Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
TPHA0J007808.269ON58358328450.0
TDEL0F039608.269ON55855916560.0
ZYRO0C01496g8.269ON56756416240.0
Suva_2.2768.269ON56556016020.0
Kpol_392.28.269ON56656015930.0
YDR117C (TMA64)8.269ON56556015800.0
NCAS0B038008.269ON56556215770.0
Skud_4.3778.269ON56256215680.0
SAKL0H16874g8.269ON56356515470.0
Smik_4.3618.269ON56556915470.0
NDAI0J013108.269ON57957415120.0
KLTH0G13530g8.269ON57456914790.0
Kwal_56.237718.269ON56256414770.0
CAGL0B01837g8.269ON56956614410.0
KAFR0B054708.269ON56256913860.0
TBLA0I032008.269ON56356612121e-160
Ecym_43018.269ON56457311921e-157
KNAG0H032008.269ON56157111471e-150
KLLA0F19294g8.269ON57056411361e-149
AGR079W8.269ON54255710451e-135
AER067C4.261ON1282120790.68
KAFR0A024008.232ON46268751.4
SAKL0F04576g7.152ON180119722.2
YLR440C (SEC39)4.323ON709155724.4
TPHA0P001808.15ON99738715.6
AAL068C5.312ON66485699.4
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= TPHA0J00780
         (583 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

TPHA0J00780 Chr10 complement(180939..182690) [1752 bp, 583 aa] {...  1100   0.0  
TDEL0F03960 Chr6 complement(733512..735188) [1677 bp, 558 aa] {O...   642   0.0  
ZYRO0C01496g Chr3 (108150..109853) [1704 bp, 567 aa] {ON} simila...   630   0.0  
Suva_2.276 Chr2 complement(478604..480301) [1698 bp, 565 aa] {ON...   621   0.0  
Kpol_392.2 s392 (1564..3264) [1701 bp, 566 aa] {ON} (1564..3264)...   618   0.0  
YDR117C Chr4 complement(683946..685643) [1698 bp, 565 aa] {ON}  ...   613   0.0  
NCAS0B03800 Chr2 (678984..680681) [1698 bp, 565 aa] {ON} Anc_8.2...   612   0.0  
Skud_4.377 Chr4 complement(655577..657265) [1689 bp, 562 aa] {ON...   608   0.0  
SAKL0H16874g Chr8 (1484425..1486116) [1692 bp, 563 aa] {ON} simi...   600   0.0  
Smik_4.361 Chr4 complement(645227..646924) [1698 bp, 565 aa] {ON...   600   0.0  
NDAI0J01310 Chr10 (306474..308213) [1740 bp, 579 aa] {ON} Anc_8....   587   0.0  
KLTH0G13530g Chr7 (1161702..1163426) [1725 bp, 574 aa] {ON} simi...   574   0.0  
Kwal_56.23771 s56 (698257..699945) [1689 bp, 562 aa] {ON} YDR117...   573   0.0  
CAGL0B01837g Chr2 complement(166953..168662) [1710 bp, 569 aa] {...   559   0.0  
KAFR0B05470 Chr2 (1120794..1122482) [1689 bp, 562 aa] {ON} Anc_8...   538   0.0  
TBLA0I03200 Chr9 complement(769960..771651) [1692 bp, 563 aa] {O...   471   e-160
Ecym_4301 Chr4 (644340..646034) [1695 bp, 564 aa] {ON} similar t...   463   e-157
KNAG0H03200 Chr8 (599611..601296) [1686 bp, 561 aa] {ON} Anc_8.2...   446   e-150
KLLA0F19294g Chr6 complement(1784664..1786376) [1713 bp, 570 aa]...   442   e-149
AGR079W Chr7 (879417..881045) [1629 bp, 542 aa] {ON} Syntenic ho...   407   e-135
AER067C Chr5 complement(757163..761011) [3849 bp, 1282 aa] {ON} ...    35   0.68 
KAFR0A02400 Chr1 complement(499107..500495) [1389 bp, 462 aa] {O...    33   1.4  
SAKL0F04576g Chr6 (369113..369120,369587..370121) [543 bp, 180 a...    32   2.2  
YLR440C Chr12 complement(1015568..1017697) [2130 bp, 709 aa] {ON...    32   4.4  
TPHA0P00180 Chr16 (33456..36449) [2994 bp, 997 aa] {ON} Anc_8.15...    32   5.6  
AAL068C Chr1 complement(229091..231085) [1995 bp, 664 aa] {ON} S...    31   9.4  

>TPHA0J00780 Chr10 complement(180939..182690) [1752 bp, 583 aa] {ON}
           Anc_8.269 YDR117C
          Length = 583

 Score = 1100 bits (2845), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 544/583 (93%), Positives = 544/583 (93%)

Query: 1   MFKKTPNVKASSNLKNSERKKLLQSCKEQRNSSDYNFPSSIIKQANYKGQTSAGTVYTDE 60
           MFKKTPNVKASSNLKNSERKKLLQSCKEQRNSSDYNFPSSIIKQANYKGQTSAGTVYTDE
Sbjct: 1   MFKKTPNVKASSNLKNSERKKLLQSCKEQRNSSDYNFPSSIIKQANYKGQTSAGTVYTDE 60

Query: 61  QNVPIWFKEKHSDMLFPSVYTCWKNPKLLPIIVTNSYVIEEKILNGANLMISGTLLPFDE 120
           QNVPIWFKEKHSDMLFPSVYTCWKNPKLLPIIVTNSYVIEEKILNGANLMISGTLLPFDE
Sbjct: 61  QNVPIWFKEKHSDMLFPSVYTCWKNPKLLPIIVTNSYVIEEKILNGANLMISGTLLPFDE 120

Query: 121 RLICGALCGIASYKKPNVVMAIGIVQLDLQSYTKVVGETGVAVNVLHYLGDGLSDSFKMN 180
           RLICGALCGIASYKKPNVVMAIGIVQLDLQSYTKVVGETGVAVNVLHYLGDGLSDSFKMN
Sbjct: 121 RLICGALCGIASYKKPNVVMAIGIVQLDLQSYTKVVGETGVAVNVLHYLGDGLSDSFKMN 180

Query: 181 LEPPETGAEVDETNEMLLNQDKQDVNNELTNSNKDLAPDARPNDDLAEVLETLPVDIIDD 240
           LEPPETGAEVDETNEMLLNQDKQDVNNELTNSNKDLAPDARPNDDLAEVLETLPVDIIDD
Sbjct: 181 LEPPETGAEVDETNEMLLNQDKQDVNNELTNSNKDLAPDARPNDDLAEVLETLPVDIIDD 240

Query: 241 FITKSLYYSLTNDPKLEFPISASNFISNYIMSNLPPVDNDMVNLKKSSWKKTAKFLRHFE 300
           FITKSLYYSLTNDPKLEFPISASNFISNYIMSNLPPVDNDMVNLKKSSWKKTAKFLRHFE
Sbjct: 241 FITKSLYYSLTNDPKLEFPISASNFISNYIMSNLPPVDNDMVNLKKSSWKKTAKFLRHFE 300

Query: 301 KEGFIKLKGKNDDLVITGFNKEKTELKSFVPYRTXXXXXXXXXXXXXXXXXXXXXMMQSV 360
           KEGFIKLKGKNDDLVITGFNKEKTELKSFVPYRT                     MMQSV
Sbjct: 301 KEGFIKLKGKNDDLVITGFNKEKTELKSFVPYRTGNGNSTKSKKDKTNDTSDNGDMMQSV 360

Query: 361 SYYKPISLGKDLIRESVAPEKSLYTAHELRDFITEYINKKNLVDSKNKKMILMDDLMYSL 420
           SYYKPISLGKDLIRESVAPEKSLYTAHELRDFITEYINKKNLVDSKNKKMILMDDLMYSL
Sbjct: 361 SYYKPISLGKDLIRESVAPEKSLYTAHELRDFITEYINKKNLVDSKNKKMILMDDLMYSL 420

Query: 421 VYKKKNSAEPRLISRADVIEPITKNNFNEHFQIYKKGDNETAVPLFKKPIRGSIPKVEIV 480
           VYKKKNSAEPRLISRADVIEPITKNNFNEHFQIYKKGDNETAVPLFKKPIRGSIPKVEIV
Sbjct: 421 VYKKKNSAEPRLISRADVIEPITKNNFNEHFQIYKKGDNETAVPLFKKPIRGSIPKVEIV 480

Query: 481 TEMKIGRKVITRVSNFEVFHIDAETLAADLRKLCNGATTIGETLTSPKTAEVQVQGPHSQ 540
           TEMKIGRKVITRVSNFEVFHIDAETLAADLRKLCNGATTIGETLTSPKTAEVQVQGPHSQ
Sbjct: 481 TEMKIGRKVITRVSNFEVFHIDAETLAADLRKLCNGATTIGETLTSPKTAEVQVQGPHSQ 540

Query: 541 VIIKHLNSLSIPTKWIDFXXXXXXXXXXXXXXXXXXLDQILLQ 583
           VIIKHLNSLSIPTKWIDF                  LDQILLQ
Sbjct: 541 VIIKHLNSLSIPTKWIDFKNSVKPKRKKNKPAFNKPLDQILLQ 583

>TDEL0F03960 Chr6 complement(733512..735188) [1677 bp, 558 aa] {ON}
           Anc_8.269 YDR117C
          Length = 558

 Score =  642 bits (1656), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 316/559 (56%), Positives = 410/559 (73%), Gaps = 14/559 (2%)

Query: 1   MFKKTPNVKASSNLKNSERKKLLQSCKEQRNSSDYNFPSSIIKQANYKGQTSAGTVYTDE 60
           MFKK P++KA SNLKNSERKKLLQSCKEQ  +SDYNF +SI+KQ NYKGQ S GTVYTD+
Sbjct: 1   MFKKEPHIKALSNLKNSERKKLLQSCKEQTGASDYNFSTSIVKQTNYKGQHSDGTVYTDQ 60

Query: 61  QNVPIWFKEKHSDMLFPSVYTCWKNPKLLPIIVTNSYVIEEKILNGANLMISGTLLPFDE 120
            NVPIWFKEKH ++LFP+VY+CW  P LLPI++T+ +VIEE++ NGANLM++GTL PFDE
Sbjct: 61  NNVPIWFKEKHGELLFPTVYSCWTAPNLLPIVLTHDFVIEERLFNGANLMLAGTLPPFDE 120

Query: 121 RLICGALCGIASYKKPNVVMAIGIVQLDLQSYTKVVGETGVAVNVLHYLGDGLSDSFKMN 180
           R +   +CGIAS   P V++AIG+VQL+L SY+ V+G+ G+AV V+HY  DGL  +FK++
Sbjct: 121 RCVPAKVCGIASRTDPKVILAIGVVQLNLPSYSSVIGQPGIAVKVMHYFTDGLCQAFKID 180

Query: 181 LEPPETGAEVDETNEMLLNQDKQDVNNELTNSNKDLAPDARPNDDLAEVLETLPVDIIDD 240
           +EP    +E  E  E    ++K   + +    + +++      +D+A+VL+ L V+ +D 
Sbjct: 181 IEPAVLSSEPVEEEEEEEGKEKLTESPKRETFHTEIS-----IEDVAQVLDELSVEDVDH 235

Query: 241 FITKSLYYSLTNDPKLEFPISASNFISNYIMSNLPPVDNDMVNLKKSSWKKTAKFLRHFE 300
           F T++LYY+ T+D  L  PI+ASNFISN+I+ NLPPVD   VN+KK+SWKKTAKFL+HFE
Sbjct: 236 FFTRALYYTFTHDTGLNIPINASNFISNHILPNLPPVDQSQVNMKKTSWKKTAKFLKHFE 295

Query: 301 KEGFIKLKGKNDDLVITGFNKEKTELKSFVPYRTXXXXXXXXXXXXXXXXXXXXXMMQSV 360
           K GF++LKGK DDLVI G NK K ELK+FVPY+T                     MM S 
Sbjct: 296 KVGFLQLKGKGDDLVIVGVNKNKDELKNFVPYKT----SGQTASKKNSNKDSSPGMMYSE 351

Query: 361 SYYKPISLGKDLIRESVAPEKSLYTAHELRDFITEYINKKNLVDSKNKKMILMDDLMYSL 420
             YKPI+LGKD I+ S  P K+LYT  EL+D + +YI  K LVDSKNKKM+L+DDL++ +
Sbjct: 352 KLYKPINLGKDFIQCSDLPPKNLYTVTELKDSVNQYITAKKLVDSKNKKMVLLDDLLFDM 411

Query: 421 VYKKKNSAE-PRLISRADVIEPITKNNFNEHFQIYKKGDNETAVPLFKKPIRGSIPKVEI 479
            Y+KK + E PR +SRA +++P   NNF E +Q++K  D     PLFK PIRG +P+V+I
Sbjct: 412 FYRKKKTQETPRCVSRAQIMDPFIANNFTEFYQLFKDED----TPLFKNPIRGPLPRVKI 467

Query: 480 VTEMKIGRKVITRVSNFEVFHIDAETLAADLRKLCNGATTIGETLTSPKTAEVQVQGPHS 539
           VTEMKIGRKV+TRVS+FE F +D E LAA+LRKLC+G+TTIGET+TSPK AEVQVQG H 
Sbjct: 468 VTEMKIGRKVVTRVSHFETFKLDPEDLAANLRKLCSGSTTIGETVTSPKVAEVQVQGAHG 527

Query: 540 QVIIKHLNSLSIPTKWIDF 558
            +II +LN   IPTKWIDF
Sbjct: 528 PLIIDYLNKQGIPTKWIDF 546

>ZYRO0C01496g Chr3 (108150..109853) [1704 bp, 567 aa] {ON} similar
           to uniprot|Q04600 Saccharomyces cerevisiae YDR117C RBF64
           Hypothetical ORF
          Length = 567

 Score =  630 bits (1624), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 314/564 (55%), Positives = 414/564 (73%), Gaps = 16/564 (2%)

Query: 1   MFKKTPNVKASSNLKNSERKKLLQSCKEQRNSSDYNFPSSIIKQANYKGQTSAGTVYTDE 60
           MFKK P+VKA SNLKNSE KKLL +C+ Q  + +Y+FP+ +IKQ N++ Q+  GTVYTD 
Sbjct: 1   MFKKDPHVKALSNLKNSEAKKLLATCRAQTGNQEYSFPTGVIKQTNFQAQSGIGTVYTDA 60

Query: 61  QNVPIWFKEKHSDMLFPSVYTCWKNPKLLPIIVTNSYVIEEKILNGANLMISGTLLPFDE 120
            N PIWFKEKH ++L+P+V+ CW +P LLP+++T+ +V+EE++ NGANLM++GT+LPFD 
Sbjct: 61  DNKPIWFKEKHGNLLYPTVFACWSHPGLLPVVLTHGFVVEERLFNGANLMLAGTVLPFDS 120

Query: 121 RLICGALCGIASYKKPNVVMAIGIVQLDLQSYTKVVGETGVAVNVLHYLGDGLSDSFKMN 180
           RL  G +CGIAS   P+VVMA+G+VQLDL SY  V+G+TGVAV ++HYL DGLS  FK+N
Sbjct: 121 RLKPGTVCGIASKNAPDVVMAVGVVQLDLPSYDSVLGKTGVAVQLVHYLPDGLSKVFKVN 180

Query: 181 LEPP----ETGAEVDETNEMLLNQDKQDVNNELTNSNKDLAPDARPNDDLAEVLETLPVD 236
            EPP    ++  E +E  E+L    +Q  + E+ +  K     A   DD+AEVL+   ++
Sbjct: 181 AEPPVSLEDSDEEEEEEEEVLEESAQQPSSQEIPSQEK-----AVDIDDIAEVLDEFRLE 235

Query: 237 IIDDFITKSLYYSLTNDPKLEFPISASNFISNYIMSNLPPVDNDMVNLKKSSWKKTAKFL 296
            +D F+T++LYY+LT+D KLE PISASNFISN+I  NLP VD++ VN+KKSSWKKTAKFL
Sbjct: 236 DVDQFLTRALYYTLTHDTKLELPISASNFISNHINHNLPSVDHEKVNVKKSSWKKTAKFL 295

Query: 297 RHFEKEGFIKLKGKNDDLVITGFNKEKTELKSFVPYRTXXXXXXXXXXXXXXXXXXXXXM 356
           ++FEKEGF+KLKGK DDL I G NK+K EL++F PY+                       
Sbjct: 296 KNFEKEGFLKLKGKGDDLTIIGINKQKPELQNFQPYQISGGSGGGGNSSSNNNKKDGSPQ 355

Query: 357 MQSVSYYKPISLGKDLIRES-VAPEKSLYTAHELRDFITEYINKKNLVDSKNKKMILMDD 415
           ++  + YKPI+L KD I+++ + P+  LYTA EL++ + +YI   NL DSKNKKM+++DD
Sbjct: 356 LRCETLYKPINLAKDFIQQTDLNPQDILYTAQELKNALNDYIASNNLADSKNKKMVILDD 415

Query: 416 LMYSLVYKK-KNSAEPRLISRADVIEPITKNNFNEHFQIYKKGDNETAVPLFKKPIRGSI 474
           L+Y LV KK K++  PRL+SRA +IEP+  N+F  HFQIY KGD    +PLFK P RG++
Sbjct: 416 LLYHLVNKKQKDTTAPRLVSRATIIEPLLANSFTPHFQIY-KGD----IPLFKNPSRGNL 470

Query: 475 PKVEIVTEMKIGRKVITRVSNFEVFHIDAETLAADLRKLCNGATTIGETLTSPKTAEVQV 534
           P +EIVTEMKIGRKVITRVS FE+FHID + LAA LR+LC+G+TTIGET+TSPK  EV V
Sbjct: 471 PNIEIVTEMKIGRKVITRVSRFEIFHIDEDELAATLRRLCSGSTTIGETMTSPKYKEVTV 530

Query: 535 QGPHSQVIIKHLNSLSIPTKWIDF 558
           QGPH  +II HLNSL IPTKWI F
Sbjct: 531 QGPHGPLIIDHLNSLGIPTKWIKF 554

>Suva_2.276 Chr2 complement(478604..480301) [1698 bp, 565 aa] {ON}
           YDR117C (REAL)
          Length = 565

 Score =  621 bits (1602), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 302/560 (53%), Positives = 407/560 (72%), Gaps = 7/560 (1%)

Query: 1   MFKKTPNVKASSNLKNSERKKLLQSCKEQRNSSDYNFPSSIIKQANYKGQTSAGTVYTDE 60
           MFKK P++KA SNLKNSERKKLLQ+CK+Q N+ +Y FP+S IKQ N+ GQ S GTVYTDE
Sbjct: 1   MFKKEPHIKALSNLKNSERKKLLQTCKKQTNNEEYTFPTSTIKQTNFSGQKSLGTVYTDE 60

Query: 61  QNVPIWFKEKHSDMLFPSVYTCWKNPKLLPIIVTNSYVIEEKILNGANLMISGTLLPFDE 120
            N PI FKEKH++ LFP+VY+CW+N  LLPI++T+ +VIEE + NGANLMISG++ PFD 
Sbjct: 61  NNTPILFKEKHNEQLFPTVYSCWENHTLLPIVLTHGFVIEEHLFNGANLMISGSIPPFDP 120

Query: 121 RLICGALCGIASYKKPNVVMAIGIVQLDLQSYTKVVGETGVAVNVLHYLGDGLSDSFKMN 180
           R   G LCG+AS + P +V+A+GIV++DL SY++V+GETGVAV ++H+  DGLS +FK+ 
Sbjct: 121 RCKIGTLCGVASRQAPKIVLAVGIVEMDLPSYSRVIGETGVAVKIVHHFNDGLSKAFKVK 180

Query: 181 LEPPETGAEVDETNEMLLNQDKQDVNNELTNSNKDLAPDARPN-DDLAEVLETLPVDIID 239
           LEPP       E  ++   Q +     + T   ++   +A  N +++AEVL+ L V  +D
Sbjct: 181 LEPPAAFDVASEDEDIDNTQIEIQEGTKTTEKTRENVQEANINIEEIAEVLDHLSVSDVD 240

Query: 240 DFITKSLYYSLTNDPKLEFPISASNFISNYIMSNLPPVDNDMVNLKKSSWKKTAKFLRHF 299
            FIT++LYY+LT D  L  PISASNFISN+IM NLPP+D++ VN+K++SWKK+AKFL+HF
Sbjct: 241 YFITRALYYTLTQDKSLALPISASNFISNHIMRNLPPIDHNEVNVKRTSWKKSAKFLKHF 300

Query: 300 EKEGFIKLKGKNDDLVITGFNKEKTELKSFVPYRTXXXXXXXXXXXXXXXXXXXXXMMQS 359
           EKEGF+KLKGK DDL I G N +K ELK+FVPY+                      MM S
Sbjct: 301 EKEGFLKLKGKGDDLTIVGKNTDKDELKNFVPYKLGVNNSAKEKGENTNSKEKTSGMMYS 360

Query: 360 VSYYKPISLGKDLIRESVAPEKSLYTAHELRDFITEYINKKNLVDSKNKKMILMDDLMYS 419
           ++ YKP +L KDL++E+  P ++ YT+ ++R  IT+YI+ KNLVD+K+K  ++MDDL+Y+
Sbjct: 361 LTLYKPFNLAKDLVKEANLPFQTYYTSQDIRSAITQYISIKNLVDAKDKGKVVMDDLLYN 420

Query: 420 LVYKKKNSAE-PRLISRADVIEPITKNNFNEHFQIYKKGDNETAVPLFKKPIRGSIPKVE 478
           +V KKK   +  R+I RA +++P+  NNF E +QIYK  D      L + P++GS P+++
Sbjct: 421 MVNKKKKDPDVARVIPRAQILDPLLANNFTEFYQIYKNDD----TLLSRTPMKGSPPRIK 476

Query: 479 IVTEMKIGRKVITRVSNFEVFHIDAETLAADLRKLCNGATTIGETLTSPKTAEVQVQGPH 538
           I+TEMKIGRKVIT+VSNFE   ID E LAADLRK+C+G+TTIGE+ T  K+AEVQVQGPH
Sbjct: 477 IITEMKIGRKVITKVSNFEALQIDPELLAADLRKICSGSTTIGESQTF-KSAEVQVQGPH 535

Query: 539 SQVIIKHLNSLSIPTKWIDF 558
            Q+II HLN   +P KWIDF
Sbjct: 536 GQLIIDHLNKSGVPNKWIDF 555

>Kpol_392.2 s392 (1564..3264) [1701 bp, 566 aa] {ON} (1564..3264)
           [1701 nt, 567 aa]
          Length = 566

 Score =  618 bits (1593), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 321/560 (57%), Positives = 405/560 (72%), Gaps = 7/560 (1%)

Query: 1   MFKKTPNVKASSNLKNSERKKLLQSCKEQRNSSDYNFPSSIIKQANYKGQTSAGTVYTDE 60
           MFKKTP++K+ SNLKNSERKKLLQSCK Q  S+DYNFP+S+IKQ N+  QTS G +YTDE
Sbjct: 1   MFKKTPHIKSLSNLKNSERKKLLQSCKAQTGSTDYNFPTSVIKQTNFNAQTSVGVIYTDE 60

Query: 61  QNVPIWFKEKHSDMLFPSVYTCWKNPKLLPIIVTNSYVIEEKILNGANLMISGTLLPFDE 120
           +  P+WFKEKHS++LFP+VYTCW++P LLPI++T+  VI E I NGANLMISGTL PFD 
Sbjct: 61  EGSPLWFKEKHSELLFPTVYTCWEDPTLLPIVLTHDIVINEHIFNGANLMISGTLPPFDS 120

Query: 121 RLICGALCGIASYKKPNVVMAIGIVQLDLQSYTKVVGETGVAVNVLHYLGDGLSDSFKMN 180
           RL+   +CGIA+   PN ++A+G+VQLD+ SY+ V+G+TGVAVNVLHY GDG+S +FKM 
Sbjct: 121 RLVPATICGIATRNNPNTIVAVGVVQLDMPSYSSVIGKTGVAVNVLHYWGDGMSVAFKMK 180

Query: 181 LEPPETGAEVDETNEMLLNQDKQDVNNELTNSNKDLAPDARPND--DLAEVLETLPVDII 238
            + P      D++ +   N     +  E   +  D  P+   ND  +LA+    L V+ I
Sbjct: 181 RDIPTIVGGKDKSVDATENDQSPVIITEEEKTEDDSIPEISSNDVSELAQEESALTVEDI 240

Query: 239 DDFITKSLYYSLTNDPKLEFPISASNFISNYIMSNLPPVDNDMVNLKKSSWKKTAKFLRH 298
           D FIT+SLYY+LTND KL FPI +S+FISN+IM NLPPVD+++VN+KK+SWKK++KFL+H
Sbjct: 241 DHFITRSLYYTLTNDLKLAFPIPSSSFISNHIMRNLPPVDHNLVNIKKTSWKKSSKFLKH 300

Query: 299 FEKEGFIKLKGKNDDLVITGFNKEKTELKSFVPYRTXXXXXXXXXXXXXXXXXXXXXMMQ 358
           FEKEGFIKLKGK +DL I G NKEK ELK F PYR                      MM 
Sbjct: 301 FEKEGFIKLKGKGEDLTIVGSNKEKEELKKFEPYRI-SNSSSNSGKKINSNRQESENMMY 359

Query: 359 SVSYYKPISLGKDLIRESVAPEKSLYTAHELRDFITEYINKKNLVDSKNKKMILMDDLMY 418
           S+ +Y P    K  +  +  P K+ YTA EL++ +TEYI KK LVD KN KM  +DD +Y
Sbjct: 360 SLVFYSPKGSAKQFMTLTELPYKNWYTAIELKNAVTEYIKKKELVDKKNPKMANLDDRLY 419

Query: 419 SLVYKKKNSAEPRLISRADVIEPITKNNFNEHFQIYKKGDNETAVPLFKKPIRGSIPKVE 478
            + Y KK++  PR I+RA VIE  T NNF E +Q++K  D     PL K P+RGS P+++
Sbjct: 420 DMCYTKKSTNPPRHITRAAVIESFTTNNFTELYQLFKNDD----TPLTKNPVRGSPPRIK 475

Query: 479 IVTEMKIGRKVITRVSNFEVFHIDAETLAADLRKLCNGATTIGETLTSPKTAEVQVQGPH 538
           IVTEMKIGRK++TRVSNFE F IDA+ LA DLR+LC+G+TTIGET TSPKT EVQVQGPH
Sbjct: 476 IVTEMKIGRKIVTRVSNFESFGIDADALAGDLRRLCSGSTTIGETTTSPKTTEVQVQGPH 535

Query: 539 SQVIIKHLNSLSIPTKWIDF 558
           S++II HLNSLSIPTKWIDF
Sbjct: 536 SKIIIDHLNSLSIPTKWIDF 555

>YDR117C Chr4 complement(683946..685643) [1698 bp, 565 aa] {ON}
           TMA64Protein of unknown function that associates with
           ribosomes; has a putative RNA binding domain; in mammals
           the corresponding protein, eIF2D, has been shown to
           possess translation initiation factor activity
          Length = 565

 Score =  613 bits (1580), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 300/560 (53%), Positives = 399/560 (71%), Gaps = 7/560 (1%)

Query: 1   MFKKTPNVKASSNLKNSERKKLLQSCKEQRNSSDYNFPSSIIKQANYKGQTSAGTVYTDE 60
           MFKK P++KA SNLKNSERKKLLQ+ ++Q N+ +Y+F +S IKQ N+ GQ S GTVYTDE
Sbjct: 1   MFKKEPHIKALSNLKNSERKKLLQTFQKQTNNEEYSFRTSTIKQTNFNGQKSVGTVYTDE 60

Query: 61  QNVPIWFKEKHSDMLFPSVYTCWKNPKLLPIIVTNSYVIEEKILNGANLMISGTLLPFDE 120
            N PI FKEKH + LFP+VY+CW+ P LLPI++T+ +VIEE + NGANLMISG++ PFD 
Sbjct: 61  NNTPILFKEKHKEQLFPTVYSCWEYPALLPIVLTHGFVIEEHLFNGANLMISGSIPPFDP 120

Query: 121 RLICGALCGIASYKKPNVVMAIGIVQLDLQSYTKVVGETGVAVNVLHYLGDGLSDSFKMN 180
           R   G LCGIAS + P  V+AIGIV+LDL S+ KV+GETGVAV ++H+  DGLS  FKM 
Sbjct: 121 RCKIGTLCGIASKQAPETVLAIGIVELDLPSFDKVIGETGVAVKIIHHFNDGLSKVFKMK 180

Query: 181 LEPPETGAEVDETNEMLLNQ-DKQDVNNELTNSNKDLAPDARPNDDLAEVLETLPVDIID 239
           LEPP   +   + N +   Q +  +    +    +D+   +   +++AEVL+   V  +D
Sbjct: 181 LEPPFVLSTQSKDNNISSKQIESSEQIKAVEKEQEDVKEASVDVEEIAEVLDHFTVSDVD 240

Query: 240 DFITKSLYYSLTNDPKLEFPISASNFISNYIMSNLPPVDNDMVNLKKSSWKKTAKFLRHF 299
            FIT++LYY+LT D  LE PISASNFISN+IM NLPP+D++ VN+KK+SWKK+AKFL+HF
Sbjct: 241 YFITRALYYTLTQDKGLELPISASNFISNHIMRNLPPIDHNEVNVKKTSWKKSAKFLKHF 300

Query: 300 EKEGFIKLKGKNDDLVITGFNKEKTELKSFVPYRTXXXXXXXXXXXXXXXXXXXXXMMQS 359
           EKEGF+KLKGK DDL I G N +K ELK+FVPY+                      MM S
Sbjct: 301 EKEGFLKLKGKGDDLTIVGKNTDKDELKNFVPYKLGCSKSATESRESTTSKEKTSGMMYS 360

Query: 360 VSYYKPISLGKDLIRESVAPEKSLYTAHELRDFITEYINKKNLVDSKNKKMILMDDLMYS 419
           ++ YKP +L KDL++E      + YT+ ++R  +++YI+ KNL D+K+K  ++MDDL++ 
Sbjct: 361 LTLYKPFNLAKDLLKEVNLASHTYYTSQDIRSAVSQYISVKNLADTKDKGKVIMDDLLFD 420

Query: 420 LVYKKKNSAEP-RLISRADVIEPITKNNFNEHFQIYKKGDNETAVPLFKKPIRGSIPKVE 478
           +V KKK      R+I+R +++ P+  NNF E +QI+K  D      LFK P++GS+P ++
Sbjct: 421 MVNKKKKVLNASRIIARGEILHPLLTNNFTEFYQIFKSDD----TLLFKAPMKGSLPHIK 476

Query: 479 IVTEMKIGRKVITRVSNFEVFHIDAETLAADLRKLCNGATTIGETLTSPKTAEVQVQGPH 538
           I+TEMKIGRKVITRVSNFEVF +D E+LAADLRK+C+G+TTI E+ T  K AEVQVQGPH
Sbjct: 477 IITEMKIGRKVITRVSNFEVFQVDPESLAADLRKICSGSTTISESQTF-KCAEVQVQGPH 535

Query: 539 SQVIIKHLNSLSIPTKWIDF 558
            Q II HLN L IP+KWIDF
Sbjct: 536 GQSIIDHLNKLGIPSKWIDF 555

>NCAS0B03800 Chr2 (678984..680681) [1698 bp, 565 aa] {ON} Anc_8.269
           YDR117C
          Length = 565

 Score =  612 bits (1577), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 310/562 (55%), Positives = 404/562 (71%), Gaps = 12/562 (2%)

Query: 1   MFKKTPNVKASSNLKNSERKKLLQSCKEQRNSSDYNFPSSIIKQANYKGQTSAGTVYTDE 60
           MF+K P++KA SNLKNS+RKKL Q+   Q  +  Y  PS I+KQ N++  T+ GT+YTDE
Sbjct: 1   MFRKEPHIKALSNLKNSDRKKLAQTIHAQTGNDKYTCPS-IVKQTNFQTPTTIGTIYTDE 59

Query: 61  QNVPIWFKEKHSDMLFPSVYTCWKNPKLLPIIVTNSYVIEEKILNGANLMISGTLLPFDE 120
           +N+PIWFKEKH   L+ +VYTCW    LLPI +++ +VI+EK+ NGANLMISGT+ PFDE
Sbjct: 60  KNIPIWFKEKHDPRLYATVYTCWNCEDLLPICLSHDFVIQEKLFNGANLMISGTIPPFDE 119

Query: 121 RLICGALCGIASYKKPN-VVMAIGIVQLDLQSYTKVVGETGVAVNVLHYLGDGLSDSFKM 179
           +L  G LCG+AS + P  VV AIGIV +DL  + KVVGE+GVAV ++H+  D L  SFK+
Sbjct: 120 KLKVGTLCGVASCQDPGRVVYAIGIVMMDLPKFEKVVGESGVAVQIIHHFEDELFKSFKI 179

Query: 180 NLEPPETGAEVDETNEMLLNQDKQDVNNELT--NSNKDLAPDARPNDDLAEVLETLPVDI 237
           +L+PP    +    N+    +++++         + K+++  A   +DLAEVL+ L V  
Sbjct: 180 DLKPPVVDVQKGSVNDEEEEEEEKEQEKANEEDETTKEMS-TATNVEDLAEVLDHLSVQD 238

Query: 238 IDDFITKSLYYSLTNDPKLEFPISASNFISNYIMSNLPPVDNDMVNLKKSSWKKTAKFLR 297
           +D FIT++LYY++T D KL  PISASNFIS +I  NLP VD++ VN+KKSSWKKTAKFL+
Sbjct: 239 VDYFITRALYYTITTDTKLSLPISASNFISQHINKNLPDVDHNEVNIKKSSWKKTAKFLK 298

Query: 298 HFEKEGFIKLKGKNDDLVITGFNKEKTELKSFVPYRTXXXXXXXXXXXXXXXXXXXXXMM 357
           HFEKEGF+KLKGK DDL + G NK K ELK+FVPY+                      MM
Sbjct: 299 HFEKEGFLKLKGKGDDLTVVGMNKTKDELKNFVPYK--LGSSNGENKGAKKEGDSQSGMM 356

Query: 358 QSVSYYKPISLGKDLIRESVAPEKSLYTAHELRDFITEYINKKNLVDSKNKKMILMDDLM 417
            S+++YKPI+L KDLI+ES  P K+LY   E+RD +  YI  KNLVD+KNKKM+L+DDL+
Sbjct: 357 YSITFYKPINLAKDLIKESGMPMKNLYLPTEIRDGVNNYITLKNLVDNKNKKMVLLDDLL 416

Query: 418 YSLVYKKK-NSAEPRLISRADVIEPITKNNFNEHFQIYKKGDNETAVPLFKKPIRGSIPK 476
           + +V KK+ +    R ISRA ++EP  KNNF EHFQIY    +    PLFK P+RGS P+
Sbjct: 417 FGMVNKKRTDPTVSRSISRAQILEPTLKNNFTEHFQIY----DSQGTPLFKSPMRGSPPR 472

Query: 477 VEIVTEMKIGRKVITRVSNFEVFHIDAETLAADLRKLCNGATTIGETLTSPKTAEVQVQG 536
           ++I+TEMKIGRKVIT+VSNFE F I+ ETLAADLRK+C+G+TTIGET+TSPKTAEVQVQG
Sbjct: 473 IKILTEMKIGRKVITKVSNFEQFGINPETLAADLRKMCSGSTTIGETMTSPKTAEVQVQG 532

Query: 537 PHSQVIIKHLNSLSIPTKWIDF 558
           PH Q+II HLN L +PTKWID+
Sbjct: 533 PHGQIIIDHLNKLGVPTKWIDY 554

>Skud_4.377 Chr4 complement(655577..657265) [1689 bp, 562 aa] {ON}
           YDR117C (REAL)
          Length = 562

 Score =  608 bits (1568), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 301/562 (53%), Positives = 407/562 (72%), Gaps = 14/562 (2%)

Query: 1   MFKKTPNVKASSNLKNSERKKLLQSCKEQRNSSDYNFPSSIIKQANYKGQTSAGTVYTDE 60
           MFKK P++KA SNLKNSERKKLLQ+CK+Q N+ +Y FP+S IKQ N+  Q S G VYTDE
Sbjct: 1   MFKKEPHIKALSNLKNSERKKLLQTCKKQTNNDEYTFPTSTIKQTNFCSQKSVGVVYTDE 60

Query: 61  QNVPIWFKEKHSDMLFPSVYTCWKNPKLLPIIVTNSYVIEEKILNGANLMISGTLLPFDE 120
            N PI FKEKH++ LFP+VY+CW+NP LLPII+T+ +VIEE + NGANLMISG++ PFD 
Sbjct: 61  NNTPILFKEKHNEQLFPTVYSCWENPTLLPIILTHGFVIEEHLFNGANLMISGSIPPFDP 120

Query: 121 RLICGALCGIASYKKPNVVMAIGIVQLDLQSYTKVVGETGVAVNVLHYLGDGLSDSFKMN 180
           R   G LCG+AS + P VV+AIGIV++DL SY +V+GETGVAV V+H+  DGLS + K+ 
Sbjct: 121 RSKVGTLCGVASREAPKVVLAIGIVEMDLPSYDRVLGETGVAVKVIHHFNDGLSKALKVK 180

Query: 181 LEPP--ETGAEVDETNEMLLNQDKQDVNNELTNSNKDLAPDARPN-DDLAEVLETLPVDI 237
           L+PP  ++G E   + ++   ++ + V N   N  K     A+ + ++LAEVL+   V  
Sbjct: 181 LDPPIAKSGDEDINSKQVQPPEEAKIVENAQENMQK-----AQVHVEELAEVLDHFSVSD 235

Query: 238 IDDFITKSLYYSLTNDPKLEFPISASNFISNYIMSNLPPVDNDMVNLKKSSWKKTAKFLR 297
           +D FIT++LYY+LT D  L  PIS SNFISN+IM NLPP+D++ VN+KK+SW+K+AKFL+
Sbjct: 236 VDYFITRALYYTLTQDKSLVLPISPSNFISNHIMRNLPPIDHNEVNVKKTSWRKSAKFLK 295

Query: 298 HFEKEGFIKLKGKNDDLVITGFNKEKTELKSFVPYRTXXXXXXXXXXXXXXXXXXXXXMM 357
           HFEKEGF+KLKGK DDL I G   +K ELK+FVPY+                      MM
Sbjct: 296 HFEKEGFLKLKGKGDDLTIVGKTIDKDELKNFVPYKVGSSTSAQESGEHANSKEKTPGMM 355

Query: 358 QSVSYYKPISLGKDLIRESVAPEKSLYTAHELRDFITEYINKKNLVDSKNKKMILMDDLM 417
            S++ YKP S+ KD ++E+    ++ YT+ ++R  +++YI+  NL D+K+K  ++MDDL+
Sbjct: 356 YSMTLYKPFSIAKDFLKEANLGFRTYYTSQDIRSALSQYISTNNLADTKDKGKVVMDDLL 415

Query: 418 YSLV-YKKKNSAEPRLISRADVIEPITKNNFNEHFQIYKKGDNETAVPLFKKPIRGSIPK 476
           +++V  KKKN    R++ RA +++P+  NNF E +QI+K  D+     LFK PI+GS P+
Sbjct: 416 FNMVNKKKKNLNAARIMPRAQILDPLLANNFTEFYQIFKNDDSL----LFKAPIKGSPPR 471

Query: 477 VEIVTEMKIGRKVITRVSNFEVFHIDAETLAADLRKLCNGATTIGETLTSPKTAEVQVQG 536
           ++I TEMKIGRKVITRVSNFEVF ID E+LA DLRK+C+G+TTIGE+ T  K+AEVQVQG
Sbjct: 472 IKITTEMKIGRKVITRVSNFEVFQIDPESLAGDLRKICSGSTTIGESQTF-KSAEVQVQG 530

Query: 537 PHSQVIIKHLNSLSIPTKWIDF 558
           PH Q+II HLN+L +P KWIDF
Sbjct: 531 PHGQLIIDHLNNLGVPNKWIDF 552

>SAKL0H16874g Chr8 (1484425..1486116) [1692 bp, 563 aa] {ON} similar
           to uniprot|Q04600 Saccharomyces cerevisiae YDR117C RBF64
           Hypothetical ORF
          Length = 563

 Score =  600 bits (1547), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 304/565 (53%), Positives = 405/565 (71%), Gaps = 22/565 (3%)

Query: 1   MFKKTPNVKASSNLKNSERKKLLQSCKEQRNSSDYNFPSSIIKQANYKGQTSAGTVYTDE 60
           MFKK P++KA SNLKNSERKKLL S +EQR  SDY FP+ ++KQ  +KGQTSAGTVYTDE
Sbjct: 1   MFKKDPHIKALSNLKNSERKKLLASVREQREVSDYQFPTQVVKQTTFKGQTSAGTVYTDE 60

Query: 61  QNVPIWFKEKHSDMLFPSVYTCWKNPKLLPIIVTNSYVIEEKILNGANLMISGTLLPFDE 120
           QNVPIWFKEKH  ++FP+V+TCW NP +LP++ T+ +V+EEK+L GA+LM+ G + PF  
Sbjct: 61  QNVPIWFKEKHGSLMFPTVFTCWSNPDILPVVQTHKHVVEEKLLKGADLMLPGMVPPFSS 120

Query: 121 RLICGALCGIASYKKPNVVMAIGIVQLDLQSYTKVVGETGVAVNVLHYLGDGLSDSFKMN 180
           +   G+L G+AS + P V+ AIGIVQLDL SYT+V+GETGVAVN++H   DGL  +FKM 
Sbjct: 121 KCSKGSLVGVASTRSPRVIKAIGIVQLDLPSYTRVIGETGVAVNIIHTFDDGLCKAFKMK 180

Query: 181 LEPPETGAEVDETNEMLLNQDKQDVNNELTNSNKDLAPDARP----NDDLAEVLETLPVD 236
           LEPPE    +++T+     Q+++ V++   +  K +A   +      +D +E L  L  +
Sbjct: 181 LEPPEA---IEDTSSKTEEQEEEHVDS--ADEAKAIATTTQARMVNTEDASEQLNELSAE 235

Query: 237 IIDDFITKSLYYSLTNDPKLEFPISASNFISNYIMSNLPPVDNDMVNLKKSSWKKTAKFL 296
            ID F+T+SLYY+LT D +L+ P++ASNF+SN+I+ NLPPVD++ +N+KKSSWKK+AKFL
Sbjct: 236 DIDHFLTRSLYYTLTQDDRLQLPVNASNFVSNHILHNLPPVDHNQINMKKSSWKKSAKFL 295

Query: 297 RHFEKEGFIKLKGKNDDLVITGFNKEKTELKSFVPYRTXXXXXXXXXXXXXXXXXXXXXM 356
           +HFEK  F+KLKGK DDLV+ G NK+K ELK FVPYR                      M
Sbjct: 296 KHFEKANFLKLKGKGDDLVVVGINKDKDELKKFVPYRI---GSHGEPTQTKAKAQENSNM 352

Query: 357 MQSVSYYKPISLGKDLIRESVAPEKSLYTAHELRDFITEYINKKNLVDSKNKKMILMDDL 416
           MQ+VS YKPIS  K+  +    P   ++TA EL+  +  YI KKNLV+  +KKM+L+DD 
Sbjct: 353 MQAVSLYKPISSAKEFSKAVDLPPNKIFTAQELKAALDSYILKKNLVNKDDKKMVLLDDT 412

Query: 417 MYSLV---YKKKNSAEPRLISRADVIEPITKNNFNEHFQIYKKGDNETAVPLFKKPIRGS 473
           ++ ++    KK+N+   R ISRA ++ P   NNF EHFQI  KGD    VPLFK  ++G+
Sbjct: 413 LFPMINRSTKKENAL--RTISRAQIMPPFLANNFTEHFQIL-KGD----VPLFKTALKGA 465

Query: 474 IPKVEIVTEMKIGRKVITRVSNFEVFHIDAETLAADLRKLCNGATTIGETLTSPKTAEVQ 533
           IP+++IVTEMKIGRKV+T+VSNFE F +DAETLAA+LRK C+G+TTIGET++SPKT EV 
Sbjct: 466 IPEIQIVTEMKIGRKVVTKVSNFEKFQLDAETLAAELRKRCSGSTTIGETMSSPKTLEVT 525

Query: 534 VQGPHSQVIIKHLNSLSIPTKWIDF 558
           VQGPH  ++I  LN   IPTKWI+F
Sbjct: 526 VQGPHGAIVIGMLNEYGIPTKWINF 550

>Smik_4.361 Chr4 complement(645227..646924) [1698 bp, 565 aa] {ON}
           YDR117C (REAL)
          Length = 565

 Score =  600 bits (1547), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 309/569 (54%), Positives = 409/569 (71%), Gaps = 25/569 (4%)

Query: 1   MFKKTPNVKASSNLKNSERKKLLQSCKEQRNSSDYNFPSSIIKQANYKGQTSAGTVYTDE 60
           MFKK P++KA SNLKNSERKKLLQ+C +Q N+ +Y FP+SIIKQ N+ GQ S GTVYTDE
Sbjct: 1   MFKKEPHIKALSNLKNSERKKLLQTCIKQTNNEEYTFPTSIIKQTNFGGQKSVGTVYTDE 60

Query: 61  QNVPIWFKEKHSDMLFPSVYTCWKNPKLLPIIVTNSYVIEEKILNGANLMISGTLLPFDE 120
            N+PI FKEKH + L+P+VY+CWKNP LLPI++T+ +VIEE + NGANLMISG++ PFD 
Sbjct: 61  NNIPILFKEKHCEQLYPTVYSCWKNPSLLPIVLTHGFVIEEHLFNGANLMISGSIPPFDS 120

Query: 121 RLICGALCGIASYKKPNVVMAIGIVQLDLQSYTKVVGETGVAVNVLHYLGDGLSDSFKMN 180
           R   G LCG+A  + P VV+AIG+V+LDL SY +V+GETGVAV V+H+  DGL  +FK+ 
Sbjct: 121 RCNVGTLCGVAGKQSPKVVLAIGVVELDLPSYDRVIGETGVAVKVIHHFNDGLFKAFKVK 180

Query: 181 LEPP----------ETGAEVDETNEMLLNQDKQDVNNELTNSNKDLAPDARPNDDLAEVL 230
           LEPP             ++  ET E + + DK         S K  APD    +++AEVL
Sbjct: 181 LEPPVVLNTESEDENINSKQTETPEQVKSADKSQ------ESIKKTAPDL---EEVAEVL 231

Query: 231 ETLPVDIIDDFITKSLYYSLTNDPKLEFPISASNFISNYIMSNLPPVDNDMVNLKKSSWK 290
           + L V  +D FIT++LYYSLT D  L  PISAS FISN+IM NLPP+D++ VN+KKSSWK
Sbjct: 232 DHLTVSDVDYFITRALYYSLTQDKGLILPISASKFISNHIMRNLPPIDHNEVNVKKSSWK 291

Query: 291 KTAKFLRHFEKEGFIKLKGKNDDLVITGFNKEKTELKSFVPYRTXXXXXXXXXXXXXXXX 350
           K+AKFL+HFEKEG +KLKGK DDL I G N +K ELK+FVPY+                 
Sbjct: 292 KSAKFLKHFEKEGILKLKGKGDDLTIVGKNTDKDELKNFVPYKLGCSSPSKGSGENATSK 351

Query: 351 XXXXXMMQSVSYYKPISLGKDLIRESVAPEKSLYTAHELRDFITEYINKKNLVDSKNKKM 410
                MM S++ YKP SL KDL+RE+     + YT+ ++R+ ++EYI+ KNL D K+K+ 
Sbjct: 352 DRTSGMMHSLTLYKPFSLAKDLLREAKLGCDTYYTSQDVRNAVSEYISVKNLADKKDKRK 411

Query: 411 ILMDDLMYSLVYKKKNSAE-PRLISRADVIEPITKNNFNEHFQIYKKGDNETAVPLFKKP 469
           ++MDDL++++V KKK + +  R+I+R+++++P+  NNF E +QI++  D      LF+ P
Sbjct: 412 VVMDDLLFNMVNKKKKTPDTTRIIARSEILQPLLSNNFTEFYQIFRNDD----TLLFRVP 467

Query: 470 IRGSIPKVEIVTEMKIGRKVITRVSNFEVFHIDAETLAADLRKLCNGATTIGETLTSPKT 529
           ++G  P+++IVTEMKIGRKVIT+VSNFEVFHID E LAADLRK+C+G+TTIGE+ T  K+
Sbjct: 468 MKGCPPRIKIVTEMKIGRKVITKVSNFEVFHIDPELLAADLRKICSGSTTIGESQTF-KS 526

Query: 530 AEVQVQGPHSQVIIKHLNSLSIPTKWIDF 558
           AEVQVQGPH Q II +LN   IP+KWIDF
Sbjct: 527 AEVQVQGPHGQFIIDYLNKSGIPSKWIDF 555

>NDAI0J01310 Chr10 (306474..308213) [1740 bp, 579 aa] {ON} Anc_8.269
           YDR117C
          Length = 579

 Score =  587 bits (1512), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 306/574 (53%), Positives = 405/574 (70%), Gaps = 22/574 (3%)

Query: 1   MFKKTPNVKASSNLKNSERKKLLQSCKEQRNSSDYNFPSS-IIKQANYKGQT--SAGTVY 57
           MFKK P++KA SNLKNS+RKKLLQ+ K Q N   YNF +S IIKQ N++     S GT++
Sbjct: 1   MFKKEPHIKALSNLKNSDRKKLLQTIKTQTNLETYNFNNSNIIKQTNFQTTNPPSIGTIF 60

Query: 58  TDEQNVPIWFKEKHSDMLFPSVYTCWKNPKLLPIIVTNSYVIEEKILNGANLMISGTLLP 117
           T++ N+PIWFK KH+D+L+P+V+TCW N  +LP ++++ +VI+EK+ NGANLMISGT+ P
Sbjct: 61  TNDSNIPIWFKSKHNDLLYPTVFTCWNNHDILPTLLSHDFVIQEKLFNGANLMISGTIPP 120

Query: 118 FDERLICGALCGIASYKKP-NVVMAIGIVQLDLQSYTKVVGETGVAVNVLHYLGDGLSDS 176
           FD RLI G LCGIAS + P  +V AIG+V++++ S+ KVVGETGVAV V+H+  D L   
Sbjct: 121 FDSRLIPGTLCGIASVQDPKRIVWAIGVVKMNMPSFDKVVGETGVAVEVIHHFEDELFKI 180

Query: 177 FKMN-LEPPETGAEVDETNEMLLNQDKQDVNNELTNSNKDLAPDARPNDDLAEVLETLPV 235
           FK N L+P E   E   T      QD  DV +E T   K+   +   N+   EVL+    
Sbjct: 181 FKCNDLKPDEFVKEQLNTEHP---QD-NDVADEDTTRKKE--ENRESNEPDFEVLDHFKT 234

Query: 236 DIIDDFITKSLYYSLTNDPKLEFPISASNFISNYIMSNLPPVDNDMVNLKKSSWKKTAKF 295
           + +D FIT+SLYY++T D K+E PISASNFIS +I  NLP + ++ VN+KK+SWKKTAKF
Sbjct: 235 EDVDYFITRSLYYTITQDTKVELPISASNFISQHINKNLPDISHNEVNIKKTSWKKTAKF 294

Query: 296 LRHFEKEGFIKLKGKNDDLVITGFNKEKTELKSFVPYRTXXXXXXXXXXXX--XXXXXXX 353
           L+HFEKEGF+KLKGK DDL + G NK K ELK+FVPY+                      
Sbjct: 295 LKHFEKEGFLKLKGKGDDLTVVGMNKTKDELKNFVPYKIGKSTTPSFSLSSPNTNDKSDT 354

Query: 354 XXMMQSVSYYKPISLGKDLIRE-SVAPEKSLYTAHELRDFITEYINKKNLVDSKNKKMIL 412
             MM S ++YKPI+  KDL++     P K LYT  E+RD +T YIN KNL+D KNKKMIL
Sbjct: 355 KGMMYSETFYKPINHAKDLLKAVPTIPTKPLYTQQEIRDIVTSYINSKNLIDMKNKKMIL 414

Query: 413 MDDLMYSLVYKKKN--SAEPRLISRADVIEPITKNNFNEHFQIYKKGDN-----ETAVPL 465
           +DDL++++V+K+++  +A PR + R  ++EPI  NNF EH+QIY+K +      E   PL
Sbjct: 415 LDDLLFNMVHKRQSEANAAPRTMMRGTILEPILANNFTEHYQIYRKRNGKGELMEDVEPL 474

Query: 466 FKKPIRGSIPKVEIVTEMKIGRKVITRVSNFEVFHIDAETLAADLRKLCNGATTIGETLT 525
           FK P RG +P+++I+TEMKIGRKVIT+VSNFE+F I ++ LAADLRKLC+G+TTIGET+T
Sbjct: 475 FKSPQRGHLPQIDILTEMKIGRKVITKVSNFEIFGISSDFLAADLRKLCSGSTTIGETMT 534

Query: 526 SPKTAEVQVQGPHSQVIIKHLN-SLSIPTKWIDF 558
           SPKT EVQVQGPH Q+II HLN    +PTKWI++
Sbjct: 535 SPKTPEVQVQGPHGQIIIDHLNKKFGVPTKWINY 568

>KLTH0G13530g Chr7 (1161702..1163426) [1725 bp, 574 aa] {ON} similar
           to uniprot|Q04600 Saccharomyces cerevisiae YDR117C RBF64
           Hypothetical ORF
          Length = 574

 Score =  574 bits (1479), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 289/569 (50%), Positives = 386/569 (67%), Gaps = 17/569 (2%)

Query: 1   MFKKTPNVKASSNLKNSERKKLLQSCKEQRNSSDYNFPSSIIKQANYKGQTSAGTVYTDE 60
           MFKK P +KA SNLKNSERK +   CKEQ  SS+Y FPS +IKQ  +K   + GTV+TD+
Sbjct: 1   MFKKEPQIKALSNLKNSERKNIQSQCKEQTGSSEYAFPSQVIKQTTFKTPFTTGTVFTDQ 60

Query: 61  QNVPIWFKEKHSDMLFPSVYTCWKNPKLLPIIVTNSYVIEEKILNGANLMISGTLLPFDE 120
           +NVPIWFKEK SD+L+P+V+TCW N KLLPI++ + YV+EEK+L GANLM+ GT+ PFDE
Sbjct: 61  KNVPIWFKEKFSDLLYPTVFTCWSNSKLLPIVLAHEYVVEEKLLKGANLMLPGTVPPFDE 120

Query: 121 RLICGALCGIASYKKPNVVMAIGIVQLDLQSYTKVVGETGVAVNVLHYLGDGLSDSFKMN 180
           R +   +  +AS   P+VV AIGIVQ++L  Y++V+GE+GVAV ++H  GD L   FK+ 
Sbjct: 121 RCVKTRMVSVASTAAPDVVKAIGIVQINLPQYSRVIGESGVAVEIVHTFGDELCKVFKVK 180

Query: 181 LEPPETGAEV--DETNEMLLNQDKQDVNN--ELTNSNKDLAPDARP---NDDLAEVLETL 233
           L+PPE  A +   E+ E    +D   V +  E   + K L     P    +D++E L  L
Sbjct: 181 LQPPEGSAAILDSESEEEADIEDDTGVPSAPESLAAPKSLQDVQEPLVNVEDISEQLTEL 240

Query: 234 PVDIIDDFITKSLYYSLTNDPKLEFPISASNFISNYIMSNLPPVDNDMVNLKKSSWKKTA 293
            V+ +D F T+SLYYSL +D KLE PISASNF+SN+I+ NLPP+D+  VN+KK+SWKKTA
Sbjct: 241 RVEDVDHFFTRSLYYSLAHDAKLETPISASNFVSNHILRNLPPIDHTQVNMKKTSWKKTA 300

Query: 294 KFLRHFEKEGFIKLKGKNDDLVITGFNKEKTELKSFVPYRTXXXXXXXXXXXXXXX-XXX 352
           KFL++FEKEGF+KLKGK DDL I G ++ K+ELK+F PYR                    
Sbjct: 301 KFLKYFEKEGFLKLKGKGDDLTIIGVDRTKSELKNFAPYRIGGGASSSEKGASSVANEKE 360

Query: 353 XXXMMQSVSYYKPISLGKDLIRESVAPEKSLYTAHELRDFITEYINKKNLVDSKNKKMIL 412
              +M++VS Y+PIS  K  +  +  P   ++T  +++  + +YI+ KNLV   NK  + 
Sbjct: 361 QASVMKAVSLYRPISSTKAFLSATDLPPNQMFTQQDIKSAVDKYISAKNLVSPDNKSAVR 420

Query: 413 MDDLMYSLV---YKKKNSAEPRLISRADVIEPITKNNFNEHFQIYKKGDNETAVPLFKKP 469
           +DDL+Y LV    KK+N+   R I+RA ++ P+ K NF+EHF I K        PLFK P
Sbjct: 421 LDDLLYDLVNRSSKKENAV--RTIARAQIMAPVLKGNFSEHFLILKAD----GTPLFKHP 474

Query: 470 IRGSIPKVEIVTEMKIGRKVITRVSNFEVFHIDAETLAADLRKLCNGATTIGETLTSPKT 529
           ++GSIP+V+IVTEMKIGRKV+T+VSNFE F +DA+ LA  LRK C+G+TTIGE  TSPKT
Sbjct: 475 VKGSIPQVQIVTEMKIGRKVVTKVSNFEKFQVDADELAEALRKKCSGSTTIGEANTSPKT 534

Query: 530 AEVQVQGPHSQVIIKHLNSLSIPTKWIDF 558
            EV VQGPH   +I+ LN   IPTKWI+F
Sbjct: 535 LEVTVQGPHGPAVIELLNESGIPTKWINF 563

>Kwal_56.23771 s56 (698257..699945) [1689 bp, 562 aa] {ON} YDR117C -
           Hypothetical ORF [contig 173] FULL
          Length = 562

 Score =  573 bits (1477), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 291/564 (51%), Positives = 383/564 (67%), Gaps = 19/564 (3%)

Query: 1   MFKKTPNVKASSNLKNSERKKLLQSCKEQRNSSDYNFPSSIIKQANYKGQTSAGTVYTDE 60
           MFKK P +KA SNLKNSERKKL   C+EQ   SDY+FPS +IKQ  +K   + GTVYTD+
Sbjct: 1   MFKKEPQIKALSNLKNSERKKLQSQCREQVQPSDYSFPSQVIKQTTFKTPFTTGTVYTDD 60

Query: 61  QNVPIWFKEKHSDMLFPSVYTCWKNPKLLPIIVTNSYVIEEKILNGANLMISGTLLPFDE 120
           +N+PIWFKEK SD+L+P+V++CW N  L+PI++ + YV+EEK+L GANLM+ GT+ PFDE
Sbjct: 61  KNIPIWFKEKFSDLLYPTVFSCWSNKDLVPIVLAHEYVVEEKLLKGANLMLPGTVPPFDE 120

Query: 121 RLICGALCGIASYKKPNVVMAIGIVQLDLQSYTKVVGETGVAVNVLHYLGDGLSDSFKMN 180
           R +   + G+AS   P+VV AIGIVQL+L  Y++V+GE+GVAV ++H   D L  +FK+ 
Sbjct: 121 RCVKTKMVGVASTHSPDVVKAIGIVQLNLPQYSRVIGESGVAVEIVHTFDDELCKAFKVK 180

Query: 181 LEPPETGAEVDETNEMLLNQDKQDVNNELTNSNKDLAPDARP---NDDLAEVLETLPVDI 237
           L+PPE GA+    ++   N D + V+  +    K  AP   P    DD AE L  L V+ 
Sbjct: 181 LQPPE-GADGIAESDSEENSDAE-VSGAIKIEPKPSAPLQEPIVNIDDAAEQLSQLSVED 238

Query: 238 IDDFITKSLYYSLTNDPKLEFPISASNFISNYIMSNLPPVDNDMVNLKKSSWKKTAKFLR 297
           +D F T++LYY+LT D KLE P SASNF+SN+I+ NLPP+D+  VN+KK+SWKKTAKFL+
Sbjct: 239 VDHFFTRALYYTLTQDSKLEVPCSASNFVSNHILRNLPPLDHTQVNMKKTSWKKTAKFLK 298

Query: 298 HFEKEGFIKLKGKNDDLVITGFNKEKTELKSFVPYRTXXXXXXXXXXXXXXXXXXXXXMM 357
           HFEKEGF+KLKGK DDL I G +K K ELK FVPYRT                     MM
Sbjct: 299 HFEKEGFLKLKGKGDDLTIVGLDKTKDELKHFVPYRT-----GGNSGGSTGSESEQNSMM 353

Query: 358 QSVSYYKPISLGKDLIRESVAPEKSLYTAHELRDFITEYINKKNLVDSKNKKMILMDDLM 417
           +++  YKP+S  K  +  +     S+++  EL+  +  YI  K LV   NK  + +DDL+
Sbjct: 354 KALVIYKPMSSAKPFLCATDLSPNSMFSPQELKGAVDAYIASKGLVSQDNKAAVRLDDLL 413

Query: 418 YSLV---YKKKNSAEPRLISRADVIEPITKNNFNEHFQIYKKGDNETAVPLFKKPIRGSI 474
           +SLV    KK+N+   R I RA ++ PI K NF EHF + K        PLFK P++G I
Sbjct: 414 FSLVNRSTKKENAV--RTILRAQIMPPILKGNFAEHFLVLKPD----GTPLFKHPVKGDI 467

Query: 475 PKVEIVTEMKIGRKVITRVSNFEVFHIDAETLAADLRKLCNGATTIGETLTSPKTAEVQV 534
           P+++IVTEMKIGRKV+T+VSNFE F +DA+ LA  LRK C+G+TTIGET TSPKT EV V
Sbjct: 468 PQIQIVTEMKIGRKVVTKVSNFEKFQVDADELAEALRKKCSGSTTIGETTTSPKTTEVTV 527

Query: 535 QGPHSQVIIKHLNSLSIPTKWIDF 558
           QGPH   +I+ LN L+IPTKWI+F
Sbjct: 528 QGPHGPAVIELLNQLAIPTKWINF 551

>CAGL0B01837g Chr2 complement(166953..168662) [1710 bp, 569 aa] {ON}
           similar to uniprot|Q04600 Saccharomyces cerevisiae
           YDR117c
          Length = 569

 Score =  559 bits (1441), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 292/566 (51%), Positives = 400/566 (70%), Gaps = 16/566 (2%)

Query: 1   MFKKTPNVKASSNLKNSERKKLLQSCKEQRNSSDYNFPSSIIKQANYKGQTSAGTVYTDE 60
           MFKK P++KA SNLKNSERKKL + C+ Q ++ +Y+F S+ IKQ N+KG T+ GT+YTDE
Sbjct: 1   MFKKEPHIKALSNLKNSERKKLQEKCRIQTSNEEYSFGSNTIKQTNFKGITTIGTIYTDE 60

Query: 61  QNVPIWFKEKHSDMLFPSVYTCWKNPKLLPIIVTNSYVIEEKILNGANLMISGTLLPFDE 120
            N PIWFKEKH + L+P+V  CW+ P L+P+++T+S V+E+ I NGANLMISGT+ PFDE
Sbjct: 61  GNAPIWFKEKHDEKLYPTVLACWRCPNLIPVVLTHSIVLEDHIFNGANLMISGTIPPFDE 120

Query: 121 RLICGALCGIASYKKPNVVMAIGIVQLDLQSYTKVVGETGVAVNVLHYLGDGLSDSFKMN 180
           RL  G +CGIA  + PN+++A+GIVQ++L S+T+V+GETGVAV ++H+L D L   FK+ 
Sbjct: 121 RLTVGTVCGIADKRTPNLIVAVGIVQMNLPSFTRVIGETGVAVQIVHHLEDELFKVFKVK 180

Query: 181 LEPPETGAEVDETN--EMLLNQDKQDVNNELT--NSNKDLAPDARPNDDLAEVLETLPVD 236
            EPP   AE+ +T        + + D++ + T   SN D   +    DD+AEVL+ L ++
Sbjct: 181 EEPP---AELLQTQSSSSEELELEADIHEDETKVESNSDTEKEKSNLDDMAEVLDELRLE 237

Query: 237 IIDDFITKSLYYSLTNDPKLEFPISASNFISNYIMSNLPPVDN-DMVNLKKSSWKKTAKF 295
            ID FIT++LYY+++ D KLE P SASNF+SN+I  NLP   N   VN+KKSSWKKTAKF
Sbjct: 238 DIDYFITRALYYTISQDTKLETPTSASNFVSNHINHNLPKGTNLAEVNIKKSSWKKTAKF 297

Query: 296 LRHFEKEGFIKLKGKNDDLVITGFNKEKTELKSFVPYRTXXXXXXXXXXXXXXXXXXXXX 355
           L+HFEKEGF+KLKG  DDL I   NK+K E+K F+PY                       
Sbjct: 298 LKHFEKEGFLKLKGVGDDLTIVEVNKDKDEIKQFLPYPVIGNQGSNTGSEGGNAKTT--- 354

Query: 356 MMQSVSYYKPISLGKDLIRESVAPEKSLYTAHELRDFITEYINKKNLVDSKNKKMILMDD 415
            ++ V+ YKPI+L KD I  +  P K LY   E+++ I +YI  K+LVD K+KK +L+DD
Sbjct: 355 -IKIVTLYKPINLAKDFISSNKVPLKQLYMEPEIKELINKYITMKDLVDKKDKKCVLVDD 413

Query: 416 LMYSLVYKKK--NSAEPRLISRADVIEPITKNNFNEHFQIYKKGDNETAVPLFKKPIRGS 473
           ++ +++YKKK   + + R+I RA++++P+ +NNFN+++ +++   NE   PL K P++G 
Sbjct: 414 MLMTMIYKKKEDQATKSRVIPRANILQPVLQNNFNKNYHLFRITGNE-QTPLTKTPLKGE 472

Query: 474 IPKVEIVTEMKIGRKVITRVSNFEVFHIDAETLAADLRKLCNGATTIGETLTSP-KTAEV 532
            PK+ IVTEMKIGRKVIT+VSNFEVF ID E  AAD+RK C+G+TTIGET +S  KTAEV
Sbjct: 473 PPKINIVTEMKIGRKVITKVSNFEVFQIDPEEFAADIRKKCSGSTTIGETTSSAKKTAEV 532

Query: 533 QVQGPHSQVIIKHLNSLSIPTKWIDF 558
           QVQGPH Q+I+ +LN L IP KWIDF
Sbjct: 533 QVQGPHGQLIMSYLNDLGIPNKWIDF 558

>KAFR0B05470 Chr2 (1120794..1122482) [1689 bp, 562 aa] {ON}
           Anc_8.269 YDR117C
          Length = 562

 Score =  538 bits (1386), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 282/569 (49%), Positives = 383/569 (67%), Gaps = 29/569 (5%)

Query: 1   MFKKTPNVKASSNLKNSERKKLLQSCKEQ-RNSSDYNFPSSIIKQANYKGQTSAGTVYTD 59
           MFKK P +KA S LKNS+RKKL+QS K Q ++  D +     I Q N+   T+AGT+YTD
Sbjct: 1   MFKKEPRIKALSKLKNSDRKKLVQSLKAQLKSDEDISVAGDSIMQTNFISTTAAGTIYTD 60

Query: 60  EQNVPIWFKEKHSDMLFPSVYTCWKNPKLLPIIVTNSYVIEEKILNGANLMISGTLLPFD 119
             ++PI FK KHSD L+P+ +  W N  LL  + T+S V+E  I NGA+LMI+GT+ PFD
Sbjct: 61  SNSIPIMFKTKHSDTLYPTSFLLWSNNGLLSTVRTHSVVVENYIFNGADLMIAGTVPPFD 120

Query: 120 ERLICGALCGIASYKKPNVVMAIGIVQLDLQSYTKVVGETGVAVNVLHYLGDGLSDSFKM 179
             L  G +C +A+ + P+V +A+GIV+L+L  Y +V+G+TGVAV +LH+  D L  +FK 
Sbjct: 121 STLTIGTICAVATKEAPDVAIAVGIVKLNLPEYQQVLGKTGVAVEILHHFEDALFSTFKA 180

Query: 180 NLEPP---------ETGAEVDETNEMLLNQDKQDVNNELTNSNKDLAPDARPNDDLAEVL 230
            LE P         ET A+V + ++    Q+ Q V    + S     P     DD+AEVL
Sbjct: 181 KLEIPASVKSILQEETTADVAKESDA--EQESQSVTEPPSGSE---GP-----DDIAEVL 230

Query: 231 ETLPVDIIDDFITKSLYYSLTNDPKLEFPISASNFISNYIMSNLPPVDNDMVNLKKSSWK 290
           + L V+ +D FI ++LY+++  D  L  P+ AS F+SN+IM NLP VD+  VN+K++SWK
Sbjct: 231 DELTVEDVDYFIRRALYFTMVQDNTLTLPVVASAFMSNHIMRNLPDVDHKKVNIKRTSWK 290

Query: 291 KTAKFLRHFEKEGFIKLKGKNDDLVITGFNKEKTELKSFVPYRTXXXXXXXXXXXXXXXX 350
           KTAKFL++FEKEGF+KLKGK DDL+I G NK+K ELK+FVPY+                 
Sbjct: 291 KTAKFLKYFEKEGFLKLKGKGDDLIIVGMNKDKDELKNFVPYKIGNTAKKAASKSDSTQT 350

Query: 351 XXXXXMMQSVSYYKPISLGKDLIRESVAPEKSLYTAHELRDFITEYINKKNLVDSKNKKM 410
                 + SV+ YKPI+LG+  I+ES      +YT+ E+R+ I +YI KKNLVD K+KKM
Sbjct: 351 QGVS--VSSVNLYKPINLGQKFIKESNISGGPMYTSLEIRNCINDYIIKKNLVDEKDKKM 408

Query: 411 ILMDDLMYSLVYKK-KNSAEPRLISRADVIEPITKNNFNEHFQIYKKGDNETAVPLFKKP 469
           +++DDL++++V +K +N   PR+I RA+++EP+  NNFNE+FQ+Y KGDN    PLFK P
Sbjct: 409 VMLDDLLFAMVNRKIQNPIFPRIIPRANILEPLIANNFNEYFQLY-KGDN---TPLFKNP 464

Query: 470 IRGSIPKVEIVTEMKIGRKVITRVSNFEVFHIDAETLAADLRKLCNGATTIGETLTSPKT 529
           I+G  PK++IVTEMKIGRKV+TRVSNFE F I  E LAADLRKLC+G+TTI E  T  K 
Sbjct: 465 IKGQTPKIDIVTEMKIGRKVVTRVSNFENFRISPEELAADLRKLCSGSTTISE--TPKKV 522

Query: 530 AEVQVQGPHSQVIIKHLNSLSIPTKWIDF 558
           +EVQVQGPH Q+II H N   IP+K+I F
Sbjct: 523 SEVQVQGPHGQLIIDHFNKSGIPSKFIQF 551

>TBLA0I03200 Chr9 complement(769960..771651) [1692 bp, 563 aa] {ON}
           Anc_8.269 YDR117C
          Length = 563

 Score =  471 bits (1212), Expect = e-160,   Method: Compositional matrix adjust.
 Identities = 250/566 (44%), Positives = 357/566 (63%), Gaps = 22/566 (3%)

Query: 1   MFKKTPNVKASSNLKNSERKKLLQSCKEQRNSSDYNFPSSIIKQANYKGQTSAGTVYTDE 60
           MFKK   +   SNLKNSE + + Q+C++  ++++Y FP S +KQ  ++   + G +YTD 
Sbjct: 1   MFKKNLTITTLSNLKNSESRNIRQTCRDALSNNEYEFPGSQVKQTTFESTVANGVIYTDS 60

Query: 61  QNVPIWFKEKHSDMLFPSVYTCWKNPKLLPIIVTNSYVIEEKILNGANLMISGTLLPFDE 120
            NVPIWFK+K+S+ + P+VYT W+ P  +PII T+ ++IE KI NGANLMI GT+ P DE
Sbjct: 61  NNVPIWFKQKYSNTIVPTVYTAWEYPNNIPIIRTHDFIIETKIFNGANLMIPGTVGPHDE 120

Query: 121 RLICGALCGIASYKKPNVVMAIGIVQLDLQSYTKVVGETGVAVNVLHYLGDGLSDSFKMN 180
           RL  G +CGIAS K P  ++AIG+   D+ +    +G+TGVAV VLH+  D L++ FK+ 
Sbjct: 121 RLKPGKICGIASTKVPGTILAIGLCTFDMSTVDTPLGKTGVAVEVLHWYSDELTNIFKIK 180

Query: 181 LEPPETGAEVDETN-EMLLNQDKQDVNNELTNSNKDLAPDARPN-------DDLAEVLET 232
           L PP     ++ +N + L +  ++ +  E++ +  ++ PDA  N       DDLAE LE 
Sbjct: 181 LNPPTI---MNTSNLKTLESMTQESMTQEISEAESEVKPDAPFNDTFTSNADDLAETLEQ 237

Query: 233 LPVDIIDDFITKSLYYSLTNDPKLEFPISASNFISNYIMSNLPPVDNDMVNLKKSSWKKT 292
           L V+ ID+F+T+SLYY++T +  L+ PI +S F+S Y+M NLP VD++ VN+KKSSWKKT
Sbjct: 238 LRVEDIDNFLTQSLYYTITQETSLQLPIISSTFVSGYLMKNLPNVDHNQVNIKKSSWKKT 297

Query: 293 AKFLRHFEKEGFIKLKGKNDDLVITGFNKEKTELKSFVPYRTXXXXXXXXXXXXXXXXXX 352
           AKFL+HFEKEGF+KLKGK DDL ITGFNKEK +LK+FVPYR                   
Sbjct: 298 AKFLKHFEKEGFLKLKGKGDDLTITGFNKEKPQLKTFVPYR----IGKPAGALPSKDKQD 353

Query: 353 XXXMMQSVSYYKPISLGKDLIRESVAPEKSLYTAHELRDFITEYINKKNLVDSKNKKMIL 412
               ++ V+ Y P               KS +T+ E+   I  YI KKNL + K+K  I 
Sbjct: 354 NKNFLKVVTLYSPKKKNDSCWTALGLTSKSYFTSAEITSAIQGYIAKKNLANPKDKAKIS 413

Query: 413 MDDLMYSLVYKKKNSAEPRLISRADVIEPITKNNFNEHFQIYKKGDNETAVPLFKKPIRG 472
           MDD+++ LV     +   R I R+ V+EP+  NNF  + Q++   DN   + L K P +G
Sbjct: 414 MDDVLFDLVITNNKANANRNIMRSQVVEPVLVNNFLLYHQLFTH-DN---ISLSKHPKKG 469

Query: 473 SIPKVEIVTEMKIGRKVITRVSNFEVFHIDAETLAADLRKLCNGATTIGETLTSPKTAEV 532
           S P V++VTE     KVITRVSNFEVF+IDA+ ++ +L+ LC+G+T+I E    P  +EV
Sbjct: 470 SPPTVKMVTEKVKRGKVITRVSNFEVFNIDAKDMSNELKVLCSGSTSIEEL---PNGSEV 526

Query: 533 QVQGPHSQVIIKHLNSLSIPTKWIDF 558
           QVQGPH  +++++     IP KW D+
Sbjct: 527 QVQGPHGDIVMEYFEKHGIPRKWFDY 552

>Ecym_4301 Chr4 (644340..646034) [1695 bp, 564 aa] {ON} similar to
           Ashbya gossypii AGR079W
          Length = 564

 Score =  463 bits (1192), Expect = e-157,   Method: Compositional matrix adjust.
 Identities = 239/573 (41%), Positives = 360/573 (62%), Gaps = 33/573 (5%)

Query: 1   MFKKTPNVKASSNLKNSERKKLLQSCKEQRNSSDYNFPSSIIKQANYKGQTSAGTVYTDE 60
           MFKK P +K++SNLKNSERKKLL + + Q  + ++ F ++I+KQA +K  T+ GT++TDE
Sbjct: 1   MFKKKPTIKSASNLKNSERKKLLGNVRAQCANQEFQFSTTIVKQATFKTPTATGTIFTDE 60

Query: 61  QNVPIWFKEKHSDMLFPSVYTCWKNPKLLPIIVTNSYVIEEKILNGANLMISGTLLPFDE 120
            N PI+FKEKHS+ L P++ TCW+ P LL +++T+ +V++ K+ NGA+LM+ GT+ PF +
Sbjct: 61  DNKPIFFKEKHSEFLIPTILTCWQYPGLLHVVLTHKHVLDNKLKNGADLMLPGTIPPFSD 120

Query: 121 RLICGALCGIASYKKPNVVMAIGIVQLDLQSYTKVVGETGVAVNVLHYLGDGLSDSFKMN 180
               G L G+AS + P VV AIG+ QL+L    KVVGETGVAV VLH + DGL + FKM+
Sbjct: 121 NCTRGKLVGVASSETPFVVEAIGVCQLNLAGIVKVVGETGVAVKVLHTINDGLWEVFKMS 180

Query: 181 LEPP-------------ETGAEVDETNEMLLNQDKQDVNNELTNSNKDLAPDARPN--DD 225
           +EPP             E  A+ D+   +   Q+ +D+    T S     P   PN   +
Sbjct: 181 VEPPSQLLVSQKHEVELEALAQADDAGGI---QEDEDLPTAKTAS----GPLEEPNSLSE 233

Query: 226 LAEVLETLPVDIIDDFITKSLYYSLTNDPKLEFPISASNFISNYIMSNLPPVDNDMVNLK 285
           +AE LE L ++ +D F+T+++YY+L  D  L+ PI ASNFI+N++M NLP +    V+LK
Sbjct: 234 VAEQLEELSIETVDHFLTQAVYYTLALDNTLKLPIGASNFIANHVMKNLPRIHKTQVSLK 293

Query: 286 KSSWKKTAKFLRHFEKEGFIKLKGKNDDLVITGFNKEKTELKSFVPYRTXXXXXXXXXXX 345
           +SSW + +KFL++FE +GF+KLKGK ++L +   NK+KTE+KSF PYRT           
Sbjct: 294 RSSWARASKFLKYFENQGFLKLKGKVENLTVVSVNKDKTEIKSFQPYRTIQKSVSTSSKN 353

Query: 346 XXXXXXXXXXMMQSVSYYKPISLGKDLIRESVAPEKSLYTAHELRDFITEYINKKNLVDS 405
                      ++ V YY+P++  K  +        ++  A +++  + +Y+ +K LV++
Sbjct: 354 NDKHD------VEVVVYYQPLNTAKATLHALGNNPNAMLKAKDIKAILNKYVTEKKLVNA 407

Query: 406 KNKKMILMDDLMYSLVYKKKNSAEPRLISRADVIEPITKNNFNEHFQIYKKGDNETAVPL 465
            ++++IL+DD ++SL YKK  S   R + RA + + I   +F E F I+K G      PL
Sbjct: 408 TDERIILLDDTLFSLAYKKSASDSTRKVLRAKMFDLILSTSFTEVFFIFKDGK-----PL 462

Query: 466 FKKPIRGSIPKVEIVTEMKIGRKVITRVSNFEVFHIDAETLAADLRKLCNGATTIGETLT 525
             KP++     V ++TEMKI RK++TR+SNFE++ +D E L+ +LRK C+G++T+ E  T
Sbjct: 463 SSKPLKSKNRNVSVMTEMKIHRKIVTRISNFEIYGVDPEELSLELRKRCSGSSTVLEPST 522

Query: 526 SPKTAEVQVQGPHSQVIIKHLNSLSIPTKWIDF 558
              T EVQVQGPH    I  LN   IP+K+IDF
Sbjct: 523 LQSTTEVQVQGPHGNTAINILNEHGIPSKYIDF 555

>KNAG0H03200 Chr8 (599611..601296) [1686 bp, 561 aa] {ON} Anc_8.269
           YDR117C
          Length = 561

 Score =  446 bits (1147), Expect = e-150,   Method: Compositional matrix adjust.
 Identities = 250/571 (43%), Positives = 362/571 (63%), Gaps = 34/571 (5%)

Query: 1   MFKKTPNVKASSNLKNSERKKLLQSCKEQRNSSDYNFPSSIIKQANYKGQTSAGTVYTDE 60
           MFKKTP++K  SNLKNSE++KL Q  ++Q    ++ F  + +KQ N++  TS GT+Y ++
Sbjct: 1   MFKKTPHIKPLSNLKNSEQRKLQQEVQKQFGVDEFVFSGNTVKQTNFQSTTSVGTIYLND 60

Query: 61  QN--VPIWFKEKH-SDMLFPSVYTCWKNPKLLPIIVTNSYVIEEKILNGANLMISGTLLP 117
           +   VP++FKEKH S  L+PSVY CW +P LLPII+T+S VIE+ + NGANLMISGT+ P
Sbjct: 61  EKIPVPLFFKEKHGSGPLWPSVYACWSHPGLLPIILTHSVVIEDHLFNGANLMISGTMPP 120

Query: 118 FD-ERLICGALCGIASYKKPNVVMAIGIVQLDLQSY--TKVVGETGVAVNVLHYLGDGLS 174
           FD   L  G  CGIA+YK P+V++A+G +++DL+ +  T VVG +GV V V H+  DGL+
Sbjct: 121 FDVAHLHKGRPCGIANYKSPDVIIAVGTLKMDLEPFNTTGVVGHSGVVVEVAHHFADGLA 180

Query: 175 DSFKMNLEPPETGAEVDETNEMLLNQDKQDVNNELTNSNKDLAPDARPN--DDLAEVLET 232
           D+F++ L+ P+           L +   Q+V  E     K  +P   P   DDLAEVLET
Sbjct: 181 DAFRLKLDIPDK----------LESATTQEVAEEPPVEAKPTSPVTNPVAVDDLAEVLET 230

Query: 233 LPVDIIDDFITKSLYYSLTNDPKLEFPISASNFISNYIMSNLPP-VDNDMVNLKKSSWKK 291
           L V+ +D F+T++LYY+LT +PKL  PI+ASNF+S ++M  LP  +D   VN+KKSSWKK
Sbjct: 231 LSVEDVDYFMTRALYYTLTQEPKLALPINASNFMSMHLMKCLPKGIDATEVNVKKSSWKK 290

Query: 292 TAKFLRHFEKEGFIKLKGKNDDLVITGFNKEKTE--LKSFVPYRTXXXXXXXXXXXXXXX 349
           TAK+L+HFEKEG +KLKGK DDLV+ G    KT   LK FVPY                 
Sbjct: 291 TAKYLKHFEKEGLLKLKGKGDDLVVVGSTDSKTHAGLKDFVPY----LVGNSIAESGPKS 346

Query: 350 XXXXXXMMQSVSYYKPISLGKDLIRESVAPEKSLYTAHELRDFITEYINKKNLVDSKNKK 409
                 +M +V+ ++P S  +  +       +  ++  E+R+ + EYI    L    N K
Sbjct: 347 QTTNGPVMFAVTSFQPDSTAQTALPLG---GQRYFSGPEIREVLNEYITANKLAQPNNPK 403

Query: 410 MILMDDLMYSLVYK--KKNSAEPRLISRADVIEPITKNNFNEHFQIYKKGDNETAVPLFK 467
           M+L++D ++ +V K  ++     R+++R +++E + K +F   +Q++K  D     PL K
Sbjct: 404 MVLLNDTLFGMVTKGNEEKQTTKRIMARPEILERVMKYHFKTLYQLFKDKDT----PLTK 459

Query: 468 KPIRGSIPKVEIVTEMKIGRKVITRVSNFEVFHIDAETLAADLRKLCNGATTIGETLTSP 527
            P +G  PKV I+TEMKIGRKV+TRV NF+  +I     AADLRKLC+ +TTIG+T+++P
Sbjct: 460 HPQKGEPPKVHIITEMKIGRKVVTRVYNFDHLNIRDTEFAADLRKLCSASTTIGKTVSTP 519

Query: 528 KTAEVQVQGPHSQVIIKHLNSLSIPTKWIDF 558
             +E+QVQG H  +II HL  L +P+ W+ F
Sbjct: 520 VVSEIQVQGAHGPLIIDHLRELGVPSSWVVF 550

>KLLA0F19294g Chr6 complement(1784664..1786376) [1713 bp, 570 aa]
           {ON} similar to uniprot|Q04600 Saccharomyces cerevisiae
           YDR117C RBF64 Hypothetical ORF
          Length = 570

 Score =  442 bits (1136), Expect = e-149,   Method: Compositional matrix adjust.
 Identities = 242/564 (42%), Positives = 341/564 (60%), Gaps = 12/564 (2%)

Query: 1   MFKKTPNVKASSNLKNSERKKLLQSCKEQRNSSDYNFPSSIIKQANYKGQTSAGTVYTDE 60
           MF K P++K  SNLKNS+RKKL  + K Q N  +YN P+++IKQ +++    AG++YTDE
Sbjct: 1   MFAKEPHIKPLSNLKNSDRKKLQSTIKRQINE-EYNLPTAVIKQTSFQVANVAGSIYTDE 59

Query: 61  QNVPIWFKEKHSDMLFPSVYTCWK-NPKLLPIIVTNSYVIEEKILNGANLMISGTLLPFD 119
            N PIWFK K  D L+P++++ W    +LLPII+T+ +VIE+ IL GA LM+ GT+ PF 
Sbjct: 60  SNKPIWFKTKFEDQLYPTIFSLWNLQMQLLPIILTHDFVIEKHILGGAQLMLPGTVPPFP 119

Query: 120 ERLICGALCGIASYKKPNVVMAIGIVQLDLQSYTKVVGETGVAVNVLHYLGDGLSDSFKM 179
             +  G++ GIAS K P +V AIGI ++DL   + V+G  G+AV V+HYL DGL  +FK+
Sbjct: 120 SNVKRGSIVGIASTKDPLLVKAIGIAEMDLCGISHVIGTKGIAVRVVHYLDDGLFKAFKL 179

Query: 180 NLEPPET--GAEVDETNEMLLNQDKQDVNNELTNSNKDLAPDARPNDDLAEVLETLPVDI 237
            LEPP     +E  ET  +     K     +  +++ + +    P +++A+ LE + ++ 
Sbjct: 180 ELEPPAVVYNSEPIETTAIETQTSKYGEQLDEESNHLERSSSQSPVNEIADELEEMSIED 239

Query: 238 IDDFITKSLYYSLTNDPKLEFPISASNFISNYIMSNLPPVDNDMVNLKKSSWKKTAKFLR 297
           +D  + +++ YS+  D K+  PI AS FISN++M NLP VD +MVN+KKSSWKK  K L+
Sbjct: 240 VDHMLMRAVKYSIKFDDKITLPIVASTFISNHVMKNLPDVDTNMVNIKKSSWKKATKLLK 299

Query: 298 HFEKEGFIKLKGKNDDLVITGFNKEKTELKSFVPYRTXXXXXXXXXXXXXXXXXXXXXMM 357
           + E EGF+KLKGKND   +   NK   +L +   Y+T                       
Sbjct: 300 YLEDEGFLKLKGKNDSCTVISLNKNHKDLTNMEAYKTLATIAKKSSGDTTNQSNKNKITA 359

Query: 358 QSV-SYYKPISLGKDLIRESVAP-EKSLYTAHELRDFITEYINKKNLVDSKNKKMILMDD 415
            S  + YKP+S  +  I    A   +S YT  EL+  +  Y+   NL+D +NK ++  DD
Sbjct: 360 YSGENLYKPMSACQRFITGITADVPQSYYTQQELKKLLDLYVANNNLIDPENKSLVKYDD 419

Query: 416 LMYSLVYKKKNSAEPRLISRADVIEP-ITKNNFNEHFQIYKKGDNETAVPLFKKPIRGSI 474
            +Y +  +   +   + I+R  ++ P     NFN + QIYK        PL K P +G I
Sbjct: 420 TLYQMSNRAPQNGGIQKIARGLIVSPTFLSKNFNTYHQIYKPNGE----PLLKVPEKGPI 475

Query: 475 PKVEIVTEMKIGRKVITRVSNFEVFHIDAETLAADLRKLCNGATTIGETLTSPKTAEVQV 534
           P +EIVTE KIGRKVITRV+NFE F ID+E LAA LRK C+G+TTIGE+  S KTAEVQV
Sbjct: 476 PTLEIVTEKKIGRKVITRVTNFEKFKIDSEELAAALRKKCSGSTTIGES-KSTKTAEVQV 534

Query: 535 QGPHSQVIIKHLNSLSIPTKWIDF 558
           QGPH  ++I  LN   IPTKWI F
Sbjct: 535 QGPHGSIVISILNDYGIPTKWISF 558

>AGR079W Chr7 (879417..881045) [1629 bp, 542 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YDR117C
          Length = 542

 Score =  407 bits (1045), Expect = e-135,   Method: Compositional matrix adjust.
 Identities = 214/557 (38%), Positives = 322/557 (57%), Gaps = 28/557 (5%)

Query: 1   MFKKTPNVKASSNLKNSERKKLLQSCKEQRNSSDYNFPSSIIKQANYKGQTSAGTVYTDE 60
           MFKK PN+  +SN KNSERK+L  S +EQ     Y F S+ IK   +K Q++ GTVYTD 
Sbjct: 1   MFKKEPNLNPTSNTKNSERKRLQASIREQYEYESYQFSSTEIKHGTFKTQSTVGTVYTDP 60

Query: 61  QNVPIWFKEKHSDMLFPSVYTCWKNPKLLPIIVTNSYVIEEKILNGANLMISGTLLPFDE 120
            N+P+WF+ KH     P+VY+CW +P LLP++ T+ +V+E K+  GA+LM+ GT+ PF  
Sbjct: 61  NNIPLWFRGKHDQTYIPTVYSCWDHPDLLPVVHTHEHVVESKLKGGADLMLPGTVPPFSS 120

Query: 121 RLICGALCGIASYKKPNVVMAIGIVQLDLQSYTKVVGETGVAVNVLHYLGDGLSDSFKMN 180
               G + GIAS + P VV A+GI ++DL+  T V   TGVAV VLH  GDGL   FK+ 
Sbjct: 121 GTRRGRVVGIASTRAPGVVKAVGICEMDLEGVTTVADTTGVAVRVLHTYGDGLCRVFKVQ 180

Query: 181 LEPPETGAEVDETNEMLLNQDKQDVNNELTNSNKDLAPDARPNDDLAEVLETLPVDIIDD 240
            E PE               + +  + E      +  P   P + LAE LE L ++ +D 
Sbjct: 181 REAPEA-------------SEAKGASPEAREPEAE-PPKTAPGEGLAEELERLTMEDVDH 226

Query: 241 FITKSLYYSLTNDPKLEFPISASNFISNYIMSNLPPVDNDMVNLKKSSWKKTAKFLRHFE 300
            +T+++YY++  D +L+ P++AS FI+ +++ NLPP+D   V +K+SSW K AK L+HFE
Sbjct: 227 LLTRAVYYTIKADGRLQLPVTASKFIAEHVLKNLPPMDLSQVTVKRSSWGKAAKLLKHFE 286

Query: 301 KEGFIKLKGKNDDLVITGFNKEKTELKSFVPYRTXXXXXXXXXXXXXXXXXXXXXMMQSV 360
            +G + LKGK +   +   N     LKSF PYRT                      ++ V
Sbjct: 287 AQGLLTLKGKPESFTVVSVNSAHEALKSFEPYRTVSDKASTGSKNSSTTQS-----LEIV 341

Query: 361 SYYKP-ISLGKDLIRESVAPEKSLYTAHELRDFITEYINKKNLVDSKNKKMILMDDLMYS 419
            +Y P  +L   L    ++   +L +A ++RD + +Y+  +  VD  +K M+ +DD +  
Sbjct: 342 YHYVPNRTLLPQLNGLGISGGDAL-SAKDIRDRLEQYVAARKCVDPYDKSMLRLDDTLAQ 400

Query: 420 LVYKKKNSAEPRLISRADVIEPITKNNFNEHFQIYKKGDNETAVPLFKKPIRGSIPKVEI 479
           L++K  N+  PR + R + +  +   +F+E+F +  +GD     PL  KP +G  P +++
Sbjct: 401 LLHKNVNADTPRSLPRPEALAALLSRSFSEYF-VVMRGD----APL-SKPQKGRAPPIKV 454

Query: 480 VTEMKIGRKVITRVSNFEVFHIDAETLAADLRKLCNGATTIGETLTSPKTAEVQVQGPHS 539
             E KI +KV+T+VSNFEV+ +D E LAA+LR  C+G+TTI + + + K  EVQVQGPH 
Sbjct: 455 TNERKIYKKVVTKVSNFEVYGVDPEELAAELRVRCSGSTTITD-VPNTKAVEVQVQGPHE 513

Query: 540 QVIIKHLNSLSIPTKWI 556
             I+  LN   IP+K+I
Sbjct: 514 ATIVSILNKHGIPSKYI 530

>AER067C Chr5 complement(757163..761011) [3849 bp, 1282 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YLR398C
           (SKI2)
          Length = 1282

 Score = 35.0 bits (79), Expect = 0.68,   Method: Compositional matrix adjust.
 Identities = 38/120 (31%), Positives = 55/120 (45%), Gaps = 28/120 (23%)

Query: 141 AIGIVQLDLQSYTKVVGETGVAVNVLHYLGDGLSD---SFK---MNLEPPETGAE----- 189
            I +  + LQS    + ETGVA + LH   DGL D    F    M ++ PE GAE     
Sbjct: 179 GISMTTMKLQSN---ISETGVATSRLHRDADGLFDIPQGFDRGIMLVDNPEEGAEQVVDL 235

Query: 190 --VDETNEMLLNQDKQDVNNELTNSNKDLA----------PDARPNDDLAEVLETLPVDI 237
             +D+ +  L N  KQ++     +  ++LA          P A    +LA+V + LPV I
Sbjct: 236 HSLDQVDTELAN--KQELEGIKKHKEQELAVGGTGSMLWKPAAGAERNLADVDDLLPVGI 293

>KAFR0A02400 Chr1 complement(499107..500495) [1389 bp, 462 aa] {ON} 
          Length = 462

 Score = 33.5 bits (75), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 23/68 (33%), Positives = 37/68 (54%), Gaps = 1/68 (1%)

Query: 206 NNELTNSNKDLAPDARPNDDLAEVLETLPVDIIDDFITKSLY-YSLTNDPKLEFPISASN 264
           N+ +T  NK  +PD R +  + E  ET P+   D+FI  +LY Y L+   ++    S SN
Sbjct: 210 NDAITEFNKIFSPDKRKSVPIMEKCETTPLSASDNFIVGALYRYRLSPTHRVNSTNSLSN 269

Query: 265 FISNYIMS 272
            ++ Y+ S
Sbjct: 270 SMNKYLPS 277

>SAKL0F04576g Chr6 (369113..369120,369587..370121) [543 bp, 180 aa]
           {ON} similar to uniprot|P89886 Saccharomyces cerevisiae
           YER007C-A TMA20 Protein of unknown function that
           associates with ribosomes
          Length = 180

 Score = 32.3 bits (72), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 35/119 (29%), Positives = 57/119 (47%), Gaps = 16/119 (13%)

Query: 65  IWFKEKHSDMLFPSVYTCWKNPKLLPIIVTNSYVIEEKILNGANLMISGTL-----LPFD 119
           I F +K +D L P++    + P   P +  +   I+  +L+GAN+M  G       LP  
Sbjct: 66  ILFFQKFND-LIPTLKFVHRFPGAFPTVQVDRGAIK-FVLSGANIMCPGLTSPGAKLPDA 123

Query: 120 ERLICGALCGIASYKKPNVVMAIGIVQL---DLQSYTKVVGETGVAVNVLHYLGDGLSD 175
             L   A+  + +  K +  +AIG + +   D++S  K     G  V ++HYLGD L D
Sbjct: 124 PGLEKDAIVIVNAENKEHA-LAIGTLLMSTEDIRSINK-----GHGVEMVHYLGDCLWD 176

>YLR440C Chr12 complement(1015568..1017697) [2130 bp, 709 aa] {ON}
           SEC39Component of the Dsl1p tethering complex that
           interacts with ER SNAREs Sec20p and Use1p; proposed to
           be involved in protein secretion; localizes to the ER
           and nuclear envelope
          Length = 709

 Score = 32.3 bits (72), Expect = 4.4,   Method: Compositional matrix adjust.
 Identities = 39/155 (25%), Positives = 71/155 (45%), Gaps = 12/155 (7%)

Query: 371 DLIRESVAPEKSLYTAHELRDFITEYINKKNLVDSKNKKMILMDDLMYSLVYKKKNSAEP 430
           D+I + +AP  +L    +   FITE+ NK+      +    L   L YSL    K+++E 
Sbjct: 212 DVIEDELAP--TLSYGKKWETFITEFFNKQQFSLKSDTNYQLFIKLYYSLEKGVKDNSEA 269

Query: 431 RLISRADVIEPI---TKNNFNEHFQIYKKGDNETAVPLFKKPI----RGSIPKVEIVTEM 483
               +++V++ +   ++N FN     +K  +  + +  F   I    + +I  +E+   M
Sbjct: 270 SRKLQSNVVDILFHNSENLFNLSSLTHKLDELWSILSGFPDEITIEEQKTITALEMKQFM 329

Query: 484 KIGRKVITRVSNFEVFHIDAETLAADL---RKLCN 515
           +   K  T+ S  E+F I  E  +A L     LC+
Sbjct: 330 EFFIKCSTKFSFKEIFAITQEEESAQLAHFSSLCH 364

>TPHA0P00180 Chr16 (33456..36449) [2994 bp, 997 aa] {ON} Anc_8.15
           YLR071C
          Length = 997

 Score = 32.0 bits (71), Expect = 5.6,   Method: Compositional matrix adjust.
 Identities = 16/38 (42%), Positives = 23/38 (60%)

Query: 431 RLISRADVIEPITKNNFNEHFQIYKKGDNETAVPLFKK 468
           +L+S  DV+E + KN  +EHF+I     NE A   F+K
Sbjct: 732 QLVSLTDVVERLRKNFESEHFKILNLQPNEVAFKYFEK 769

>AAL068C Chr1 complement(229091..231085) [1995 bp, 664 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YHR035W
          Length = 664

 Score = 31.2 bits (69), Expect = 9.4,   Method: Compositional matrix adjust.
 Identities = 24/85 (28%), Positives = 39/85 (45%)

Query: 82  CWKNPKLLPIIVTNSYVIEEKILNGANLMISGTLLPFDERLICGALCGIASYKKPNVVMA 141
           C+   + LP +  N    E  + +      +GTLL  DE  +C +LC   S ++ +   A
Sbjct: 359 CFGPVRKLPPLRNNYSDTERGVGSTTTWAYNGTLLSADELSLCFSLCLAPSVRQSSKESA 418

Query: 142 IGIVQLDLQSYTKVVGETGVAVNVL 166
              + L ++   +V GE  VAV  L
Sbjct: 419 APNITLQVEFMYEVHGELCVAVTTL 443

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.315    0.133    0.377 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 62,766,285
Number of extensions: 2961760
Number of successful extensions: 9135
Number of sequences better than 10.0: 73
Number of HSP's gapped: 9395
Number of HSP's successfully gapped: 74
Length of query: 583
Length of database: 53,481,399
Length adjustment: 115
Effective length of query: 468
Effective length of database: 40,294,809
Effective search space: 18857970612
Effective search space used: 18857970612
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (22.0 bits)
S2: 69 (31.2 bits)