YMR238W DFG5 Mannosidase essential
           glycosylphosphatidylinositol (GPI)-anchored membrane
           protein required for cell wall biogenesis involved in
           filamentous growth homologous to Dcw1p
          Length = 454

 Score =  549 bits (1415), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 270/458 (58%), Positives = 329/458 (71%), Gaps = 20/458 (4%)

Query: 9   LISQILYASAITLDVDSKDSVCEATALIQKGMLDYYQGTRYGGTVGMFQPPYYWWEAGEA 68
           L+  IL    I LD     S+C+AT+LIQ G++DYY GTR GGTVGMFQ PYYWWEAGE 
Sbjct: 12  LLQPIL---GIDLDTSDSSSICDATSLIQGGIMDYYAGTRIGGTVGMFQQPYYWWEAGEV 68

Query: 69  FGGMLENWYLCQNDTFESLISDALIYQAGSNYDYIPSNQTLVEGNDDQGVWGLTVLGAVE 128
           FGGMLENW+LCQNDT+  +I DA+I+QAG +YD++PSNQ++VEGNDDQGVWGLTV+ A E
Sbjct: 69  FGGMLENWFLCQNDTYHDIIYDAMIHQAGPDYDFMPSNQSMVEGNDDQGVWGLTVMSAAE 128

Query: 129 RNL--PDRDGVPGWLAISQAVFNTMYARWDTAYCGGGLRWQIYTWNSGYNYKNTISNACL 186
           RN   P  DGVPGWLA++Q VFNTM+ RWD+ +CGGG+RWQI+TWNSGYNYKNT+SNAC+
Sbjct: 129 RNFTNPTEDGVPGWLAMAQGVFNTMWMRWDSEHCGGGVRWQIFTWNSGYNYKNTVSNACM 188

Query: 187 FQIAARLGRYTGNNTYLEVAEKVFDWMVDVEYIVLKD--VANVYDGATTNYNCSDIVQYE 244
           FQ+AARLGRYTGN+TYL  AE V+DW+VDV ++VL +   ANVYDGA  + NC+DIV+ E
Sbjct: 189 FQLAARLGRYTGNDTYLTKAETVWDWLVDVGFVVLNENGNANVYDGANIDDNCTDIVKNE 248

Query: 245 WSYNHGVVLGGLAYMYNAT-NGTSKWETALTQVLSGATTYFFKNNIMYESACQEAKTCNT 303
           WSYN G+VLGG AYMYNAT N TS W++ L Q++ G+T +FFK+ +MYES CQ++KTCN 
Sbjct: 249 WSYNQGIVLGGAAYMYNATQNDTSVWKSRLDQIVGGSTEFFFKDKVMYESTCQDSKTCNQ 308

Query: 304 DQRSFKSIFSRMLGYTRVLAPYTAATLDTLIETSAKAAAGSCDGGTDGVTCGLSWFDSTN 363
           DQRSFKSIFSRML  TR LAPYTA T+D L+E SA+ AA SC GGTDG TCGL+W    +
Sbjct: 309 DQRSFKSIFSRMLSLTRSLAPYTAETIDPLMEASAEGAAKSCTGGTDGHTCGLNWQLGYH 368

Query: 364 DGYYGLGEQMSALEIINQLLVXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXLNTTS 423
           DGYYGLGEQ  ALE I  L+                                   LN+TS
Sbjct: 369 DGYYGLGEQACALEGIQSLMY------------SKRPAPYTSDNGGSSVGDTEAALNSTS 416

Query: 424 TNVLQNNLDIESKDKXXXXXXXXXXXXXXXXXSVWMLF 461
           TNVLQ+++ I  KDK                 S+WM+F
Sbjct: 417 TNVLQSDIKITHKDKVGASIITAVILAVLVGGSIWMIF 454

>ZYRO0F12210g Chr6 (992529..993890) [1362 bp, 453 aa] {ON} similar
           to uniprot|Q05031 Saccharomyces cerevisiae YMR238W DFG5
           Mannosidase essential glycosylphosphatidylinositol
           (GPI)-anchored membrane protein required for cell wall
           biogenesis involved in filamentous growth homologous to
           Dcw1p
          Length = 453

 Score =  549 bits (1415), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 266/464 (57%), Positives = 326/464 (70%), Gaps = 15/464 (3%)

Query: 1   MFYLTLLGLISQILYASAITLDVDSKDSVCEATALIQKGMLDYYQGTRYGGTVGMFQPPY 60
           + +  L+ L+  +    A+ L V  KDSVC ATALIQ+GMLDYY G +YGG +GMFQPPY
Sbjct: 2   LLHNILVWLVFSLSPIWAVDLQVGDKDSVCSATALIQQGMLDYYAGDKYGGAIGMFQPPY 61

Query: 61  YWWEAGEAFGGMLENWYLCQNDTFESLISDALIYQAGSNYDYIPSNQTLVEGNDDQGVWG 120
           YWW+AGEAFGGM++NW+ C+N+TFE LI +A++ QAG +YDY+P NQT+VEGNDDQGVWG
Sbjct: 62  YWWQAGEAFGGMIDNWHFCKNNTFEELIREAMLTQAGPHYDYMPQNQTMVEGNDDQGVWG 121

Query: 121 LTVLGAVERNLPDR-DGVPGWLAISQAVFNTMYARWDTAYCGGGLRWQIYTWNSGYNYKN 179
           LTV+ AVERN  D  DG PGWLA++QAVFN +  RWD   C GG+RWQI+TWNSGYNYKN
Sbjct: 122 LTVMEAVERNFTDPGDGKPGWLAMAQAVFNEINERWDDKSCAGGVRWQIFTWNSGYNYKN 181

Query: 180 TISNACLFQIAARLGRYTGNNTYLEVAEKVFDWMVDVEYIVLKDVANVYDGATTNYNCSD 239
           TISN C FQ+AARLGRYT N TYLEVAEKVFDW+ DV ++VLKD  NV+DGA T+ NC+ 
Sbjct: 182 TISNGCYFQLAARLGRYTNNQTYLEVAEKVFDWLTDVGFVVLKDKGNVFDGAVTDDNCTQ 241

Query: 240 IVQYEWSYNHGVVLGGLAYMYNATNGTSKWETALTQVLSGATTYFFKNNIMYESACQ--E 297
           + + EW+YNHG++LGG AYMYNATNG+SKWE  + Q+L+GA+ YFF++N+MYES CQ  +
Sbjct: 242 VTELEWTYNHGIILGGSAYMYNATNGSSKWEERVNQILNGASDYFFQDNVMYESGCQHGD 301

Query: 298 AKTCNTDQRSFKSIFSRMLGYTRVLAPYTAATLDTLIETSAKAAAGSCDGGTDGVTCGLS 357
           +  CN DQRSFKSIFSRMLG T VL P  +  +D L+  SA+ AA SC GG DG TCGL+
Sbjct: 302 SSNCNNDQRSFKSIFSRMLGLTSVLVPSVSDKVDQLLNASAEGAAKSCSGGIDGHTCGLN 361

Query: 358 WFDSTNDGYYGLGEQMSALEIINQLLVXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX 417
           WF  + D  YGLGEQMSALE+I   L+                                 
Sbjct: 362 WFKGSWDNQYGLGEQMSALEVIQNTLI------------HNSDPPYRESTGGSSKGDSAA 409

Query: 418 XLNTTSTNVLQNNLDIESKDKXXXXXXXXXXXXXXXXXSVWMLF 461
            LNTT+TNVLQ  L I+SKD+                 SVWMLF
Sbjct: 410 GLNTTTTNVLQKKLKIQSKDRAGAAIITGVVLMVVVGGSVWMLF 453

>NCAS0A08740 Chr1 (1727048..1728352) [1305 bp, 434 aa] {ON} 
          Length = 434

 Score =  526 bits (1356), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 247/374 (66%), Positives = 298/374 (79%), Gaps = 6/374 (1%)

Query: 16  ASAITLDVDSKDSVCEATALIQKGMLDYYQGTRYGGTVGMFQPPYYWWEAGEAFGGMLEN 75
            S+I L+V S  S+C+AT++I KG+LDYY+GTR+ GTVGMFQ PYYWW+AG AFGGMLEN
Sbjct: 24  GSSIKLNVTSNTSICDATSIITKGILDYYEGTRFNGTVGMFQQPYYWWKAGSAFGGMLEN 83

Query: 76  WYLCQNDTFESLISDALIYQAGSNYDYIPSNQTLVEGNDDQGVWGLTVLGAVERNLPDRD 135
           WYLCQNDTFESL++DA+++QAG +YDY+P NQT+VE NDDQGVWGLT++GAVERN  D  
Sbjct: 84  WYLCQNDTFESLLTDAMLHQAGKDYDYLPENQTMVEANDDQGVWGLTIMGAVERNFTDPQ 143

Query: 136 G--VPGWLAISQAVFNTMYARWDTAYCGGGLRWQIYTWNSGYNYKNTISNACLFQIAARL 193
           G  VPGWLA++Q++FN MY+RWDT  CGGGLRWQIY WN GYNYKNTIS ACLFQ+AARL
Sbjct: 144 GKDVPGWLAMAQSIFNQMYSRWDTGSCGGGLRWQIYDWNKGYNYKNTISTACLFQMAARL 203

Query: 194 GRYTGNNTYLEVAEKVFDWMVDVEYIVLK-DVANVYDGATTNYNCSDIVQYEWSYNHGVV 252
           GRYTGN+TYL+VA+K F WMVD+ YI L      V+DGA    NCSDI + EWSYNHG+V
Sbjct: 204 GRYTGNSTYLKVADKTFQWMVDIGYIQLNTSSGRVFDGAHIESNCSDITKLEWSYNHGIV 263

Query: 253 LGGLAYMYNATNGTSKWETALTQVLSGATTYFFKNNIMYESACQEAKT--CNTDQRSFKS 310
           LGG AYMYNAT  + +W     ++L+GATTYFF+N  M E+ACQ      CN DQR+FKS
Sbjct: 264 LGGCAYMYNATK-SPEWGMNTIKILNGATTYFFQNKTMLETACQRPDRVFCNNDQRTFKS 322

Query: 311 IFSRMLGYTRVLAPYTAATLDTLIETSAKAAAGSCDGGTDGVTCGLSWFDSTNDGYYGLG 370
           IFSRMLG T V+AP+T+  +D LI  SA+AAA SC GG D  TCGL+W +  NDGYYGLG
Sbjct: 323 IFSRMLGLTSVMAPFTSERIDPLIVQSAEAAALSCTGGFDNETCGLNWLEGKNDGYYGLG 382

Query: 371 EQMSALEIINQLLV 384
           EQ+SALE+I  LL+
Sbjct: 383 EQLSALEVIQNLLI 396

>AFR530W Chr6 (1388049..1389428) [1380 bp, 459 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YMR238W (DFG5)
          Length = 459

 Score =  518 bits (1333), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 236/383 (61%), Positives = 296/383 (77%), Gaps = 2/383 (0%)

Query: 4   LTLLGLISQILYASAITLDVDSKDSVCEATALIQKGMLDYYQGTRYGGTVGMFQPPYYWW 63
           L  L L+ Q + + A+ LD+ S++ VC  T  IQKG++DYY G++YGG VGMFQPPYYWW
Sbjct: 11  LVGLFLLMQGMLSRALDLDLSSREDVCHFTNEIQKGIMDYYWGSKYGGIVGMFQPPYYWW 70

Query: 64  EAGEAFGGMLENWYLCQNDTFESLISDALIYQAGSNYDYIPSNQTLVEGNDDQGVWGLTV 123
           EAGE FGGMLENWYLC N  +ES++ +++I Q G  +DYIP+NQ+  EGNDDQGVW L +
Sbjct: 71  EAGEVFGGMLENWYLCDNQEYESVLRESMIAQTGDKFDYIPANQSTTEGNDDQGVWALFI 130

Query: 124 LGAVERNL--PDRDGVPGWLAISQAVFNTMYARWDTAYCGGGLRWQIYTWNSGYNYKNTI 181
           +GAVERN   P+++G+PGWL + Q VFN M ARWD   CGGGLRWQI+ WN+GY YKNTI
Sbjct: 131 MGAVERNFKDPEKEGMPGWLTMVQTVFNKMEARWDAENCGGGLRWQIFQWNNGYTYKNTI 190

Query: 182 SNACLFQIAARLGRYTGNNTYLEVAEKVFDWMVDVEYIVLKDVANVYDGATTNYNCSDIV 241
           +N CLFQ+AARLGRYTGN TYL+VA KVF W+VDV+YIVL+D A V+DGA  + NCSDI 
Sbjct: 191 ANGCLFQLAARLGRYTGNQTYLDVASKVFQWLVDVKYIVLEDKARVFDGAHIHENCSDIK 250

Query: 242 QYEWSYNHGVVLGGLAYMYNATNGTSKWETALTQVLSGATTYFFKNNIMYESACQEAKTC 301
             EWSYNHG++L G AYMYNAT G+ +WE+ +T++L+GA  ++F++ IMYE ACQ+  TC
Sbjct: 251 GIEWSYNHGIILAGAAYMYNATGGSPEWESHVTKILAGAADFYFRDKIMYERACQDYNTC 310

Query: 302 NTDQRSFKSIFSRMLGYTRVLAPYTAATLDTLIETSAKAAAGSCDGGTDGVTCGLSWFDS 361
           + DQRSFKSIFSRML  T V+AP+T  T+D LI  SA AA+ SC+ GT G TCGL+W   
Sbjct: 311 DNDQRSFKSIFSRMLAITSVVAPFTRGTIDELIYASATAASKSCEQGTHGYTCGLNWHKG 370

Query: 362 TNDGYYGLGEQMSALEIINQLLV 384
           T DG YGLGEQ SALEII  +L+
Sbjct: 371 TYDGVYGLGEQASALEIIQNVLI 393

>Ecym_1474 Chr1 (976393..977757) [1365 bp, 454 aa] {ON} similar to
           Ashbya gossypii AFR530W
          Length = 454

 Score =  516 bits (1330), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 259/459 (56%), Positives = 313/459 (68%), Gaps = 15/459 (3%)

Query: 5   TLLGLISQILYASAITLDVDSKDSVCEATALIQKGMLDYYQGTRYGGTVGMFQPPYYWWE 64
           +LL LI  +     + LDV SKDS+C AT  IQ+G++DYY G+  GG VGMF  PYYWWE
Sbjct: 9   SLLLLIC-VPVCGGLQLDVKSKDSICAATQKIQRGIMDYYWGSTPGGIVGMFIQPYYWWE 67

Query: 65  AGEAFGGMLENWYLCQNDTFESLISDALIYQAGSNYDYIPSNQTLVEGNDDQGVWGLTVL 124
           AG  F GMLENWYLC N  + S + +++I Q G+NYDYIPSNQ++ EGNDDQG+WGL ++
Sbjct: 68  AGLVFAGMLENWYLCDNMEYNSTLYESMIAQTGANYDYIPSNQSMTEGNDDQGIWGLFIM 127

Query: 125 GAVERNLPDRD--GVPGWLAISQAVFNTMYARWDTAYCGGGLRWQIYTWNSGYNYKNTIS 182
           GAVERN PD     VPGWL ++QAVFNTMYARWD+ +CGGGLRWQI+TWN GY+YKNTI+
Sbjct: 128 GAVERNFPDAQMGNVPGWLTMAQAVFNTMYARWDSQHCGGGLRWQIFTWNLGYDYKNTIA 187

Query: 183 NACLFQIAARLGRYTGNNTYLEVAEKVFDWMVDVEYIVLKDVANVYDGATTNYNCSDIVQ 242
           N CLFQ+AARLGRYTGN+TYL++A + F W+VDV+++VLKD ANV+DGA    NC DI  
Sbjct: 188 NGCLFQLAARLGRYTGNSTYLDIANETFSWLVDVKFVVLKDEANVFDGAHIGDNCQDIKG 247

Query: 243 YEWSYNHGVVLGGLAYMYNATNGTSKWETALTQVLSGATTYFFKNNIMYESACQEAKTCN 302
            EW+YNHGV+LGG AYMYNATNG   WET L Q+L GA  +FF+NNIMYE ACQ+ K CN
Sbjct: 248 IEWTYNHGVILGGCAYMYNATNGDPVWETRLRQILGGARAFFFRNNIMYERACQDNKICN 307

Query: 303 TDQRSFKSIFSRMLGYTRVLAPYTAATLDTLIETSAKAAAGSCDGGTDGVTCGLSWFDST 362
            DQRSFKSIFSRML  T VLAP+T  T+D L+E SA AAA SC GG DG TCGL W   +
Sbjct: 308 NDQRSFKSIFSRMLAVTSVLAPFTRETIDPLLEASAAAAAASCSGGKDGETCGLDWTTGS 367

Query: 363 NDGYYGLGEQMSALEIINQLLVXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXLNTT 422
            DGYYGLGEQ SALE+I  LL+                                  L T 
Sbjct: 368 WDGYYGLGEQASALEVIQNLLI------------HTKAPPLTKNAGGTSNGDPGAGLGTP 415

Query: 423 STNVLQNNLDIESKDKXXXXXXXXXXXXXXXXXSVWMLF 461
             NVL + L+I SKD+                 ++WM+ 
Sbjct: 416 MDNVLHSRLNIGSKDRIKAALITAVCLGLLVGTALWMVI 454

>NCAS0A08730 Chr1 (1724401..1726296) [1896 bp, 631 aa] {ON} 
          Length = 631

 Score =  516 bits (1330), Expect = e-179,   Method: Compositional matrix adjust.
 Identities = 224/368 (60%), Positives = 297/368 (80%), Gaps = 1/368 (0%)

Query: 18  AITLDVDSKDSVCEATALIQKGMLDYYQGTRYGGTVGMFQPPYYWWEAGEAFGGMLENWY 77
           ++TLD  S  S+C+AT+L+QKG+LDYY+GT YGGTVGMFQ PYYWW +G AFG M+ENWY
Sbjct: 28  SLTLDQTSSKSICDATSLLQKGILDYYEGTTYGGTVGMFQAPYYWWHSGCAFGSMIENWY 87

Query: 78  LCQNDTFESLISDALIYQAGSNYDYIPSNQTLVEGNDDQGVWGLTVLGAVERNLPDRDGV 137
           LCQ+DT+ESLI+DA++ QAG NYD++P NQT+VEGNDDQGVWGL ++ A ER  P   G 
Sbjct: 88  LCQDDTYESLITDAILAQAGDNYDFVPQNQTMVEGNDDQGVWGLALMDAAEREFPQVKGQ 147

Query: 138 PGWLAISQAVFNTMYARWDTAYCGGGLRWQIYTWNSGYNYKNTISNACLFQIAARLGRYT 197
           P WL +++ +F +M+ARWD A CGGGLRWQIY+WN+GY+YKNT+S  CLFQ+AARLGRYT
Sbjct: 148 PSWLTMAENIFESMFARWDNANCGGGLRWQIYSWNNGYDYKNTVSTTCLFQLAARLGRYT 207

Query: 198 GNNTYLEVAEKVFDWMVDVEYIVLKDVAN-VYDGATTNYNCSDIVQYEWSYNHGVVLGGL 256
           GN TY++ A + FDW+  V +++ K+    V+DGA  + NC++I +YEWSYNHG+VLGG 
Sbjct: 208 GNETYVKAANQAFDWLQGVGFVMFKNNDGYVFDGADISTNCTNIKKYEWSYNHGIVLGGA 267

Query: 257 AYMYNATNGTSKWETALTQVLSGATTYFFKNNIMYESACQEAKTCNTDQRSFKSIFSRML 316
           AYMYN T+G+S WET  +Q+L+ A++YFF+N IM+E+ CQ +  CN DQRSF+SIF+RML
Sbjct: 268 AYMYNLTDGSSTWETRTSQLLNLASSYFFQNGIMFEAECQTSNICNNDQRSFRSIFARML 327

Query: 317 GYTRVLAPYTAATLDTLIETSAKAAAGSCDGGTDGVTCGLSWFDSTNDGYYGLGEQMSAL 376
           G T ++AP+TA T+D L++T++KAAA +C GG DG TCGL+W +S  DG YGLGE+MSA+
Sbjct: 328 GKTSIMAPFTAETIDPLLKTTSKAAANACSGGKDGHTCGLNWLNSNFDGNYGLGEEMSAM 387

Query: 377 EIINQLLV 384
           E+I  LL+
Sbjct: 388 EVIQNLLI 395

>ACL200W Chr3 (12145..13536) [1392 bp, 463 aa] {ON} Non-syntenic
           homolog of Saccharomyces cerevisiae YMR238W (DFG5);
           Tandem gene triplication in this genome
          Length = 463

 Score =  492 bits (1267), Expect = e-172,   Method: Compositional matrix adjust.
 Identities = 229/381 (60%), Positives = 290/381 (76%), Gaps = 3/381 (0%)

Query: 6   LLGLISQILYASAITLDVDSKDSVCEATALIQKGMLDYYQGTRYGGTVGMFQPPYYWWEA 65
           +L +I  I+ ++A+ +D +S +S+C+AT LIQ G+LDYY+G R GG VG FQ PYYWW A
Sbjct: 18  VLLVILNIVLSNALDVDFNSSESICDATKLIQVGILDYYEGLRPGGRVGFFQKPYYWWMA 77

Query: 66  GEAFGGMLENWYLCQNDTFESLISDALIYQAGSNYDYIPSNQTLVEGNDDQGVWGLTVLG 125
           GEAFGGM+ENWYLC N  ++ L++DA++ Q G N DY+PS+Q ++EGNDDQG+WGL V+G
Sbjct: 78  GEAFGGMVENWYLCNNTEYQDLLTDAMVSQIGENKDYVPSHQKMIEGNDDQGIWGLLVMG 137

Query: 126 AVERNLPD--RDGVPGWLAISQAVFNTMYARWDTAYCGGGLRWQIYTWNSGYNYKNTISN 183
           A ERN PD   +  PGWLA++QAVFNTM+ARWD   CGGGLRWQI+ WN+GY+YKNTISN
Sbjct: 138 AAERNFPDAPPERAPGWLALAQAVFNTMWARWDPENCGGGLRWQIFPWNNGYDYKNTISN 197

Query: 184 ACLFQIAARLGRYTGNNTYLEVAEKVFDWMVDVEYIVLKDVANVYDGATTNYNCSDIVQY 243
           ACLFQIAARL R+TGN+TY +VAE VFDW+VD + + L++ A V DGA  +  C D  + 
Sbjct: 198 ACLFQIAARLARFTGNSTYQDVAETVFDWLVDSKLVQLENDAKVLDGAHISERCEDHSKL 257

Query: 244 EWSYNHGVVLGGLAYMYNATNGTSKWETALTQVLSGATTYFFKNNIMYESACQEAKTCNT 303
           EW+YNHGVVL G AYMYN TNG++ W   L +VL+G +  FF N I+YE ACQ+ + CN 
Sbjct: 258 EWTYNHGVVLAGCAYMYNITNGSAVWGDRLNKVLNG-SLLFFPNGILYERACQDVQKCND 316

Query: 304 DQRSFKSIFSRMLGYTRVLAPYTAATLDTLIETSAKAAAGSCDGGTDGVTCGLSWFDSTN 363
           DQRSF+SIFSRML  T VLAP+T A ++  I  SA+AAA SC GG DG TCG+ W + T 
Sbjct: 317 DQRSFRSIFSRMLALTSVLAPHTKARIEPNIRKSAEAAAKSCSGGRDGHTCGMVWRNYTW 376

Query: 364 DGYYGLGEQMSALEIINQLLV 384
           DG YGLGEQ+SALEII   L+
Sbjct: 377 DGKYGLGEQLSALEIIQNTLI 397

>ACL201W Chr3 (10277..11623) [1347 bp, 448 aa] {ON} Non-syntenic
           homolog of Saccharomyces cerevisiae YMR238W (DFG5);
           Tandem gene triplication in this genome
          Length = 448

 Score =  489 bits (1258), Expect = e-171,   Method: Compositional matrix adjust.
 Identities = 229/381 (60%), Positives = 288/381 (75%), Gaps = 3/381 (0%)

Query: 6   LLGLISQILYASAITLDVDSKDSVCEATALIQKGMLDYYQGTRYGGTVGMFQPPYYWWEA 65
           +L +I  I+ ++A+ +D +S +S+C+AT LIQ G+LDYY+G + GG  G    PYYWW A
Sbjct: 3   VLLVILNIVLSNALDVDFNSSESICDATKLIQVGILDYYEGAKPGGRAGFLVKPYYWWMA 62

Query: 66  GEAFGGMLENWYLCQNDTFESLISDALIYQAGSNYDYIPSNQTLVEGNDDQGVWGLTVLG 125
           GEAFGGM+ENWYLC N  ++ L++DA++ Q G N DY+PS+Q +VEGNDDQG+WGL V+G
Sbjct: 63  GEAFGGMVENWYLCNNTEYQDLLTDAMVSQIGENKDYMPSHQKMVEGNDDQGIWGLLVMG 122

Query: 126 AVERNLPD--RDGVPGWLAISQAVFNTMYARWDTAYCGGGLRWQIYTWNSGYNYKNTISN 183
           A ERN PD   +  PGWLA++QAVFNTM+ARWD   CGGGLRWQI+ WN GY+YKNTISN
Sbjct: 123 AAERNFPDAPPERAPGWLALAQAVFNTMWARWDPENCGGGLRWQIFPWNGGYDYKNTISN 182

Query: 184 ACLFQIAARLGRYTGNNTYLEVAEKVFDWMVDVEYIVLKDVANVYDGATTNYNCSDIVQY 243
           ACLFQIAARL R+TGN+TY +VAE VFDW+VDV+ + L++ A V DGA  +  C D  Q 
Sbjct: 183 ACLFQIAARLARFTGNSTYQDVAETVFDWLVDVKLVELENDARVLDGAHISERCEDHSQL 242

Query: 244 EWSYNHGVVLGGLAYMYNATNGTSKWETALTQVLSGATTYFFKNNIMYESACQEAKTCNT 303
           EW+YNHGVVLGG AYMYN TNG++ W   L +VL+G +  FF+N I+YE ACQ+   CN 
Sbjct: 243 EWTYNHGVVLGGCAYMYNITNGSAVWGDRLNKVLNG-SLLFFENGILYERACQDVNKCND 301

Query: 304 DQRSFKSIFSRMLGYTRVLAPYTAATLDTLIETSAKAAAGSCDGGTDGVTCGLSWFDSTN 363
           DQRSF+SIFSRML  T VLAP+T A ++  I  SA+AAA SC GG DG TCG+ W + T 
Sbjct: 302 DQRSFRSIFSRMLALTSVLAPHTKARIEPNIRKSAEAAAKSCSGGRDGHTCGMVWRNYTW 361

Query: 364 DGYYGLGEQMSALEIINQLLV 384
           DG YGLGEQ+SALEII   L+
Sbjct: 362 DGKYGLGEQLSALEIIQNTLI 382

>TBLA0C03850 Chr3 (921692..923395) [1704 bp, 567 aa] {ON} 
          Length = 567

 Score =  489 bits (1258), Expect = e-169,   Method: Compositional matrix adjust.
 Identities = 224/370 (60%), Positives = 284/370 (76%), Gaps = 5/370 (1%)

Query: 19  ITLDVDSKDSVCEATALIQKGMLDYYQGTRYGGTVGMFQPPYYWWEAGEAFGGMLENWYL 78
           I +D  SK+S+C AT+LIQ G+LDYY+G RYGGTVG+FQPPYYWW++GEAFG +L NWYL
Sbjct: 17  IEIDTHSKESICNATSLIQDGLLDYYEGNRYGGTVGIFQPPYYWWQSGEAFGSLLNNWYL 76

Query: 79  CQNDTFESLISDALIYQAGSNYDYIPSNQTLVEGNDDQGVWGLTVLGAVERNL--PDRDG 136
           CQNDT+E LI DA++ QAG NYD++P NQT+VEGNDDQGV+ +T+L A+ERN   P + G
Sbjct: 77  CQNDTYEKLIYDAILAQAGPNYDFVPKNQTMVEGNDDQGVFDMTILDAMERNFTAPPK-G 135

Query: 137 VPGWLAISQAVFNTMYARWDTAYCGGGLRWQIYTWNSGYNYKNTISNACLFQIAARLGRY 196
            P WL ++Q VFN+MY RWDT  C GG+RWQIY+WN+GY+YKN +S   LF IAARL RY
Sbjct: 136 SPSWLDMNQRVFNSMYDRWDTTSCNGGIRWQIYSWNNGYDYKNAVSTGSLFHIAARLARY 195

Query: 197 TGNNTYLEVAEKVFDWMVDVEYIVLKDV-ANVYDGATTNYNCSDIVQYEWSYNHGVVLGG 255
           TGN +Y +VA+ +FDW+  V Y++  D    V DGA+   NC+DI + EW+YN G+++ G
Sbjct: 196 TGNASYFQVADTIFDWLTSVNYVMFDDKYGYVMDGASIEQNCTDITRIEWTYNFGIIMDG 255

Query: 256 LAYMYNATNGTSKWETALTQVLSGATTYFF-KNNIMYESACQEAKTCNTDQRSFKSIFSR 314
            AY+YNATNG++KWE   T++L+GA   FF KN+IMYE+ACQ    CN DQRSFK++ +R
Sbjct: 256 CAYLYNATNGSAKWEQCTTKLLAGAKDDFFDKNDIMYEAACQTNNKCNNDQRSFKALLAR 315

Query: 315 MLGYTRVLAPYTAATLDTLIETSAKAAAGSCDGGTDGVTCGLSWFDSTNDGYYGLGEQMS 374
            LG T VLAPYT +T+  +I  SA  AA SC+GG DG TCGLSW   TNDGYYG+GEQMS
Sbjct: 316 FLGTTSVLAPYTESTIKPMINASAIGAAKSCNGGYDGHTCGLSWQKGTNDGYYGMGEQMS 375

Query: 375 ALEIINQLLV 384
           ALEII  LL+
Sbjct: 376 ALEIIQNLLI 385

>ACL202W Chr3 (8390..9742) [1353 bp, 450 aa] {ON} Non-syntenic
           homolog of Saccharomyces cerevisiae YMR238W (DFG5);
           Tandem gene triplication in this genome
          Length = 450

 Score =  464 bits (1194), Expect = e-161,   Method: Compositional matrix adjust.
 Identities = 222/378 (58%), Positives = 277/378 (73%), Gaps = 3/378 (0%)

Query: 9   LISQILYASAITLDVDSKDSVCEATALIQKGMLDYYQGTRYGGTVGMFQPPYYWWEAGEA 68
           +I  I+  +A+ ++ +S  S+C AT LIQ+G+LDYY+G R GG VG FQ PYYWW AG+ 
Sbjct: 5   VIFNIVLCNALDVNFNSSASICNATKLIQQGILDYYEGLRPGGRVGFFQEPYYWWMAGDV 64

Query: 69  FGGMLENWYLCQNDTFESLISDALIYQAGSNYDYIPSNQTLVEGNDDQGVWGLTVLGAVE 128
           FGGM+ENWYLC N  ++ L+++A++ Q G N DY+P +Q +VEGNDDQG+WGL V+ A E
Sbjct: 65  FGGMVENWYLCDNTEYKDLLTEAMVSQIGENKDYVPWHQRMVEGNDDQGIWGLLVMDAAE 124

Query: 129 RNLPD--RDGVPGWLAISQAVFNTMYARWDTAYCGGGLRWQIYTWNSGYNYKNTISNACL 186
           R+ PD   D  PGWLA++QAVFNTM+ARWD   C GGL WQIY WN GY+YKNTISN  L
Sbjct: 125 RDFPDAPPDQAPGWLALAQAVFNTMWARWDMDNCAGGLLWQIYPWNVGYDYKNTISNGYL 184

Query: 187 FQIAARLGRYTGNNTYLEVAEKVFDWMVDVEYIVLKDVANVYDGATTNYNCSDIVQYEWS 246
           FQIAARL R+TGN+TY  VAE VFDW+VD + + L +VA V DGA    NC+D  +YEW+
Sbjct: 185 FQIAARLARFTGNSTYGRVAETVFDWLVDSKLVQLDNVALVLDGAHVYTNCTDFTRYEWT 244

Query: 247 YNHGVVLGGLAYMYNATNGTSKWETALTQVLSGATTYFFKNNIMYESACQEAKTCNTDQR 306
           YN+GVVLGG AYMYN TNG+  W   L +VL+GA   FF+N IMYE  CQ+   CN DQR
Sbjct: 245 YNYGVVLGGCAYMYNFTNGSPVWANRLNRVLNGA-LLFFENGIMYERTCQDVDRCNNDQR 303

Query: 307 SFKSIFSRMLGYTRVLAPYTAATLDTLIETSAKAAAGSCDGGTDGVTCGLSWFDSTNDGY 366
            FKSIF+RML  T VLAP+T A ++  I  SA+AAA SC+GG+DG TCGL W + T DG 
Sbjct: 304 FFKSIFTRMLALTSVLAPHTKARIEPNIRKSAEAAAKSCNGGSDGHTCGLVWRNYTWDGK 363

Query: 367 YGLGEQMSALEIINQLLV 384
            GLGEQ+ ALEII   L+
Sbjct: 364 AGLGEQLCALEIIQNTLI 381

>SAKL0D13574g Chr4 (1125011..1126366) [1356 bp, 451 aa] {ON} highly
           similar to uniprot|P36091 Saccharomyces cerevisiae
           YKL046C DCW1 Mannosidase GPI-anchored membrane protein
           required for cell wall biosynthesis homologous to Dfg5p
          Length = 451

 Score =  420 bits (1080), Expect = e-144,   Method: Compositional matrix adjust.
 Identities = 201/376 (53%), Positives = 266/376 (70%), Gaps = 6/376 (1%)

Query: 11  SQILYAS--AITLDVDSKDSVCEATALIQKGMLDYYQGTRYGGTVGMFQPPYYWWEAGEA 68
           S +LY+   A+ LDVD  +S+  ATAL+  G++DYY G +YG T+GMF  PYYWWEAG A
Sbjct: 13  SLLLYSPTGAMDLDVDDLNSLKNATALVAYGLMDYYTGLQYGQTIGMFSNPYYWWEAGGA 72

Query: 69  FGGMLENWYLCQNDTFESLISDALIYQAGSNYDYIPSNQTLVEGNDDQGVWGLTVLGAVE 128
           +G ML+ W+  +NDT+  ++  AL+YQ G ++DY+P NQ+  EGNDDQ  WGL V+ A E
Sbjct: 73  WGSMLDYWWYMENDTYNDIVKQALLYQTGDDHDYVPLNQSTTEGNDDQAFWGLAVMAAAE 132

Query: 129 RNL--PDRDGVPGWLAISQAVFNTMYARWDTAYCGGGLRWQIYTWNSGYNYKNTISNACL 186
           RN   PD D  P WL ++QAVFNTM  RWD   CGGGLRWQI+TWNSGY+YKN++SN  L
Sbjct: 133 RNFSNPDPD-QPQWLYLAQAVFNTMALRWDADSCGGGLRWQIFTWNSGYDYKNSVSNGAL 191

Query: 187 FQIAARLGRYTGNNTYLEVAEKVFDWMVDVEYIVLKDVANVYDGATTNYNCSDIVQYEWS 246
           F IAARL RYTGN +Y++ AEKVFDWM DV  I   D A V+DG + + NC+ +  Y+W+
Sbjct: 192 FHIAARLARYTGNQSYVDWAEKVFDWMRDVGLITEGDWAFVHDGVSIDDNCTSVTPYQWT 251

Query: 247 YNHGVVLGGLAYMYNATNGTSKWETALTQVLSGATTYFFKNNIMYESACQEAKTCNTDQR 306
           YNHG+++ G AY+YN T G+  W     + L  ++ +F   +I++E+ACQ + TCNTDQR
Sbjct: 252 YNHGLIMAGSAYLYNFT-GSEVWHNRTKEFLHSSSVFFKNGSILWEAACQASNTCNTDQR 310

Query: 307 SFKSIFSRMLGYTRVLAPYTAATLDTLIETSAKAAAGSCDGGTDGVTCGLSWFDSTNDGY 366
           SFK+ FSR LG T  L P + + +   I +SAK AA SC GG DG TCG++WF+ + DG+
Sbjct: 311 SFKAYFSRFLGLTAQLVPESRSQIMEWIRSSAKGAAESCSGGRDGHTCGINWFNGSWDGF 370

Query: 367 YGLGEQMSALEIINQL 382
           YGLGEQM+ALEII  +
Sbjct: 371 YGLGEQMAALEIIQNV 386

>KLTH0D08008g Chr4 (680735..682081) [1347 bp, 448 aa] {ON} highly
           similar to uniprot|P36091 Saccharomyces cerevisiae
           YKL046C DCW1 Mannosidase GPI-anchored membrane protein
           required for cell wall biosynthesis homologous to Dfg5p
          Length = 448

 Score =  416 bits (1069), Expect = e-142,   Method: Compositional matrix adjust.
 Identities = 204/369 (55%), Positives = 260/369 (70%), Gaps = 3/369 (0%)

Query: 16  ASAITLDVDSKDSVCEATALIQKGMLDYYQGTRYGGTVGMFQPPYYWWEAGEAFGGMLEN 75
           + A+  DVD++ S+  ATAL+  G+LDYY G +YG T+GMF  PYYWWEAG A+G +L+ 
Sbjct: 18  SQALDFDVDNEGSIKNATALVAGGLLDYYTGQQYGQTIGMFSNPYYWWEAGGAWGSILDF 77

Query: 76  WYLCQNDTFESLISDALIYQAGSNYDYIPSNQTLVEGNDDQGVWGLTVLGAVERNLPDR- 134
           W+  QNDT+ +++ +AL+YQAG N+DYIP NQ+  EGNDDQ  WGL V+ A ERN  +  
Sbjct: 78  WWYTQNDTYNAMLEEALLYQAGENHDYIPLNQSTTEGNDDQAFWGLVVMAAAERNFTNPP 137

Query: 135 DGVPGWLAISQAVFNTMYARWDTAYCGGGLRWQIYTWNSGYNYKNTISNACLFQIAARLG 194
           +  P WL ++QAVFNTM  RWD   CGGGLRWQI+TWNSGY+YKNT+SN  LF +AARL 
Sbjct: 138 ETEPQWLYLAQAVFNTMALRWDDESCGGGLRWQIFTWNSGYDYKNTVSNGALFHLAARLA 197

Query: 195 RYTGNNTYLEVAEKVFDWMVDVEYIVLKDVANVYDGATTNYNCSDIVQYEWSYNHGVVLG 254
           RYTGNNTY++ AEKVFDWM  +  +   D + VYDGA  + NCS I +  W+YN G+++ 
Sbjct: 198 RYTGNNTYVDWAEKVFDWMKGIGLLTENDNSYVYDGAKVDGNCSTITKLIWTYNQGLLMS 257

Query: 255 GLAYMYNATNGTSKWETALTQVLSGATTYFFKNNIMYESACQEAKTCNTDQRSFKSIFSR 314
           G AY+YN T G+  W T   + L+ ++  FF N+I+YE  CQEA TCNTDQRSFK+ FSR
Sbjct: 258 GCAYLYNYT-GSETWHTRTFEFLN-SSDIFFNNSILYERTCQEANTCNTDQRSFKAYFSR 315

Query: 315 MLGYTRVLAPYTAATLDTLIETSAKAAAGSCDGGTDGVTCGLSWFDSTNDGYYGLGEQMS 374
            LG T  L P     +   I  SAK AA SC GGTDG TCGL+WF    DG +GLGEQM+
Sbjct: 316 FLGLTAQLVPAARNQIMDWIRASAKGAAQSCSGGTDGHTCGLNWFYDGWDGKWGLGEQMA 375

Query: 375 ALEIINQLL 383
           ALEI+  +L
Sbjct: 376 ALEIMQNVL 384

>KAFR0A02170 Chr1 (454336..455685) [1350 bp, 449 aa] {ON} Anc_2.570
           YKL046C
          Length = 449

 Score =  411 bits (1057), Expect = e-140,   Method: Compositional matrix adjust.
 Identities = 202/375 (53%), Positives = 263/375 (70%), Gaps = 5/375 (1%)

Query: 7   LGLISQILYASAITLDVDSKDSVCEATALIQKGMLDYYQGTRYGGTVGMFQPPYYWWEAG 66
           L L + I  + ++ LD+D   S+  ATAL+  G++DYY+GT+YGGTVGMF  PYYWWEAG
Sbjct: 10  LILSTLIWRSQSLELDLDDYQSLQNATALVAWGLMDYYEGTKYGGTVGMFSSPYYWWEAG 69

Query: 67  EAFGGMLENWYLCQNDTFESLISDALIYQAGSNYDYIPSNQTLVEGNDDQGVWGLTVLGA 126
            AFG +L+ WY   NDT+   I  A++YQAG+++DYIP NQ+  EGNDDQ  WG+  + A
Sbjct: 70  GAFGTLLDFWYFMDNDTYNDEILAAMVYQAGNDWDYIPLNQSTTEGNDDQAFWGIAAMTA 129

Query: 127 VERNL--PDRDGVPGWLAISQAVFNTMYARWDTAYCGGGLRWQIYTWNSGYNYKNTISNA 184
            ERN   P  D  P WL ++QAVFNTM  RWDT  CGGGLRWQI+TWNSGY+YKN++SN 
Sbjct: 130 AERNFTNPASD-EPQWLYLAQAVFNTMALRWDTDSCGGGLRWQIFTWNSGYDYKNSVSNG 188

Query: 185 CLFQIAARLGRYTGNNTYLEVAEKVFDWMVDVEYIVLKDVANVYDGATTNYNCSDIVQYE 244
            LF +AARL RYTGN++Y++ AEKV++WM D  +I   +   VYDGA+T  NCS + +Y+
Sbjct: 189 ALFHLAARLARYTGNDSYVDWAEKVYNWMEDTGFITTGNTLYVYDGASTEDNCSSVTKYQ 248

Query: 245 WSYNHGVVLGGLAYMYNATNGTSKWETALTQVLSGATTYFFKNNIMYESACQEAKTCNTD 304
           W+YN G++L G AY+YN +  +  +   +T + S     F  N+IM E+ACQ A TC+TD
Sbjct: 249 WTYNQGLILSGAAYLYNYSESSLWYNRTMTALSSSGV--FLNNSIMCEAACQPAGTCDTD 306

Query: 305 QRSFKSIFSRMLGYTRVLAPYTAATLDTLIETSAKAAAGSCDGGTDGVTCGLSWFDSTND 364
           QRSFK+ F+R LG T  L P T   + T +  SA A A SC GGTDG TCGL+WF  + D
Sbjct: 307 QRSFKAYFARFLGVTAQLVPSTRTQIMTWMNASAYAVAESCSGGTDGHTCGLNWFLGSWD 366

Query: 365 GYYGLGEQMSALEII 379
           GYYGLGEQMSALE++
Sbjct: 367 GYYGLGEQMSALEVL 381

>TPHA0I02470 Chr9 (550108..551466) [1359 bp, 452 aa] {ON} Anc_2.570
           YKL046C
          Length = 452

 Score =  411 bits (1057), Expect = e-140,   Method: Compositional matrix adjust.
 Identities = 206/381 (54%), Positives = 264/381 (69%), Gaps = 7/381 (1%)

Query: 1   MFYLTLLGLISQILYASAITLDVDSKDSVCEATALIQKGMLDYYQGTRYGGTVGMFQPPY 60
           +F   +L L S +   SA+ LD+D+ +S+  ATAL+  G++DYY G +YG T+GMF  PY
Sbjct: 9   LFVNCILSLYSSL--TSAVYLDLDNYESLQNATALVAYGLMDYYTGLQYGKTIGMFSDPY 66

Query: 61  YWWEAGEAFGGMLENWYLCQNDTFESLISDALIYQAGSNYDYIPSNQTLVEGNDDQGVWG 120
           YWWEAG A+G ML+ W+  +NDT+  +I  AL+YQ G+  DY+P NQ+  EGNDDQ  WG
Sbjct: 67  YWWEAGGAWGCMLDYWFFMENDTYNDIIKQALLYQVGTANDYVPLNQSTTEGNDDQAFWG 126

Query: 121 LTVLGAVERNL--PDRDGVPGWLAISQAVFNTMYARWDTAYCGGGLRWQIYTWNSGYNYK 178
           +  + A ERN   P  D  P WL ++QAVFNTM  RWDT  CGGGLRWQI+ WNSGY+YK
Sbjct: 127 IAAMMAAERNFTNPAED-EPQWLYLAQAVFNTMALRWDTDSCGGGLRWQIFQWNSGYDYK 185

Query: 179 NTISNACLFQIAARLGRYTGNNTYLEVAEKVFDWMVDVEYIVLKDVANVYDGATTNYNCS 238
           N++SN  LF IAARL RYTGN++Y E AEKV+DWMVDV+ I       VYDG  +N NC+
Sbjct: 186 NSVSNGALFHIAARLARYTGNDSYAEWAEKVYDWMVDVDLITQDQYYFVYDGVDSNDNCT 245

Query: 239 DIVQYEWSYNHGVVLGGLAYMYNATNGTSKWETALTQVLSGATTYFFKNNIMYESACQEA 298
            I +Y+W+YN G++L G AY+YN T G+  W T     LS +++ FF + I+YE+ACQ  
Sbjct: 246 TITKYQWTYNQGLILSGCAYLYNYT-GSELWHTRTKNFLS-SSSVFFNDTILYEAACQNQ 303

Query: 299 KTCNTDQRSFKSIFSRMLGYTRVLAPYTAATLDTLIETSAKAAAGSCDGGTDGVTCGLSW 358
           +TCNTDQRSFK+ FSR LG T  L P T   +   I+ SA  AA SC GGTDG TCG++W
Sbjct: 304 ETCNTDQRSFKAYFSRFLGVTAQLVPETRDNIMKWIDASAYGAAESCSGGTDGHTCGINW 363

Query: 359 FDSTNDGYYGLGEQMSALEII 379
           F    DG YGLGEQM+ALEI+
Sbjct: 364 FYGGWDGKYGLGEQMAALEIL 384

>CAGL0L01727g Chr12 complement(184249..185589) [1341 bp, 446 aa]
           {ON} highly similar to uniprot|P36091 Saccharomyces
           cerevisiae YKL046c
          Length = 446

 Score =  409 bits (1051), Expect = e-139,   Method: Compositional matrix adjust.
 Identities = 202/380 (53%), Positives = 258/380 (67%), Gaps = 3/380 (0%)

Query: 1   MFYLTLLGLISQILYASAITLDVDSKDSVCEATALIQKGMLDYYQGTRYGGTVGMFQPPY 60
           M  +TLL  +  ++    + LD+D   S+  ATAL+  G++DYY G +YG TVGMF  PY
Sbjct: 1   MRLVTLLSGLVSLVSVFGLELDLDDYASLQNATALVAYGLMDYYTGDQYGKTVGMFSDPY 60

Query: 61  YWWEAGEAFGGMLENWYLCQNDTFESLISDALIYQAGSNYDYIPSNQTLVEGNDDQGVWG 120
           YWW+AG A+G ML+ WY  QNDT+   I  AL++Q G N DY+P NQ+  EGNDDQ  WG
Sbjct: 61  YWWQAGGAWGCMLDYWYFMQNDTYNDKIMAALLHQTGDNNDYVPLNQSTTEGNDDQAFWG 120

Query: 121 LTVLGAVERNLPDR-DGVPGWLAISQAVFNTMYARWDTAYCGGGLRWQIYTWNSGYNYKN 179
           + V+ A ER  P+  D  P WL ++QAVFNTM  RWD+  CGGGLRWQI+ WNSGY+YKN
Sbjct: 121 IAVMQAAERKFPNPPDDKPQWLYLTQAVFNTMALRWDSETCGGGLRWQIFVWNSGYDYKN 180

Query: 180 TISNACLFQIAARLGRYTGNNTYLEVAEKVFDWMVDVEYIVLKDVANVYDGATTNYNCSD 239
           T+SN  LF IAARL RYTGN +Y++ AE+V+DWM DV  I       VYDG + N NC+ 
Sbjct: 181 TVSNGALFHIAARLARYTGNQSYVDWAERVYDWMEDVHLIDNGTYRYVYDGVSINDNCTT 240

Query: 240 IVQYEWSYNHGVVLGGLAYMYNATNGTSKWETALTQVLSGATTYFFKNNIMYESACQEAK 299
           + +Y+W+YN G++L G AY++N T G+  W    T     A+  FF N+I+YE+ACQ   
Sbjct: 241 VTKYQWTYNQGLMLSGSAYLFNMT-GSDLWHER-THAFLNASRVFFNNSILYEAACQGPN 298

Query: 300 TCNTDQRSFKSIFSRMLGYTRVLAPYTAATLDTLIETSAKAAAGSCDGGTDGVTCGLSWF 359
           TCNTDQRSFK+ F+R LG T  L P T   + T + TSA AAA SC GGTDG TCGL+WF
Sbjct: 299 TCNTDQRSFKAYFARFLGSTAELVPETRQQIMTWLNTSALAAAKSCSGGTDGHTCGLNWF 358

Query: 360 DSTNDGYYGLGEQMSALEII 379
               DG YGLGEQM+ALE++
Sbjct: 359 RDDWDGMYGLGEQMAALEVM 378

>KLLA0E07723g Chr5 complement(691980..693332) [1353 bp, 450 aa] {ON}
           similar to uniprot|P36091 Saccharomyces cerevisiae
           YKL046C DCW1 Mannosidase GPI-anchored membrane protein
           required for cell wall biosynthesis homologous to Dfg5p
          Length = 450

 Score =  408 bits (1049), Expect = e-139,   Method: Compositional matrix adjust.
 Identities = 198/382 (51%), Positives = 270/382 (70%), Gaps = 7/382 (1%)

Query: 4   LTLLGLISQILYASAITLDVDSKDSVCEATALIQKGMLDYYQGTRYGGTVGMFQPPYYWW 63
           L+L+ L S + +   + LDV+  +S+  AT+L+  G++DYY G +YG T+GMF  P YWW
Sbjct: 8   LSLVTLFSSVSFG--LDLDVNDLNSLKNATSLVAYGLMDYYTGLQYGKTIGMFASPSYWW 65

Query: 64  EAGEAFGGMLENWYLCQNDTFESLISDALIYQAGSNYDYIPSNQTLVEGNDDQGVWGLTV 123
           +AG A+G +L+ W+  +NDT+  +++ AL+YQ G N+DY+P NQT+ EGNDDQ  WG  V
Sbjct: 66  QAGGAWGSILDYWFYMENDTYNDILTQALLYQTGDNHDYMPLNQTVTEGNDDQAFWGFAV 125

Query: 124 LGAVERNLPD-RDGVPGWLAISQAVFNTMYARWDTAYCGGGLRWQIYTWNSGYNYKNTIS 182
           + A ERN P+  D  P WL ++QAVFNTM +RWD   CGGGLRWQI+TWNSGY+YKN++S
Sbjct: 126 MAAAERNYPNPPDDEPQWLYLAQAVFNTMSSRWDMDSCGGGLRWQIFTWNSGYDYKNSVS 185

Query: 183 NACLFQIAARLGRYTGNNTYLEVAEKVFDWMVDVEYIVLKDVAN--VYDGATTNYNCSDI 240
           NA LF ++ARL RYTGN++Y E AEK++DWM D++ +V ++     VYDGA+   NC+D 
Sbjct: 186 NAALFHLSARLARYTGNSSYTEWAEKIYDWMQDIQLLVDEEPTQYYVYDGASIEENCTDT 245

Query: 241 VQYEWSYNHGVVLGGLAYMYNATNGTSKWETALTQVLSGATTYFFKNNIMYESACQEAKT 300
           V+Y+W+YN G++L G AY+YN T  +  W       L+ ++  FF N+IMYE+ACQ +  
Sbjct: 246 VKYQWTYNQGLMLSGSAYLYNFTE-SETWHERTKNFLN-SSGIFFNNSIMYEAACQGSGY 303

Query: 301 CNTDQRSFKSIFSRMLGYTRVLAPYTAATLDTLIETSAKAAAGSCDGGTDGVTCGLSWFD 360
           CN DQRSFK+ FSR LG T  L P T  T+  L++ SA+ AA SC GGTDG TCGL+WF 
Sbjct: 304 CNNDQRSFKAYFSRFLGLTAQLVPETRDTVLALLQASAQGAADSCSGGTDGHTCGLNWFY 363

Query: 361 STNDGYYGLGEQMSALEIINQL 382
              DG YGLGEQM+ALE++  L
Sbjct: 364 GGWDGKYGLGEQMAALEVMQNL 385

>YKL046C Chr11 complement(351275..352624) [1350 bp, 449 aa] {ON}
           DCW1Putative mannosidase, GPI-anchored membrane protein
           required for cell wall biosynthesis in bud
           formation;homologous to Dfg5p
          Length = 449

 Score =  407 bits (1047), Expect = e-139,   Method: Compositional matrix adjust.
 Identities = 201/377 (53%), Positives = 262/377 (69%), Gaps = 3/377 (0%)

Query: 4   LTLLGLISQILYASAITLDVDSKDSVCEATALIQKGMLDYYQGTRYGGTVGMFQPPYYWW 63
           + LLG++    + +A+ LD+D+ +S+  AT+LI  G++DYY G +YG TVGMF  PYYWW
Sbjct: 7   IGLLGVLFATRFTNAVELDLDNYESLQNATSLIAYGLMDYYTGNQYGKTVGMFSDPYYWW 66

Query: 64  EAGEAFGGMLENWYLCQNDTFESLISDALIYQAGSNYDYIPSNQTLVEGNDDQGVWGLTV 123
           EAG A+G ML+ W+   NDT+   I  A+I+QAG + DYIP NQ+  EGNDDQ  WG+  
Sbjct: 67  EAGGAWGCMLDYWFFMDNDTYNDEIIAAMIHQAGDDNDYIPLNQSTTEGNDDQAFWGIAA 126

Query: 124 LGAVERNLPDR-DGVPGWLAISQAVFNTMYARWDTAYCGGGLRWQIYTWNSGYNYKNTIS 182
           + A ERN  +  +  P WL ++QAVFNTM  RWD   CGGGLRWQI+ WNSGY+YKNT+S
Sbjct: 127 MTAAERNFTNPPENEPQWLYLAQAVFNTMALRWDADSCGGGLRWQIFVWNSGYDYKNTVS 186

Query: 183 NACLFQIAARLGRYTGNNTYLEVAEKVFDWMVDVEYIVLKDVANVYDGATTNYNCSDIVQ 242
           N  LF IAARL RYTGN TY++ AEKV++WMV V  I       VYDG + + NC+ +  
Sbjct: 187 NGALFHIAARLARYTGNQTYVDWAEKVYEWMVGVNLISNGTYKYVYDGVSIDDNCTKVTS 246

Query: 243 YEWSYNHGVVLGGLAYMYNATNGTSKWETALTQVLSGATTYFFKNNIMYESACQEAKTCN 302
           Y+W+YN G++L G AY+YN T G+  W T   + L+ A+  FF + I+YE+ACQ   +CN
Sbjct: 247 YQWTYNQGLLLAGSAYLYNFT-GSDLWHTRTKEFLN-ASQVFFHDGIVYEAACQGPNSCN 304

Query: 303 TDQRSFKSIFSRMLGYTRVLAPYTAATLDTLIETSAKAAAGSCDGGTDGVTCGLSWFDST 362
           TDQRSFK+ F+R LG T  L P T   + + + TSA AAA SC GGTDG TCGL+WF+ T
Sbjct: 305 TDQRSFKAYFARFLGVTAQLVPETRNQIMSWLNTSAIAAAKSCSGGTDGHTCGLNWFNGT 364

Query: 363 NDGYYGLGEQMSALEII 379
            DG YGLGEQMSALE++
Sbjct: 365 WDGMYGLGEQMSALEVM 381

>Suva_11.180 Chr11 complement(334319..335671) [1353 bp, 450 aa] {ON}
           YKL046C (REAL)
          Length = 450

 Score =  406 bits (1043), Expect = e-138,   Method: Compositional matrix adjust.
 Identities = 203/385 (52%), Positives = 265/385 (68%), Gaps = 9/385 (2%)

Query: 1   MFYLTLLGLISQIL----YASAITLDVDSKDSVCEATALIQKGMLDYYQGTRYGGTVGMF 56
           M     +GL+S +     + +A+ LD+D+  S+  AT+LI  G++DYY G +YG TVGMF
Sbjct: 1   MLVNKFIGLLSVLFATTRFTNAVELDLDNYQSLQNATSLIAYGLMDYYTGDQYGKTVGMF 60

Query: 57  QPPYYWWEAGEAFGGMLENWYLCQNDTFESLISDALIYQAGSNYDYIPSNQTLVEGNDDQ 116
             PYYWWEAG A+G ML+ W+  +NDT+   I+ A+I+QAG + DYIP NQ+  EGNDDQ
Sbjct: 61  SDPYYWWEAGGAWGCMLDYWFFMENDTYNDEITAAMIHQAGDDNDYIPLNQSTTEGNDDQ 120

Query: 117 GVWGLTVLGAVERNL--PDRDGVPGWLAISQAVFNTMYARWDTAYCGGGLRWQIYTWNSG 174
             WG+  + A ERN   P  D  P WL ++QAVFNTM  RWD   CGGGLRWQI+ WNSG
Sbjct: 121 AFWGIAAMTAAERNFTNPPSD-EPQWLYLAQAVFNTMALRWDADSCGGGLRWQIFVWNSG 179

Query: 175 YNYKNTISNACLFQIAARLGRYTGNNTYLEVAEKVFDWMVDVEYIVLKDVANVYDGATTN 234
           Y+YKNT+SN  LF IAARL RYTGN TY++ AEKV++WMV V  I       VYDG + +
Sbjct: 180 YDYKNTVSNGALFHIAARLARYTGNETYVDWAEKVYEWMVGVNLISNGTYKYVYDGVSID 239

Query: 235 YNCSDIVQYEWSYNHGVVLGGLAYMYNATNGTSKWETALTQVLSGATTYFFKNNIMYESA 294
            NC+ +  Y+W+YN G++L G AY+YN T G+  W T   + L+ A+  FF + I+YE+A
Sbjct: 240 DNCTKVTSYQWTYNQGLLLAGSAYLYNFT-GSDLWHTRTKEFLN-ASQVFFHDGIVYEAA 297

Query: 295 CQEAKTCNTDQRSFKSIFSRMLGYTRVLAPYTAATLDTLIETSAKAAAGSCDGGTDGVTC 354
           CQ   +CNTDQRSFK+ F+R LG T  L P T + + + + TSA AAA SC GGTDG TC
Sbjct: 298 CQGPNSCNTDQRSFKAYFARFLGVTAQLVPETRSQIMSWLNTSAIAAAKSCSGGTDGHTC 357

Query: 355 GLSWFDSTNDGYYGLGEQMSALEII 379
           GL+WF+ T DG YGLGEQM+ALE++
Sbjct: 358 GLNWFNGTWDGMYGLGEQMAALEVM 382

>KAFR0I01740 Chr9 complement(352631..353977) [1347 bp, 448 aa] {ON}
           Anc_2.570 YKL046C
          Length = 448

 Score =  405 bits (1040), Expect = e-138,   Method: Compositional matrix adjust.
 Identities = 206/377 (54%), Positives = 261/377 (69%), Gaps = 3/377 (0%)

Query: 4   LTLLGLISQILYASAITLDVDSKDSVCEATALIQKGMLDYYQGTRYGGTVGMFQPPYYWW 63
           L LL L + I    ++ LD+DS +S+  ATAL+  G++DYY G +YG TVGMF  PYYWW
Sbjct: 6   LILLILSTFIGRVYSLELDLDSFESLQNATALVAYGLMDYYTGNQYGKTVGMFSDPYYWW 65

Query: 64  EAGEAFGGMLENWYLCQNDTFESLISDALIYQAGSNYDYIPSNQTLVEGNDDQGVWGLTV 123
           EAG A+G M++ WY   N+T+   I  AL++Q G ++DYIP NQ+  EGNDDQ  WG+ V
Sbjct: 66  EAGGAWGSMIDFWYYMDNNTYNDDIMAALLHQTGDDWDYIPLNQSTTEGNDDQAFWGIAV 125

Query: 124 LGAVERNLPDR-DGVPGWLAISQAVFNTMYARWDTAYCGGGLRWQIYTWNSGYNYKNTIS 182
           + A ERN  +  D  P WL ++QAVFNTM  RWD A CGGGLRWQI+TWNSGY+YKNT+S
Sbjct: 126 MTAAERNFTNPPDDQPQWLYLAQAVFNTMALRWDDATCGGGLRWQIFTWNSGYDYKNTVS 185

Query: 183 NACLFQIAARLGRYTGNNTYLEVAEKVFDWMVDVEYIVLKDVANVYDGATTNYNCSDIVQ 242
           N  LF +AARL RYTGN +Y++ AEKV++WM D   I       VYDGA+   NC+ + +
Sbjct: 186 NGALFHLAARLARYTGNTSYVDWAEKVYNWMEDTYLISNGTQMFVYDGASVTDNCTTVTK 245

Query: 243 YEWSYNHGVVLGGLAYMYNATNGTSKWETALTQVLSGATTYFFKNNIMYESACQEAKTCN 302
           Y+W+YN G++L G AY+YN T  +  W       L+ A+  FF N+IMYE+ACQ  +TCN
Sbjct: 246 YQWTYNQGLLLSGSAYLYNFTE-SELWHERTKGFLN-ASVVFFNNSIMYEAACQGPQTCN 303

Query: 303 TDQRSFKSIFSRMLGYTRVLAPYTAATLDTLIETSAKAAAGSCDGGTDGVTCGLSWFDST 362
           TDQRSFK+ FSR LG T  L P T  T+   + TSA AAA SC GGTDG TCG++WF   
Sbjct: 304 TDQRSFKAYFSRFLGATAQLVPETRDTVMHWVNTSAVAAATSCSGGTDGHTCGINWFYGG 363

Query: 363 NDGYYGLGEQMSALEII 379
            DGYYGLGEQMSALEI+
Sbjct: 364 WDGYYGLGEQMSALEIM 380

>Smik_11.202 Chr11 complement(337711..339060) [1350 bp, 449 aa] {ON}
           YKL046C (REAL)
          Length = 449

 Score =  405 bits (1040), Expect = e-138,   Method: Compositional matrix adjust.
 Identities = 201/385 (52%), Positives = 265/385 (68%), Gaps = 10/385 (2%)

Query: 1   MFYLTLLGLISQIL---YASAITLDVDSKDSVCEATALIQKGMLDYYQGTRYGGTVGMFQ 57
           M    ++G +S +    + +A+ LD+D+ +S+  AT+L+  G++DYY G +YG T+GMF 
Sbjct: 1   MLMNKVIGFLSVLFATRFTNAVELDLDNYESLQNATSLVAYGLMDYYTGNQYGKTIGMFS 60

Query: 58  PPYYWWEAGEAFGGMLENWYLCQNDTFESLISDALIYQAGSNYDYIPSNQTLVEGNDDQG 117
            PYYWWEAG A+G ML+ W+   NDT+   I  A+I+QAG + DYIP NQ+  EGNDDQ 
Sbjct: 61  DPYYWWEAGGAWGCMLDYWFFMDNDTYNDEIIAAMIHQAGDDNDYIPLNQSTTEGNDDQA 120

Query: 118 VWGLTVLGAVERNL---PDRDGVPGWLAISQAVFNTMYARWDTAYCGGGLRWQIYTWNSG 174
            WG+  + A ERN    P+ D  P WL ++QAVFNTM  RWD   CGGGLRWQI+ WNSG
Sbjct: 121 FWGIAAMTAAERNFTNPPEDD--PQWLYLAQAVFNTMALRWDADSCGGGLRWQIFVWNSG 178

Query: 175 YNYKNTISNACLFQIAARLGRYTGNNTYLEVAEKVFDWMVDVEYIVLKDVANVYDGATTN 234
           Y+YKNT+SN  LF IAARL RYTGN TY++ AEKV++WMV V+ I       VYDG + +
Sbjct: 179 YDYKNTVSNGALFHIAARLARYTGNQTYVDWAEKVYEWMVGVDLISNGTYKYVYDGVSID 238

Query: 235 YNCSDIVQYEWSYNHGVVLGGLAYMYNATNGTSKWETALTQVLSGATTYFFKNNIMYESA 294
            NC+ +  Y+W+YN G++L G AY+YN T G+  W T   + L+ A+  FF + I+YE+A
Sbjct: 239 DNCTKVTSYQWTYNQGLLLAGSAYLYNFT-GSDLWHTRTKEFLN-ASQVFFHDGIVYEAA 296

Query: 295 CQEAKTCNTDQRSFKSIFSRMLGYTRVLAPYTAATLDTLIETSAKAAAGSCDGGTDGVTC 354
           CQ   +CNTDQRSFK+ F+R LG T  L P T   + + + TSA AAA SC GGTDG TC
Sbjct: 297 CQGPNSCNTDQRSFKAYFARFLGVTAQLVPETRHQIMSWLNTSAIAAAKSCSGGTDGHTC 356

Query: 355 GLSWFDSTNDGYYGLGEQMSALEII 379
           GL+WF+ T DG YGLGEQMSALE++
Sbjct: 357 GLNWFNGTWDGMYGLGEQMSALEVL 381

>NDAI0C00680 Chr3 complement(132980..134338) [1359 bp, 452 aa] {ON}
           Anc_2.570
          Length = 452

 Score =  404 bits (1037), Expect = e-137,   Method: Compositional matrix adjust.
 Identities = 200/364 (54%), Positives = 248/364 (68%), Gaps = 5/364 (1%)

Query: 18  AITLDVDSKDSVCEATALIQKGMLDYYQGTRYGGTVGMFQPPYYWWEAGEAFGGMLENWY 77
           A+ +D+D  DS+  AT+L+  G++DYY G +YG T+GMF  PYYWWEAG A+G ML+ WY
Sbjct: 24  ALEIDLDDIDSLRNATSLVAYGLMDYYTGNQYGKTIGMFSDPYYWWEAGGAWGSMLDYWY 83

Query: 78  LCQNDTFESLISDALIYQAGSNYDYIPSNQTLVEGNDDQGVWGLTVLGAVERNL--PDRD 135
              NDT+   I  AL++Q G N DY+P NQ+  EGNDDQ  WG+ V+ A ERN   P  D
Sbjct: 84  YMDNDTYNDEIMAALLHQTGDNNDYVPLNQSTTEGNDDQAFWGIAVMTAAERNFTNPPED 143

Query: 136 GVPGWLAISQAVFNTMYARWDTAYCGGGLRWQIYTWNSGYNYKNTISNACLFQIAARLGR 195
             P WL ++QAVFNTM  RWD   CGGGLRWQI+ WNSGY+YKNT+SN  LF +AARL R
Sbjct: 144 S-PQWLYLAQAVFNTMALRWDGDTCGGGLRWQIFVWNSGYDYKNTVSNGALFHMAARLAR 202

Query: 196 YTGNNTYLEVAEKVFDWMVDVEYIVLKDVANVYDGATTNYNCSDIVQYEWSYNHGVVLGG 255
           YTGN +Y++ AEKV+DWM +V  +       VYDG     NCS I  Y+W+YNHG+V+ G
Sbjct: 203 YTGNQSYVDWAEKVYDWMYEVGLVSNGSSMFVYDGVNIANNCSTITPYQWTYNHGLVMAG 262

Query: 256 LAYMYNATNGTSKWETALTQVLSGATTYFFKNNIMYESACQEAKTCNTDQRSFKSIFSRM 315
            AY+YN T     W    T++L  A+T FF N+IMYE+ACQ   +CNTDQRSFK+ FSR 
Sbjct: 263 AAYLYNFTE-NEVWHNR-TKMLVDASTVFFNNSIMYEAACQGPNSCNTDQRSFKAYFSRF 320

Query: 316 LGYTRVLAPYTAATLDTLIETSAKAAAGSCDGGTDGVTCGLSWFDSTNDGYYGLGEQMSA 375
           LG T  L P T + +  LI  SA AA  SC GGTDG TCGL+WF    DG YGLGEQM A
Sbjct: 321 LGATAQLVPETRSKILPLINASAIAAGKSCSGGTDGHTCGLNWFIGDWDGMYGLGEQMCA 380

Query: 376 LEII 379
           LE++
Sbjct: 381 LEVM 384

>Kwal_26.8225 s26 (696173..697522) [1350 bp, 449 aa] {ON} YKL046C -
           Hypothetical ORF [contig 58] FULL
          Length = 449

 Score =  402 bits (1034), Expect = e-137,   Method: Compositional matrix adjust.
 Identities = 200/370 (54%), Positives = 259/370 (70%), Gaps = 10/370 (2%)

Query: 19  ITLDVDSKDSVCEATALIQKGMLDYYQGTRYGGTVGMFQPPYYWWEAGEAFGGMLENWYL 78
           I LDV++ +S+  ATAL+  G+LDYY G +YG T+GMF  PYYWWEAG A+G +L+ W+ 
Sbjct: 21  IYLDVNNTESIKNATALVAGGLLDYYTGLQYGETIGMFSDPYYWWEAGGAWGSILDYWHY 80

Query: 79  CQNDTFESLISDALIYQAGSNYDYIPSNQTLVEGNDDQGVWGLTVLGAVERNL----PDR 134
            QNDT+  ++  AL+YQ+G N+DYIP NQ+  EGNDDQ  WGL V+ A ERN     PD+
Sbjct: 81  TQNDTYNKILEQALLYQSGENHDYIPLNQSTTEGNDDQAFWGLVVMAAAERNFTNPPPDQ 140

Query: 135 DGVPGWLAISQAVFNTMYARWDTAYCGGGLRWQIYTWNSGYNYKNTISNACLFQIAARLG 194
              P WL ++QAVFNTM  RWD   CGGGLRWQI+TWNSGY+YKNT+SN  LF +AARL 
Sbjct: 141 ---PQWLYLAQAVFNTMALRWDEDTCGGGLRWQIFTWNSGYDYKNTVSNGALFHLAARLA 197

Query: 195 RYTGNNTYLEVAEKVFDWMVDVEYIVLKDVANVYDGATTNYNCSDIVQYEWSYNHGVVLG 254
           RYTGN+TY+E AEKVFDWM  ++ +  ++   VYDGA  + NC+ I +  W+YN G+++ 
Sbjct: 198 RYTGNDTYVEWAEKVFDWMKGIKLLTEENENFVYDGAKVDDNCTVITKLIWTYNQGLLMS 257

Query: 255 GLAYMYNATNGTSKWETALTQVLSGATTYFFKNNIMYESACQEAK-TCNTDQRSFKSIFS 313
           G AY+YN T G  KW T   + L+ ++  FF N+++YE ACQ    +CNTDQRSFK+ FS
Sbjct: 258 GSAYLYNYT-GAEKWHTRTFEFLN-SSHIFFNNSVLYERACQGVTVSCNTDQRSFKAYFS 315

Query: 314 RMLGYTRVLAPYTAATLDTLIETSAKAAAGSCDGGTDGVTCGLSWFDSTNDGYYGLGEQM 373
           R +G T  L P + + +   I+ SA  AA SC GG DG TCGL+WF    DG +GLGEQM
Sbjct: 316 RFMGLTAQLVPESRSKIMAWIQASALGAAQSCSGGRDGHTCGLNWFYDGWDGKWGLGEQM 375

Query: 374 SALEIINQLL 383
           SALEI+  LL
Sbjct: 376 SALEIMQNLL 385

>Skud_11.183 Chr11 complement(330975..332324) [1350 bp, 449 aa] {ON}
           YKL046C (REAL)
          Length = 449

 Score =  402 bits (1034), Expect = e-137,   Method: Compositional matrix adjust.
 Identities = 200/384 (52%), Positives = 265/384 (69%), Gaps = 8/384 (2%)

Query: 1   MFYLTLLGLISQILY---ASAITLDVDSKDSVCEATALIQKGMLDYYQGTRYGGTVGMFQ 57
           M    ++GL+S + +   ++A+ LD+D+ +S+  AT+LI  G++DYY G +YG T+GMF 
Sbjct: 1   MLLNKVIGLLSVLFFTKFSNAVELDLDNYESLENATSLIAYGLMDYYTGNQYGKTIGMFS 60

Query: 58  PPYYWWEAGEAFGGMLENWYLCQNDTFESLISDALIYQAGSNYDYIPSNQTLVEGNDDQG 117
            PYYWWEAG A+G ML+ W+   NDT+   I  A+++Q+G + DYIP NQ+  EGNDDQ 
Sbjct: 61  DPYYWWEAGGAWGCMLDYWFFMDNDTYNDEIIAAMVHQSGDDNDYIPLNQSTTEGNDDQA 120

Query: 118 VWGLTVLGAVERNL--PDRDGVPGWLAISQAVFNTMYARWDTAYCGGGLRWQIYTWNSGY 175
            WG+  + A ERN   P  D  P WL ++QAVFNTM  RWD   CGGGLRWQI+ WNSGY
Sbjct: 121 FWGIAAMTAAERNFTNPPAD-EPQWLYLAQAVFNTMALRWDADSCGGGLRWQIFVWNSGY 179

Query: 176 NYKNTISNACLFQIAARLGRYTGNNTYLEVAEKVFDWMVDVEYIVLKDVANVYDGATTNY 235
           +YKNT+SN  LF IAARL RYTGN TY++ AEKV++WMV V  I       VYDG +   
Sbjct: 180 DYKNTVSNGALFHIAARLARYTGNQTYVDWAEKVYEWMVGVNLISNGTYKYVYDGVSIGD 239

Query: 236 NCSDIVQYEWSYNHGVVLGGLAYMYNATNGTSKWETALTQVLSGATTYFFKNNIMYESAC 295
           NC+ +  Y+W+YN G++L G AY+YN T G+  W T   + L+ ++  FF++ I+YE+AC
Sbjct: 240 NCTKVTSYQWTYNQGLLLAGSAYLYNFT-GSDLWHTRTKEFLN-SSQVFFQDGIVYEAAC 297

Query: 296 QEAKTCNTDQRSFKSIFSRMLGYTRVLAPYTAATLDTLIETSAKAAAGSCDGGTDGVTCG 355
           Q   +CNTDQRSFK+ F+R LG T  L P T   + T + TSA AAA SC GGTDG TCG
Sbjct: 298 QGPNSCNTDQRSFKAYFARFLGVTAQLVPETRNQIMTWLNTSAIAAAKSCSGGTDGHTCG 357

Query: 356 LSWFDSTNDGYYGLGEQMSALEII 379
           L+WF+ T DG YGLGEQM+ALE++
Sbjct: 358 LNWFNGTWDGMYGLGEQMAALEVM 381

>NDAI0B01510 Chr2 complement(354643..355986) [1344 bp, 447 aa] {ON}
           Anc_2.570
          Length = 447

 Score =  400 bits (1029), Expect = e-136,   Method: Compositional matrix adjust.
 Identities = 199/377 (52%), Positives = 256/377 (67%), Gaps = 3/377 (0%)

Query: 4   LTLLGLISQILYASAITLDVDSKDSVCEATALIQKGMLDYYQGTRYGGTVGMFQPPYYWW 63
             +L L++    A+A++LD+++  S+   TAL+  G++DYY G +YG TVGMF  PYYWW
Sbjct: 5   FNILFLLTFTHRANALSLDLNNYQSLENDTALVAYGLMDYYNGDQYGQTVGMFSNPYYWW 64

Query: 64  EAGEAFGGMLENWYLCQNDTFESLISDALIYQAGSNYDYIPSNQTLVEGNDDQGVWGLTV 123
           EAG A+G ML+ W+  +NDT+  LI  AL++Q G N DYIP NQ+  EGNDDQ  WG+  
Sbjct: 65  EAGGAWGTMLDYWFFMENDTYNDLIMSALLHQTGENNDYIPLNQSTTEGNDDQAFWGIAA 124

Query: 124 LGAVERNLPDR-DGVPGWLAISQAVFNTMYARWDTAYCGGGLRWQIYTWNSGYNYKNTIS 182
           + A ERN  +  +  P WL ++QAVFNTM  RWD   CGGGLRWQI+ WNSGY+YKN++S
Sbjct: 125 MTAAERNFTNPPESSPQWLYLAQAVFNTMALRWDAQNCGGGLRWQIFVWNSGYDYKNSVS 184

Query: 183 NACLFQIAARLGRYTGNNTYLEVAEKVFDWMVDVEYIVLKDVANVYDGATTNYNCSDIVQ 242
           N  LF +AARL RYTGN +Y++ AEK +DWM DV  I       VYDG +   NC+ I  
Sbjct: 185 NGALFHLAARLARYTGNQSYVDWAEKTYDWMSDVGLISNGTQKYVYDGTSIETNCTTITS 244

Query: 243 YEWSYNHGVVLGGLAYMYNATNGTSKWETALTQVLSGATTYFFKNNIMYESACQEAKTCN 302
           Y+WSYN G++L G AY+YN T G++ W      +L  AT+ FF N+IMYE ACQ   TCN
Sbjct: 245 YQWSYNQGLMLAGAAYLYNFT-GSTIWLNRTMDLLD-ATSVFFNNSIMYEVACQPTGTCN 302

Query: 303 TDQRSFKSIFSRMLGYTRVLAPYTAATLDTLIETSAKAAAGSCDGGTDGVTCGLSWFDST 362
            DQRSFKS  +R LG T  L   T + +   + TSA A A SC GGTDG TCGL+WFD+ 
Sbjct: 303 NDQRSFKSYLARFLGLTAQLVTITQSRIMNWLNTSAIAVAHSCSGGTDGHTCGLNWFDNG 362

Query: 363 NDGYYGLGEQMSALEII 379
            DGYYGLGEQMSAL+++
Sbjct: 363 WDGYYGLGEQMSALDVL 379

>NCAS0H02900 Chr8 (566940..568301) [1362 bp, 453 aa] {ON} Anc_2.570
          Length = 453

 Score =  399 bits (1026), Expect = e-135,   Method: Compositional matrix adjust.
 Identities = 202/373 (54%), Positives = 253/373 (67%), Gaps = 8/373 (2%)

Query: 9   LISQILYASAITLDVDSKDSVCEATALIQKGMLDYYQGTRYGGTVGMFQPPYYWWEAGEA 68
           L SQ+   SA+TLD++  +S+  AT+L+  G++DYY G +YG TVGMF  PYYWW+AG A
Sbjct: 19  LPSQV---SALTLDLNDTESLQNATSLVAYGLMDYYTGNQYGKTVGMFSDPYYWWQAGGA 75

Query: 69  FGGMLENWYLCQNDTFESLISDALIYQAGSNYDYIPSNQTLVEGNDDQGVWGLTVLGAVE 128
           +G ML+ WY   NDT+   I  AL++Q G + DY+P NQ+  EGNDDQ  WG+ V+ A E
Sbjct: 76  WGSMLDYWYYMNNDTYNDDIMAALLHQTGDDNDYVPLNQSTTEGNDDQAFWGIAVMTAAE 135

Query: 129 RNL--PDRDGVPGWLAISQAVFNTMYARWDTAYCGGGLRWQIYTWNSGYNYKNTISNACL 186
           RN   P  D  P WL ++QAVFNTM  RWD+  CGGGLRWQI+ WNSGY+YKNT+SN  L
Sbjct: 136 RNFTNPPED-QPQWLYLAQAVFNTMAMRWDSDTCGGGLRWQIFIWNSGYDYKNTVSNGAL 194

Query: 187 FQIAARLGRYTGNNTYLEVAEKVFDWMVDVEYIVLKDVANVYDGATTNYNCSDIVQYEWS 246
           F IA+RL RYTGN +Y++ AEKV+DWM DV  I       VYDG     NC+ +  Y+W+
Sbjct: 195 FHIASRLARYTGNQSYVDWAEKVYDWMYDVHLISNGSYMYVYDGVNIGDNCTTVTPYQWT 254

Query: 247 YNHGVVLGGLAYMYNATNGTSKWETALTQVLSGATTYFFKNNIMYESACQEAKTCNTDQR 306
           YN G++L G AY+YN T G   W      +L+ A   FF N+I+YE+ACQ   TCNTDQR
Sbjct: 255 YNQGLLLSGCAYLYNFT-GEELWHNRTKNLLTAAGV-FFNNSILYEAACQGHNTCNTDQR 312

Query: 307 SFKSIFSRMLGYTRVLAPYTAATLDTLIETSAKAAAGSCDGGTDGVTCGLSWFDSTNDGY 366
           SFK+ FSR LG T  L P T   +   I TSA AAA SC GGTDG TCG++WF    DG 
Sbjct: 313 SFKAYFSRFLGTTAQLVPETRNQIMHWINTSAVAAAQSCSGGTDGHTCGINWFADGWDGM 372

Query: 367 YGLGEQMSALEII 379
           YGLGEQM+ALEI+
Sbjct: 373 YGLGEQMAALEIM 385

>KNAG0A07180 Chr1 (1127961..1129352) [1392 bp, 463 aa] {ON} 
          Length = 463

 Score =  400 bits (1027), Expect = e-135,   Method: Compositional matrix adjust.
 Identities = 201/377 (53%), Positives = 253/377 (67%), Gaps = 5/377 (1%)

Query: 6   LLGLISQILYASAITLDVDSKDSVCEATALIQKGMLDYYQGTRYGGTVGMFQPPYYWWEA 65
           LL L + +   +A+ +D+D+ DS+  AT+LI  G++DYY G +YG TVGMF  PYYWWEA
Sbjct: 16  LLALSAVVSKVAALDIDLDNLDSIRNATSLIAYGLMDYYTGEQYGKTVGMFADPYYWWEA 75

Query: 66  GEAFGGMLENWYLCQNDTFESLISDALIYQAGSNYDYIPSNQTLVEGNDDQGVWGLTVLG 125
           G A+G ML+  +   NDT++S I  A+++Q G + +YIP NQ+  EGNDDQ  WG+  + 
Sbjct: 76  GGAWGSMLDYSWFMDNDTYDSQIMSAMLHQTGEHNNYIPLNQSTTEGNDDQAFWGIAAMT 135

Query: 126 AVERNL--PDRDGVPGWLAISQAVFNTMYARWDTAYCGGGLRWQIYTWNSGYNYKNTISN 183
           A ERN   P  D  P WL ++QAVFNTM  RWDT  CGGGLRWQI+ WNSGY+YKNT+SN
Sbjct: 136 AAERNFTNPPEDK-PQWLYLAQAVFNTMALRWDTESCGGGLRWQIFNWNSGYDYKNTVSN 194

Query: 184 ACLFQIAARLGRYTGNNTYLEVAEKVFDWMVDVEYIVLKDVANVYDGATTNYNCSDIVQY 243
             LF +A+RL RYTGN +Y++ AEKV+DWM DV  I       VYDG   N NCS + QY
Sbjct: 195 GALFHMASRLARYTGNQSYVDWAEKVYDWMWDVHVISNSTYMFVYDGVDANDNCSTVTQY 254

Query: 244 EWSYNHGVVLGGLAYMYNATNGTSKWETALTQVLSGATTYFFKNN-IMYESACQEAKTCN 302
           +W+YNHG++L G AY+YN T G   W     ++++ A  +F     IMYE+ACQ A TCN
Sbjct: 255 QWTYNHGLLLAGSAYLYNFT-GDEVWHNRTKKLVTAAQVFFNSTTGIMYEAACQAALTCN 313

Query: 303 TDQRSFKSIFSRMLGYTRVLAPYTAATLDTLIETSAKAAAGSCDGGTDGVTCGLSWFDST 362
            DQRSFK+ FSR LG T  L P T   +   + TSA AA  SC GG DG TCGL+WF   
Sbjct: 314 NDQRSFKAYFSRFLGLTAQLVPETRTQIMGWLNTSAVAAGKSCSGGYDGHTCGLNWFKDG 373

Query: 363 NDGYYGLGEQMSALEII 379
            DG YGLGEQMSALE I
Sbjct: 374 WDGMYGLGEQMSALECI 390

>NCAS0A12750 Chr1 (2516616..2517959) [1344 bp, 447 aa] {ON}
           Anc_2.570
          Length = 447

 Score =  399 bits (1024), Expect = e-135,   Method: Compositional matrix adjust.
 Identities = 198/365 (54%), Positives = 257/365 (70%), Gaps = 5/365 (1%)

Query: 17  SAITLDVDSKDSVCEATALIQKGMLDYYQGTRYGGTVGMFQPPYYWWEAGEAFGGMLENW 76
           +A+ L+++S  S+  AT+L+  G++DYY G +YG TVGMF  PYYWWEAG A+G ML+ W
Sbjct: 18  AAVDLNLNSLQSLQNATSLVAYGLMDYYTGDQYGQTVGMFSDPYYWWEAGGAWGTMLDYW 77

Query: 77  YLCQNDTFESLISDALIYQAGSNYDYIPSNQTLVEGNDDQGVWGLTVLGAVERNL--PDR 134
           Y  QNDT+  +I+ AL++Q G++ +YIP NQ+  EGNDDQ  WG+TV+ A ERN   P  
Sbjct: 78  YFMQNDTYNDIITAALLHQVGTDNNYIPLNQSTTEGNDDQAFWGITVMTAAERNFTNPPE 137

Query: 135 DGVPGWLAISQAVFNTMYARWDTAYCGGGLRWQIYTWNSGYNYKNTISNACLFQIAARLG 194
           D  P WL ++QAVFNTM  RWD   CGGGLRWQI+ WNSGY+YKN++SN  LF +AARL 
Sbjct: 138 D-QPQWLYLAQAVFNTMALRWDADSCGGGLRWQIFVWNSGYDYKNSVSNGALFHMAARLA 196

Query: 195 RYTGNNTYLEVAEKVFDWMVDVEYIVLKDVANVYDGATTNYNCSDIVQYEWSYNHGVVLG 254
           RYTGN +Y++ AE+V+DWM DV  I       VYDGA+T  NC+ +  Y+W+YN G++L 
Sbjct: 197 RYTGNQSYVDWAERVYDWMSDVGLISNGSYKFVYDGASTTDNCTVLTTYQWTYNQGLLLS 256

Query: 255 GLAYMYNATNGTSKWETALTQVLSGATTYFFKNNIMYESACQEAKTCNTDQRSFKSIFSR 314
           G AY+YN T G+  W     Q+L+ A++ FF N+I+YE+ACQ++ TCN DQRSFK+ F R
Sbjct: 257 GAAYLYNYT-GSDTWLLRTNQLLN-ASSVFFNNSILYEAACQKSGTCNNDQRSFKAYFLR 314

Query: 315 MLGYTRVLAPYTAATLDTLIETSAKAAAGSCDGGTDGVTCGLSWFDSTNDGYYGLGEQMS 374
            LG T  L   T  T+   +  SA AAA SC GGTDG TCGL+WF    DG YGLGEQMS
Sbjct: 315 FLGQTAQLVSETQPTIMKWLNASAYAAAQSCSGGTDGHTCGLNWFSGGWDGMYGLGEQMS 374

Query: 375 ALEII 379
           ALE +
Sbjct: 375 ALEAL 379

>TBLA0H02590 Chr8 complement(612543..613895) [1353 bp, 450 aa] {ON} 
          Length = 450

 Score =  397 bits (1021), Expect = e-135,   Method: Compositional matrix adjust.
 Identities = 202/388 (52%), Positives = 259/388 (66%), Gaps = 22/388 (5%)

Query: 1   MFYLTLLGLISQILYASAITLDVDSKDSVCEATALIQKGMLDYYQGTRYGGTVGMFQPPY 60
           +F ++LL L     + +A+ +D+D   S+  AT+LI  GM+DYY G  YG  +GMF  PY
Sbjct: 8   LFQISLLPL-----FTNALKIDLDDFSSLQNATSLIAYGMMDYYNGHDYGQVIGMFAKPY 62

Query: 61  YWWEAGEAFGGMLENWYLCQNDTFESLISDALIYQAGSNYDYIPSNQTLVEGNDDQGVWG 120
           YWWEAG A+G +L+ WY  QNDT+  LI++AL+YQ G   DY+P NQ+  EGNDDQ  WG
Sbjct: 63  YWWEAGGAWGCLLDYWYYMQNDTYNDLITEALLYQTGDRNDYVPLNQSTTEGNDDQAFWG 122

Query: 121 LTVLGAVERNL----PDRDGVPGWLAISQAVFNTMYARWDTAYCGGGLRWQIYTWNSGYN 176
           +  + A ERN     PD+   P WL ++QAVFNTM  RWD + C GGLRWQI+ WNSGY+
Sbjct: 123 IAAITAAERNFTNPPPDK---PQWLYLAQAVFNTMALRWDDSTCNGGLRWQIFVWNSGYS 179

Query: 177 YKNTISNACLFQIAARLGRYTGNNTYLEVAEKVFDWM-----VDVEYIVLKDVANVYDGA 231
           YKN++SN  LF IAARL RYTGN +Y+E A+K++DWM     +  EY   K    VYDGA
Sbjct: 180 YKNSVSNGALFHIAARLARYTGNQSYVEWADKIYDWMFGTGIISDEYETYK---FVYDGA 236

Query: 232 TTNYNCSDIVQYEWSYNHGVVLGGLAYMYNATNGTSKWETALTQVLSGATTYFFKNNIMY 291
               NC+DI +Y+W+YN G+VL G AY+YN T    KW     Q L+G+   FF++N++Y
Sbjct: 237 NIETNCTDITRYQWTYNQGLVLAGCAYLYNHTQ-DEKWLIRTEQFLNGSVV-FFRDNVIY 294

Query: 292 ESACQEAKTCNTDQRSFKSIFSRMLGYTRVLAPYTAATLDTLIETSAKAAAGSCDGGTDG 351
           E+ACQ  K CN DQRSFK+ F+R LG T  L P T  T+   I TSA AAA +C GGTDG
Sbjct: 295 EAACQPNKNCNNDQRSFKAYFARFLGVTAQLIPSTRDTIMRWINTSAYAAAQACSGGTDG 354

Query: 352 VTCGLSWFDSTNDGYYGLGEQMSALEII 379
            TCG+ W     DGYYGLGEQM+ALE +
Sbjct: 355 HTCGMDWVWKGWDGYYGLGEQMAALEFM 382

>TBLA0H02580 Chr8 complement(610287..611636) [1350 bp, 449 aa] {ON} 
          Length = 449

 Score =  395 bits (1016), Expect = e-134,   Method: Compositional matrix adjust.
 Identities = 200/386 (51%), Positives = 262/386 (67%), Gaps = 12/386 (3%)

Query: 1   MFYLTLLGLISQIL--YASAITLDVDSKDSVCEATALIQKGMLDYYQGTRYGGTVGMFQP 58
           M +L  L +   IL  +++A+ L+++   S+  A +L+  G++DYY G +YG T+GMF  
Sbjct: 1   MVWLRYLIIQISILASFSTAVHLNLNVTSSLQNAASLVAVGLMDYYNGDQYGQTIGMFSN 60

Query: 59  PYYWWEAGEAFGGMLENWYLCQNDTFESLISDALIYQAGSNYDYIPSNQTLVEGNDDQGV 118
           PYYWWEAG A+G M++ WY  QNDT+  +IS AL+YQ G   DYIP NQ+  EGNDDQ  
Sbjct: 61  PYYWWEAGGAWGCMIDYWYFMQNDTYNDIISQALLYQTGDRNDYIPLNQSTTEGNDDQAF 120

Query: 119 WGLTVLGAVERNL----PDRDGVPGWLAISQAVFNTMYARWDTAYCGGGLRWQIYTWNSG 174
           WG+TV+ A ERN     PD+   P WL ++QAVFNTM  RWD + C GGLRWQI+ WNSG
Sbjct: 121 WGITVMSAAERNFTNPPPDK---PQWLYLAQAVFNTMALRWDDSTCNGGLRWQIFVWNSG 177

Query: 175 YNYKNTISNACLFQIAARLGRYTGNNTYLEVAEKVFDWMVDVEYIVLKDVAN-VYDGATT 233
           Y+YKN++SN  LF +AARL RYTGN +Y++ A KV+DWM     I        VYDGA+ 
Sbjct: 178 YSYKNSVSNGALFHMAARLARYTGNQSYVDWAVKVYDWMEKTGLISNDTYFKFVYDGASI 237

Query: 234 NYNCSDIVQYEWSYNHGVVLGGLAYMYNATNGTSKWETALTQVLSGATTYFFKNNIMYES 293
             NC+DI Q++W+YN G++L G AY+YN T   SKW T   Q ++G+   FF N+I+YE+
Sbjct: 238 ETNCTDITQFQWTYNQGLILSGCAYLYNHTE-DSKWLTRTEQFVNGSAV-FFNNSIVYEA 295

Query: 294 ACQEAKTCNTDQRSFKSIFSRMLGYTRVLAPYTAATLDTLIETSAKAAAGSCDGGTDGVT 353
           ACQ +K C+ DQRSF++ F+R LG T  L P T   +   I TSA AAA +C GGTDG T
Sbjct: 296 ACQGSKRCDNDQRSFRAYFARFLGVTAQLVPTTKDIIMDWINTSAYAAAQACSGGTDGHT 355

Query: 354 CGLSWFDSTNDGYYGLGEQMSALEII 379
           CGL+WF+   DGYYGLGEQM ALE +
Sbjct: 356 CGLNWFNIGWDGYYGLGEQMGALEFL 381

>Kpol_1056.4 s1056 complement(6537..7889) [1353 bp, 450 aa] {ON}
           complement(6537..7889) [1353 nt, 451 aa]
          Length = 450

 Score =  387 bits (995), Expect = e-131,   Method: Compositional matrix adjust.
 Identities = 196/384 (51%), Positives = 254/384 (66%), Gaps = 8/384 (2%)

Query: 1   MFYLTLLGLISQILYAS--AITLDVDSKDSVCEATALIQKGMLDYYQGTRYGGTVGMFQP 58
           +F+  L+ L+  + + +  A+ LD+++ DS+  AT+L+  G++DYY G +YG T+GMF  
Sbjct: 2   LFHKVLISLLCTVWFRAGHAVELDLNNLDSLRNATSLVAYGLMDYYNGLQYGQTIGMFSN 61

Query: 59  PYYWWEAGEAFGGMLENWYLCQNDTFESLISDALIYQAGSNYDYIPSNQTLVEGNDDQGV 118
           PYYWWEAG A+G M++ WY  QNDT+  +I  AL YQ G N DY+P NQ+  EGNDDQ  
Sbjct: 62  PYYWWEAGGAWGTMIDYWYYMQNDTYNDIIMQALQYQTGVNNDYVPLNQSTTEGNDDQAF 121

Query: 119 WGLTVLGAVERNL--PDRDGVPGWLAISQAVFNTMYARWDTAYCGGGLRWQIYTWNSGYN 176
           WG+ V+ A ERN   P  D  P WL ++QAVFNTM  RWD   C GGLRWQI+ WNSGY+
Sbjct: 122 WGIAVMSAAERNFTNPPAD-RPQWLYLAQAVFNTMALRWDDQTCNGGLRWQIFVWNSGYD 180

Query: 177 YKNTISNACLFQIAARLGRYTGNNTYLEVAEKVFDWMVDVEYIVLKDV-ANVYDGATTNY 235
           YKN++SN  LF I ARL R+TGN++Y+E AEKV+DWM  V  I      A VYDG     
Sbjct: 181 YKNSVSNGALFHIGARLARFTGNDSYVEWAEKVYDWMESVNLIEDDGKGAFVYDGVNIGD 240

Query: 236 NCSDIVQYEWSYNHGVVLGGLAYMYNATNGTSKWETALTQVLSGATTYFFKNNIMYESAC 295
           NC+ +   +W+YNHG++L G AY+YN T G +KW     + L  A   FF   +M+E+AC
Sbjct: 241 NCTKVTNLQWTYNHGLILSGCAYLYNYT-GDAKWYNRTERFLEYAYV-FFNRTVMFEAAC 298

Query: 296 QEAKTCNTDQRSFKSIFSRMLGYTRVLAPYTAATLDTLIETSAKAAAGSCDGGTDGVTCG 355
           Q   TC TDQR+FK+ FSR LG T  L P T  T+ T +  SA  AA SC GG DG TCG
Sbjct: 299 QGVHTCTTDQRTFKAYFSRFLGMTAQLVPDTQHTIMTYMNASAYGAAQSCSGGYDGHTCG 358

Query: 356 LSWFDSTNDGYYGLGEQMSALEII 379
           ++WF    DGYYGLGEQM ALE++
Sbjct: 359 INWFYGGWDGYYGLGEQMCALEVM 382

>TDEL0B06580 Chr2 (1164804..1166147) [1344 bp, 447 aa] {ON}
           Anc_2.570 YKL046C
          Length = 447

 Score =  385 bits (989), Expect = e-130,   Method: Compositional matrix adjust.
 Identities = 194/382 (50%), Positives = 254/382 (66%), Gaps = 6/382 (1%)

Query: 1   MFYLTLLG-LISQILYASAITLDVDSKDSVCEATALIQKGMLDYYQGTRYGGTVGMFQPP 59
           MF + LL  L S    A+A+ +D+++ +S+  A++L+  G++DYY G +YG T+GMF  P
Sbjct: 1   MFVMRLLAALASTFACANAVWIDLNNTESIHNASSLVAVGLMDYYTGLQYGETIGMFSDP 60

Query: 60  YYWWEAGEAFGGMLENWYLCQNDTFESLISDALIYQAGSNYDYIPSNQTLVEGNDDQGVW 119
           YYWWEAG A+G ML+ W+  QNDT+  +I  AL+YQ G++ DY+P NQ+  EGNDDQ  W
Sbjct: 61  YYWWEAGGAWGCMLDYWWYMQNDTYNDIIMQALLYQVGTHNDYVPLNQSTTEGNDDQAFW 120

Query: 120 GLTVLGAVERNL--PDRDGVPGWLAISQAVFNTMYARWDTAYCGGGLRWQIYTWNSGYNY 177
           G+  + A ERN   P  D  P WL ++QAVFNTM  RWDT  C GGLRWQI+ WN+GY+Y
Sbjct: 121 GIAAMTAAERNFTNPPSD-QPQWLYLAQAVFNTMALRWDTTSCNGGLRWQIFMWNTGYDY 179

Query: 178 KNTISNACLFQIAARLGRYTGNNTYLEVAEKVFDWMVDVEYIVLKDVANVYDGATTNYNC 237
           KNT+SN  LF +AARL RYTGN +Y++ A+KV+DWM  V  I   +   VYDG    +NC
Sbjct: 180 KNTVSNGALFNLAARLARYTGNQSYVDWADKVYDWMYGVGLISNGNSRFVYDGVNIAHNC 239

Query: 238 SDIVQYEWSYNHGVVLGGLAYMYNATNGTSKWETALTQVLSGATTYFFKNNIMYESACQE 297
           ++I  Y+WSYNHG++L G AY+YN T    KW     + L+ A+  F+ N+++YE ACQ 
Sbjct: 240 ANITGYQWSYNHGLMLSGCAYLYNMTK-DEKWGNRTFEYLNSASI-FYNNSVLYEVACQT 297

Query: 298 AKTCNTDQRSFKSIFSRMLGYTRVLAPYTAATLDTLIETSAKAAAGSCDGGTDGVTCGLS 357
              CNTDQRSFK+ F+R LG T  L P         I  SA  AA SC GG DG TCG++
Sbjct: 298 VNKCNTDQRSFKAYFTRFLGVTAELIPQARDQAMKWINASALGAAQSCSGGYDGHTCGIN 357

Query: 358 WFDSTNDGYYGLGEQMSALEII 379
           WF    DG YGLGEQMSALE +
Sbjct: 358 WFYDGWDGMYGLGEQMSALEAL 379

>TBLA0H02600 Chr8 complement(614887..616236) [1350 bp, 449 aa] {ON}
           Anc_2.570 YKL046C
          Length = 449

 Score =  384 bits (986), Expect = e-129,   Method: Compositional matrix adjust.
 Identities = 195/383 (50%), Positives = 254/383 (66%), Gaps = 10/383 (2%)

Query: 2   FYLTLLGLISQILYASAITLDVDSKDSVCEATALIQKGMLDYYQGTRYGGTVGMFQPPYY 61
           F+  LL +       +A++L+++   S+  A AL+  G++DYY G +YG T+GMF  PYY
Sbjct: 4   FHSLLLKISVITTITNAVSLNLNDSSSLDNAAALVAYGLMDYYNGNQYGQTIGMFSDPYY 63

Query: 62  WWEAGEAFGGMLENWYLCQNDTFESLISDALIYQAGSNYDYIPSNQTLVEGNDDQGVWGL 121
           WWEAG A+G ML+ WY  QNDT+  +I +AL YQ G + DYIP NQ+  EGNDDQ  WG+
Sbjct: 64  WWEAGGAWGCMLDYWYYMQNDTYNDVIYEALQYQTGDDNDYIPLNQSTTEGNDDQAFWGI 123

Query: 122 TVLGAVERNL----PDRDGVPGWLAISQAVFNTMYARWDTAYCGGGLRWQIYTWNSGYNY 177
             + A ERN     PD+   P WL ++QAVFNTM  RWD+  C GGLRWQI+ WNSGY+Y
Sbjct: 124 AAITAAERNFTNPPPDK---PQWLYLAQAVFNTMALRWDSDTCNGGLRWQIFVWNSGYSY 180

Query: 178 KNTISNACLFQIAARLGRYTGNNTYLEVAEKVFDWMVDVEYIVLKDVAN-VYDGATTNYN 236
           KN++SN  LF IAARL RYTGN +Y++ +EKV+DWM+    I        V+DG     N
Sbjct: 181 KNSVSNGALFHIAARLARYTGNQSYVDWSEKVYDWMLGTGLISNGTTYKFVHDGVNIETN 240

Query: 237 CSDIVQYEWSYNHGVVLGGLAYMYNATNGTSKWETALTQVLSGATTYFFKNNIMYESACQ 296
           C+DI  Y+W+YN G++L G AY+YN T    KW     Q L+G+   FF N+++YE+ACQ
Sbjct: 241 CTDITPYQWTYNQGLLLAGCAYLYNFTQ-DEKWLIRTNQFLNGSGV-FFNNSVIYEAACQ 298

Query: 297 EAKTCNTDQRSFKSIFSRMLGYTRVLAPYTAATLDTLIETSAKAAAGSCDGGTDGVTCGL 356
             K CN DQRSFK+ F+R LG T  L P T  T+   I+TSA AAA +C GGTDG TCG+
Sbjct: 299 PNKNCNNDQRSFKAYFARFLGVTAQLLPSTRDTIMQWIDTSAYAAAQACSGGTDGHTCGM 358

Query: 357 SWFDSTNDGYYGLGEQMSALEII 379
            W  +  DGYYGLGEQM+ALE +
Sbjct: 359 DWNWNGWDGYYGLGEQMAALEFM 381

>Ecym_4577 Chr4 complement(1128622..1129974) [1353 bp, 450 aa] {ON}
           similar to Ashbya gossypii ABR060W
          Length = 450

 Score =  379 bits (974), Expect = e-128,   Method: Compositional matrix adjust.
 Identities = 195/382 (51%), Positives = 250/382 (65%), Gaps = 9/382 (2%)

Query: 3   YLTLLGLISQILYASAITLDVDSKDSVCEATALIQKGMLDYYQGTRYGGTVGMFQPPYYW 62
           +L LLG        SA+ LDVD   S+  AT+LI  G+LDYY G   G T+GMF  PYYW
Sbjct: 11  FLNLLGTD-----VSALELDVDDFSSMQSATSLISTGVLDYYTGLDPGNTIGMFSSPYYW 65

Query: 63  WEAGEAFGGMLENWYLCQNDTFESLISDALIYQAGSNYDYIPSNQTLVEGNDDQGVWGLT 122
           WEAG A+G +++ W+  +NDT+  +I  AL+YQ G   DY+P NQ+  EGNDDQ  WG+ 
Sbjct: 66  WEAGAAWGALIDYWFYMENDTYNDIIKQALLYQVGKYEDYVPLNQSTTEGNDDQAFWGIA 125

Query: 123 VLGAVERNLPDRDG-VPGWLAISQAVFNTMYARWDTAYCGGGLRWQIYTWNSGYNYKNTI 181
           V+ A E+  P+ D   P WLA++QAVFNTM  RWD++ C GGLRWQI+TWN+GY+YKN++
Sbjct: 126 VMSAAEKGFPNPDPDQPQWLALAQAVFNTMAYRWDSSSCNGGLRWQIFTWNTGYDYKNSV 185

Query: 182 SNACLFQIAARLGRYTGNNTYLEVAEKVFDWMVDVEYI-VLKDVANVYDGATTNYNCSDI 240
           SN  LF +AARL RYTGN +Y + AEKV+DWM  V+ I    D   VYDGA  + NCS  
Sbjct: 186 SNGALFHLAARLARYTGNQSYADWAEKVYDWMASVQLINQTGDWTFVYDGAFIHDNCSRP 245

Query: 241 VQYEWSYNHGVVLGGLAYMYNATNGTSKWETALTQVLSGATTYFFKNNIMYESACQEAKT 300
              +WSYNHG++LGG AY+ + T G+  W     ++L  A+  FF N ++ E ACQEA T
Sbjct: 246 SVLQWSYNHGLILGGCAYLTDFT-GSDVWHNRTLRLLRSASI-FFPNGVVTEVACQEAGT 303

Query: 301 CNTDQRSFKSIFSRMLGYTRVLAPYTAATLDTLIETSAKAAAGSCDGGTDGVTCGLSWFD 360
           CNTDQRSFK+ F R LG T  L P +       I  SAK AA SC GG DG TCG+++  
Sbjct: 304 CNTDQRSFKAYFMRFLGLTAQLIPESREIAMKWIRDSAKGAALSCSGGRDGHTCGMNYSR 363

Query: 361 STNDGYYGLGEQMSALEIINQL 382
            + D  YGLGEQ++ALE I  L
Sbjct: 364 GSYDESYGLGEQLAALETIQNL 385

>ABR060W Chr2 (504045..505400) [1356 bp, 451 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YKL046C
          Length = 451

 Score =  369 bits (947), Expect = e-124,   Method: Compositional matrix adjust.
 Identities = 185/367 (50%), Positives = 240/367 (65%), Gaps = 5/367 (1%)

Query: 19  ITLDVDSKDSVCEATALIQKGMLDYYQGTRYGGTVGMFQPPYYWWEAGEAFGGMLENWYL 78
           + LDVD   S+ EAT+L+  G++DYY G  YG TVG F  PYYWWEAG A+G +L+ WY 
Sbjct: 22  LNLDVDDLQSIREATSLLATGLMDYYHGHDYGETVGKFSDPYYWWEAGGAWGSILDYWYY 81

Query: 79  CQNDTFESLISDALIYQAGSNYDYIPSNQTLVEGNDDQGVWGLTVLGAVERNLPDRDG-V 137
            +N T+  L++D+L++QAG +  Y P N+T  EGNDDQ  WG+ V+ A ER  P+     
Sbjct: 82  MENSTYNDLLTDSLLHQAGEDLSYTPWNETTTEGNDDQFFWGMAVMDAAERKNPNPPADQ 141

Query: 138 PGWLAISQAVFNTMYARWDTAYCGGGLRWQIYTWNSGYNYKNTISNACLFQIAARLGRYT 197
           P  LA++QAVFNTM  RWD   C GGLRWQI+ WN GY+YKN++SN  LF +AARL RYT
Sbjct: 142 PQRLALAQAVFNTMALRWDMETCNGGLRWQIFRWNDGYHYKNSVSNGALFHMAARLTRYT 201

Query: 198 GNNTYLEVAEKVFDWM--VDVEYIVLKDVANVYDGATTNYNCSDIVQYEWSYNHGVVLGG 255
           GN TYLE AE+V+DWM  V +  IV  +   VYDG   N NC+++ + +W+YNHG+++ G
Sbjct: 202 GNATYLEWAERVYDWMYGVGLISIVQPNWHVVYDGTDINDNCTNLNKLQWTYNHGLIMAG 261

Query: 256 LAYMYNATNGTSKWETALTQVLSGATTYFFKNNIMYESACQEAKTCNTDQRSFKSIFSRM 315
            A++YN T     W     + L  A   F  N+ +YE+ CQ    CN DQRSFK+ FSR 
Sbjct: 262 CAFIYNHTQ-DELWHQRTLRFLDSARI-FLSNDTLYEAGCQGGDNCNIDQRSFKAYFSRF 319

Query: 316 LGYTRVLAPYTAATLDTLIETSAKAAAGSCDGGTDGVTCGLSWFDSTNDGYYGLGEQMSA 375
           LG T  L P +  T+   I  SA+ AA SC GG DG TCGL+W  +  DG +GLGEQM+A
Sbjct: 320 LGLTAQLVPESRETIVRWIRASAQGAAASCSGGRDGHTCGLNWLINGWDGKWGLGEQMAA 379

Query: 376 LEIINQL 382
           LEII  L
Sbjct: 380 LEIIQNL 386

>ZYRO0E06380g Chr5 (484736..486097) [1362 bp, 453 aa] {ON} similar
           to uniprot|P36091 Saccharomyces cerevisiae YKL046C DCW1
           Mannosidase GPI-anchored membrane protein required for
           cell wall biosynthesis homologous to Dfg5p
          Length = 453

 Score =  369 bits (946), Expect = e-123,   Method: Compositional matrix adjust.
 Identities = 187/375 (49%), Positives = 254/375 (67%), Gaps = 5/375 (1%)

Query: 9   LISQILYASAITLDVDSKDSVCEATALIQKGMLDYYQGTRYGGTVGMFQPPYYWWEAGEA 68
           L S    ASA+ +D++   ++  A+AL+ KG++DYY G +YG T+GMF  PYYWWEAG A
Sbjct: 12  LASWFPSASALDIDLNDFKTLQNASALVAKGLMDYYTGDQYGQTIGMFSWPYYWWEAGGA 71

Query: 69  FGGMLENWYLCQNDTFESLISDALIYQAGSNYDYIPSNQTLVEGNDDQGVWGLTVLGAVE 128
           +  +++ W+  +NDT+   +++AL+YQ+G N+DY+P NQ+ VEGNDDQ  WG+ VL A E
Sbjct: 72  WNTLIDYWFYMKNDTYNDKVTEALLYQSGDNHDYVPLNQSTVEGNDDQAFWGIAVLNAAE 131

Query: 129 RNLPD-RDGVPGWLAISQAVFNTMYARWDTAYCGGGLRWQIYTWNSGYNYKNTISNACLF 187
           R  P+  D  P WL + QAVFNTM  RWDTA CGGGLRWQI+TWN+GY+YKNT+SN  LF
Sbjct: 132 RKFPNPPDDQPQWLYLGQAVFNTMALRWDTATCGGGLRWQIFTWNTGYDYKNTVSNGALF 191

Query: 188 QIAARLGRYTGNNTYLEVAEKVFDWMVDVEYIVLKDVAN--VYDGATTNYNCS-DIVQYE 244
            IAARL  +TGN++Y++ AE+V+DWM DV+ I  ++  N  VYDG   + NCS  + +  
Sbjct: 192 HIAARLAYFTGNSSYVDWAERVYDWMHDVKLIEPENDDNKYVYDGVDVSNNCSGPVTRIV 251

Query: 245 WSYNHGVVLGGLAYMYNATNGTSKWETALTQVLSGATTYFFKNNIMYESACQEAKTCNTD 304
           W+YNHG+VL G AY+Y  T G   W       L  A   F+ ++I+YE +CQ++KTCN D
Sbjct: 252 WTYNHGLVLSGCAYLYKET-GDKIWYNRSKAFLETAAKLFYNDSILYEYSCQQSKTCNVD 310

Query: 305 QRSFKSIFSRMLGYTRVLAPYTAATLDTLIETSAKAAAGSCDGGTDGVTCGLSWFDSTND 364
           QRSFKS +S  L  T  L P     +  ++  +A AAA +C GG DG TCG++W     D
Sbjct: 311 QRSFKSYYSTFLAATAQLIPDFREQIMKVVNATAYAAAQACVGGYDGHTCGINWNQKGWD 370

Query: 365 GYYGLGEQMSALEII 379
           G YGLGEQM+ALE +
Sbjct: 371 GQYGLGEQMAALEAL 385

>Smik_12.181 Chr12 (359296..361878) [2583 bp, 860 aa] {ON} YLR115W
           (REAL)
          Length = 860

 Score = 35.4 bits (80), Expect = 0.30,   Method: Compositional matrix adjust.
 Identities = 29/91 (31%), Positives = 39/91 (42%), Gaps = 12/91 (13%)

Query: 165 RWQIYTWNSGYNYKNTISNACLFQIAARLGRYTGNNTYLEVAEKVFDWMVDVEYIVLKDV 224
           R Q+Y      N    +S    +  A  +G Y  N   LE  EK FD +V ++Y  L D+
Sbjct: 84  RIQVYATLPVINL-GRVSTIDAYASAGVIGPYDTNKLDLEDIEKSFDHIVPLKYSQLVDL 142

Query: 225 ANVYDGATTNYNCSDIVQYEWSYNHGVVLGG 255
            + YDG T             +YN GV  GG
Sbjct: 143 RSRYDGLTL-----------LAYNAGVCPGG 162

>Suva_10.206 Chr10 (385842..388430) [2589 bp, 862 aa] {ON} YLR115W
           (REAL)
          Length = 862

 Score = 34.7 bits (78), Expect = 0.65,   Method: Compositional matrix adjust.
 Identities = 23/66 (34%), Positives = 31/66 (46%), Gaps = 11/66 (16%)

Query: 190 AARLGRYTGNNTYLEVAEKVFDWMVDVEYIVLKDVANVYDGATTNYNCSDIVQYEWSYNH 249
           A  +G Y  N   LE  EK FD +V ++Y  L D+ + +DG T             +YN 
Sbjct: 108 AGVIGPYDTNKLDLEDIEKSFDHIVPLKYSQLVDLRSRFDGLTL-----------LAYNA 156

Query: 250 GVVLGG 255
           GV  GG
Sbjct: 157 GVCPGG 162

>Skud_12.187 Chr12 (360900..363485) [2586 bp, 861 aa] {ON} YLR115W
           (REAL)
          Length = 861

 Score = 33.9 bits (76), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 23/66 (34%), Positives = 31/66 (46%), Gaps = 11/66 (16%)

Query: 190 AARLGRYTGNNTYLEVAEKVFDWMVDVEYIVLKDVANVYDGATTNYNCSDIVQYEWSYNH 249
           A  +G Y  N   LE  +K FD +V ++Y  L D+ + YDG T             +YN 
Sbjct: 108 AGVIGPYDTNKLDLEDIDKSFDHIVPLKYSQLVDLRSRYDGLTL-----------LAYNA 156

Query: 250 GVVLGG 255
           GV  GG
Sbjct: 157 GVCPGG 162

>TPHA0C00920 Chr3 complement(192829..195297) [2469 bp, 822 aa] {ON}
           Anc_8.308 YLR115W
          Length = 822

 Score = 33.1 bits (74), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 27/92 (29%), Positives = 40/92 (43%), Gaps = 15/92 (16%)

Query: 194 GRYTGNNTYLEVAEKVFDWMVDVEYIVLKDVANVYDGATTNYNCSDIVQYEWSYNHGVVL 253
           G Y  N   LE  EK FD +  ++Y  L D+ + +DG T             ++N GV +
Sbjct: 112 GPYDSNEIDLEDIEKAFDMIQTIKYSQLVDLKSKFDGLTF-----------VAHNSGVNV 160

Query: 254 GGLAY-MYNATNG---TSKWETALTQVLSGAT 281
           GG  + +   T       KW      +LSGA+
Sbjct: 161 GGSIFCLMTYTEKLIYAPKWNHTRDMILSGAS 192

>YLR115W Chr12 (377985..380564) [2580 bp, 859 aa] {ON}  CFT2Subunit
           of the mRNA cleavage and polyadenlylation factor (CPF);
           required for pre-mRNA cleavage, polyadenylation and
           poly(A) site recognition, 43% similarity with the
           mammalian CPSF-100 protein.
          Length = 859

 Score = 32.3 bits (72), Expect = 3.4,   Method: Compositional matrix adjust.
 Identities = 23/66 (34%), Positives = 30/66 (45%), Gaps = 11/66 (16%)

Query: 190 AARLGRYTGNNTYLEVAEKVFDWMVDVEYIVLKDVANVYDGATTNYNCSDIVQYEWSYNH 249
           A  +G Y  N   LE  E  FD +V ++Y  L D+ + YDG T             +YN 
Sbjct: 108 AGVIGPYDTNKLDLEDIEISFDHIVPLKYSQLVDLRSRYDGLTL-----------LAYNA 156

Query: 250 GVVLGG 255
           GV  GG
Sbjct: 157 GVCPGG 162

>TBLA0G01510 Chr7 (401330..407761) [6432 bp, 2143 aa] {ON} 
          Length = 2143

 Score = 31.6 bits (70), Expect = 5.0,   Method: Compositional matrix adjust.
 Identities = 21/65 (32%), Positives = 34/65 (52%), Gaps = 5/65 (7%)

Query: 139 GWLAISQ-AVFNTMYARWDTAYCGGGLRWQIYTWNSGYNYKNTISNACLFQIAARLGRYT 197
           G+L + Q  +F+T Y  W ++Y        +YT +S YNY N++    L++I A   R  
Sbjct: 102 GFLMVPQVTIFSTYYTYWKSSYTA---TVSVYT-SSRYNYWNSLDTLTLYEILATPQRNA 157

Query: 198 GNNTY 202
            +N Y
Sbjct: 158 QSNYY 162

>Kpol_1036.59 s1036 (166830..169295) [2466 bp, 821 aa] {ON}
           (166830..169295) [2466 nt, 822 aa]
          Length = 821

 Score = 30.8 bits (68), Expect = 8.7,   Method: Compositional matrix adjust.
 Identities = 23/66 (34%), Positives = 30/66 (45%), Gaps = 11/66 (16%)

Query: 190 AARLGRYTGNNTYLEVAEKVFDWMVDVEYIVLKDVANVYDGATTNYNCSDIVQYEWSYNH 249
           A  +G Y  N   LE  EK FD +  V+Y  L D+ + +DG T             +YN 
Sbjct: 108 AGIIGPYETNEMDLEDIEKSFDNIKTVKYSQLVDLRSKFDGLTL-----------VAYNS 156

Query: 250 GVVLGG 255
           GV  GG
Sbjct: 157 GVNAGG 162

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.318    0.134    0.419 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 46,244,699
Number of extensions: 1949155
Number of successful extensions: 3986
Number of sequences better than 10.0: 61
Number of HSP's gapped: 3957
Number of HSP's successfully gapped: 76
Length of query: 461
Length of database: 53,481,399
Length adjustment: 113
Effective length of query: 348
Effective length of database: 40,524,141
Effective search space: 14102401068
Effective search space used: 14102401068
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 67 (30.4 bits)