Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
TPHA0J007708.268ON27827814490.0
KLTH0G13552g8.268ON2812828731e-118
SAKL0H16896g8.268ON2852738641e-116
Kwal_56.237758.268ON2812748631e-116
ZYRO0C01518g8.268ON2772778621e-116
Kpol_392.38.268ON2812818611e-116
YDR116C (MRPL1)8.268ON2852698341e-112
KLLA0F19272g8.268ON2662448291e-111
TDEL0F039508.268ON2762718241e-110
Smik_4.3608.268ON2852708181e-109
Suva_2.2758.268ON2852698151e-109
Skud_4.3768.268ON2852707921e-105
Ecym_43028.268ON2752467821e-104
NCAS0B038108.268ON3142537711e-102
NDAI0J013308.268ON3142917509e-99
AGR080W8.268ON2752467461e-98
KAFR0B054808.268ON2802757149e-94
CAGL0B01815g8.268ON2902476942e-90
KNAG0H032108.268ON2852436765e-88
TBLA0I031908.268ON2412214936e-61
Kwal_47.175474.117ON1240112721.7
Smik_7.2844.117ON117755721.7
Skud_7.2814.117ON117755712.3
Smik_4.6845.514ON235106683.0
CAGL0A00517g4.117ON112259693.9
TBLA0C040104.117ON1144189685.2
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= TPHA0J00770
         (278 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

TPHA0J00770 Chr10 complement(179754..180590) [837 bp, 278 aa] {O...   562   0.0  
KLTH0G13552g Chr7 (1163624..1164469) [846 bp, 281 aa] {ON} simil...   340   e-118
SAKL0H16896g Chr8 (1486354..1487211) [858 bp, 285 aa] {ON} simil...   337   e-116
Kwal_56.23775 s56 (700146..700991) [846 bp, 281 aa] {ON} YDR116C...   337   e-116
ZYRO0C01518g Chr3 (110061..110894) [834 bp, 277 aa] {ON} similar...   336   e-116
Kpol_392.3 s392 (3674..4519) [846 bp, 281 aa] {ON} (3674..4519) ...   336   e-116
YDR116C Chr4 complement(682724..683581) [858 bp, 285 aa] {ON}  M...   325   e-112
KLLA0F19272g Chr6 complement(1783497..1784297) [801 bp, 266 aa] ...   323   e-111
TDEL0F03950 Chr6 complement(732544..733374) [831 bp, 276 aa] {ON...   322   e-110
Smik_4.360 Chr4 complement(644029..644886) [858 bp, 285 aa] {ON}...   319   e-109
Suva_2.275 Chr2 complement(477386..478243) [858 bp, 285 aa] {ON}...   318   e-109
Skud_4.376 Chr4 complement(654375..655232) [858 bp, 285 aa] {ON}...   309   e-105
Ecym_4302 Chr4 (646221..647048) [828 bp, 275 aa] {ON} similar to...   305   e-104
NCAS0B03810 Chr2 (680870..681814) [945 bp, 314 aa] {ON} Anc_8.26...   301   e-102
NDAI0J01330 Chr10 (309586..310530) [945 bp, 314 aa] {ON} Anc_8.2...   293   9e-99
AGR080W Chr7 (881213..882040) [828 bp, 275 aa] {ON} Syntenic hom...   291   1e-98
KAFR0B05480 Chr2 (1122727..1123569) [843 bp, 280 aa] {ON} Anc_8....   279   9e-94
CAGL0B01815g Chr2 complement(165648..166520) [873 bp, 290 aa] {O...   271   2e-90
KNAG0H03210 Chr8 (601470..602327) [858 bp, 285 aa] {ON} Anc_8.26...   265   5e-88
TBLA0I03190 Chr9 complement(768942..769667) [726 bp, 241 aa] {ON...   194   6e-61
Kwal_47.17547 s47 (448414..452136) [3723 bp, 1240 aa] {ON} YGL00...    32   1.7  
Smik_7.284 Chr7 (477865..481398) [3534 bp, 1177 aa] {ON} YGL006W...    32   1.7  
Skud_7.281 Chr7 (488922..492455) [3534 bp, 1177 aa] {ON} YGL006W...    32   2.3  
Smik_4.684 Chr4 (1215469..1216176) [708 bp, 235 aa] {ON} YDR412W...    31   3.0  
CAGL0A00517g Chr1 (58830..62198) [3369 bp, 1122 aa] {ON} similar...    31   3.9  
TBLA0C04010 Chr3 complement(964128..967562) [3435 bp, 1144 aa] {...    31   5.2  

>TPHA0J00770 Chr10 complement(179754..180590) [837 bp, 278 aa] {ON}
           Anc_8.268 YDR116C
          Length = 278

 Score =  562 bits (1449), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 278/278 (100%), Positives = 278/278 (100%)

Query: 1   MLKANFLQVTRKNAFHVSRIIREEITGAEGPIAQVSKLSKDQLKKRELRRFTIRKREAKM 60
           MLKANFLQVTRKNAFHVSRIIREEITGAEGPIAQVSKLSKDQLKKRELRRFTIRKREAKM
Sbjct: 1   MLKANFLQVTRKNAFHVSRIIREEITGAEGPIAQVSKLSKDQLKKRELRRFTIRKREAKM 60

Query: 61  PATSHPLYMQVPQALRFLRAAEVGQPLSQQTINLTTLVVSEKGSPNLAGDIAFVTPLKEV 120
           PATSHPLYMQVPQALRFLRAAEVGQPLSQQTINLTTLVVSEKGSPNLAGDIAFVTPLKEV
Sbjct: 61  PATSHPLYMQVPQALRFLRAAEVGQPLSQQTINLTTLVVSEKGSPNLAGDIAFVTPLKEV 120

Query: 121 KIAIFTNDETQMKIAKEKFNCYVVGGSELISKIKNGEIEVDFDKAFATPDIVQELGSVAR 180
           KIAIFTNDETQMKIAKEKFNCYVVGGSELISKIKNGEIEVDFDKAFATPDIVQELGSVAR
Sbjct: 121 KIAIFTNDETQMKIAKEKFNCYVVGGSELISKIKNGEIEVDFDKAFATPDIVQELGSVAR 180

Query: 181 ILGPRGVFPSIKKGTVSENVEDLIKGNLGSIPFRQLGNCISVAIGKCNFSDRQILENLIS 240
           ILGPRGVFPSIKKGTVSENVEDLIKGNLGSIPFRQLGNCISVAIGKCNFSDRQILENLIS
Sbjct: 181 ILGPRGVFPSIKKGTVSENVEDLIKGNLGSIPFRQLGNCISVAIGKCNFSDRQILENLIS 240

Query: 241 VRKAFKDSVSTQKTKKPSILGKTILSTTHGPGIVIDFS 278
           VRKAFKDSVSTQKTKKPSILGKTILSTTHGPGIVIDFS
Sbjct: 241 VRKAFKDSVSTQKTKKPSILGKTILSTTHGPGIVIDFS 278

>KLTH0G13552g Chr7 (1163624..1164469) [846 bp, 281 aa] {ON} similar
           to uniprot|Q04599 Saccharomyces cerevisiae YDR116C MRPL1
           Mitochondrial ribosomal protein of the large subunit
          Length = 281

 Score =  340 bits (873), Expect = e-118,   Method: Compositional matrix adjust.
 Identities = 163/282 (57%), Positives = 224/282 (79%), Gaps = 10/282 (3%)

Query: 2   LKANFLQVTRKNA---FHVSRIIREEITGAEGPIAQV-SKLSKDQLKKRELRRFTIRKRE 57
           L + FL + R +     HVS  +R     AE P+    SKLSKDQLKKRE+RRF  +K  
Sbjct: 5   LSSRFLPLVRASPVRRLHVSASLR-----AEEPVGNATSKLSKDQLKKREVRRFAQKKAA 59

Query: 58  AKMPATSHPLYMQVPQALRFLRAAEVGQPLSQQTINLTTLVVSEKGSPNLAGDIAFVTPL 117
           A+ PA+ HPLYM V +ALRFLRAAEVGQP SQQT+++TT+V+SE+G+P L+G+++F   L
Sbjct: 60  ARRPASEHPLYMPVDKALRFLRAAEVGQPQSQQTLSVTTIVISERGAPLLSGNVSFPNAL 119

Query: 118 KEVKIAIFTNDETQMKIAKEKFNCYVVGGSELISKIKNGEIEVDFDKAFATPDIVQELGS 177
           KE+KIA+FTNDE Q +IA+EKFNC+VVGGSEL+ KIK G++ +DFDK+FATP+I   L S
Sbjct: 120 KELKIAVFTNDEQQAQIAREKFNCHVVGGSELVEKIKQGQVPLDFDKSFATPEIATLLAS 179

Query: 178 -VARILGPRGVFPSIKKGTVSENVEDLIKGNLGSIPFRQLGNCISVAIGKCNFSDRQILE 236
            + RILGPRG+ P+ KKGTVSEN+E LIK ++G++PFRQ GN IS+A+G+C+F+D+Q+LE
Sbjct: 180 QLGRILGPRGLLPAAKKGTVSENLESLIKDSMGTLPFRQRGNNISIAVGRCSFTDKQLLE 239

Query: 237 NLISVRKAFKDSVSTQKTKKPSILGKTILSTTHGPGIVIDFS 278
           N+++ +K+ K++++ QK KKPS+LG+T L++T GPGIVIDF+
Sbjct: 240 NIVAAQKSVKEALANQKAKKPSLLGQTTLTSTRGPGIVIDFA 281

>SAKL0H16896g Chr8 (1486354..1487211) [858 bp, 285 aa] {ON} similar
           to uniprot|Q04599 Saccharomyces cerevisiae YDR116C MRPL1
           Mitochondrial ribosomal protein of the large subunit
          Length = 285

 Score =  337 bits (864), Expect = e-116,   Method: Compositional matrix adjust.
 Identities = 165/273 (60%), Positives = 217/273 (79%), Gaps = 6/273 (2%)

Query: 7   LQVTRKNAFHVSRIIREEITGAEGPIAQVSKLSKDQLKKRELRRFTIRKREAKMPATSHP 66
           +  TR + FH    ++     +E P    +KLSKDQLK+RELRR   RK  A+ PA  HP
Sbjct: 18  ISCTRTSLFHTFTALK-----SEEPSTIATKLSKDQLKRRELRRLVQRKAAARKPAADHP 72

Query: 67  LYMQVPQALRFLRAAEVGQPLSQQTINLTTLVVSEKGSPNLAGDIAFVTPLKEVKIAIFT 126
           LYM V QALRFLRAAEVGQP SQQTI+LTTLV+SE+G+P L G+I+F  PLK+VKIA+FT
Sbjct: 73  LYMPVTQALRFLRAAEVGQPQSQQTISLTTLVISERGAPQLNGNISFPKPLKDVKIAVFT 132

Query: 127 NDETQMKIAKEKFNCYVVGGSELISKIKNGEIEVDFDKAFATPDIVQELGS-VARILGPR 185
           NDE ++KIA+++FNC++VGGSELI KIK GE+ +DFDKAFATPDI   L S + RILGPR
Sbjct: 133 NDEDKLKIARDQFNCHLVGGSELIEKIKKGEVPLDFDKAFATPDIAISLTSQLGRILGPR 192

Query: 186 GVFPSIKKGTVSENVEDLIKGNLGSIPFRQLGNCISVAIGKCNFSDRQILENLISVRKAF 245
           G+ P+ KKGTV+E++  LIK ++G++PFRQ GNCIS+A+ KC+F+D Q+LEN+++ +K+F
Sbjct: 193 GLLPNAKKGTVTEDISSLIKDSMGTLPFRQRGNCISIAVAKCSFTDTQVLENILAAQKSF 252

Query: 246 KDSVSTQKTKKPSILGKTILSTTHGPGIVIDFS 278
           K +++ QK KKPSILG+T L+TTHGPG+VIDF+
Sbjct: 253 KLALANQKAKKPSILGQTTLTTTHGPGLVIDFA 285

>Kwal_56.23775 s56 (700146..700991) [846 bp, 281 aa] {ON} YDR116C -
           Hypothetical ORF [contig 173] FULL
          Length = 281

 Score =  337 bits (863), Expect = e-116,   Method: Compositional matrix adjust.
 Identities = 155/274 (56%), Positives = 216/274 (78%), Gaps = 5/274 (1%)

Query: 6   FLQVTRKNAFHVSRIIREEITGAEGPIAQVSKLSKDQLKKRELRRFTIRKREAKMPATSH 65
            +Q       H    +R E    E P   VSKLSKDQL+KRE+R+   +K  A+ PAT H
Sbjct: 12  LVQFPYARNLHAFSALRAE----ETPSPVVSKLSKDQLRKREIRKLAQKKAAARRPATDH 67

Query: 66  PLYMQVPQALRFLRAAEVGQPLSQQTINLTTLVVSEKGSPNLAGDIAFVTPLKEVKIAIF 125
           PLYM V +ALRFLRAAE GQP SQQT+++TT+V+SE+G+P L+G+++F  PLK++KIA+F
Sbjct: 68  PLYMPVDKALRFLRAAEAGQPHSQQTLSVTTIVISERGAPPLSGNLSFPKPLKDLKIAVF 127

Query: 126 TNDETQMKIAKEKFNCYVVGGSELISKIKNGEIEVDFDKAFATPDIVQELGS-VARILGP 184
           TNDE Q +IA+EKF C++VGGS+L+ KIK G + +DFDK+FATP+I   L S + RILGP
Sbjct: 128 TNDEQQAQIAREKFGCHLVGGSDLVEKIKEGAVSLDFDKSFATPEITTLLASQLGRILGP 187

Query: 185 RGVFPSIKKGTVSENVEDLIKGNLGSIPFRQLGNCISVAIGKCNFSDRQILENLISVRKA 244
           RG+ P+ KKGTV+EN+E L+K ++G++PFRQ GN +SVA+GKC+F+D+Q+LEN+++ +K 
Sbjct: 188 RGLLPAAKKGTVAENLEPLLKNSMGTLPFRQRGNVVSVAVGKCSFTDKQLLENILAAQKG 247

Query: 245 FKDSVSTQKTKKPSILGKTILSTTHGPGIVIDFS 278
            K++++TQKTKKPS+LG+T L++THGPGIVIDF+
Sbjct: 248 LKEALATQKTKKPSLLGQTTLTSTHGPGIVIDFA 281

>ZYRO0C01518g Chr3 (110061..110894) [834 bp, 277 aa] {ON} similar to
           uniprot|Q04599 Saccharomyces cerevisiae YDR116C MRPL1
           Mitochondrial ribosomal protein of the large subunit
          Length = 277

 Score =  336 bits (862), Expect = e-116,   Method: Compositional matrix adjust.
 Identities = 161/277 (58%), Positives = 213/277 (76%), Gaps = 9/277 (3%)

Query: 2   LKANFLQVTRKNAFHVSRIIREEITGAEGPIAQVSKLSKDQLKKRELRRFTIRKREAKMP 61
           L++  L  T +  FH + ++R E  G        SKL+K+QL+KRE+RR   RK EAK P
Sbjct: 8   LRSQLLGSTSRCLFHTAALLRAEEAG--------SKLTKEQLRKREVRRAARRKVEAKKP 59

Query: 62  ATSHPLYMQVPQALRFLRAAEVGQPLSQQTINLTTLVVSEKGSPNLAGDIAFVTPLKEVK 121
           A +HPLYM  P ALR+LRA EVG P SQQ I +TT VV+++G+P +AG+++  +PLK+V 
Sbjct: 60  AHTHPLYMPTPLALRYLRAVEVGYPASQQVITVTTSVVADRGNPPIAGNVSLPSPLKDVL 119

Query: 122 IAIFTNDETQMKIAKEKFNCYVVGGSELISKIKNGEIEVDFDKAFATPDIVQELGS-VAR 180
           +A+F+NDE Q+ +A++KF C++VGGS++I+KIK GEI VDFDKAFATPDI QEL S VAR
Sbjct: 120 VAVFSNDEQQLSMARDKFRCHLVGGSDIIAKIKQGEIPVDFDKAFATPDIAQELTSQVAR 179

Query: 181 ILGPRGVFPSIKKGTVSENVEDLIKGNLGSIPFRQLGNCISVAIGKCNFSDRQILENLIS 240
           ILGP+ V P  K+GTV+ ++E LIK + GSIPFRQ GN IS+A+ KC FSDRQ+LENL++
Sbjct: 180 ILGPKQVLPMAKRGTVASDLEPLIKDSFGSIPFRQKGNSISLAVAKCEFSDRQVLENLLA 239

Query: 241 VRKAFKDSVSTQKTKKPSILGKTILSTTHGPGIVIDF 277
           V+ AFK++VS QK K+PSILG+T L+TTHGPGIVID 
Sbjct: 240 VQTAFKEAVSNQKAKRPSILGRTTLTTTHGPGIVIDL 276

>Kpol_392.3 s392 (3674..4519) [846 bp, 281 aa] {ON} (3674..4519)
           [846 nt, 282 aa]
          Length = 281

 Score =  336 bits (861), Expect = e-116,   Method: Compositional matrix adjust.
 Identities = 161/281 (57%), Positives = 225/281 (80%), Gaps = 3/281 (1%)

Query: 1   MLKANFLQVTRKNAFHVSRII-REEITGAEGPIAQ-VSKLSKDQLKKRELRRFTIRKREA 58
           ML  +F  ++R+  +H  R++  E +  +E   A+ VSK  KD+LK+RELRR + RK +A
Sbjct: 1   MLSRSFGILSRRCEYHSGRVLLAEAVAASETASAKPVSKSVKDKLKRRELRRHSKRKADA 60

Query: 59  KMPATSHPLYMQVPQALRFLRAAEVGQPLSQQTINLTTLVVSEKGSPNLAGDIAFVTPLK 118
           + PA+S+PLYM + QALR+LRAAEVGQP+SQQ I +TT VVSE+G+ NL G+I++ TP+K
Sbjct: 61  RKPASSYPLYMPISQALRYLRAAEVGQPISQQIITITTDVVSERGNLNLNGNISYNTPIK 120

Query: 119 EVKIAIFTNDETQMKIAKEKFNCYVVGGSELISKIKNGEIEVDFDKAFATPDIVQELGS- 177
           +VKIA+F+ND  ++   KE+ NC+++GG++L+ KIK+G+  VDFDKAFATPDI   L S 
Sbjct: 121 DVKIAVFSNDPEKLAKIKEEHNCHLIGGTDLVEKIKSGKQPVDFDKAFATPDISPMLTSQ 180

Query: 178 VARILGPRGVFPSIKKGTVSENVEDLIKGNLGSIPFRQLGNCISVAIGKCNFSDRQILEN 237
           +AR+LGPRGV P+IKKGTVSE+V  LIKG++G +PFRQ GN ISV++G+CNFSD+QILEN
Sbjct: 181 LARVLGPRGVLPTIKKGTVSEDVSSLIKGSIGLMPFRQTGNSISVSVGRCNFSDKQILEN 240

Query: 238 LISVRKAFKDSVSTQKTKKPSILGKTILSTTHGPGIVIDFS 278
           +I+VR A+  ++S+QK+KKPS+LGKT +++THGPGI IDF+
Sbjct: 241 IIAVRSAYNTTLSSQKSKKPSLLGKTTITSTHGPGITIDFA 281

>YDR116C Chr4 complement(682724..683581) [858 bp, 285 aa] {ON}
           MRPL1Mitochondrial ribosomal protein of the large
           subunit
          Length = 285

 Score =  325 bits (834), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 157/269 (58%), Positives = 208/269 (77%), Gaps = 1/269 (0%)

Query: 11  RKNAFHVSRIIREEITGAEGPIAQVSKLSKDQLKKRELRRFTIRKREAKMPATSHPLYMQ 70
           R+  FH ++ +  +        +    L+KDQ KKREL+R   RK EAK PAT+ PLYM 
Sbjct: 17  RRCFFHTAKKLYADDYKPAAMSSNAPSLTKDQAKKRELKRLVQRKAEAKRPATASPLYMP 76

Query: 71  VPQALRFLRAAEVGQPLSQQTINLTTLVVSEKGSPNLAGDIAFVTPLKEVKIAIFTNDET 130
           V +ALR+LRAAEVG+P SQQTINLTTLVV E+G+  L+G + F  PL+ +KIA FTNDE+
Sbjct: 77  VTKALRYLRAAEVGRPQSQQTINLTTLVVGERGTAPLSGSVTFPKPLRYIKIAAFTNDES 136

Query: 131 QMKIAKEKFNCYVVGGSELISKIKNGEIEVDFDKAFATPDIVQELGS-VARILGPRGVFP 189
           +++  +EK+  +++GG++L++KIK+GEI VDFDKAFATPDIV  L S VARILGPRGV P
Sbjct: 137 KLEELREKYPNHLIGGADLVAKIKSGEISVDFDKAFATPDIVPALQSQVARILGPRGVLP 196

Query: 190 SIKKGTVSENVEDLIKGNLGSIPFRQLGNCISVAIGKCNFSDRQILENLISVRKAFKDSV 249
           S+KKGTVS+++  L++ +LGS+PFRQ GN IS+ +GKC F+DR+IL+N+IS R AFK +V
Sbjct: 197 SVKKGTVSDDISSLLQESLGSMPFRQRGNSISIGVGKCYFTDREILQNIISARAAFKTAV 256

Query: 250 STQKTKKPSILGKTILSTTHGPGIVIDFS 278
             QK+KKP+IL KT LS+THGPGIVIDF+
Sbjct: 257 DNQKSKKPNILSKTTLSSTHGPGIVIDFA 285

>KLLA0F19272g Chr6 complement(1783497..1784297) [801 bp, 266 aa]
           {ON} similar to uniprot|Q04599 Saccharomyces cerevisiae
           YDR116C MRPL1 Mitochondrial ribosomal protein of the
           large subunit
          Length = 266

 Score =  323 bits (829), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 147/244 (60%), Positives = 202/244 (82%), Gaps = 1/244 (0%)

Query: 36  SKLSKDQLKKRELRRFTIRKREAKMPATSHPLYMQVPQALRFLRAAEVGQPLSQQTINLT 95
           +KL+K+QL+KRELR+   R+ +AK PA+ HPLYM V +ALR+LRA EVGQP SQQTI LT
Sbjct: 23  TKLTKEQLRKRELRKMVQRRLQAKTPASDHPLYMPVSRALRYLRAIEVGQPASQQTITLT 82

Query: 96  TLVVSEKGSPNLAGDIAFVTPLKEVKIAIFTNDETQMKIAKEKFNCYVVGGSELISKIKN 155
           TLVV+E+G P L G+++F  PLK+VK+A+FTNDE Q  + K+K++ ++VGGS+L+S+IK 
Sbjct: 83  TLVVAERGVPPLTGNVSFGKPLKDVKVAVFTNDEAQAALMKDKYSVHLVGGSDLVSQIKA 142

Query: 156 GEIEVDFDKAFATPDIVQELGS-VARILGPRGVFPSIKKGTVSENVEDLIKGNLGSIPFR 214
           GE+ +DFDKAFATPDIV +L S V RILGPRG+ P+ KKGTV+E++E LIK ++ S+PFR
Sbjct: 143 GEVSIDFDKAFATPDIVPQLASQVGRILGPRGLLPTAKKGTVAEDLEPLIKDSMSSVPFR 202

Query: 215 QLGNCISVAIGKCNFSDRQILENLISVRKAFKDSVSTQKTKKPSILGKTILSTTHGPGIV 274
           Q GN IS+ + K +F+D+++LENL++ +KAFK S++ Q+TKKPSIL +T L++THGPGIV
Sbjct: 203 QRGNSISLGVAKTHFTDKEVLENLLATQKAFKQSITNQQTKKPSILSQTTLTSTHGPGIV 262

Query: 275 IDFS 278
           IDF+
Sbjct: 263 IDFA 266

>TDEL0F03950 Chr6 complement(732544..733374) [831 bp, 276 aa] {ON}
           Anc_8.268 YDR116C
          Length = 276

 Score =  322 bits (824), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 167/271 (61%), Positives = 211/271 (77%), Gaps = 6/271 (2%)

Query: 9   VTRKNAFHVSRIIREEITGAEGPIAQVSKLSKDQLKKRELRRFTIRKREAKMPATSHPLY 68
           V R++  H   ++R     AE   A VSKLSKDQLKKRE+RR   RK  AK   + HPLY
Sbjct: 11  VLRRSFLHTGNVLR-----AEEAAANVSKLSKDQLKKREIRRLAQRKAAAKKSPSDHPLY 65

Query: 69  MQVPQALRFLRAAEVGQPLSQQTINLTTLVVSEKGSPNLAGDIAFVTPLKEVKIAIFTND 128
           M +P ALRFLRAAEVGQP +QQTI LTT VV+E+G P LAG ++F  PLKEVKIA+F+ D
Sbjct: 66  MSIPMALRFLRAAEVGQPQTQQTITLTTAVVAERGVPALAGSVSFPKPLKEVKIAVFSGD 125

Query: 129 ETQMKIAKEKFNCYVVGGSELISKIKNGEIEVDFDKAFATPDIVQELGS-VARILGPRGV 187
           E Q+K+A+EKFNC++VGG+E+I KIK+GEI VDFDKAFATPDI   L S +ARILGPRGV
Sbjct: 126 EDQLKVAREKFNCHLVGGTEIIEKIKSGEIPVDFDKAFATPDIAPALTSQLARILGPRGV 185

Query: 188 FPSIKKGTVSENVEDLIKGNLGSIPFRQLGNCISVAIGKCNFSDRQILENLISVRKAFKD 247
            P++KKGTV+ +V  L++ ++GS+PFRQ GN IS+A+GK +FSDRQILEN I+   A K+
Sbjct: 186 LPTVKKGTVATDVSRLVQDSMGSMPFRQRGNAISIAVGKSSFSDRQILENAIATHDAVKE 245

Query: 248 SVSTQKTKKPSILGKTILSTTHGPGIVIDFS 278
           +++ Q +KK S+LGKT LS+THGPGIVIDF+
Sbjct: 246 ALANQVSKKTSLLGKTTLSSTHGPGIVIDFA 276

>Smik_4.360 Chr4 complement(644029..644886) [858 bp, 285 aa] {ON}
           YDR116C (REAL)
          Length = 285

 Score =  319 bits (818), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 154/270 (57%), Positives = 207/270 (76%), Gaps = 1/270 (0%)

Query: 10  TRKNAFHVSRIIREEITGAEGPIAQVSKLSKDQLKKRELRRFTIRKREAKMPATSHPLYM 69
           TR+   H ++ +  E        +    L+KDQ KKREL+R   RK EAK PA ++PLYM
Sbjct: 16  TRRCLSHTAKKLYAEEYKPTAMSSNAPSLTKDQAKKRELKRLAQRKAEAKRPAATNPLYM 75

Query: 70  QVPQALRFLRAAEVGQPLSQQTINLTTLVVSEKGSPNLAGDIAFVTPLKEVKIAIFTNDE 129
            V  ALR+LRAAEVG+P SQQTINLTTLVV E+G+  L+G + F  PL+ +K+A FTNDE
Sbjct: 76  PVTMALRYLRAAEVGRPQSQQTINLTTLVVGERGTAPLSGSVTFPKPLRYIKVAAFTNDE 135

Query: 130 TQMKIAKEKFNCYVVGGSELISKIKNGEIEVDFDKAFATPDIVQELGS-VARILGPRGVF 188
            +++  ++K+  +++GG++L+++IK+GEI VDFDKAFATPDIV  L S VARILGPRGV 
Sbjct: 136 NKLEELRKKYPNHLIGGADLVARIKSGEIPVDFDKAFATPDIVPTLQSQVARILGPRGVL 195

Query: 189 PSIKKGTVSENVEDLIKGNLGSIPFRQLGNCISVAIGKCNFSDRQILENLISVRKAFKDS 248
           PS+KKGTVS+++  L++ +LGS+PFRQ GN IS+ +GKC FSDR+IL+N+IS R AFK +
Sbjct: 196 PSLKKGTVSDDINSLLEESLGSMPFRQRGNSISLGVGKCYFSDREILQNIISARSAFKAA 255

Query: 249 VSTQKTKKPSILGKTILSTTHGPGIVIDFS 278
           V+ QK+KKP++L KT LS+THGPGIVIDF+
Sbjct: 256 VNNQKSKKPNLLSKTTLSSTHGPGIVIDFA 285

>Suva_2.275 Chr2 complement(477386..478243) [858 bp, 285 aa] {ON}
           YDR116C (REAL)
          Length = 285

 Score =  318 bits (815), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 154/269 (57%), Positives = 202/269 (75%), Gaps = 1/269 (0%)

Query: 11  RKNAFHVSRIIREEITGAEGPIAQVSKLSKDQLKKRELRRFTIRKREAKMPATSHPLYMQ 70
           R+   H +R +  E        +    L+KDQ KKREL+R   R+ EAK PA + PL+M 
Sbjct: 17  RRYLSHTARQLYAEEYKTAAMSSNAPSLTKDQAKKRELKRLAQRRAEAKRPAATSPLHMP 76

Query: 71  VPQALRFLRAAEVGQPLSQQTINLTTLVVSEKGSPNLAGDIAFVTPLKEVKIAIFTNDET 130
           V  ALR+LRAAEVG+P SQQTINLTTLVV E+G+  ++G++ F  PL+ VK+A+FTNDE 
Sbjct: 77  VTMALRYLRAAEVGRPQSQQTINLTTLVVGERGTAPISGNVTFSKPLRYVKVAVFTNDEV 136

Query: 131 QMKIAKEKFNCYVVGGSELISKIKNGEIEVDFDKAFATPDIVQELGS-VARILGPRGVFP 189
           ++K  +EK+   +VGG++L++KIKN E  VDFDKAFATPDIV  L S VARILGPRGV P
Sbjct: 137 KLKELREKYPNLIVGGTDLVAKIKNNESPVDFDKAFATPDIVPTLQSQVARILGPRGVLP 196

Query: 190 SIKKGTVSENVEDLIKGNLGSIPFRQLGNCISVAIGKCNFSDRQILENLISVRKAFKDSV 249
           S+KKGTVS+++  L++ +LGS+PFRQ GN IS+ IGKC F+DR++L+N+IS R AF+ +V
Sbjct: 197 SVKKGTVSDDITSLLQESLGSMPFRQRGNAISLGIGKCYFTDRELLQNIISARTAFRAAV 256

Query: 250 STQKTKKPSILGKTILSTTHGPGIVIDFS 278
             QK KKPS+L KT LS+THGPGIVIDF+
Sbjct: 257 DNQKAKKPSLLSKTTLSSTHGPGIVIDFA 285

>Skud_4.376 Chr4 complement(654375..655232) [858 bp, 285 aa] {ON}
           YDR116C (REAL)
          Length = 285

 Score =  309 bits (792), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 155/270 (57%), Positives = 208/270 (77%), Gaps = 1/270 (0%)

Query: 10  TRKNAFHVSRIIREEITGAEGPIAQVSKLSKDQLKKRELRRFTIRKREAKMPATSHPLYM 69
           TR+   H +  +  E   +    +    L+K+Q KKREL+R   R+ EAK PA ++PLYM
Sbjct: 16  TRRCLSHTASKLYAEEYKSTAMSSNAPSLTKEQAKKRELKRLAQRRAEAKRPAATNPLYM 75

Query: 70  QVPQALRFLRAAEVGQPLSQQTINLTTLVVSEKGSPNLAGDIAFVTPLKEVKIAIFTNDE 129
            V  ALR+LRAAEVG+P SQQTINLTTLVV E+G+  L+G +AF  PL+ +K+A+FTNDE
Sbjct: 76  PVTVALRYLRAAEVGRPQSQQTINLTTLVVGERGTAPLSGSVAFPKPLRYIKVAVFTNDE 135

Query: 130 TQMKIAKEKFNCYVVGGSELISKIKNGEIEVDFDKAFATPDIVQELGS-VARILGPRGVF 188
            ++K  +EK+  +++GG++L+S+IKNGEI VDFDKA+AT DIV  L S VARILGPRGV 
Sbjct: 136 NKLKELREKYPNHLIGGADLVSRIKNGEIPVDFDKAYATADIVPALQSQVARILGPRGVL 195

Query: 189 PSIKKGTVSENVEDLIKGNLGSIPFRQLGNCISVAIGKCNFSDRQILENLISVRKAFKDS 248
           PS+KKGTVS+++  L++ +LGS+PFRQ GN IS+ IGKC F+DR++L+N+I+ R AFK +
Sbjct: 196 PSVKKGTVSDDITSLLQESLGSMPFRQRGNSISLGIGKCYFTDREVLQNIIAARAAFKAA 255

Query: 249 VSTQKTKKPSILGKTILSTTHGPGIVIDFS 278
           VS QK+KKP+IL KT LS+THGPGIVIDF+
Sbjct: 256 VSDQKSKKPNILSKTTLSSTHGPGIVIDFA 285

>Ecym_4302 Chr4 (646221..647048) [828 bp, 275 aa] {ON} similar to
           Ashbya gossypii AGR080W
          Length = 275

 Score =  305 bits (782), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 142/246 (57%), Positives = 200/246 (81%), Gaps = 1/246 (0%)

Query: 33  AQVSKLSKDQLKKRELRRFTIRKREAKMPATSHPLYMQVPQALRFLRAAEVGQPLSQQTI 92
           +  +KLSK+Q+KK+ELR    ++  AK     HPLYM V QA RFLRAAEVGQP SQQTI
Sbjct: 29  SSTTKLSKEQMKKKELRALLQKRAAAKKSPFEHPLYMPVQQAFRFLRAAEVGQPPSQQTI 88

Query: 93  NLTTLVVSEKGSPNLAGDIAFVTPLKEVKIAIFTNDETQMKIAKEKFNCYVVGGSELISK 152
           +LTT+VVS+KG+P L+G+I F  PL++VK+A+FTN++ Q ++A+E+F C++VGG+ELI  
Sbjct: 89  SLTTVVVSDKGAPLLSGNILFPNPLRDVKVAVFTNNKEQEEVAREQFKCHLVGGTELIEA 148

Query: 153 IKNGEIEVDFDKAFATPDIVQELGS-VARILGPRGVFPSIKKGTVSENVEDLIKGNLGSI 211
           IKNG+  +DFDKA ATPD+V +L S +A +LGPR + P++KKGTVSEN+ +LI+ N+ ++
Sbjct: 149 IKNGDTPIDFDKALATPDVVAQLTSQLASVLGPRRLLPAVKKGTVSENIANLIRENMFTV 208

Query: 212 PFRQLGNCISVAIGKCNFSDRQILENLISVRKAFKDSVSTQKTKKPSILGKTILSTTHGP 271
           PFRQ G  +SVA+GKC+FSD+Q+L+N+++V+KAFK +++ Q+ KK SILGKT +++THGP
Sbjct: 209 PFRQRGPFLSVAVGKCDFSDKQLLQNIVAVQKAFKQALADQQGKKSSILGKTTVTSTHGP 268

Query: 272 GIVIDF 277
           GIVIDF
Sbjct: 269 GIVIDF 274

>NCAS0B03810 Chr2 (680870..681814) [945 bp, 314 aa] {ON} Anc_8.268
           YDR116C
          Length = 314

 Score =  301 bits (771), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 146/253 (57%), Positives = 191/253 (75%), Gaps = 1/253 (0%)

Query: 26  TGAEGPIAQVSKLSKDQLKKRELRRFTIRKREAKMPATSHPLYMQVPQALRFLRAAEVGQ 85
           T     I  V  LSK+QLKKRELRR + RK EAK PA+ HPLYM V +ALR++RAAEVG+
Sbjct: 61  TTTSATIPVVPTLSKEQLKKRELRRLSQRKTEAKRPASIHPLYMPVVEALRYIRAAEVGR 120

Query: 86  PLSQQTINLTTLVVSEKGSPNLAGDIAFVTPLKEVKIAIFTNDETQMKIAKEKFNCYVVG 145
           P  QQTI LT+LVV+EKG   L G I+   PLK +K+A+F+ +E  +   KEK++C++VG
Sbjct: 121 PSGQQTITLTSLVVNEKGVAPLNGHISLPRPLKALKVAVFSQNEELLTRMKEKYHCHLVG 180

Query: 146 GSELISKIKNGEIEVDFDKAFATPDIVQELGS-VARILGPRGVFPSIKKGTVSENVEDLI 204
           G ELI+KIKNGE++ DFDKAFA+ D+   L + + + LG RG+ P+ KKGTVS+++E L+
Sbjct: 181 GVELINKIKNGEVKTDFDKAFASSDMANILSAQLGKTLGRRGLLPNAKKGTVSDDLESLL 240

Query: 205 KGNLGSIPFRQLGNCISVAIGKCNFSDRQILENLISVRKAFKDSVSTQKTKKPSILGKTI 264
              +GS+PFRQ GNCIS+ IGKC+FSD +IL N+I+ R A   ++S QK+KKPSILGKT 
Sbjct: 241 ADKIGSLPFRQTGNCISIGIGKCHFSDEEILRNIIAARSAVMKALSEQKSKKPSILGKTT 300

Query: 265 LSTTHGPGIVIDF 277
           LS+THGPGIVIDF
Sbjct: 301 LSSTHGPGIVIDF 313

>NDAI0J01330 Chr10 (309586..310530) [945 bp, 314 aa] {ON} Anc_8.268
           YDR116C
          Length = 314

 Score =  293 bits (750), Expect = 9e-99,   Method: Compositional matrix adjust.
 Identities = 148/291 (50%), Positives = 203/291 (69%), Gaps = 18/291 (6%)

Query: 5   NFLQVTR---KNAFHVSRII--------------REEITGAEGPIAQVSKLSKDQLKKRE 47
           N+  +TR     +FH+SR                +   +G   P A  +KLSK+QLKKRE
Sbjct: 23  NYGVITRMLNTRSFHISRTSSLAAVAATEDASESKSTTSGTNMPPANATKLSKEQLKKRE 82

Query: 48  LRRFTIRKREAKMPATSHPLYMQVPQALRFLRAAEVGQPLSQQTINLTTLVVSEKGSPNL 107
           +RR + RK++A+ PA SHPLYM+V  ALRF+RAAEVG+P  QQTI LTTL+VSEKG+  L
Sbjct: 83  IRRLSQRKQQARQPANSHPLYMEVVDALRFIRAAEVGRPEGQQTITLTTLIVSEKGTSLL 142

Query: 108 AGDIAFVTPLKEVKIAIFTNDETQMKIAKEKFNCYVVGGSELISKIKNGEIEVDFDKAFA 167
            G++    PLKE+KIA+F+ D+  ++  K +FNC +VGG+E +  IK+G I  +FD AFA
Sbjct: 143 NGNMKLFRPLKELKIAVFSTDKELLEEVKSQFNCQLVGGNETVEGIKDGTIRANFDVAFA 202

Query: 168 TPDIVQELGS-VARILGPRGVFPSIKKGTVSENVEDLIKGNLGSIPFRQLGNCISVAIGK 226
           TP+IV  + S + + LG RG+ P+ KKGTVS+++  L+   +G+IPF+Q GN IS+ IGK
Sbjct: 203 TPEIVPFINSQLGKQLGRRGILPNTKKGTVSDDLVTLMNAKMGNIPFKQTGNNISIPIGK 262

Query: 227 CNFSDRQILENLISVRKAFKDSVSTQKTKKPSILGKTILSTTHGPGIVIDF 277
           C FSD+ IL N+I+ R AFK++++ QK K+PSIL KT LS+THGPGIVIDF
Sbjct: 263 CYFSDKDILLNIIAARDAFKEALANQKAKRPSILSKTTLSSTHGPGIVIDF 313

>AGR080W Chr7 (881213..882040) [828 bp, 275 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YDR116C (MRPL1)
          Length = 275

 Score =  291 bits (746), Expect = 1e-98,   Method: Compositional matrix adjust.
 Identities = 140/246 (56%), Positives = 197/246 (80%), Gaps = 1/246 (0%)

Query: 33  AQVSKLSKDQLKKRELRRFTIRKREAKMPATSHPLYMQVPQALRFLRAAEVGQPLSQQTI 92
           A  SKLSKDQLKKRELRR   RK  A+ PA++ PLYM V QALRFLRAAEVGQP +QQTI
Sbjct: 28  ATSSKLSKDQLKKRELRRLAQRKAAARRPASASPLYMPVQQALRFLRAAEVGQPATQQTI 87

Query: 93  NLTTLVVSEKGSPNLAGDIAFVTPLKEVKIAIFTNDETQMKIAKEKFNCYVVGGSELISK 152
           ++ T+V+ +KG+  L+G +   +P++E K+A+FTND  Q + A+ K+ CY+VGG+EL+ +
Sbjct: 88  SVNTMVIGDKGAALLSGTVTLPSPMRETKVAVFTNDPEQAETARTKYGCYLVGGAELVEQ 147

Query: 153 IKNGEIEVDFDKAFATPDIVQELGS-VARILGPRGVFPSIKKGTVSENVEDLIKGNLGSI 211
           +K+GE++VDFDKAFATPDI   + + + R+LGP+G+ PS+KKGTV+ ++ +L+  ++ S 
Sbjct: 148 LKSGEVKVDFDKAFATPDIAPLMAAKLGRVLGPKGLLPSVKKGTVAGDLSELLGDDINST 207

Query: 212 PFRQLGNCISVAIGKCNFSDRQILENLISVRKAFKDSVSTQKTKKPSILGKTILSTTHGP 271
           PF+Q  NCIS+AIGKC+FSDRQI+ENL++V+ AF+ ++++QKTKK S+ G T L++THGP
Sbjct: 208 PFKQRNNCISLAIGKCHFSDRQIMENLLAVQAAFRAAMTSQKTKKTSLFGTTTLTSTHGP 267

Query: 272 GIVIDF 277
           GIVIDF
Sbjct: 268 GIVIDF 273

>KAFR0B05480 Chr2 (1122727..1123569) [843 bp, 280 aa] {ON} Anc_8.268
           YDR116C
          Length = 280

 Score =  279 bits (714), Expect = 9e-94,   Method: Compositional matrix adjust.
 Identities = 141/275 (51%), Positives = 196/275 (71%), Gaps = 10/275 (3%)

Query: 5   NFLQVTRKNAFHVSRIIREEITGAEGPIAQVSKLSKDQLKKRELRRFTIRKREAKMPATS 64
           N L  TR  +   SR+  EE + A       SK +K Q KK+ LR F   +++A+ PA++
Sbjct: 13  NLLFGTR--SLQTSRLWLEEASVAP------SKTNKQQAKKKMLRDFLRSRKQAREPASN 64

Query: 65  HPLYMQVPQALRFLRAAEVGQPLSQQTINLTTLVVSEKGSPNLAGDIAFVTPLKEVKIAI 124
           HPLYM+VP ALRFLRA EVGQP SQQTI LTTLV+SEKG P + G++   TPL+  K+ +
Sbjct: 65  HPLYMKVPDALRFLRAVEVGQPRSQQTITLTTLVISEKGVPPVYGNVQLPTPLRNSKVVV 124

Query: 125 FTNDETQMKIAKEKF-NCYVVGGSELISKIKNGEIEVDFDKAFATPDIVQELG-SVARIL 182
            ++D  +++  ++ F N ++VGG EL+ K KN +IE+DFDK  ATPDI+     ++ ++ 
Sbjct: 125 LSDDPKKLEEVQDNFKNVHLVGGRELVDKFKNEDIEIDFDKVVATPDILNYTNQNLGKMF 184

Query: 183 GPRGVFPSIKKGTVSENVEDLIKGNLGSIPFRQLGNCISVAIGKCNFSDRQILENLISVR 242
           GP+G+ P++KKGTVSEN+ +L+  N+ S+PFRQ   CIS+ IGK  FSD+QILEN+I+ R
Sbjct: 185 GPKGLLPNVKKGTVSENLIELMNENVSSMPFRQRAGCISLGIGKVEFSDKQILENIIATR 244

Query: 243 KAFKDSVSTQKTKKPSILGKTILSTTHGPGIVIDF 277
           +AF +++S QKTKK S LGKT L++THGPGIVIDF
Sbjct: 245 EAFLNTLSNQKTKKQSTLGKTTLTSTHGPGIVIDF 279

>CAGL0B01815g Chr2 complement(165648..166520) [873 bp, 290 aa] {ON}
           similar to uniprot|Q04599 Saccharomyces cerevisiae
           YDR116c
          Length = 290

 Score =  271 bits (694), Expect = 2e-90,   Method: Compositional matrix adjust.
 Identities = 135/247 (54%), Positives = 189/247 (76%), Gaps = 7/247 (2%)

Query: 38  LSKDQLKKRELRRFTIRKREAKMPATSHPLYMQVPQALRFLRAAEVGQPLSQQTINLTTL 97
           L+K+Q KKRE++R  ++K EAK PA  HPLYM +P ALR+LR+AEVG+P   QTI +TTL
Sbjct: 43  LTKEQAKKREMKRLALKKAEAKKPANIHPLYMPIPLALRYLRSAEVGRPTQHQTITVTTL 102

Query: 98  VVSEKGSPNLAGDIAFVTPLKEVKIAIFTNDETQMKIAKEKFN--CYVVGGSELISKIKN 155
           VV++KG+  LAG+I F  PLK++KIAIF++++ ++   K K++    + GG ++I+ IK+
Sbjct: 103 VVADKGNAALAGNILFPHPLKQMKIAIFSSNKEKLDELKSKYSKQVKIAGGEDMIADIKS 162

Query: 156 GEIEVD-FDKAFATPDIVQELGS-VARILGPRGVFPSIKK---GTVSENVEDLIKGNLGS 210
           G+I+VD  +K FATP+I   + S + R+LGP+G+ P++KK    TV E+++ LI+ NLG 
Sbjct: 163 GKIKVDGVNKVFATPEIFPTIASQLGRVLGPKGLMPNLKKQHQNTVGEDLDSLIEENLGQ 222

Query: 211 IPFRQLGNCISVAIGKCNFSDRQILENLISVRKAFKDSVSTQKTKKPSILGKTILSTTHG 270
           + FRQ GN +SV++G+CNFSDR ILEN+I+VR AFK SVS+Q  KKPSILGKT +STT G
Sbjct: 223 VSFRQRGNSLSVSVGRCNFSDRDILENIIAVRNAFKQSVSSQVAKKPSILGKTTISTTAG 282

Query: 271 PGIVIDF 277
           PGIVIDF
Sbjct: 283 PGIVIDF 289

>KNAG0H03210 Chr8 (601470..602327) [858 bp, 285 aa] {ON} Anc_8.268
           YDR116C
          Length = 285

 Score =  265 bits (676), Expect = 5e-88,   Method: Compositional matrix adjust.
 Identities = 129/243 (53%), Positives = 178/243 (73%), Gaps = 1/243 (0%)

Query: 37  KLSKDQLKKRELRRFTIRKREAKMPATSHPLYMQVPQALRFLRAAEVGQPLSQQTINLTT 96
           KL+K+QL++RELR+    K  AK PA+   +Y+ VP+A+R LRA EVGQP SQQTI LTT
Sbjct: 43  KLTKEQLRRRELRKMIRSKMLAKRPASQDKVYLSVPEAMRILRAVEVGQPTSQQTITLTT 102

Query: 97  LVVSEKGSPNLAGDIAFVTPLKEVKIAIFTNDETQMKIAKEKFNCYVVGGSELISKIKNG 156
           +VVSEKG P L GD+   TPLK V+IA F+ D   +K  +E+    +VGG+ELI ++K+G
Sbjct: 103 MVVSEKGVPPLHGDVVLPTPLKPVRIAAFSADPELLKRLQEEVELEIVGGAELIDQLKSG 162

Query: 157 EIEVDFDKAFATPDIVQELGS-VARILGPRGVFPSIKKGTVSENVEDLIKGNLGSIPFRQ 215
           E+ V FDKAFATPDI  +L S +  +LG RG+ P+IKKGTV  ++  +I+  +G++PFRQ
Sbjct: 163 EVPVQFDKAFATPDIAPQLNSKLGALLGRRGLLPNIKKGTVGPDLLAMIRSKVGAMPFRQ 222

Query: 216 LGNCISVAIGKCNFSDRQILENLISVRKAFKDSVSTQKTKKPSILGKTILSTTHGPGIVI 275
               ++  I KC+FSDRQ+L NLI+ R+AF+ ++  QK+KK SILG++ LS+THGPGIVI
Sbjct: 223 RAANLAFGIAKCHFSDRQVLGNLIAAREAFQLAIQNQKSKKRSILGRSTLSSTHGPGIVI 282

Query: 276 DFS 278
           D +
Sbjct: 283 DLA 285

>TBLA0I03190 Chr9 complement(768942..769667) [726 bp, 241 aa] {ON}
           Anc_8.268 YDR116C
          Length = 241

 Score =  194 bits (493), Expect = 6e-61,   Method: Compositional matrix adjust.
 Identities = 99/221 (44%), Positives = 147/221 (66%), Gaps = 1/221 (0%)

Query: 57  EAKMPATSHPLYMQVPQALRFLRAAEVGQPLSQQTINLTTLVVSEKGSPNLAGDIAFVTP 116
           +A++ + +HPL M+VP ALR+LRA E G+  S+QT+ L T+V + +G+  L G+I F   
Sbjct: 21  KARILSKNHPLKMEVPLALRYLRAIESGRKSSEQTVTLQTVVAAARGNTPLRGEINFHML 80

Query: 117 LKEVKIAIFTNDETQMKIAKEKFNCYVVGGSELISKIKNGEIEVDFDKAFATPDIVQELG 176
           +++  IA+FT D  Q KIAKE     ++GGSELI KI +GE ++ F  AFAT D+VQ+L 
Sbjct: 81  IRKPVIAVFTEDPEQHKIAKE-MGIDIIGGSELIDKIASGEQKITFQTAFATTDMVQDLA 139

Query: 177 SVARILGPRGVFPSIKKGTVSENVEDLIKGNLGSIPFRQLGNCISVAIGKCNFSDRQILE 236
            VA+ LG + V P +KK TV +N+ +L++  L  +PF +  + IS  +GKC+F+D +IL 
Sbjct: 140 RVAQKLGKQKVLPQLKKKTVGDNIRELLQDKLYVVPFAEKASFISFPVGKCSFTDEEILR 199

Query: 237 NLISVRKAFKDSVSTQKTKKPSILGKTILSTTHGPGIVIDF 277
           NLI  R+  + ++  Q  KKPS + K  L++THGPGI ID 
Sbjct: 200 NLIKAREGLQKALREQNNKKPSTIIKATLTSTHGPGIDIDL 240

>Kwal_47.17547 s47 (448414..452136) [3723 bp, 1240 aa] {ON} YGL006W
           (PMC1) - putative vacuolar Ca2+ ATPase [contig 207] FULL
          Length = 1240

 Score = 32.3 bits (72), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 31/112 (27%), Positives = 53/112 (47%), Gaps = 8/112 (7%)

Query: 111 IAFVTPLKEVKIAIFTNDETQMKIAKEKFNCYVVGGSELISKIKNG-EIEVDFDKAFATP 169
           I F+  L  +K     +D T  +      N ++VG + ++  +  G  + V    AFAT 
Sbjct: 345 ILFMRFLANLKKGGELHDLTPAQKGSRFMNIFIVGITVIVVAVPEGLPLAVTLALAFATT 404

Query: 170 DIVQELGSVARIL------GPRGVFPSIKKGTVSENVEDLIKGNLGSIPFRQ 215
            + ++ G++ R+L      G      S K GT++EN   ++KG LGS  F +
Sbjct: 405 RMAKD-GNLVRVLRACETMGSATAVCSDKTGTLTENRMTVVKGFLGSTFFDE 455

>Smik_7.284 Chr7 (477865..481398) [3534 bp, 1177 aa] {ON} YGL006W
           (REAL)
          Length = 1177

 Score = 32.3 bits (72), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 19/55 (34%), Positives = 31/55 (56%), Gaps = 7/55 (12%)

Query: 165 AFATPDIVQELGSVARIL------GPRGVFPSIKKGTVSENVEDLIKGNLGSIPF 213
           AFAT  + Q+ G++ R+L      G      S K GT++EN+  +++G+LG   F
Sbjct: 414 AFATTRMTQD-GNLVRVLRSCETMGSATAICSDKTGTLTENIMSVVRGSLGDSKF 467

>Skud_7.281 Chr7 (488922..492455) [3534 bp, 1177 aa] {ON} YGL006W
           (REAL)
          Length = 1177

 Score = 32.0 bits (71), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 20/55 (36%), Positives = 32/55 (58%), Gaps = 7/55 (12%)

Query: 165 AFATPDIVQELGSVARIL------GPRGVFPSIKKGTVSENVEDLIKGNLGSIPF 213
           AFAT  + Q+ G++ R+L      G      S K GT++ENV ++++G LG+  F
Sbjct: 414 AFATTRMTQD-GNLVRVLRSCETMGSATAVCSDKTGTLTENVMNVVRGFLGNSKF 467

>Smik_4.684 Chr4 (1215469..1216176) [708 bp, 235 aa] {ON} YDR412W
           (REAL)
          Length = 235

 Score = 30.8 bits (68), Expect = 3.0,   Method: Compositional matrix adjust.
 Identities = 30/106 (28%), Positives = 45/106 (42%), Gaps = 14/106 (13%)

Query: 129 ETQMKIAKEKFNCYVVGGSELISKIKNGE---IEVDFDKAFATPDIVQELGSVARILGPR 185
           E Q+K  KE  N         I   KNG+    E + D+++   D  +E     R    R
Sbjct: 82  EEQLKTFKESLNLEAE-----IEDAKNGDTKGFEAESDESWRGFDSDKEASEDDR--NER 134

Query: 186 GVFPSIKKGTVSENVEDLIKGNLGSIP----FRQLGNCISVAIGKC 227
           GV P +KKG ++E  +D     L S+     F  L +  +V + K 
Sbjct: 135 GVKPILKKGAITEVYDDSTTVELESLEPNDNFEYLAHLNNVKLEKA 180

>CAGL0A00517g Chr1 (58830..62198) [3369 bp, 1122 aa] {ON} similar to
           uniprot|P38929 Saccharomyces cerevisiae YGL006w PMC1
          Length = 1122

 Score = 31.2 bits (69), Expect = 3.9,   Method: Compositional matrix adjust.
 Identities = 19/59 (32%), Positives = 32/59 (54%), Gaps = 7/59 (11%)

Query: 165 AFATPDIVQELGSVARIL------GPRGVFPSIKKGTVSENVEDLIKGNLGSIPFRQLG 217
           AFAT  + ++ G++ R+L      G      S K GT++EN+  +++G LG   F  +G
Sbjct: 377 AFATTRMTKD-GNLVRVLRSCETMGSATAVCSDKTGTLTENIMTVVRGTLGRAGFDDIG 434

>TBLA0C04010 Chr3 complement(964128..967562) [3435 bp, 1144 aa] {ON}
           Anc_4.117 YGL006W
          Length = 1144

 Score = 30.8 bits (68), Expect = 5.2,   Method: Compositional matrix adjust.
 Identities = 46/189 (24%), Positives = 80/189 (42%), Gaps = 28/189 (14%)

Query: 92  INLTTLVVSEKGSPNLAGDIAFVTPLKEVKIAIFTNDE-----TQMKIAKEKFNCYVVGG 146
           I LT L  S     +LAG I F+T   +  I  F  D      T  + +    + ++   
Sbjct: 326 IRLTHLADSISIYGSLAGLILFLTLFIKFCINCFKKDGKFVDLTPAEKSSRFMDIFITSI 385

Query: 147 SELISKIKNG-EIEVDFDKAFATPDIVQELGSVARIL------GPRGVFPSIKKGTVSEN 199
           + ++  +  G  + V    AFAT  + ++ G++ RIL      G      S K GT++EN
Sbjct: 386 TIIVVAVPEGLPLAVTLALAFATTRMTKD-GNLVRILRACETMGSATAICSDKTGTLTEN 444

Query: 200 VEDLIKGNLGSIPFRQLG---------NCISVAIGKCNFSDRQILENLISVRKAFKDSVS 250
              +++G  G+  F +           N I+  + K       +L N++    AF++S  
Sbjct: 445 SMSVVRGIFGNTFFNKKNSKDILPADKNIIATPLRK------DLLANIVLNSTAFENSKY 498

Query: 251 TQKTKKPSI 259
               ++PSI
Sbjct: 499 KPTGRQPSI 507

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.318    0.135    0.371 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 26,337,840
Number of extensions: 1054764
Number of successful extensions: 3037
Number of sequences better than 10.0: 31
Number of HSP's gapped: 3105
Number of HSP's successfully gapped: 31
Length of query: 278
Length of database: 53,481,399
Length adjustment: 108
Effective length of query: 170
Effective length of database: 41,097,471
Effective search space: 6986570070
Effective search space used: 6986570070
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 65 (29.6 bits)