Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
TPHA0J007908.270ON68568532800.0
Kpol_392.18.270ON4244297081e-85
Smik_4.3628.270ON6484266025e-68
YDR118W (APC4)8.270ON6524205861e-65
Skud_4.3788.270ON6524245782e-64
Suva_2.2778.270ON6495295386e-59
ZYRO0C01474g8.270ON5994645234e-57
TDEL0F039708.270ON6194474991e-53
KAFR0B054608.270ON6103854715e-50
KNAG0H031908.270ON6224454541e-47
CAGL0B01859g8.270ON6224254419e-46
NDAI0J012708.270ON7354094061e-40
TBLA0C045708.270ON6084873791e-37
NCAS0B037908.270ON6124233711e-36
SAKL0H16852g8.270ON6444303561e-34
KLTH0G13508g8.270ON6454252912e-26
Kwal_56.237668.270ON7404272734e-24
KLLA0F19316g8.270ON6713201144e-05
Ecym_43008.270ON71596870.087
KLLA0D16390g8.324ON93675800.53
KAFR0E039005.429ON43986780.82
TPHA0L021305.49ON150840781.0
ACR137W8.672ON425104771.2
TDEL0F044308.316ON367122714.8
NDAI0J010408.316ON39889715.1
AFR631C1.133ON65458716.4
KAFR0E014705.296ON87234716.7
SAKL0H15708g8.316ON36880706.8
Skud_11.1362.490ON110052708.1
NDAI0C025105.272ON84759709.5
NOTE: 1 genes in the same pillar as TPHA0J00790 were not hit in these BLAST results
LIST: AGR078C

BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= TPHA0J00790
         (685 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

TPHA0J00790 Chr10 (182991..185048) [2058 bp, 685 aa] {ON} Anc_8....  1268   0.0  
Kpol_392.1 s392 complement(1..1272) [1272 bp, 424 aa] {ON} compl...   277   1e-85
Smik_4.362 Chr4 (647135..649081) [1947 bp, 648 aa] {ON} YDR118W ...   236   5e-68
YDR118W Chr4 (685882..687840) [1959 bp, 652 aa] {ON}  APC4Subuni...   230   1e-65
Skud_4.378 Chr4 (657502..659460) [1959 bp, 652 aa] {ON} YDR118W ...   227   2e-64
Suva_2.277 Chr2 (480574..481624,481684..482579) [1947 bp, 649 aa...   211   6e-59
ZYRO0C01474g Chr3 complement(106209..108008) [1800 bp, 599 aa] {...   206   4e-57
TDEL0F03970 Chr6 (735393..737252) [1860 bp, 619 aa] {ON} Anc_8.2...   196   1e-53
KAFR0B05460 Chr2 complement(1118755..1120587) [1833 bp, 610 aa] ...   186   5e-50
KNAG0H03190 Chr8 complement(597550..599418) [1869 bp, 622 aa] {O...   179   1e-47
CAGL0B01859g Chr2 (168976..170844) [1869 bp, 622 aa] {ON} weakly...   174   9e-46
NDAI0J01270 Chr10 (297256..299463) [2208 bp, 735 aa] {ON} Anc_8....   160   1e-40
TBLA0C04570 Chr3 (1107010..1108836) [1827 bp, 608 aa] {ON} Anc_8...   150   1e-37
NCAS0B03790 Chr2 complement(676973..678811) [1839 bp, 612 aa] {O...   147   1e-36
SAKL0H16852g Chr8 complement(1482321..1484255) [1935 bp, 644 aa]...   141   1e-34
KLTH0G13508g Chr7 complement(1159671..1161608) [1938 bp, 645 aa]...   116   2e-26
Kwal_56.23766 s56 complement(695943..698165) [2223 bp, 740 aa] {...   109   4e-24
KLLA0F19316g Chr6 (1786659..1788674) [2016 bp, 671 aa] {ON} cons...    49   4e-05
Ecym_4300 Chr4 complement(642023..644170) [2148 bp, 715 aa] {ON}...    38   0.087
KLLA0D16390g Chr4 (1378884..1381694) [2811 bp, 936 aa] {ON} simi...    35   0.53 
KAFR0E03900 Chr5 complement(771649..772968) [1320 bp, 439 aa] {O...    35   0.82 
TPHA0L02130 Chr12 complement(441224..445750) [4527 bp, 1508 aa] ...    35   1.0  
ACR137W Chr3 (590077..591354) [1278 bp, 425 aa] {ON} Syntenic ho...    34   1.2  
TDEL0F04430 Chr6 complement(831678..832781) [1104 bp, 367 aa] {O...    32   4.8  
NDAI0J01040 Chr10 (238940..240136) [1197 bp, 398 aa] {ON} Anc_8....    32   5.1  
AFR631C Chr6 complement(1587894..1589858) [1965 bp, 654 aa] {ON}...    32   6.4  
KAFR0E01470 Chr5 complement(293344..295962) [2619 bp, 872 aa] {O...    32   6.7  
SAKL0H15708g Chr8 (1370148..1371254) [1107 bp, 368 aa] {ON} high...    32   6.8  
Skud_11.136 Chr11 complement(251660..254962) [3303 bp, 1100 aa] ...    32   8.1  
NDAI0C02510 Chr3 complement(573717..576260) [2544 bp, 847 aa] {O...    32   9.5  

>TPHA0J00790 Chr10 (182991..185048) [2058 bp, 685 aa] {ON} Anc_8.270
           YDR118W
          Length = 685

 Score = 1268 bits (3280), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 636/685 (92%), Positives = 636/685 (92%)

Query: 1   MTEHSDSQLYYYKLNPIYQLYTFKSDKGLAICTISDHSILATIFIKDFSLVVDFFWDSIT 60
           MTEHSDSQLYYYKLNPIYQLYTFKSDKGLAICTISDHSILATIFIKDFSLVVDFFWDSIT
Sbjct: 1   MTEHSDSQLYYYKLNPIYQLYTFKSDKGLAICTISDHSILATIFIKDFSLVVDFFWDSIT 60

Query: 61  GKFLLFAFNDGSIRVYDIFKLGRLVSFFRSPLKQIKCVYWDRIIITETLDQQLKIFDYDL 120
           GKFLLFAFNDGSIRVYDIFKLGRLVSFFRSPLKQIKCVYWDRIIITETLDQQLKIFDYDL
Sbjct: 61  GKFLLFAFNDGSIRVYDIFKLGRLVSFFRSPLKQIKCVYWDRIIITETLDQQLKIFDYDL 120

Query: 121 TNSMPTLVKFVKDPQGLQLVPVLKNTQAWRQIDVDLNLKLENSKTEVSTDDVLDIHLLYT 180
           TNSMPTLVKFVKDPQGLQLVPVLKNTQAWRQIDVDLNLKLENSKTEVSTDDVLDIHLLYT
Sbjct: 121 TNSMPTLVKFVKDPQGLQLVPVLKNTQAWRQIDVDLNLKLENSKTEVSTDDVLDIHLLYT 180

Query: 181 ESGMDNFAVLVNGVYDLSDIHVPNRSPNKVIKLVKASQGKYLGFYENASYRLIDVTPFSS 240
           ESGMDNFAVLVNGVYDLSDIHVPNRSPNKVIKLVKASQGKYLGFYENASYRLIDVTPFSS
Sbjct: 181 ESGMDNFAVLVNGVYDLSDIHVPNRSPNKVIKLVKASQGKYLGFYENASYRLIDVTPFSS 240

Query: 241 NDIRVNLLNNSIDLRNSVSXXXXXXXXXXXXXXSPFESFINLVCVDAYEGYDNLYRSMTN 300
           NDIRVNLLNNSIDLRNSVS              SPFESFINLVCVDAYEGYDNLYRSMTN
Sbjct: 241 NDIRVNLLNNSIDLRNSVSLLKEQIEIIKKELISPFESFINLVCVDAYEGYDNLYRSMTN 300

Query: 301 LLLTGEISEEFEDWLINTIGERNLRKWKNLGIELLDKLVQILSLIFIPITEKFIITAERI 360
           LLLTGEISEEFEDWLINTIGERNLRKWKNLGIELLDKLVQILSLIFIPITEKFIITAERI
Sbjct: 301 LLLTGEISEEFEDWLINTIGERNLRKWKNLGIELLDKLVQILSLIFIPITEKFIITAERI 360

Query: 361 QNYITAMRLSDNSKILENDSEXXXXXXXXXXXXKTSIKQIPILNNDKMAFEIFIDWIRNT 420
           QNYITAMRLSDNSKILENDSE            KTSIKQIPILNNDKMAFEIFIDWIRNT
Sbjct: 361 QNYITAMRLSDNSKILENDSEINDLILNLSNILKTSIKQIPILNNDKMAFEIFIDWIRNT 420

Query: 421 IYLIIDEXXXXXXXXXXXXXXPFDIQKYINLQFKDHNKAILTVVDEFETYANKILIDLDM 480
           IYLIIDE              PFDIQKYINLQFKDHNKAILTVVDEFETYANKILIDLDM
Sbjct: 421 IYLIIDENYKSKLSLSSSNSYPFDIQKYINLQFKDHNKAILTVVDEFETYANKILIDLDM 480

Query: 481 IDEKLIKPHLKTXXXXXXXXXNTLQNSNKIFESSNLKVLDVLRIEEKSCFLFVVKELPLN 540
           IDEKLIKPHLKT         NTLQNSNKIFESSNLKVLDVLRIEEKSCFLFVVKELPLN
Sbjct: 481 IDEKLIKPHLKTSIIISDIIDNTLQNSNKIFESSNLKVLDVLRIEEKSCFLFVVKELPLN 540

Query: 541 HNSEIATHNYKIILSSEPRIGNNHSGKPLMIPEKYQNLLFKEMIIIEHLFQRNGNTTYLD 600
           HNSEIATHNYKIILSSEPRIGNNHSGKPLMIPEKYQNLLFKEMIIIEHLFQRNGNTTYLD
Sbjct: 541 HNSEIATHNYKIILSSEPRIGNNHSGKPLMIPEKYQNLLFKEMIIIEHLFQRNGNTTYLD 600

Query: 601 SSTMLRSQLALNKFNDDEFNQNRNNTTKICLLLKFQKNDLSKEFDYVYGKVCIEVDQHFN 660
           SSTMLRSQLALNKFNDDEFNQNRNNTTKICLLLKFQKNDLSKEFDYVYGKVCIEVDQHFN
Sbjct: 601 SSTMLRSQLALNKFNDDEFNQNRNNTTKICLLLKFQKNDLSKEFDYVYGKVCIEVDQHFN 660

Query: 661 IIQSPAPFQNQDVLMSLEVQFETTN 685
           IIQSPAPFQNQDVLMSLEVQFETTN
Sbjct: 661 IIQSPAPFQNQDVLMSLEVQFETTN 685

>Kpol_392.1 s392 complement(1..1272) [1272 bp, 424 aa] {ON}
           complement(1..1272) [1272 nt, 424 aa]
          Length = 424

 Score =  277 bits (708), Expect = 1e-85,   Method: Compositional matrix adjust.
 Identities = 156/429 (36%), Positives = 245/429 (57%), Gaps = 14/429 (3%)

Query: 1   MTEHSDSQLYYYKLNPIYQLYTFKSDKGLAICTISDHSILATIFIKDFSLVVDFFWDSIT 60
           M   S  +LYY K NP +QLY  +SD+GLA+  I D S LA IFIKDF  V  + WD+ +
Sbjct: 1   MVIDSGIRLYYSKYNPCFQLYVTRSDQGLAVYRIKDSSQLAHIFIKDFDTVAGYEWDNYS 60

Query: 61  GKFLLFAFNDGSIRVYDIFKLGRLVSFFR-SPLKQIKCVYWDRIIITETLDQQLKIFDYD 119
           G+F+     DG+IR+YDIFK GRLVS+ R S  K +    WDR     ++  +L++FD +
Sbjct: 61  GRFISVFLTDGTIRIYDIFKNGRLVSYIRSSSQKNVDSCLWDRAEF--SIPSKLQLFDSN 118

Query: 120 LTNSMPTLVKFVKDPQGLQLVPVLKNTQAWRQIDVDLNLKLENSKTEVSTDDVLDIHLLY 179
           +   +PTL+KFVKD + + ++       +WR +D +     +++  E+   ++LD+H+ +
Sbjct: 119 IIECLPTLIKFVKDSRNINIIDYYPPNHSWRHVDKE----SQDTDKEIDFRNLLDVHIQH 174

Query: 180 TESGMDNFAVLVNGVYDLSDIHVPNRSPNKVIKLVKASQGKYLGFYENASYRLIDVTPFS 239
             +  DNF +++NGVY+++ I +P+ S ++V +L+K   G+Y+ FY+N  YR I+     
Sbjct: 175 NPN-EDNFTIILNGVYEINGIVMPDISKSEVYQLLKLHNGEYMSFYKNGHYRKINFNNLL 233

Query: 240 SNDIRVNLLNNSIDLRNSVSXXXXXXXXXXXXXXSPFESFINLVCVDAYE-GYDNLYRSM 298
           S ++   LL+N +++RN                  P+  F+  +C+DAY  G   L   +
Sbjct: 234 SCNVSNGLLSNILEIRNLNRYVNDHLDLIKRELIIPYSDFVKKICIDAYAGGMTKLNDEL 293

Query: 299 TNLLLTGEISEEFEDWLINTIGERNLRKWKNLGIELLDKLVQILSLIFIPITEKFIITAE 358
            +LLLTGEI+ EF+DWL+N IG+RN +KW+ LG+++ +K+V+IL+L  IP  E+F+I  E
Sbjct: 294 ESLLLTGEINNEFKDWLVNIIGDRNGKKWRKLGMDMFEKIVKILTLAIIPSCERFMIYLE 353

Query: 359 RIQNYITAMRLSDNSKILENDSEXXXXXXXXXXXXKTSIKQIPILNNDKMAFEIFIDWIR 418
           R   Y+     +D         +            + SI  I  LNN    FEIF +WI 
Sbjct: 354 RTDGYLNGYMKTDTDFY-----DIISLREYFSKLIRNSITIINSLNNQLKYFEIFSEWIN 408

Query: 419 NTIYLIIDE 427
           + I  I DE
Sbjct: 409 DKINEITDE 417

>Smik_4.362 Chr4 (647135..649081) [1947 bp, 648 aa] {ON} YDR118W
           (REAL)
          Length = 648

 Score =  236 bits (602), Expect = 5e-68,   Method: Compositional matrix adjust.
 Identities = 141/426 (33%), Positives = 229/426 (53%), Gaps = 30/426 (7%)

Query: 10  YYYKLNPIYQLYTFKSDKGLAICTISDHSILATIFIKDFSLVVDFFWDSITGKFLLFAFN 69
           Y+   NP + ++  ++ KGLAI  +SDH+ LA I I++ +LV ++ WD++TGKFL   F 
Sbjct: 8   YFIDYNPRFPIFATRTAKGLAINRVSDHARLAAIPIRNINLVANYNWDTVTGKFLSIFFK 67

Query: 70  DGSIRVYDIFKLGRLVSFFRSPLKQIKCVYWDRIII-TETLDQQLKIFDYDLTNSMPTLV 128
           DG+IR++DIFK GRLVSF R P  +I    WDRI + +E+ +  L    Y++ + +P L+
Sbjct: 68  DGTIRIHDIFKDGRLVSFLRIPSTKISKGTWDRIPLESESGNGNLA---YNIIDYLPKLI 124

Query: 129 KFVKDPQGLQLVPVLKNTQAWRQIDVDLNLKLENSKTEVSTDDVLDIHLLYTESGMDNFA 188
           ++VKD + + +VP       WR  D D          E   ++ LDIH+++ E G D   
Sbjct: 125 RYVKDSKRINIVPYTPPNSLWRGPDED----------EPENNEKLDIHIIFNE-GHDKIT 173

Query: 189 VLVNGVYDLSDIHVP---NRSPNKVIKLVKASQGKYLGFYENASYRLIDVTPFSSNDIRV 245
           V  NG Y    I VP   + +   V  +VK   G Y  FY++ + R +++ P   ++  +
Sbjct: 174 VFFNGDY---AIFVPVGADENERFVKSIVKIQDGFYHCFYDDGTVRTLNLGPLLRSEPSM 230

Query: 246 NLLNNSIDLRNSVSXXXXXXXXXXXXXXSPFESFINLVCVDAYEGYDNLYRSMTNLLLTG 305
           N+L   + ++  +               +P+  F+N +C +AY GYD L   +  L L G
Sbjct: 231 NILKYIMAIKELIGYLLNHIEFINRELVTPYLEFVNRLCDEAY-GYDKLISELECLFLLG 289

Query: 306 EISEEFEDWLINTIGERNLRKWKNLGIELLDKLVQILSLIFIPITEKFIITAERIQNYIT 365
           E+S + EDWL N++GE+N ++WK LG E   K  QIL+LIF+P  E+ II  E+++  + 
Sbjct: 290 EVSCDLEDWLCNSVGEKNFKRWKCLGCEAYQKTTQILTLIFVPACERIIIFVEKLRGILE 349

Query: 366 AM----RLSDNSKILENDSEXXXXXXXXXXXXKTSIKQIPILNNDKMAFEIFIDWIRNTI 421
           A     + +D+S +   D+               ++K I  L  D+  FE F  W+ + I
Sbjct: 350 AFSIQNKFNDSSDLTAVDT----LLKNSQELLTITLKSIVDLGKDETLFETFFIWLNDRI 405

Query: 422 YLIIDE 427
           + ++DE
Sbjct: 406 HEVLDE 411

>YDR118W Chr4 (685882..687840) [1959 bp, 652 aa] {ON}  APC4Subunit
           of the Anaphase-Promoting Complex/Cyclosome (APC/C),
           which is a ubiquitin-protein ligase required for
           degradation of anaphase inhibitors, including mitotic
           cyclins, during the metaphase/anaphase transition;
           component of the platform domain of the APC/C, based on
           structural analysis
          Length = 652

 Score =  230 bits (586), Expect = 1e-65,   Method: Compositional matrix adjust.
 Identities = 135/420 (32%), Positives = 221/420 (52%), Gaps = 18/420 (4%)

Query: 10  YYYKLNPIYQLYTFKSDKGLAICTISDHSILATIFIKDFSLVVDFFWDSITGKFLLFAFN 69
           Y+   NP++ ++  +  KGLAI  +SDH+ LA I I++ +LV ++ WD+ TGKFL   F 
Sbjct: 8   YFIDYNPLFPIFATRIAKGLAIYRVSDHARLAVIPIRNINLVANYDWDTTTGKFLSIFFK 67

Query: 70  DGSIRVYDIFKLGRLVSFFRSPLKQIKCVYWDRIIITETLDQQLKIFDYDLTNSMPTLVK 129
           DG+IR++DIFK GRLVSF R P  +I    WDRI +    +   + F  ++ + +P L++
Sbjct: 68  DGTIRIHDIFKDGRLVSFLRIPSTKISKGIWDRIPL--RYEPNNRDFACNIIDDLPKLIR 125

Query: 130 FVKDPQGLQLVPVLKNTQAWRQIDVDLNLKLENSKTEVSTDDVLDIHLLYTESGMDNFAV 189
           FVKD + + +VP  +    WR  D D          ++ +++ LD+H+++ E G D   V
Sbjct: 126 FVKDSKRINIVPYTQPNSLWRGPDED----------DLDSNEKLDVHVVFNE-GNDKITV 174

Query: 190 LVNGVYD--LSDIHVPNRSPNKVIKLVKASQGKYLGFYENASYRLIDVTPFSSNDIRVNL 247
             NG Y   LS  ++ N   N +  ++K   G Y  FYE+ + + +++ P   +   VNL
Sbjct: 175 FFNGDYAVFLSVDNIENE--NSLKSIIKVQDGFYQCFYEDGTVQTLNLGPLLQSKSSVNL 232

Query: 248 LNNSIDLRNSVSXXXXXXXXXXXXXXSPFESFINLVCVDAYEGYDNLYRSMTNLLLTGEI 307
           LN  + ++  +               +P+  F+  +C +AY GY  L   +  L L GEI
Sbjct: 233 LNYIMVIKELIGYMLTHLEFINRELATPYLDFVKRLCDEAY-GYGKLKSELEALFLLGEI 291

Query: 308 SEEFEDWLINTIGERNLRKWKNLGIELLDKLVQILSLIFIPITEKFIITAERIQNYITAM 367
           S + EDWL N++GE+N ++WK LG E   K VQIL+LIF+P  E+ II  E+++  + A 
Sbjct: 292 SCDLEDWLCNSVGEKNFKRWKYLGCEAYQKTVQILTLIFVPACERIIIYVEKLRAILQAF 351

Query: 368 RLSDNSKILENDSEXXXXXXXXXXXXKTSIKQIPILNNDKMAFEIFIDWIRNTIYLIIDE 427
            + +      + +               ++  I  L  D+  FE F  W  + ++  +DE
Sbjct: 352 SIQNKLSYTSDLTAVEVLLKSSQKLLTMTLNSIIGLGRDETLFEKFFIWFNDRLHEALDE 411

>Skud_4.378 Chr4 (657502..659460) [1959 bp, 652 aa] {ON} YDR118W
           (REAL)
          Length = 652

 Score =  227 bits (578), Expect = 2e-64,   Method: Compositional matrix adjust.
 Identities = 133/424 (31%), Positives = 219/424 (51%), Gaps = 26/424 (6%)

Query: 10  YYYKLNPIYQLYTFKSDKGLAICTISDHSILATIFIKDFSLVVDFFWDSITGKFLLFAFN 69
           Y+   NP + ++  +  KGLAI  +SDH+ +A I +++ +LV ++ WD  +GKFL   F 
Sbjct: 8   YFIDYNPRFPIFATRITKGLAIHRVSDHARIAIIPVRNIALVANYSWDRTSGKFLSIFFK 67

Query: 70  DGSIRVYDIFKLGRLVSFFRSPLKQIKCVYWDRIIITETLDQQLKIFDYDLTNSMPTLVK 129
           DG++R++DIFK GRLVSF R P  +I    WDRI +    D +   F Y++ + +P L++
Sbjct: 68  DGTVRIHDIFKDGRLVSFLRVPSTKISRGIWDRIPLKREYDSE--TFAYNVIDILPKLIR 125

Query: 130 FVKDPQGLQLVPVLKNTQAWRQIDVDLNLKLENSKTEVSTDDVLDIHLLYTESGMDNFAV 189
           FVKD + + +VP       WR  D D          +  + ++LD+H+++ E G D   +
Sbjct: 126 FVKDSKRVSIVPYTPPNGLWRGPDED----------DPESGEILDVHVIFNE-GNDKITI 174

Query: 190 LVNGVY----DLSDIHVPNRSPNKVI--KLVKASQGKYLGFYENASYRLIDVTPFSSNDI 243
             NG Y     + DI       N+ I   +VK   G Y  FY + S R +++ P   +  
Sbjct: 175 FFNGDYTILLPMDDIE------NERILESVVKVQDGFYHCFYNDGSVRTLNLQPLLRSKP 228

Query: 244 RVNLLNNSIDLRNSVSXXXXXXXXXXXXXXSPFESFINLVCVDAYEGYDNLYRSMTNLLL 303
            V+LL+  + ++  +               +P+  F+  +C +AY GY+ L   +  L L
Sbjct: 229 SVDLLHYIMVIKELIGYLLAHVELINRELITPYLDFVKRICDEAY-GYNKLKSELECLFL 287

Query: 304 TGEISEEFEDWLINTIGERNLRKWKNLGIELLDKLVQILSLIFIPITEKFIITAERIQNY 363
            GE+S + EDWL N++GE+NL+KWK LG E   K  QIL+L+F+P  E+ II  E+++  
Sbjct: 288 LGEVSCDLEDWLCNSVGEKNLKKWKFLGCEAYQKTTQILTLVFVPTCERIIIFVEKLRGT 347

Query: 364 ITAMRLSDNSKILENDSEXXXXXXXXXXXXKTSIKQIPILNNDKMAFEIFIDWIRNTIYL 423
           + A  + + S    + +               ++K I  L  ++  FE F  W  + I+ 
Sbjct: 348 LEAFSVQNKSNNTSDLTAVELLLKNSQELLNNTLKSIIALGRNETLFEKFFIWFNDRIHE 407

Query: 424 IIDE 427
            +DE
Sbjct: 408 GLDE 411

>Suva_2.277 Chr2 (480574..481624,481684..482579) [1947 bp, 649 aa]
           {ON} YDR118W (REAL)
          Length = 649

 Score =  211 bits (538), Expect = 6e-59,   Method: Compositional matrix adjust.
 Identities = 141/529 (26%), Positives = 248/529 (46%), Gaps = 22/529 (4%)

Query: 10  YYYKLNPIYQLYTFKSDKGLAICTISDHSILATIFIKDFSLVVDFFWDSITGKFLLFAFN 69
           Y+   NP + ++  +  KGLAI  +SDH+ LA I +++ +LV ++ WD  TGKFL   F 
Sbjct: 4   YFIDYNPRFPIFAIRVVKGLAIHRVSDHARLAVIPVRNIALVANYNWDVSTGKFLSIFFK 63

Query: 70  DGSIRVYDIFKLGRLVSFFRSPLKQIKCVYWDRIIITETLDQQLKIFDYDLTNSMPTLVK 129
           DG+IR++DIFK GRLVSF R P  +I    WDRI +    +   + F  ++ + +P L++
Sbjct: 64  DGTIRIHDIFKDGRLVSFLRIPRTKISRGIWDRIPL--KYESSNRNFANNVIDVLPKLIR 121

Query: 130 FVKDPQGLQLVPVLKNTQAWRQIDVDLNLKLENSKTEVSTDDVLDIHLLYTESGMDNFAV 189
           FVKD + + + P       WR  D D     EN          LDIH+++ E G D   V
Sbjct: 122 FVKDSKRVTIAPYTPPNSLWRGPDEDDPENCEN----------LDIHVIFNE-GNDKITV 170

Query: 190 LVNGVYDLSDIHVPNRSPNKVIK-LVKASQGKYLGFYENASYRLIDVTPFSSNDIRVNLL 248
             NG Y +  + V +    K++K +VK   G Y  FY + +    ++     ++  V+LL
Sbjct: 171 FFNGDYAIL-LPVSDIENEKILKSVVKVQNGFYHCFYNDGTVSTFNLERLLQSEPSVDLL 229

Query: 249 NNSIDLRNSVSXXXXXXXXXXXXXXSPFESFINLVCVDAYEGYDNLYRSMTNLLLTGEIS 308
              + ++  +               +P+  F+  +C +AY GY  L   +  L L GE+ 
Sbjct: 230 RYMMVIKELIGYLLAHIEFINRELTTPYMDFVKRICDEAY-GYSKLKSELKCLFLLGEVP 288

Query: 309 EEFEDWLINTIGERNLRKWKNLGIELLDKLVQILSLIFIPITEKFIITAERIQNYITAMR 368
            + +DWL N +GE+N ++WK LG E   K VQ+ +L F+P  E+ II  ++++  + A  
Sbjct: 289 SDLDDWLCNAVGEKNFKRWKVLGCEAYQKTVQVFTLAFVPTCERIIIFVQKLKGILEAFS 348

Query: 369 LSDNSKILENDSEXXXXXXXXXXXXKTSIKQIPILNNDKMAFEIFIDWIRNTIYLIIDEX 428
           +        + +               ++K I  L  D+  FE F+ W  + I+ ++DE 
Sbjct: 349 IQXXXXXXXDLTAVELLLKQSQELLNITLKSIIDLGKDETLFEKFLMWFNDRIHEVLDED 408

Query: 429 XXXXXXXXXXXXXPFDIQKYINLQFKDHNKAILTVVDE--FETYANKILIDLDMIDEKLI 486
                         +D+  +      D N    +V+D   +    N +      I +  +
Sbjct: 409 YKPKFEFEDDPYFGYDLLNFFEKFLSDRNTESSSVIDMKLYRDLINSMTAMEKDIAKNNV 468

Query: 487 KPHLKTXXXXXXXXXNTLQNSNKIFESSNLKVLDVLRIEEKSCFLFVVK 535
            PH++             Q     + SS + +LD +++ +++  +++++
Sbjct: 469 NPHIQRQVLVQSRADVFSQR----YPSSKINLLDAIKLSKQNYIVYLIQ 513

>ZYRO0C01474g Chr3 complement(106209..108008) [1800 bp, 599 aa] {ON}
           weakly similar to uniprot|Q04601 Saccharomyces
           cerevisiae YDR118W APC4 Subunit of the
           Anaphase-Promoting Complex/Cyclosome (APC/C) which is a
           ubiquitin-protein ligase required for degradation of
           anaphase inhibitors including mitotic cyclins during the
           metaphase/anaphase transition
          Length = 599

 Score =  206 bits (523), Expect = 4e-57,   Method: Compositional matrix adjust.
 Identities = 128/464 (27%), Positives = 222/464 (47%), Gaps = 28/464 (6%)

Query: 11  YYKLNPIYQLYTFKSDKGLAICTISDHSILATIFIKDFSLVVDFFWDSITGKFLLFAFND 70
           Y   NP+Y LY  +  +G ++  ++D + +ATI ++D S V  + WD ITGKFL   + D
Sbjct: 5   YVDYNPVYPLYVKQFTRGFSVHRMADDARIATIIVRDMSQVAGYQWDPITGKFLSIFYKD 64

Query: 71  GSIRVYDIFKLGRLVSFFRSPLKQIKCVYWDRIIITETLDQQLKIF--DYDLTNSMPTLV 128
           G++R+YD F+ GRLVS  R+         WDRI +  + ++ +K +  D+D+T  MP +V
Sbjct: 65  GTVRIYDGFRSGRLVSLLRASSNGAVSGIWDRIELLHS-EENIKDWSIDHDVTEMMPKMV 123

Query: 129 KFVKDPQGLQLVPVLKNTQAWRQIDVDLNLKLENSKTEVSTDDVLDIHLLYTESGMDNFA 188
           KF +D + L +VP    +  WR    D             T+ +LD H++      D+ +
Sbjct: 124 KFARDSRQLCVVPYTLPSDVWRPQAAD------------DTNALLDAHVIRCH---DSLS 168

Query: 189 VLVNGVYDLSDIHVPNRSPNKVIKLVKASQGKYLGFYENASYRLIDVTPFSSNDIRVNLL 248
           V+ +G + +S I +    P+ ++K V A Q +YL FY++ S    D+     +   + LL
Sbjct: 169 VMFDGEFTIS-IQLAA-IPSPLVKFVSA-QHQYLAFYQDGSVERFDLANLVKDPFSLRLL 225

Query: 249 NNSIDLRNSVSXXXXXXXXXXXXXXSPFESFINLVCVDAYEGYDNLYRSMTNLLLTGEIS 308
            N I +R                   P++ F+   C  A+ GYD L   + +L+L G+++
Sbjct: 226 KNVITMRQLHRYLQDHIELIQRDLLQPYDEFLERCCQGAFGGYDLLREQLIDLMLVGDVT 285

Query: 309 EEFEDWLINTIGERNLRKWKNLGIELLDKLVQILSLIFIPITEKFIITAERIQNYITAMR 368
            E EDWL+N++GE+NL++W+ LG +   K +Q+L+L  +P  E+ I   +R    +    
Sbjct: 286 PELEDWLVNSMGEKNLKRWRKLGTDAYHKTLQVLTLACLPACERLISLGQRCTGNLL--- 342

Query: 369 LSDNSKILENDSEXXXXXXXXXXXXKTSIKQIPILNNDKMAFEIFIDWIRNTIYLIIDEX 428
               S+ L                 K  ++ I  L++ +     F+DW  + +   IDE 
Sbjct: 343 ----SRQLTLQLPLLPPIDCLQFFLKNVLEAIASLSSQQRLLGSFLDWFDDRVRESIDED 398

Query: 429 XXXXXXXXXXXXXPFDIQKYINLQFKDHNKAILTVVDEFETYAN 472
                          D   Y+ L+ ++ +    +V D   + A+
Sbjct: 399 YKLRFNLHDNSSLGPDTASYLQLRLRNSSPEFSSVSDLTHSLAS 442

>TDEL0F03970 Chr6 (735393..737252) [1860 bp, 619 aa] {ON} Anc_8.270
           YDR118W
          Length = 619

 Score =  196 bits (499), Expect = 1e-53,   Method: Compositional matrix adjust.
 Identities = 123/447 (27%), Positives = 234/447 (52%), Gaps = 17/447 (3%)

Query: 7   SQLYYYKLNPIYQLYTFKSDKGLAICTISDHSILATIFIKDFSLVVDFFWDSITGKFLLF 66
           ++L Y   NP+Y LY  K +KGL+IC ++D++ +AT+ ++D +++  F WD ITGK +  
Sbjct: 4   TELDYRCYNPLYSLYAKKFNKGLSICRVADNAKIATVAVRDLNVLAQFQWDPITGKRMTV 63

Query: 67  AFNDGSIRVYDIFKLGRLVSFFRSPLKQIKCVYWDRIIITETLDQQLKI-FDYDLTNSMP 125
            + DG+ R+YD F+ G+L++  R    ++    WDRI ++    Q++   FD+ + NSMP
Sbjct: 64  FYKDGNARIYDAFQAGKLLALLRISKTRVDGAIWDRIELSR---QEVTFKFDHFVLNSMP 120

Query: 126 TLVKFVKDPQGLQLVPVLKNTQAWRQIDVDLNLKLENSKTEVSTDDVLDIHLLYTESGMD 185
            +++F +D + + ++P     + WR       L  E         ++LD+HL++ E   +
Sbjct: 121 KMIRFARDTRQIFILPYEPPNKTWR-------LATEEEDGVKREKEILDVHLVHQED--N 171

Query: 186 NFAVLVNGVYDLSDIHVPNRSPNKVIKLVKASQGKYLGFYENASYRLIDVTPFSSNDIRV 245
              ++++G + L     P+    K I  V A +G Y  FYE+A+   + +      D  +
Sbjct: 172 GLVLMLDGDFILRLAAGPSGPALKDI--VVADRGLYHCFYEDATVESLSLDQLIQCDATI 229

Query: 246 NLLNNSIDLRNSVSXXXXXXXXXXXXXXSPFESFINLVCVDAYEGYDNLYRSMTNLLLTG 305
            L+ + I ++                  +P+  F+  +C DA  GY+ L+  + +LLL G
Sbjct: 230 QLIQHFIAIKQLNHYLQDHLDLIKRDLVAPYTEFLTKIC-DAAFGYEILHEELESLLLGG 288

Query: 306 EISEEFEDWLINTIGERNLRKWKNLGIELLDKLVQILSLIFIPITEKFIITAERIQNYIT 365
            +S E E+W   T+GE+N +KWK +G+E+  K +QIL+L FIP  E+ I+ +ER +  + 
Sbjct: 289 GLSVELENWFCYTVGEKNFKKWKKMGLEMYQKTIQILTLSFIPACERVILLSERCRACLK 348

Query: 366 AMRLSDNSKILENDSEXXXXXXXXXXXXKTSIKQIPILNNDKMAFEIFIDWIRNTIYLII 425
           A++L ++S   ++ SE            +++++ I  ++  ++ F+ F+ W  + ++  +
Sbjct: 349 ALQLIESSTTTDS-SEFANLTSLSQTYLRSTVETIQGVSAQEVLFQTFLQWFDDRLHEAL 407

Query: 426 DEXXXXXXXXXXXXXXPFDIQKYINLQ 452
           DE               + I  Y++L+
Sbjct: 408 DEDYKQKLSIDSNCKIGYQIATYLDLR 434

>KAFR0B05460 Chr2 complement(1118755..1120587) [1833 bp, 610 aa]
           {ON} Anc_8.270 YDR118W
          Length = 610

 Score =  186 bits (471), Expect = 5e-50,   Method: Compositional matrix adjust.
 Identities = 112/385 (29%), Positives = 195/385 (50%), Gaps = 25/385 (6%)

Query: 1   MTEHSDSQLYYYKLNPIYQLYTFKSDKGLAICTISDHSILATIFIKDFSLVVDFFWDSIT 60
           M E +  +  Y   N    LYT K  KGL +   SD++ +A   IK + LV   +WD I+
Sbjct: 1   MNELNPKERSYCVYNKKLPLYTEKGPKGLMVYRRSDNTAIAHTIIKKWELVAGIYWDKIS 60

Query: 61  GKFLLFAFNDGSIRVYDIFKLGRLVSFFRSPLKQIKCVYWDRIIITETLDQQLKIFDYDL 120
           GK+L   F DGSIR+ D+FK G+LV+F R+  K + C YWDR  I E    ++K F+ ++
Sbjct: 61  GKYLSIFFRDGSIRIIDVFKDGKLVAFLRTQFKNVDCTYWDR--IEEQTTNEMKQFNKNI 118

Query: 121 TNSMPTLVKFVKDPQGLQLVPVLKNTQAWRQIDVDLNLKLENSKTEVSTDDVLDIHLLYT 180
            + MP+L++FV     L L+P   +   WR++D            +   + V+D+H L+ 
Sbjct: 119 VDLMPSLIQFVSSANKLSLIPYTPSNANWRELDA-----------KWKKNRVIDMHCLH- 166

Query: 181 ESGMDNFAVLVNGVYDLS----DIHVPNRSPNKVIKLVKASQGKYLGFYENASYRLIDVT 236
           +S  D+F +++NG Y L+    +  +  + P     L+K++   Y   Y++ S R ID +
Sbjct: 167 QSETDSFLMVLNGDYYLTLKTPETDLSEKVP--ACSLIKSANSLYQCIYKDGSARKIDTS 224

Query: 237 PFSSNDIRVNLLNNSIDLRNSVSXXXXXXXXXXXXXXSPFESFINLVCVDAYEGYDNLYR 296
            F S+   ++LL   + L++                  P+  F+  +C  A+ G + L  
Sbjct: 225 SFLSSKSCIDLLECILSLKDMSKYTRNHLDLLERVIIKPYLDFLEKICDGAF-GREKLIN 283

Query: 297 SMTNLLLTGEISEEFEDWLINTIGERNLRKWKNLGIELLDKLVQILSLIFIPITEKFIIT 356
            +    L G IS+E +DWL  ++G++N+ +W+ L  +   +  ++ ++  +   E+ I+ 
Sbjct: 284 ELKITFLLGTISDELQDWLHYSVGDKNVTQWRTLCHDAYQQTTELFTIALMCACERMILL 343

Query: 357 AERIQNYITAMRLS----DNSKILE 377
           +ER    I A +      DNS++ E
Sbjct: 344 SERCFGLIMAFQFESGADDNSRLHE 368

>KNAG0H03190 Chr8 complement(597550..599418) [1869 bp, 622 aa] {ON}
           Anc_8.270 YDR118W
          Length = 622

 Score =  179 bits (454), Expect = 1e-47,   Method: Compositional matrix adjust.
 Identities = 121/445 (27%), Positives = 210/445 (47%), Gaps = 46/445 (10%)

Query: 1   MTEHS-DSQLYYYKLNPIYQLYTFKSDKGLAICTISDHSILATIFIKDFSLVVDFFWDSI 59
           MTE +  ++ +Y ++N +  LY  +  K L +   +D S +A+ FI+D S VV + WD+I
Sbjct: 1   MTEDALYARQFYTEVNNVLPLYVTRGTKQLVVNRDTDDSTIASTFIRDPSQVVSYQWDTI 60

Query: 60  TGKFLLFAFNDGSIRVYDIFKLGRLVSFFRSPLKQIKCVYWDRIIITETLDQQLKIFDYD 119
            G+ +   F DGSIR+ D+    +LV+  R+    + CV WDRI     L  + +  ++D
Sbjct: 61  GGEIISVMFQDGSIRINDVMYDAKLVALLRTQRTGLDCVLWDRI----RLPSRAQSMEWD 116

Query: 120 ---LTNSMPTLVKFVKDPQGLQLVPVLKNTQAWRQIDVDLNLKLENSKTEVSTDDVLDIH 176
              +T S+P LVKF+       + P L    +WR           NS    +   +LD+H
Sbjct: 117 PDIITQSLPRLVKFMGSDASPSMSPYLPTNHSWR---------FPNSG---AAGGILDVH 164

Query: 177 LLYTESGMDNFAVLVNGVY--DLSDIHVPNRSP-NKVIKLVKASQGKYLGFYENASYRLI 233
            L+ + G D    L+NG Y   L+  H  ++S   K+I    + +  Y  +Y+    R +
Sbjct: 165 FLHQKLG-DTLVALLNGEYQLQLTGPHQEDQSELRKIIARTDSKRHVYNCYYKTGPVRQV 223

Query: 234 DVTPFSSNDIRVNLLNNSIDLRNSVSXXXXXXXXXXXXXXSPFESFINLVCVDAYEGYDN 293
           D+T F  +   + LL   +  ++ +                P++ FI  +C DA+ G + 
Sbjct: 224 DLTGFVEDKDTIKLLERFLLFQDYLGYFLAHLEPIQTECVEPYQEFIERLCEDAF-GKEK 282

Query: 294 LYRSMTNLLLTGEISEEFEDWLINTIGERNLRKWKNLGIELLDKLVQILSLIFIPITEKF 353
           L  S+T+  L G + EE  DWL+ ++GERNL +WK+L      +  Q++ +  +P++E+ 
Sbjct: 283 LQESLTDHFLVGSMDEELRDWLVYSLGERNLEEWKSLMNTAYRRTSQVVLMCLVPVSERL 342

Query: 354 IITAERIQNYITAMRLSDN-----------SKILENDSEXXXXXXXXXXXXKTSIKQIPI 402
           II  E++Q  +   +LS+            + +LEN  E               IK I  
Sbjct: 343 IILCEQLQALVLTAQLSEGMVGDSLEISEFTDLLENCQELLQLVLQTVKQLAKDIKDI-- 400

Query: 403 LNNDKMAFEIFIDWIRNTIYLIIDE 427
                   ++F+ W+ N +   I++
Sbjct: 401 --------KVFLLWLENVLKTTINK 417

>CAGL0B01859g Chr2 (168976..170844) [1869 bp, 622 aa] {ON} weakly
           similar to uniprot|Q04601 Saccharomyces cerevisiae
           YDR118w APC4 subunit of the anaphase promoting complex
          Length = 622

 Score =  174 bits (441), Expect = 9e-46,   Method: Compositional matrix adjust.
 Identities = 124/425 (29%), Positives = 198/425 (46%), Gaps = 39/425 (9%)

Query: 11  YYKLNPIYQLYTFKSD-KGLAICTISDHSILATIFIKDFSLVVDFFWDSITGKFLLFAFN 69
           + K NP Y L+    D   L I   SD+  +  I +++  L++D+FWD I GK+L     
Sbjct: 10  FLKYNPKYGLFGMNEDNHSLVIRRTSDNVGIVKINVRNIVLLLDYFWDPIDGKYLALFLK 69

Query: 70  DGSIRVYDIFKLGRLVSFFR-------SPLKQIKCVYWDRIIITETLDQQLKIFDYDLTN 122
           DGS+R+YDIF  G+L+SF R       S    + C  WDRIII ++   +L+I + DLT 
Sbjct: 70  DGSVRIYDIFNGGKLISFLRVLPVVLGSNKPSLDCCLWDRIIIPKSGSSELRIPNNDLTE 129

Query: 123 SMPTLVKFVKDPQGLQLVPVLKNTQAWRQIDVDLNLKLENSKTEVSTDDVLDIHLLYTES 182
           SMPTLVKFV+D + + ++P    T+ WR I         N K       V+D+HL Y+ S
Sbjct: 130 SMPTLVKFVQDAKQIDIIPNRSITKLWRSIG-------NNEKK------VVDVHLGYSCS 176

Query: 183 GMDNFAVLVNGVY----DLSDIHVPNRSPNKVIKLVKASQGKYLGFYENASYRLIDVTPF 238
                 +L+NG Y     +SDI+   +     +   +  +  Y   +++ S   ID+T  
Sbjct: 177 SA-QVTILINGEYLIEKSVSDINQIQKKIPISLNKKEFCEAIYEIHFDDYSRLQIDLTGI 235

Query: 239 SSNDIRVNLLNNSIDLRNSVSXXXXXXXXXXXXXXSPFESFINLVCVDAYEGYDNLYRSM 298
             ND +++L+   I + N                 +P+  F+  +      G  N    +
Sbjct: 236 LLNDDKLDLIETQIKMTNHFDLIKDHFNLIEKSVLAPYYEFLESI------GGINDLDVL 289

Query: 299 TNLLLTGEISEEFEDWLINTIGERNLRKWKNLGIELLDKLVQILSLIFIPITEKFIITAE 358
             L L GE+  +  +W   TI E+NL+KW  LG E      Q+L ++F+PI E+ ++   
Sbjct: 290 ERLFLIGELDTKLGNWFKETINEKNLKKWSRLGNEFYSNFKQVLIIVFVPICERLMVLTN 349

Query: 359 RIQNYITAMRLSDNSKILENDSEXXXXXXXXXXXXKTSIKQIPILNNDKMAF-EIFIDWI 417
           RI   I  + L       E+                  +K +  LN D+  F + F+ W+
Sbjct: 350 RINGMIKGIDLQ------ESQETSLLDISELQSFLNLVLKLLAELNEDETYFKQDFLPWL 403

Query: 418 RNTIY 422
            + +Y
Sbjct: 404 TDKVY 408

>NDAI0J01270 Chr10 (297256..299463) [2208 bp, 735 aa] {ON} Anc_8.270
           YDR118W
          Length = 735

 Score =  160 bits (406), Expect = 1e-40,   Method: Compositional matrix adjust.
 Identities = 119/409 (29%), Positives = 208/409 (50%), Gaps = 49/409 (11%)

Query: 4   HSDSQLYYYKL---NPIYQLYTFKSDKGLAICTISDHSILATIFIKDFSLVVDFFWDSIT 60
           H D Q  +  +   NP + LY  K+   +      D   ++ I I++   V+   WDS T
Sbjct: 14  HRDEQWNFAPISYINPSFPLYLTKTSNSIIARRTLDGFQISNIIIRNMQNVIAIDWDSKT 73

Query: 61  GKFLLFAFNDGSIRVYDIFKLGRLVSFFRSPLKQIKCVY---------WDRIIITETLDQ 111
           GK+L   F+DG+ R+YDIF+ G+L++  R P + +  ++         WDR+II  ++ Q
Sbjct: 74  GKYLTINFDDGTFRIYDIFQDGKLITLVR-PQRNLLDIHRKTKVDNAIWDRLIILNSI-Q 131

Query: 112 QLKIFDYDLTNSMPTLVKFVKDPQGLQLVPVLKNTQA--WRQ----------------ID 153
           +L+ F++D+T  MPTL+KFVKD   + +VP   N +   WR+                ID
Sbjct: 132 ELE-FNHDITKLMPTLIKFVKDSTNIYIVPYSHNEKQNIWREFQPVSSYKPISTNMDAID 190

Query: 154 VDLNLKLENSKTEVSTDDVLDIHLLYTESGMDNFAVLVNGVYDLS----DIHVPNRSPNK 209
           +  N ++E S         LD+H+++     D F + +NG Y ++     I+  NR  NK
Sbjct: 191 MTTNQEVEKSMR------YLDLHIIHVIDP-DCFTIAINGTYQINLVRKTINTTNR--NK 241

Query: 210 VIKLVKAS-QGKYLGFYENASYRLIDVTPFSSNDIRVNLLNNSIDLRNSVSXXXXXXXXX 268
           +++++K++  G Y  F+EN S R +  + F+S+ + V LL   +++   +          
Sbjct: 242 IVRILKSTVHGVYHCFHENGSIRSLYFSHFTSSTLHVELLEIFMEINEMIKYFQYHLDLI 301

Query: 269 XXXXXSPFESFINLVCVDAYE--GYDNLYRSMTNLLLTGEISEEFEDWLINTIGERNLRK 326
                  F  F+     +  +  G +++ + +   LL+GE+SEE  +WL  +IGE+NL+K
Sbjct: 302 NKHLLKTFTDFLYPTIFEEKQNGGGNSMLQQLKLSLLSGEMSEELIEWLTLSIGEKNLKK 361

Query: 327 WKNLGIELLDKLVQILSLIFIPITEKFIITAERIQNYITAMRLSDNSKI 375
           WK L  EL  K +QI SL  IP  E  ++ +++    + A+ +   ++I
Sbjct: 362 WKRLSEELYSKSIQIFSLALIPACELTLLLSQKCLAILNAIEIEKKARI 410

>TBLA0C04570 Chr3 (1107010..1108836) [1827 bp, 608 aa] {ON}
           Anc_8.270 YDR118W
          Length = 608

 Score =  150 bits (379), Expect = 1e-37,   Method: Compositional matrix adjust.
 Identities = 117/487 (24%), Positives = 218/487 (44%), Gaps = 34/487 (6%)

Query: 13  KLNPIYQLYTFKSDKGLAICTISDHSILATIFIKDFSLVVDFFWDSITGKFLLFAFNDGS 72
           K NP   L   KSD GL +   +D SI+    I++ + ++ + W++  G ++   F  G+
Sbjct: 11  KSNPTLPLTLCKSDSGLKVIRTADKSIIINYKIRNKNDIIYYQWENNIGNYVAIFFQRGT 70

Query: 73  IRVYDIFKLGRLVSFFRSPLKQIKCVYWDRIIITETLDQQLKIFDYDLTNSMPTLVKFVK 132
           + +YD  K  RL++        +    WDR       D +  IFD D+T  MPTL++ ++
Sbjct: 71  VMIYDGIKTSRLLAMLNGGKPNVDAGIWDRYYFPN--DNEKDIFDSDITLYMPTLIQIIR 128

Query: 133 DPQGLQLVPVLKNTQAWRQIDVDLNLKLENSKTEVSTDDVLDIHLLYTESGMDNFAVLVN 192
           D + +           WR             K E   ++ LDIHLL+  S  D+F  ++N
Sbjct: 129 DKEKICPGTYFPPHSTWRA-----------KKEESLKNEFLDIHLLH-HSVDDSFTFILN 176

Query: 193 GVYDLSDIHVP---NRSPNKVIKLVKASQGKYLGFYENASYRLID---VTPFSSNDIRVN 246
           G     ++ +P   N +  + I ++K     ++ FY++ + R+ID   +     N+I   
Sbjct: 177 G-----ELKLPFPSNSTSGRAIGIIKGENNCFICFYQDLTVRMIDCHDLLQLKGNEI--- 228

Query: 247 LLNNSIDLRNSVSXXXXXXXXXXXXXXSPFESFINLVCVDAYEGYDNLYRSMTNLLLTGE 306
           L+++ I + + +               +PF  F+  V  +A +  + +  ++  +L++G 
Sbjct: 229 LVDHFIRINHLLKYLKEHIMFIKDNMSTPFNEFLTSVKGEATQ--EMMMENLITMLVSGY 286

Query: 307 ISEEFEDWLINTIGERNLRKWKNLGIELLDKLVQILSLIFIPITEKFIITAERIQN---Y 363
           IS E E+W+ NTIG +NL +W  LG    +K V I++L+ IP  E+F+I   R+Q    Y
Sbjct: 287 ISTELEEWIRNTIGIKNLTRWATLGGIFYEKGVDIITLMVIPACERFMILVARLQGLIEY 346

Query: 364 ITAMRLSDNSKILENDSEXXXXXXXXXXXXKTSIKQIPILNNDKMAFEIFIDWIRNTIYL 423
           +      DN  +  N S             K +++ +  L   K  FE F+ W    +  
Sbjct: 347 VIVRNRCDNRGVNLNSSYIENVKHAAKRFMKEALRMLEQLQLQKQLFEKFLHWFSENVRG 406

Query: 424 IIDEXXXXXXXXXXXXXXPFDIQKYINLQFKDHNKAILTVVDEFETYANKILIDLDMIDE 483
           ++ +                DI +Y+          + T + +FE     +  +L+++++
Sbjct: 407 VVQDEAVSGNILVKNVNNCRDIVEYLEWSMGGGPNRV-TELTQFEKELEVVQENLNLLNQ 465

Query: 484 KLIKPHL 490
             ++P L
Sbjct: 466 DFVEPAL 472

>NCAS0B03790 Chr2 complement(676973..678811) [1839 bp, 612 aa] {ON}
           Anc_8.270 YDR118W
          Length = 612

 Score =  147 bits (371), Expect = 1e-36,   Method: Compositional matrix adjust.
 Identities = 107/423 (25%), Positives = 201/423 (47%), Gaps = 32/423 (7%)

Query: 15  NPIYQLYTFKSDKGLAICTISDHSILATIFIKDFSLVVDFFWDSITGKFLLFAFNDGSIR 74
           NP Y    +K+  G A+    D + +  I I++   V+   W+S    +L   FNDGS R
Sbjct: 12  NPSYPAKLYKTSYGFAVRRTRDDTQIVKIVIRNMDAVIATCWNSFGSNYLTVMFNDGSAR 71

Query: 75  VYDIFKLGRLVSFFRSPLKQIKCV---YWDRIIITETLDQQLKIFDYDLTNSMPTLVKFV 131
           ++DIF+ G+L++  R      KC+    W ++ + +  ++    FD D++  MP+ +KFV
Sbjct: 72  IHDIFREGKLMTLLRLQDGFQKCMDTGIWSKLEVRQKPNEGE--FDRDISGLMPSPIKFV 129

Query: 132 KDPQGLQLVPVLKNTQAWRQIDVDLNLKLENSKTEVSTDDVLDIHLLYTESGMDNFAVLV 191
            +   L++VP +     WR +D  L +           +D++DIH+ +  S  D + +++
Sbjct: 130 NNAGQLEVVPYVVTQTQWRNVDKPLEV-----------NDIIDIHMAHN-SNTDEYLLMI 177

Query: 192 NGVYDLS------DIHVPNRSPNKVIKLVKASQGKYLGFYENASYRLIDVTPFSSNDIRV 245
           NGVY L+      D +  N+  +K+I L K +   +  FY++     ID+T    +   V
Sbjct: 178 NGVYKLTIQPNSTDENASNQ-LHKIIHLEKTAI--FHCFYKDRKTSTIDLTTLMESTPHV 234

Query: 246 NLLNNSIDLRNSVSXXXXXXXXXXXXXXSPFESFINLVCVDAYEGYDNLYRSMTNLLLTG 305
           +LLN   +++                   P + F+ +  +       +L +S+ + +L G
Sbjct: 235 SLLNVLTEMKQLHRYIVDHLDIIDNDLKKPLDDFLEVTNI---LNIKDLSKSLKSFILYG 291

Query: 306 EISEEFEDWLINTIGERNLRKWKNLGIELLDKLVQILSLIFIPITEKFIITAERIQNYIT 365
            +++    WL N +GE+NL+KWK L      K++QI+SL  +P  EK  + + R +  + 
Sbjct: 292 LMAKSLNHWLCNVVGEKNLKKWKRLSETKYQKIIQIISLAVLPALEKLSLLSIRCEALVV 351

Query: 366 AMRLSDNSKILENDS-EXXXXXXXXXXXXKTSIKQIPILNNDKMAFEIFIDWIRNTIYLI 424
           A+ L  +  + E +  +              +I Q    + ++    +FI WI++ I+  
Sbjct: 352 AIALPASGHMQELEYFDSLKRTTAALCNQALNITQKT--SEEEKKCSVFILWIQDLIFEC 409

Query: 425 IDE 427
           +DE
Sbjct: 410 VDE 412

>SAKL0H16852g Chr8 complement(1482321..1484255) [1935 bp, 644 aa]
           {ON} some similarities with uniprot|Q04601 Saccharomyces
           cerevisiae YDR118W APC4 Subunit of the
           Anaphase-Promoting Complex/Cyclosome (APC/C) which is a
           ubiquitin-protein ligase required for degradation of
           anaphase inhibitors including mitotic cyclins during the
           metaphase/anaphase transition
          Length = 644

 Score =  141 bits (356), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 118/430 (27%), Positives = 190/430 (44%), Gaps = 39/430 (9%)

Query: 15  NPIYQLYTFKSDKGLAICTISDHSILATIFIKDFSLVVDFFWDSITGKFLLFAFNDGSIR 74
           NP+  L+   + KG+A+    D   +AT+ +KD   +VD+ W+   G+      ++G IR
Sbjct: 21  NPVLSLFLVPTVKGIAVNRPVDGQRIATVSVKDHGTIVDYQWEQSEGRIFAVCHSNGIIR 80

Query: 75  VYDIFKLGRLVS---FFRSPLKQIK-CVYWDRIIITETLDQQLKIFDYDLTNSMPTLVKF 130
           +YD    G+ V       S    +K C   D             +FD+++T+ MP LVKF
Sbjct: 81  LYDSSLAGKSVGSVILGDSDCDVLKFCWSQDSWTFGSKFSN---VFDHEITSLMPRLVKF 137

Query: 131 VKDPQGLQLVP--VLKNTQAWRQIDVD-----LNLKLENSKTEVSTDDVLDIHLLYTESG 183
           VKD + L ++P  V      W ++D +     L    +  K  ++ D    +        
Sbjct: 138 VKDSRQLTMLPTDVGDGVPRWSKLDGNKSFIFLGYDSKRQKILMAIDGAFKLSF------ 191

Query: 184 MDNFAVLVNGVYDLSDIHVPNRSPNKVIKLVKASQGKYLGFYENASYRLIDVTPFSSNDI 243
             + A LV     L +    +  PN V  ++K   G+YL   ++   + I     + N  
Sbjct: 192 --SVAALVAAGERLDE---GDSVPNNVRDILKYDNGEYLVITDDWYIQKIKFDFLNCNLT 246

Query: 244 RVNLLNNSIDLRNSVSXXXXXXXXXXXXXXSPFESFINLVCVDAYEGYDNLYRSMTNLLL 303
           R  +++    +R+                  P+  FI  V + AYEG  +L   +T LL 
Sbjct: 247 R-EMISCCNRIRSLHKQLHESVSLVKTELVEPYTQFIERV-LGAYEG--DLIGDLTELLF 302

Query: 304 TGEISEEFEDWLINTIGERNLRKWKNLGIELLDKLVQILSLIFIPITEKFIITAERIQNY 363
           TG +  E EDWL NTIG++NLR+WK L   + +  V+I+ L  +P+ E+ I+  ER+   
Sbjct: 303 TGSVPPELEDWLSNTIGDKNLRRWKKLSSVMYENAVKIMVLTMVPVCERLILCGERLHGI 362

Query: 364 ITAMR------LSDNSKILENDSEXXXXXXXXXXXXKTSIKQIPILNNDKMAFEIFIDWI 417
           I  ++      L DN ++LE   +              SIKQI   N D    E FIDW 
Sbjct: 363 IKGLKLIGLKELEDNLEVLEA-QKLVCLSQEALENIIVSIKQI---NVDSNLHEAFIDWF 418

Query: 418 RNTIYLIIDE 427
            + +   +DE
Sbjct: 419 HDMVMEAVDE 428

>KLTH0G13508g Chr7 complement(1159671..1161608) [1938 bp, 645 aa]
           {ON} some similarities with uniprot|Q04601 Saccharomyces
           cerevisiae YDR118W APC4 Subunit of the
           Anaphase-Promoting Complex/Cyclosome (APC/C)
          Length = 645

 Score =  116 bits (291), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 101/425 (23%), Positives = 181/425 (42%), Gaps = 39/425 (9%)

Query: 15  NPIYQLYTFKSDKGLAICTISDHSILATIFIKDFSLVVDFFWDSITGKFLLFAFNDGSIR 74
           NP   LY    DK +++    D   +A + ++    ++   W+   GK     F +G++R
Sbjct: 22  NPRLSLYLVLGDKTVSVNRAIDGQRIAAVNLRGDGQLIGAQWELAEGKLFALFFGNGAVR 81

Query: 75  VYDIFKLGRL------VSFFRSPLKQIKCVYWDRIIITETLDQQLKIFDYDLTNSMPTLV 128
           +YD    G L      V   +S    +    W      +   Q+ K  + ++T  +P +V
Sbjct: 82  IYDCATGGSLREVVDLVDEGQSADVTVDTAVWSGAQWAQ-FRQEYKGLNIEITKQLPGMV 140

Query: 129 KFVKDPQGLQLVPVLKNTQAWRQIDVDLNLKLENSKTEVSTDDVLD--IHLLYTESGMDN 186
           + V+D + L +VP                  LE  K     D   D  I L + E   D 
Sbjct: 141 RLVRDAKQLSVVP------------------LETGKLRWLADPGKDAAIFLGHDEKSGD- 181

Query: 187 FAVLVNGVYDLSDIHVPNRSPNKVIKLVKASQ-GKYLGFYENASYRLIDVTPFSSNDIRV 245
           + + V+G   L  + VP+    K+ K+++  + G ++G   + + + + V  F ++ +  
Sbjct: 182 YLMTVDG---LLSVRVPS-GIKKMHKILRQGEDGTFVGVGADGTVQWV-VLRFLNSALMR 236

Query: 246 NLLNNSIDLRNSVSXXXXXXXXXXXXXXSPFESFINLVCVDAYEGYDNLYRSMTNLLLTG 305
            L+  S  +R   S               P+  F+  +  DAYEG + L     +++L+G
Sbjct: 237 ELIRYSGQIRFLCSYLTENINMCKTDLIEPYRQFLTRI-ADAYEGGE-LASRFRDIILSG 294

Query: 306 EISEEFEDWLINTIGERNLRKWKNLGIELLDKLVQILSLIFIPITEKFIITAERIQNYIT 365
            I E+ EDWL N+IG++N ++WK L   +   L  +L+L  IP  E+ I+ AE++Q    
Sbjct: 295 YIPEDLEDWLCNSIGDKNYKRWKQLSTRMYGDLNNVLALAVIPACERLILAAEQLQGIHK 354

Query: 366 AMRLSD---NSKILENDSEXXXXXXXXXXXXKTSIKQIPILNNDKMAFEIFIDWIRNTIY 422
            ++L +    S      +E              S++ +  LN D     IF DW  + + 
Sbjct: 355 GLKLQEFGLASPQEFESAEVTELITGCQALLHASLELVVDLNRDTRLHAIFADWFYDVVM 414

Query: 423 LIIDE 427
             +DE
Sbjct: 415 ETVDE 419

>Kwal_56.23766 s56 complement(695943..698165) [2223 bp, 740 aa] {ON}
           YDR118W (APC4) - subunit of the anaphase promoting
           complex (APC) [contig 173] FULL
          Length = 740

 Score =  109 bits (273), Expect = 4e-24,   Method: Compositional matrix adjust.
 Identities = 95/427 (22%), Positives = 182/427 (42%), Gaps = 43/427 (10%)

Query: 15  NPIYQLYTFKSDKGLAICTISDHSILATIFIKDFSLVVDFFWDSITGKFLLFAFNDGSIR 74
           NP   LY   +DK +A+  + D   +A + ++D   +V   W+    K      ++G +R
Sbjct: 22  NPRLSLYLVLTDKKIAVNRVIDGQQIAAVNLRDEHEIVGIQWEKNESKLFAVFQSNGVVR 81

Query: 75  VYDIFKLGRL------VSFFRSPLKQIKCVYWDRIIITETLDQQLKIFDYDLTNSMPTLV 128
           +YD    G L      V   ++   ++  V W  +   +   +  +  D+D+T  MP +V
Sbjct: 82  IYDCSIGGSLREMVNLVEEGQAAEVKVDAVVWMTVEWAK-FPESYRGLDFDITTLMPGMV 140

Query: 129 KFVKDPQGLQLVPVLKNTQAW---RQIDVDLNLKLENSKTE--VSTDDVLDIHLLYTESG 183
           + V+D + L L P+     +W   +  D  + L  +   TE  V+ D  L +      SG
Sbjct: 141 RLVRDSKQLSLAPLDLGKLSWLDGKYGDAAIFLAHDCESTEYMVAIDGQLSLRF---PSG 197

Query: 184 MDNFAVLVNGVYDLSDIHVPNRSPNKVIKLVKASQGKYLGFYENASYRLIDVTPFSSNDI 243
           + N                     +K+  L +   G +L   ++ + + + +  F    +
Sbjct: 198 IRNV--------------------HKI--LPQGGSGSFLAVGKDGTLQWVTLK-FLECAL 234

Query: 244 RVNLLNNSIDLRNSVSXXXXXXXXXXXXXXSPFESFINLVCVDAYEGYDNLYRSMTNLLL 303
              L+ +S  +R                   P+  F+  + + AYEG D+L   + ++LL
Sbjct: 235 MRELVKSSGQIRFLCRYLAENVSLCHTELIEPYRVFLTRL-MGAYEG-DDLATRLRDILL 292

Query: 304 TGEISEEFEDWLINTIGERNLRKWKNLGIELLDKLVQILSLIFIPITEKFIITAERIQNY 363
           TG I ++ E+WL N++G++N ++WK L   +   L  +L+L  +P  E+ I+ AER+Q  
Sbjct: 293 TGYIPDDLEEWLCNSVGDKNYKRWKQLSTRMYGDLNNVLTLAVVPACERLILAAERMQGI 352

Query: 364 ITAMRLSDNSKILEND---SEXXXXXXXXXXXXKTSIKQIPILNNDKMAFEIFIDWIRNT 420
             +++L    K    +    E            + ++  I  LN D    ++F +W  + 
Sbjct: 353 HKSLKLQRFCKDYAGELTTVELQTLISECQTLLEFTLNLITELNRDAALHQVFAEWFYDV 412

Query: 421 IYLIIDE 427
           +   +DE
Sbjct: 413 VMETVDE 419

>KLLA0F19316g Chr6 (1786659..1788674) [2016 bp, 671 aa] {ON}
           conserved hypothetical protein
          Length = 671

 Score = 48.5 bits (114), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 65/320 (20%), Positives = 137/320 (42%), Gaps = 40/320 (12%)

Query: 51  VVDFFWDSITGKFLLFAFNDGSIRVY-DIFKLGRLVSFFRSPLKQIKCVYWDRIIITETL 109
           ++D  W    G  L   +N G++ +Y +  +L + ++F     K  KC+  D ++ +   
Sbjct: 61  LIDVVWH---GNDLFCCYNSGTVSIYREGRELVKQLTFIPKGAK-TKCILCDNLVPS--- 113

Query: 110 DQQLKIFDYDLTNSMPTLVKFVKDPQGLQLVPVLKNTQAWRQIDVDLNLKLENSKTEVST 169
           D +  + D +L NSMP L K+           ++KN     ++D +L L      +E+  
Sbjct: 114 DDRYSLSDGNLLNSMPKLNKW----------DMIKN-----ELDNELILN-----SELGK 153

Query: 170 DDVLDIHLLYTESGMDNFAVLVNGVYDLSDIHVPNRSPNKVIKLVKASQGKYLGFYENAS 229
              +DI  +  +S  +   + + G  ++  +    + P  + +++K S GKY+   ++ S
Sbjct: 154 KKPIDI-FMAIDSKTNKLILSIEGTLNIK-VGEKLKLPKDIKRIIKVSSGKYMCLGKDWS 211

Query: 230 YRLIDVTPFSSNDIRVNLLNNSIDLRNSVSXXXXXXXXXXXXXXSPFESFINLVCVDAYE 289
           Y+++D+T     +I   L+  + +    +                P+  F+  +  + ++
Sbjct: 212 YQVLDLTFLQDPNI-YKLIKTTQEYSALLRYLKQLHRHLRMKLTEPYFEFVETLLKEEHK 270

Query: 290 GY--DNLYRSMTNLLLTGEISEEFEDWLINTIGERNLRKWKNLGIELLDKLVQILSLIFI 347
               +  Y  +T L    E+ EE  +  + T     L KW  L  +L    + ++    I
Sbjct: 271 NALQELFYIGVTKL----EVMEELHEVQLQTF---RLDKWSALSNDLCSNSIGLMVACTI 323

Query: 348 PITEKFIITAERIQNYITAM 367
           P+ E+ I+ A  I+    A+
Sbjct: 324 PLLERMIVLAASIEALCEAI 343

>Ecym_4300 Chr4 complement(642023..644170) [2148 bp, 715 aa] {ON}
           similar to Ashbya gossypii AGR078C
          Length = 715

 Score = 38.1 bits (87), Expect = 0.087,   Method: Compositional matrix adjust.
 Identities = 24/96 (25%), Positives = 42/96 (43%), Gaps = 3/96 (3%)

Query: 275 PFESFINLVCVDAYEGYDNLYRSMTNLLLTGEISEE-FEDWLINTIGERNLRKWKNLGIE 333
           P  +FIN +  D  E    L + + ++   G  +E+  E+W    +G   +  WK     
Sbjct: 278 PHATFINSLFPD--EQASRLLKGLKDVFYLGYSAEKNIENWFTLKLGRHGISIWKQRNHL 335

Query: 334 LLDKLVQILSLIFIPITEKFIITAERIQNYITAMRL 369
                  IL    IP  E+ I+  +R+Q  I +++L
Sbjct: 336 FWSSSQGILVTCMIPACERLIVAVKRLQGLIKSLKL 371

>KLLA0D16390g Chr4 (1378884..1381694) [2811 bp, 936 aa] {ON} similar
           to uniprot|Q12220 Saccharomyces cerevisiae YLR129W DIP2
           Nucleolar protein specifically associated with the U3
           snoRNA part of the large ribonucleoprotein complex known
           as the small subunit (SSU) processome required for 18S
           rRNA biogenesis part of the active pre- rRNA processing
           complex
          Length = 936

 Score = 35.4 bits (80), Expect = 0.53,   Method: Compositional matrix adjust.
 Identities = 24/75 (32%), Positives = 38/75 (50%), Gaps = 8/75 (10%)

Query: 57  DSITG-------KFLLFAFNDGSIRVYDIFKLGRLVSFFRSPLKQIKCVYWDR-IIITET 108
           D+ITG        +L+    DG I+V+D+   G+ V    +   Q   +  D  +IIT +
Sbjct: 158 DAITGIWIDHNMDWLISVAKDGLIKVWDLKAGGQCVETHMAHTGQCWSMAIDEEVIITTS 217

Query: 109 LDQQLKIFDYDLTNS 123
           +D Q KI++ DL  S
Sbjct: 218 MDSQAKIWELDLEKS 232

>KAFR0E03900 Chr5 complement(771649..772968) [1320 bp, 439 aa] {ON}
           Anc_5.429 YDR364C
          Length = 439

 Score = 34.7 bits (78), Expect = 0.82,   Method: Compositional matrix adjust.
 Identities = 21/86 (24%), Positives = 41/86 (47%), Gaps = 4/86 (4%)

Query: 60  TGKFLLFAFNDGSIRVYDIFKLGRLVSFFRSPLKQIKCVYWD---RIIITETLDQQLKIF 116
           TG   L   ND  ++++D +   + +  +R   K IK + ++      IT + DQ +K++
Sbjct: 158 TGHLFLSGGNDNIVKIWDFYHDRKSLRDYRGHTKAIKSMSFNDDAHNFITSSFDQTVKLW 217

Query: 117 DYDLTNSMPTLVKFVKDPQGLQLVPV 142
           D + T  +   +KF   P  ++  P 
Sbjct: 218 DTE-TGQVKKRLKFKSTPNCVEFRPA 242

>TPHA0L02130 Chr12 complement(441224..445750) [4527 bp, 1508 aa] {ON}
            Anc_5.49 YHR186C
          Length = 1508

 Score = 34.7 bits (78), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 18/40 (45%), Positives = 23/40 (57%)

Query: 38   SILATIFIKDFSLVVDFFWDSITGKFLLFAFNDGSIRVYD 77
            SI   I +K  SLV     D + G  ++  F+DGSIRVYD
Sbjct: 1296 SIEVDIPVKTSSLVTSITSDQLAGDTVVCGFSDGSIRVYD 1335

>ACR137W Chr3 (590077..591354) [1278 bp, 425 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YPL151C (PRP46)
          Length = 425

 Score = 34.3 bits (77), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 22/104 (21%), Positives = 48/104 (46%), Gaps = 10/104 (9%)

Query: 63  FLLFAFNDGSIRVYDIFKLGRLVSF--FRSPLKQIKCVYWDRIIITETLDQQLKIFDYDL 120
            ++ A  D  +RV+DI     +++    R P+ +++C+  D  I++ + D  +K++D   
Sbjct: 212 LIVSAGRDSVVRVWDIRSRSCVLTLAGHRGPINKVRCLPVDPQIVSCSTDATVKLWDLVA 271

Query: 121 TNSMPTLVKFVKDPQGLQLVP--------VLKNTQAWRQIDVDL 156
              M TL    ++ + L   P           + ++W+ +D  L
Sbjct: 272 GKPMKTLTHHKRNVRDLAFNPTEFSFASACTDDIRSWKLVDGQL 315

>TDEL0F04430 Chr6 complement(831678..832781) [1104 bp, 367 aa] {ON}
           Anc_8.316 YDR142C
          Length = 367

 Score = 32.0 bits (71), Expect = 4.8,   Method: Compositional matrix adjust.
 Identities = 25/122 (20%), Positives = 52/122 (42%), Gaps = 18/122 (14%)

Query: 50  LVVDFFWDSITGKFLLFAFNDGSIRVYDIFKLGRLVSFFRSPLKQIKCVYWD----RIII 105
            + D  W+ +    +L A  DGS+R++D       ++ F+   K++    W+       +
Sbjct: 62  CLFDVAWNELHENQVLVAQGDGSLRLFDTKLAQYPIAIFKEHQKEVFSCNWNLLNKNTFV 121

Query: 106 TETLDQQLKIFDYDLTNSMPTLVKFVKDPQGLQLVPVLKNTQAWRQIDVDLNLKLENSKT 165
           + + D  +KI+     +S+ TL      PQ L+ V          ++D  +N+ + N + 
Sbjct: 122 SSSWDGTVKIWSPTRKDSLLTLT-----PQPLKTV---------NRVDHSMNIPMSNQRN 167

Query: 166 EV 167
             
Sbjct: 168 HA 169

>NDAI0J01040 Chr10 (238940..240136) [1197 bp, 398 aa] {ON} Anc_8.316
           YDR142C
          Length = 398

 Score = 32.0 bits (71), Expect = 5.1,   Method: Compositional matrix adjust.
 Identities = 21/89 (23%), Positives = 39/89 (43%), Gaps = 4/89 (4%)

Query: 53  DFFWDSITGKFLLFAFNDGSIRVYDIFKLGRLVSFFRSPLKQIKCVYWDRI----IITET 108
           D  W+       L A  DGS+R++DI      ++ F+   K++    W+ I     ++ +
Sbjct: 65  DVAWNESHESQCLVAQGDGSLRLFDINLQKYPIAIFKEHKKEVLSCNWNLINKNLFLSSS 124

Query: 109 LDQQLKIFDYDLTNSMPTLVKFVKDPQGL 137
            D  +K++      S+ TL     DP  +
Sbjct: 125 WDGDVKVWSTARQASLITLSPIHTDPTAI 153

>AFR631C Chr6 complement(1587894..1589858) [1965 bp, 654 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YJL201W
           (ECM25)
          Length = 654

 Score = 32.0 bits (71), Expect = 6.4,   Method: Compositional matrix adjust.
 Identities = 16/58 (27%), Positives = 31/58 (53%), Gaps = 6/58 (10%)

Query: 624 NNTTKICLLLKFQKNDLSKE------FDYVYGKVCIEVDQHFNIIQSPAPFQNQDVLM 675
           N+T KI    K  K +LS++      FD ++ ++ +E  QH  + Q P  ++  ++L+
Sbjct: 170 NDTIKIPDWFKSSKGELSRKEYRQLIFDKIFKRLTLEAPQHPLVFQKPGSYKKINILL 227

>KAFR0E01470 Chr5 complement(293344..295962) [2619 bp, 872 aa] {ON}
           Anc_5.296 YDR285W
          Length = 872

 Score = 32.0 bits (71), Expect = 6.7,   Method: Compositional matrix adjust.
 Identities = 14/34 (41%), Positives = 22/34 (64%), Gaps = 3/34 (8%)

Query: 316 INTIGERNLRKWKNLGIELLDKLVQILSLIFIPI 349
           +NT+  R+  +WKN+ IEL +K    L L+ IP+
Sbjct: 359 LNTLASRSSTEWKNIAIELQEKY---LKLVLIPL 389

>SAKL0H15708g Chr8 (1370148..1371254) [1107 bp, 368 aa] {ON} highly
           similar to uniprot|Q750X9 Ashbya gossypii AGL190W
           AGL190Wp and similar to YDR142C uniprot|P39108
           Saccharomyces cerevisiae YDR142C PEX7 May serve as
           intraperoxisomal receptor for type 2 peroxisomal
           proteins (such as thiolase) Member of
           beta-transducin-related (WD- 40) protein family
          Length = 368

 Score = 31.6 bits (70), Expect = 6.8,   Method: Compositional matrix adjust.
 Identities = 21/80 (26%), Positives = 38/80 (47%), Gaps = 4/80 (5%)

Query: 53  DFFWDSITGKFLLFAFNDGSIRVYDIFKLGRLVSFFRSPLKQIKCVYWD----RIIITET 108
           D  W+      +L A  DGS+R++DI      +S F+   K++    W+    +  ++ +
Sbjct: 65  DVAWNEGHANQVLAAQGDGSLRLFDINLPQYPISIFQEHQKEVFSCNWNLVNKQTFVSSS 124

Query: 109 LDQQLKIFDYDLTNSMPTLV 128
            D  +KI+      S+ TLV
Sbjct: 125 WDGTVKIWSPMRQESLTTLV 144

>Skud_11.136 Chr11 complement(251660..254962) [3303 bp, 1100 aa]
           {ON} YKL092C (REAL)
          Length = 1100

 Score = 31.6 bits (70), Expect = 8.1,   Method: Compositional matrix adjust.
 Identities = 18/52 (34%), Positives = 29/52 (55%)

Query: 578 LLFKEMIIIEHLFQRNGNTTYLDSSTMLRSQLALNKFNDDEFNQNRNNTTKI 629
           LL  E+ I++    +N N  +L    +LRSQL + KF  + FN   NN+ ++
Sbjct: 239 LLKSEIRILDSSVLQNENCLFLGELPLLRSQLNIKKFCIENFNSGTNNSNEV 290

>NDAI0C02510 Chr3 complement(573717..576260) [2544 bp, 847 aa] {ON} 
          Length = 847

 Score = 31.6 bits (70), Expect = 9.5,   Method: Compositional matrix adjust.
 Identities = 20/59 (33%), Positives = 29/59 (49%), Gaps = 15/59 (25%)

Query: 26  DKGLAICTISDHSILATIFIKDFS---------------LVVDFFWDSITGKFLLFAFN 69
           DKGL + TI+D  ++ ++F KD+S               L VD+F  S   K+LL   N
Sbjct: 119 DKGLYVATINDSYVIKSVFDKDYSQTLLENKQFSYSGENLTVDYFSASPDLKYLLIRTN 177

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.321    0.138    0.398 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 72,741,748
Number of extensions: 3340546
Number of successful extensions: 10281
Number of sequences better than 10.0: 51
Number of HSP's gapped: 10568
Number of HSP's successfully gapped: 53
Length of query: 685
Length of database: 53,481,399
Length adjustment: 116
Effective length of query: 569
Effective length of database: 40,180,143
Effective search space: 22862501367
Effective search space used: 22862501367
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 69 (31.2 bits)