Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
TPHA0J007608.266ON24924912880.0
Kpol_392.48.266ON2812372518e-25
SAKL0H16940g8.266ON3032401746e-14
AGR082C8.266ON2662241665e-13
TDEL0F039308.266ON2802341666e-13
NCAS0B050408.266ON2732391491e-10
KLTH0G13596g8.266ON2671741383e-09
Ecym_43048.266ON2892351383e-09
Kwal_56.237778.266ON2672261374e-09
NDAI0B020108.266ON2812401331e-08
ZYRO0C01562g8.266ON2772291135e-06
Suva_10.1758.266ON2992411031e-04
KAFR0B027408.266ON2562301012e-04
KLLA0F19228g8.266ON3051901003e-04
KNAG0G020608.266ON286235985e-04
YLR091W (GEP5)8.266ON29376940.001
Smik_12.1508.266ON292180820.050
Skud_12.1598.266ON294107780.18
KNAG0B024907.371ON73367683.5
TBLA0E044308.262ON48193666.7
TPHA0D011708.661ON91587657.8
TDEL0F040508.278ON64828659.7
NOTE: 1 genes in the same pillar as TPHA0J00760 were not hit in these BLAST results
LIST: CAGL0L12320g

BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= TPHA0J00760
         (249 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

TPHA0J00760 Chr10 (178665..179414) [750 bp, 249 aa] {ON} Anc_8.2...   500   0.0  
Kpol_392.4 s392 complement(4596..5441) [846 bp, 281 aa] {ON} com...   101   8e-25
SAKL0H16940g Chr8 complement(1488620..1489531) [912 bp, 303 aa] ...    72   6e-14
AGR082C Chr7 complement(882744..883544) [801 bp, 266 aa] {ON} Sy...    69   5e-13
TDEL0F03930 Chr6 (731115..731957) [843 bp, 280 aa] {ON} Anc_8.26...    69   6e-13
NCAS0B05040 Chr2 (935985..936806) [822 bp, 273 aa] {ON} Anc_8.26...    62   1e-10
KLTH0G13596g Chr7 complement(1165293..1166096) [804 bp, 267 aa] ...    58   3e-09
Ecym_4304 Chr4 complement(647890..648759) [870 bp, 289 aa] {ON} ...    58   3e-09
Kwal_56.23777 s56 complement(701822..702625) [804 bp, 267 aa] {O...    57   4e-09
NDAI0B02010 Chr2 (498932..499777) [846 bp, 281 aa] {ON} Anc_8.26...    56   1e-08
ZYRO0C01562g Chr3 complement(111407..112240) [834 bp, 277 aa] {O...    48   5e-06
Suva_10.175 Chr10 (327133..328032) [900 bp, 299 aa] {ON} YLR091W...    44   1e-04
KAFR0B02740 Chr2 (561513..562283) [771 bp, 256 aa] {ON} Anc_8.26...    44   2e-04
KLLA0F19228g Chr6 (1781494..1782411) [918 bp, 305 aa] {ON} conse...    43   3e-04
KNAG0G02060 Chr7 (468363..469223) [861 bp, 286 aa] {ON} Anc_8.26...    42   5e-04
YLR091W Chr12 (322297..323178) [882 bp, 293 aa] {ON}  GEP5Protei...    41   0.001
Smik_12.150 Chr12 (302200..303078) [879 bp, 292 aa] {ON} YLR091W...    36   0.050
Skud_12.159 Chr12 (305467..306348) [882 bp, 294 aa] {ON} YLR091W...    35   0.18 
KNAG0B02490 Chr2 complement(484676..486877) [2202 bp, 733 aa] {O...    31   3.5  
TBLA0E04430 Chr5 (1136737..1138182) [1446 bp, 481 aa] {ON} Anc_8...    30   6.7  
TPHA0D01170 Chr4 complement(245675..248422) [2748 bp, 915 aa] {O...    30   7.8  
TDEL0F04050 Chr6 complement(747631..749577) [1947 bp, 648 aa] {O...    30   9.7  

>TPHA0J00760 Chr10 (178665..179414) [750 bp, 249 aa] {ON} Anc_8.266
           YLR091W
          Length = 249

 Score =  500 bits (1288), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 249/249 (100%), Positives = 249/249 (100%)

Query: 1   MLKLNRNILKNHESLDFKQIILDGLNRLPLHPNTLDLLQKQVHTKLTKNSELIELLFDYN 60
           MLKLNRNILKNHESLDFKQIILDGLNRLPLHPNTLDLLQKQVHTKLTKNSELIELLFDYN
Sbjct: 1   MLKLNRNILKNHESLDFKQIILDGLNRLPLHPNTLDLLQKQVHTKLTKNSELIELLFDYN 60

Query: 61  NAFINKQKPGQLKCLQRIIFKTHLIFNNSYKNYDHLKAFKLKYNYLTHNWPYERHDILFA 120
           NAFINKQKPGQLKCLQRIIFKTHLIFNNSYKNYDHLKAFKLKYNYLTHNWPYERHDILFA
Sbjct: 61  NAFINKQKPGQLKCLQRIIFKTHLIFNNSYKNYDHLKAFKLKYNYLTHNWPYERHDILFA 120

Query: 121 ANKNVPETKALEYLWNNCNSDNLAFMGSKFMKEITRQIQNKYITEGDYVHVFLKERYNSE 180
           ANKNVPETKALEYLWNNCNSDNLAFMGSKFMKEITRQIQNKYITEGDYVHVFLKERYNSE
Sbjct: 121 ANKNVPETKALEYLWNNCNSDNLAFMGSKFMKEITRQIQNKYITEGDYVHVFLKERYNSE 180

Query: 181 IHTLSEIIDEKEIEINLFGELFKQLHYINTINKLQIPIVILPLNALGLKIPKSRLYNKFK 240
           IHTLSEIIDEKEIEINLFGELFKQLHYINTINKLQIPIVILPLNALGLKIPKSRLYNKFK
Sbjct: 181 IHTLSEIIDEKEIEINLFGELFKQLHYINTINKLQIPIVILPLNALGLKIPKSRLYNKFK 240

Query: 241 KKLQVFGVF 249
           KKLQVFGVF
Sbjct: 241 KKLQVFGVF 249

>Kpol_392.4 s392 complement(4596..5441) [846 bp, 281 aa] {ON}
           complement(4596..5441) [846 nt, 282 aa]
          Length = 281

 Score =  101 bits (251), Expect = 8e-25,   Method: Compositional matrix adjust.
 Identities = 79/237 (33%), Positives = 124/237 (52%), Gaps = 40/237 (16%)

Query: 17  FKQIILDGLNRLPLHPNTLDLLQKQVH-TKLTKNSELIELLFDYNNAFINKQKPGQLKCL 75
            K I+L+ L RLPLH  TLD+L++++H   L    E + +L +Y  + IN +   + + L
Sbjct: 11  LKPILLESLERLPLHKPTLDILERRIHVADLPFMEEYVGILNEYEISKINSKVENESRAL 70

Query: 76  QRIIFKTHLIFNNSYKNYDHLKAFKLKYNYLTHNWPYERH-DILFAANKNVPETKALEYL 134
           ++I+ KTH+++NN  K  +HL+ FK  Y  L H+WPYE H D+L  A    P T +L YL
Sbjct: 71  EKIVKKTHIVWNND-KFPNHLEKFKNHYMELLHHWPYEFHSDVLNMAR---PGTGSLIYL 126

Query: 135 WNNC-NSDNLAFMGSKFMKEITRQIQNKYITEGDYVHVFLKERYNSEIHTLSEIIDEKEI 193
              C N+D+      +F      QI NK+    D                  ++ DE+ +
Sbjct: 127 ---CLNNDD------RFFNFYKSQINNKWFNSVDQY----------------KLTDEQRV 161

Query: 194 EINLFGELFKQLHY------INTINKLQIPIVILPLNALGLKIPKSRLYNKFKKKLQ 244
            I  + ++FKQ+ +      I+ +NK  +PIV +PL  +G  IP  R+ N F KK+ 
Sbjct: 162 SI--YNDIFKQIFFLKRHTTISEVNKNMVPIVEVPLKPIGCDIPACRIKNLFNKKVD 216

>SAKL0H16940g Chr8 complement(1488620..1489531) [912 bp, 303 aa]
           {ON} weakly similar to uniprot|Q12393 Saccharomyces
           cerevisiae YLR091W Hypothetical ORF
          Length = 303

 Score = 71.6 bits (174), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 72/240 (30%), Positives = 118/240 (49%), Gaps = 32/240 (13%)

Query: 19  QIILDGLNRLPLHPNTLDLLQKQVHTKLTKNSELIEL---LFDYNNAFINKQKPGQLKCL 75
           + +L+ L  LPL   TLDLL+  V  KL  ++ L  L   LFDY       Q     K L
Sbjct: 5   KTLLNFLECLPLDTRTLDLLEGTV--KLCSSALLDTLEQKLFDY-------QANENSKSL 55

Query: 76  QRIIFKTHLIFNNSYKNYDHLKAFKLKYNYLTHNWPYERHDILFAANKNVPETKALEYLW 135
           + I++ T+  +NN+     H++ F+  Y+ L  +WPYERH  L + +   PE  ++ ++W
Sbjct: 56  EWIVYNTYFHWNNTTP--LHIQKFRQNYHDLREHWPYERHRDLLSMS--APERVSIRHMW 111

Query: 136 NNCNS---DNLAFMGSKFMKEITRQIQNKYITEGDYVHVFLKERYN--SEIHTLSEIIDE 190
           N+ N     ++ F  + + +    +  N +       +  L+E  N  S + TL +I   
Sbjct: 112 NDNNKKVLSSMRFERNPWCRNDPLEQLNAFNVNKILNYQALEEEKNRGSMLSTLPKI--- 168

Query: 191 KEIEINL-FGELFKQLHYINT-------INKLQIPIVILPLNALGLKIPKSRLYNKFKKK 242
            ++E+ L F E+F+   ++           KL IPIV +P+  LG  IP  R+ N FK+K
Sbjct: 169 SQLELTLLFHEIFQHYMFLKRNPKLCKYGKKLPIPIVEIPMKPLGQDIPLVRIRNLFKRK 228

>AGR082C Chr7 complement(882744..883544) [801 bp, 266 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YLR091W
          Length = 266

 Score = 68.6 bits (166), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 65/224 (29%), Positives = 102/224 (45%), Gaps = 37/224 (16%)

Query: 25  LNRLPLHPNT----LDLLQKQVHTKLTKNSELIELLFDYNNAFINKQKPGQLKCLQRIIF 80
           ++RLPLH  T    L  L KQ     T+  EL+E L    N F+ K   G  + LQR++F
Sbjct: 9   VSRLPLHRATSEVILAYLSKQQAQYPTERIELVEPL----NDFLRK---GGHQGLQRLVF 61

Query: 81  KTHLIFNNSYKNYDHLKAFKLKYNYLTHNWPYERHDILFAANKNVPETKALEYLWNNCNS 140
             H  F    +  +HL+  +     L   WPYERH  L A +     +++L  LW +   
Sbjct: 62  HVH--FQLMLRAPEHLRLLRRHREELQRFWPYERHHSLLALSDV--RSQSLRRLWEDGQE 117

Query: 141 DNLAFMGSKFMKEITRQIQNKYITEGDYVHVFLKERYNSEIHTLSEIIDEKEIEINLFGE 200
           + L  M         +  ++ ++ EGD     + ERY      L++   E E+   +F +
Sbjct: 118 EVLQQM---------QYCRHHWLREGD-----VPERY-----ALTQAQRE-EVLHRVFAQ 157

Query: 201 --LFKQLHYINTINKLQIPIVILPLNALGLKIPKSRLYNKFKKK 242
               KQ   + ++ +L IP+V + +  LG  IP  R+   FK K
Sbjct: 158 YMFLKQRPALWSVRRLPIPVVEIGMTPLGFDIPDVRVDGLFKDK 201

>TDEL0F03930 Chr6 (731115..731957) [843 bp, 280 aa] {ON} Anc_8.266
           YLR091W
          Length = 280

 Score = 68.6 bits (166), Expect = 6e-13,   Method: Compositional matrix adjust.
 Identities = 65/234 (27%), Positives = 103/234 (44%), Gaps = 42/234 (17%)

Query: 19  QIILDGLNRLPLHPNTLDLLQKQVHTKLTKNSELIELLFDYNNAFINKQKPGQLKCLQRI 78
           Q +L  L +LPLH  TLDLL  ++     K + +I L    +N   ++ +  ++K L+ I
Sbjct: 7   QPLLKALEKLPLHSKTLDLLACKLKGDELK-TVIIPLAKLVSNLESSRAETQRIKALESI 65

Query: 79  IFKTHLIFNNSYKNYDHLKAFKLKYNYLTHNWPYERHDILFAANKNVPETKALEYLWNNC 138
           I+ TH ++ +      HLK F+  Y  +  +WPYERH  +   N   P + +L Y W + 
Sbjct: 66  IYHTHFVWGSPLPV--HLKMFQSHYTDMLMHWPYERHRSIL--NMEKPRSTSLRYRWEDS 121

Query: 139 NSDNLAFMGSKFMKEITRQIQNKYITEGDYVHVFLKERYNSEIHTLSEIIDEKEIEINLF 198
           +   L+         I   I +K +T                       I ++++   LF
Sbjct: 122 SKTVLSMAEYSKNPWIEDNILSKKLT-----------------------IIQRDL---LF 155

Query: 199 GELFKQLHYI---------NTINKLQIPIVILPLNALGLKIPKSRLYNKFKKKL 243
             +F   HY+         N    L IPIV +P+  LG  I  SR+ N FK K+
Sbjct: 156 HSVFS--HYLFLKANPRLCNNGRNLPIPIVEIPMRPLGNDIAVSRIKNLFKSKV 207

>NCAS0B05040 Chr2 (935985..936806) [822 bp, 273 aa] {ON} Anc_8.266
           YLR091W
          Length = 273

 Score = 62.0 bits (149), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 64/239 (26%), Positives = 103/239 (43%), Gaps = 59/239 (24%)

Query: 21  ILDGLNRLPLHPNTLDLLQKQVHT---KLTKNS---ELIELLFDYNNAFINKQKPGQLKC 74
           +L  L  +PLH  TLDLL++++ T   K T++S    L++LL  Y    I + K G  K 
Sbjct: 9   LLRSLPNVPLHRKTLDLLERKIQTANDKSTRHSFKVPLLQLLCKYERYNIQEDKRGIEKV 68

Query: 75  LQRIIFKTHLIFNNSYKNYDHLKAFKLKYNYLTHNWPYERHDILFAANKNVPETKALEYL 134
           L+ I + T+ I+NN   +  HL+ F+     L   WP   H  +        +TK    +
Sbjct: 69  LESIAYNTYFIWNNPVPS--HLQVFQKNNEMLRRYWPCVYHRGM--------DTKRDSII 118

Query: 135 WNNCNSDNLAFMGSKFMKEITRQIQNKYITEGDYVHVFLKERYNSEIHTLSEIIDEKEIE 194
                S+N    G   +K     IQ     E                            E
Sbjct: 119 VQWAKSNN----GDALLKGTMNHIQPGASAE----------------------------E 146

Query: 195 INLFGELFKQLHYI---------NTINKLQIPIVILPLNALGLKIPKSRLYNKFKKKLQ 244
           + +F ++F+  HYI         +   +LQ P+V +P+N++G  IP+ R+ N F+KK+ 
Sbjct: 147 LLMFKKIFQ--HYIFLTLNARITSNAKRLQPPLVGVPMNSMGETIPQVRVKNLFRKKVS 203

>KLTH0G13596g Chr7 complement(1165293..1166096) [804 bp, 267 aa]
           {ON} weakly similar to uniprot|Q12393 Saccharomyces
           cerevisiae YLR091W Hypothetical ORF
          Length = 267

 Score = 57.8 bits (138), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 46/174 (26%), Positives = 79/174 (45%), Gaps = 24/174 (13%)

Query: 70  GQLKCLQRIIFKTHLIFNNSYKNYDHLKAFKLKYNYLTHNWPYERHDILFAANKNVPETK 129
           G  K L+ I+  T+  + N  ++  H+K F+  Y  L  +WPYE H  + + +   P+T+
Sbjct: 44  GSSKSLESIVHLTYFHWCN--EDAPHIKKFREHYAELRDHWPYEFHRSILSMD--TPKTQ 99

Query: 130 ALEYLWNNCNSDNLAFMGSKFMKEITRQIQNKYITEGDYVHVFLKERYNSEIHTLSEIID 189
           ++ +LW++ +   L+ M  +                  Y H    E   S +  L   + 
Sbjct: 100 SIRFLWSSNSPKVLSKMSYE-----------------KYAHD--TEERPSRLTELQRTVQ 140

Query: 190 EKEIEINLFGELFKQLHYINTINKLQIPIVILPLNALGLKIPKSRLYNKFKKKL 243
             E+    F  L  + H   T   L +PIV +P+  LG  IP+ R+ N FK+K+
Sbjct: 141 FHEV-FQHFLFLKSRPHLCKTRKGLAVPIVEIPMKPLGQNIPEVRVRNLFKRKI 193

>Ecym_4304 Chr4 complement(647890..648759) [870 bp, 289 aa] {ON}
           similar to Ashbya gossypii AGR082C
          Length = 289

 Score = 57.8 bits (138), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 56/235 (23%), Positives = 109/235 (46%), Gaps = 30/235 (12%)

Query: 21  ILDGLNRLPLHPNTLDLLQKQVHTKLTKNSELIELLFDYNNAFINKQKPGQLKCLQRIIF 80
           +L+ ++RLPLH +T  ++   V +      + ++++   N   ++    G++  L+R+IF
Sbjct: 8   VLEIVSRLPLHAHTKKVIADNVGSVGKGEFKRVDVIEPINRYLLS----GEVSYLRRVIF 63

Query: 81  KTHLIFNNSYKNYDHLKAFKLKYNYLTHNWPYERHDILFAANKNVPETKALEYLWNNCNS 140
             +    N     +H++ F+     L   WPYERH  L +  +  P   +  YLW+  N+
Sbjct: 64  DVYFRILNP--KAEHVRQFERYLKELQLFWPYERHSCLLSGER--PYKDSARYLWSRNNA 119

Query: 141 DNLAFMGSKFMKEI-TRQIQNKYITEGDYVHVFLKE----RYNSEIHTLSEIIDEKEIEI 195
             L  M  ++ + +  R  + K+  +  +   F ++    R+  + +TL E        I
Sbjct: 120 KVLDIM--RYDRHLWLRDREPKFSLDSIFGEPFTQQLQYLRHEKDKNTLGET-----ERI 172

Query: 196 NLFGELFKQLHYINTINK--------LQIPIVILPLNALGLKIPKSRLYNKFKKK 242
            L   +F   HY+   ++        L IPIV + ++ LG  +P  R+ N F+K+
Sbjct: 173 ALLKLIFS--HYLFVKSRPTLCGHKNLPIPIVEVGMSPLGEDMPDVRIDNLFRKR 225

>Kwal_56.23777 s56 complement(701822..702625) [804 bp, 267 aa] {ON}
           YLR091W - Hypothetical ORF [contig 173] FULL
          Length = 267

 Score = 57.4 bits (137), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 59/226 (26%), Positives = 97/226 (42%), Gaps = 47/226 (20%)

Query: 25  LNRLPLHPNTLDLLQKQVHTKLTKNSELIELLFDYNNAFINKQKPGQLKCLQRIIFKTHL 84
           L +LPL   TL L++K++     ++   +EL   Y       +     K L+ II  T+ 
Sbjct: 8   LEKLPLDVRTLKLIEKRLER--AESLRFLELARQY-------EAKKDYKTLENIIHHTYF 58

Query: 85  IFNNSYKNYDHLKAFKLKYNYLTHNWPYERHDILFAANKNVPETKALEYLWNNCNSDNLA 144
            + N      H+KAF+  YN L   WPYE H  +       P+++++ +LW+  N   LA
Sbjct: 59  SWENEIPQ--HIKAFREHYNELRDFWPYECHRTILGMQS--PKSQSIRFLWSAGNPRVLA 114

Query: 145 FMGSKFMKEITRQIQNKYITEGDYVHVFLKERYNSEIHTLSEIIDEKEIEINLFGELFKQ 204
            M              +Y + G          +N E     E + E E  +  F E+F+ 
Sbjct: 115 AM--------------RYGSYG----------WNRE--GGGERLTELERTLR-FHEIFQH 147

Query: 205 LHYINTINK-------LQIPIVILPLNALGLKIPKSRLYNKFKKKL 243
             ++    +       L +PIV +P+  LG  I   R+ N FK+K+
Sbjct: 148 FLFLQRRPQLCKNRKHLSVPIVEIPMKPLGQNIADVRIKNLFKRKV 193

>NDAI0B02010 Chr2 (498932..499777) [846 bp, 281 aa] {ON} Anc_8.266
           YLR091W
          Length = 281

 Score = 55.8 bits (133), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 61/240 (25%), Positives = 107/240 (44%), Gaps = 55/240 (22%)

Query: 19  QIILDGLNRLPLHPNTLDLLQKQVHTKLTKNSE-----LIELLFDYNNAFINKQKPGQLK 73
           + +L  L  LPLH NTL  L+++  T+  K ++     L+ L+  Y  A  + Q     K
Sbjct: 10  KTLLSSLQNLPLHSNTLAQLERKCLTRNIKATKSFKIPLLTLINSYEKAQASGQSKLSNK 69

Query: 74  CLQRIIFKTHLIFNNSYKNYDHLKAFKLKYNYLTHNWPYERHDILFAANKNVPETKALEY 133
            L+ II+ T+  + N      HLK F+ +Y+ L   WP+  H  + +   ++  T     
Sbjct: 70  TLESIIYHTYFEWTNDLA--SHLKPFQRQYSTLLTFWPHIYHSKIDSKKNSIILT----- 122

Query: 134 LWN-NCNSDNLAFMGSKFMKEITRQIQNKYITEGDYVHVFLKERYNSEIHTLSEIIDEKE 192
            WN + NS N+                             L+E  +   +T S +  +K+
Sbjct: 123 -WNKSSNSKNM-----------------------------LRELLSHLNYTQSLVPQKKD 152

Query: 193 IEINLFGELFKQLHYI---------NTINKLQIPIVILPLNALGLKIPKSRLYNKFKKKL 243
            ++ +F ++++  HYI         +   +L  PIV +P+NA+G  IPK R+ N  + K+
Sbjct: 153 FQV-IFKKIYQ--HYIFLSLNPSLCSNGKRLPSPIVEIPMNAMGYDIPKKRINNLLRSKI 209

>ZYRO0C01562g Chr3 complement(111407..112240) [834 bp, 277 aa] {ON}
           weakly similar to uniprot|Q12393 Saccharomyces
           cerevisiae YLR091W Hypothetical ORF
          Length = 277

 Score = 48.1 bits (113), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 58/229 (25%), Positives = 97/229 (42%), Gaps = 45/229 (19%)

Query: 24  GLNRLPLHPNTLDLLQKQVHTKLTKNSELIELLFDYNNAFINKQKPGQLKCLQRIIFKTH 83
            + +LPLH  T  +L+        +NS    LL   + +   K      K L+ +I KTH
Sbjct: 16  SIRQLPLHIETQKVLEF-----YCRNSSYKSLLVAQDISEFEKH--NDHKYLEALIQKTH 68

Query: 84  LIFNNSYKNYDHLKAFKLKYNYLTHNWPYERHDILFAANKNVPETKALEYLWNNCNSDNL 143
            +++N    +  LK F+L +  LT++WPYE    L + +   P  ++  YLW +     L
Sbjct: 69  FLWDNPLPPF--LKRFQLYHKELTNHWPYEYQRSLLSMSN--PRKESQGYLWRD--GKEL 122

Query: 144 AFMGSKFMKEITRQIQNKYITEGDYVHVFLKERYNSEIHTLSEIIDEKEIEINLFGELFK 203
           A    +F K       +++  E       + ER + E  T             L   +F 
Sbjct: 123 ALSNLRFEK-------HRWADEN------IIERLSPEQGT------------QLLHSIFH 157

Query: 204 QLHYINTI-------NKLQIPIVILPLNALGLKIPKSRLYNKFKKKLQV 245
           Q  ++ +         K+ +PIV +PL  +G  +   R+ N FK+K  V
Sbjct: 158 QYFFLKSHARLCYNNRKIPVPIVEIPLRPMGNDVADCRIRNLFKRKTAV 206

>Suva_10.175 Chr10 (327133..328032) [900 bp, 299 aa] {ON} YLR091W
           (REAL)
          Length = 299

 Score = 44.3 bits (103), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 56/241 (23%), Positives = 96/241 (39%), Gaps = 34/241 (14%)

Query: 20  IILDGLNRLPLHPNTLDLLQKQVHTKLTK----------NSELIELLFDYNNAFINKQKP 69
           ++L  ++ LPLH     + +  + T+LT              L E L  Y  A   +   
Sbjct: 8   LLLPFIDSLPLH----QITKTALTTRLTDIHSDFKFKEIAVPLTESLQVYEKAQRAQDLR 63

Query: 70  GQLKCLQRIIFKTHLIFNNSYKNYDHLKAFKLKYNYLTHNWPYERHDILFAANKNVPETK 129
             LK L+ I+++TH  +NN    + HL  F+  Y++L  +WP+E H  L     ++P   
Sbjct: 64  TSLKALESIVYQTHFQWNNPRPRHAHL--FQKHYHFLLSHWPFENHRSLV---DSIPA-- 116

Query: 130 ALEYLWNNCNSDNLAFMGSKFMKEITR--QIQNKYITEGDYVHVFLKERYNSEIHTLSEI 187
                  N    +L   G+    + T   Q++N ++               + I  L   
Sbjct: 117 ------QNGKLISLTSKGNWLKADWTTLFQVKNPWVRTPPPPPSPSLSLAQNSIAELDAF 170

Query: 188 IDEKEIEINLFGELFKQL----HYINTINKLQIPIVILPL-NALGLKIPKSRLYNKFKKK 242
             E+   +   G  +K L    H      K   P+V +P+ NALG   P  ++   F ++
Sbjct: 171 TAERTFLVKSLGNHYKFLVTNSHLSYNHKKYPSPVVQIPIRNALGEISPPKQISKLFARQ 230

Query: 243 L 243
           L
Sbjct: 231 L 231

>KAFR0B02740 Chr2 (561513..562283) [771 bp, 256 aa] {ON} Anc_8.266
           YLR091W
          Length = 256

 Score = 43.5 bits (101), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 62/230 (26%), Positives = 97/230 (42%), Gaps = 56/230 (24%)

Query: 16  DFKQIILDGLNRLPLHPNTLDLLQKQVHTKLTKNSEL-IELLFDYNNAFINKQKPGQLKC 74
           + +  I + +  LPLH  TL  LQ      L +N  L I LL D     ++ +  G+ K 
Sbjct: 15  EVRDKITNAIEGLPLHQKTLLQLQDT----LKRNDALAIPLLRD----VVSYETTGKSKF 66

Query: 75  LQRIIFKTHLIFNNSYKNYDHLKAFKLKYNYLTHNWPYERHDILFAANKNV-PETKALEY 133
           L+ II++ +  + N   +  HLK    +Y +L  NWP ERH I F   KN  PE  +L  
Sbjct: 67  LESIIYRLYFQWLNEVPS--HLKPLLNQYEHLKSNWPIERH-IKF---KNAEPEAISLRN 120

Query: 134 LWNNCNSDNLAFMGSKFMKEITRQIQNKYITEGDYVHVFLKERYNSEIHTLSEIIDEKEI 193
            W    +  +    S     + + I N +             RY               +
Sbjct: 121 AWMRNKATAVDLSTS---DGVIKPILNHF-------------RY---------------L 149

Query: 194 EINLFGELFKQLHYINTINKLQIPIVILPLNALGLKIPKSRLYNKFKKKL 243
            +N    L K+        K+ +PI+ +PLN  G +IP+ R+ N  KK++
Sbjct: 150 RVN-EDRLCKK--------KVGLPILEVPLNVFGTEIPECRVNNLLKKRI 190

>KLLA0F19228g Chr6 (1781494..1782411) [918 bp, 305 aa] {ON}
           conserved hypothetical protein
          Length = 305

 Score = 43.1 bits (100), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 50/190 (26%), Positives = 87/190 (45%), Gaps = 30/190 (15%)

Query: 73  KCLQRIIFKTHL-IFNNSYKNYDHLKAFKLKYNYLTHNWPYE-RHDILFAANKNVPETKA 130
           K L+++++  H  + N+  K+ D L+ +    N L   WPYE +H IL   + N+    +
Sbjct: 51  KTLEKLVYSVHFHLLNDPPKHVDILRQYP---NELAKFWPYEMQHSILEMDDPNL---TS 104

Query: 131 LEYLWNNCNSDNLAFMG---SKFMKEITRQIQN----KYITEGDYVHVFLKERYNSEIHT 183
              LW+  N D L F+     K+++    Q  N    K IT  D +        +++I  
Sbjct: 105 QTILWSRNNKDALDFLSFNRHKWLRPKNWQTPNEELIKDITGIDGLQ-------STQITE 157

Query: 184 LSEIIDEKEIEINLFGELFKQLHYINT------INKLQIPIVILPLNALGLKIPKSRLYN 237
           +  +  EK  E     ++F+  +++ T        KLQ PIV + +   G  I   R+ N
Sbjct: 158 VLRLPAEKIKET--LRQIFEHYYFLKTNPKLCATKKLQAPIVEIGMKPDGFDIADIRIDN 215

Query: 238 KFKKKLQVFG 247
            FKKK+++  
Sbjct: 216 LFKKKVKLIS 225

>KNAG0G02060 Chr7 (468363..469223) [861 bp, 286 aa] {ON} Anc_8.266
           YLR091W
          Length = 286

 Score = 42.4 bits (98), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 55/235 (23%), Positives = 98/235 (41%), Gaps = 49/235 (20%)

Query: 21  ILDGLNRLPLHPNTLDLLQKQVHT--KLTKNSELIELLFDYNNAFINKQKPGQLKCLQRI 78
           +L  L  LPLH  TL  L + V     + +   + E L ++++    K K  Q K L  +
Sbjct: 8   LLRELRSLPLHSLTLARLSRHVAATKSIPRLKHVAETLQNFHDVPSTK-KHTQYKILTTL 66

Query: 79  IFKTHLIFNNSYKNYDHL----KAFKLKYNYLTHNWPYERHDILFAANKNVPETKALEYL 134
           + + +  ++NS+    HL      F+  +  L   WP E H  L  + K       L++ 
Sbjct: 67  LLQLYCQWDNSFSRLSHLPPHLAPFEQDFPGLVRIWPRESHLSLKQSTKG---HATLKHA 123

Query: 135 W--NNCNSDNLAFMGSKFMKEITRQIQNKYITEGDYVHVFLKERYNSEIH-TLSEIIDEK 191
           W  NN ++  ++F  +               T G           N E+  +L +I+   
Sbjct: 124 WVTNNKHALQMSFDAAAANP-----------TSG-----------NIELRGSLRQILSHY 161

Query: 192 EI---EINLFGELFKQLHYINTINKLQIPIVILPLNALGLKIPKSRLYNKFKKKL 243
           ++    + +FG++           KLQ+P+  +PLN  G +IP  R  N  ++K+
Sbjct: 162 QLLYNNMRMFGKI-----------KLQVPVAEIPLNVFGEEIPACRTANLLQRKV 205

>YLR091W Chr12 (322297..323178) [882 bp, 293 aa] {ON}  GEP5Protein
           of unknown function, required for mitochondrial genome
           maintenance; detected in highly purified mitochondria in
           high-throughput studies; null mutant has decreased
           levels of cardiolipin and phosphatidylethanolamine
          Length = 293

 Score = 40.8 bits (94), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 25/76 (32%), Positives = 40/76 (52%), Gaps = 8/76 (10%)

Query: 40  KQVHTKLTKNSELIELLFDYNNAFINKQKPGQLKCLQRIIFKTHLIFNNSYKNYDHLKAF 99
           K++   LTK+ +L      Y  A   +     LK L+ II++TH  +NN    + HL  F
Sbjct: 40  KEIAVPLTKSLQL------YEKAQRRQDLRASLKALESIIYQTHFQWNNPLPRHAHL--F 91

Query: 100 KLKYNYLTHNWPYERH 115
           +  Y++L  +WP+E H
Sbjct: 92  QKHYHFLLTHWPFENH 107

>Smik_12.150 Chr12 (302200..303078) [879 bp, 292 aa] {ON} YLR091W
           (REAL)
          Length = 292

 Score = 36.2 bits (82), Expect = 0.050,   Method: Compositional matrix adjust.
 Identities = 44/180 (24%), Positives = 74/180 (41%), Gaps = 29/180 (16%)

Query: 72  LKCLQRIIFKTHLIFNNSYKNYDHLKAFKLKYNYLTHNWPYERHDIL---FAANKNVPET 128
           LK L+ II++TH  +NN      H   F+  Y++L  +WP+E H +L    AA+K    +
Sbjct: 66  LKALESIIYQTHFKWNNPRPR--HALLFQKHYHFLLTHWPFENHRLLVDSIAAHKGKLNS 123

Query: 129 KALEYLWNNCNSDNLAFMGSKFMKEITRQIQNKYITEGDYVHVFLKERYNSEIHTLSEII 188
              +  W   +   L  + + +++        K ++E D                L    
Sbjct: 124 IPSKTTWLKADWATLFQVKNPWVQTPPTP---KNLSETD----------------LDAFT 164

Query: 189 DEKEIEINLFGELFKQL----HYINTINKLQIPIVILPL-NALGLKIPKSRLYNKFKKKL 243
            E+   +N  G  +K L    H      K   P V +P+ NALG   P  ++   F ++L
Sbjct: 165 PERAFLVNSLGNQYKFLIANSHLSYNHKKYPSPGVQIPIRNALGEVSPPKQISRLFSRQL 224

>Skud_12.159 Chr12 (305467..306348) [882 bp, 294 aa] {ON} YLR091W
           (REAL)
          Length = 294

 Score = 34.7 bits (78), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 33/107 (30%), Positives = 48/107 (44%), Gaps = 8/107 (7%)

Query: 18  KQIILDGLNRLPLH-----PNTLDLLQKQVHTKLTKNS-ELIELLFDYNNAFINKQKPGQ 71
           K ++L  +  LPLH       T  L+  Q   K  + +  L E L  Y  A   +     
Sbjct: 6   KGVLLPFIESLPLHRITKTALTTTLVGIQSDYKFKEIAVPLTESLQVYEKAQRRQDLRTS 65

Query: 72  LKCLQRIIFKTHLIFNNSYKNYDHLKAFKLKYNYLTHNWPYERHDIL 118
           LK L+ IIF+TH  +NN      H   F+  + +L  +WP+E H  L
Sbjct: 66  LKALESIIFQTHFQWNNPRPR--HALLFQKHHYFLLSHWPFENHRSL 110

>KNAG0B02490 Chr2 complement(484676..486877) [2202 bp, 733 aa] {ON}
           Anc_7.371 YBL052C
          Length = 733

 Score = 30.8 bits (68), Expect = 3.5,   Method: Compositional matrix adjust.
 Identities = 20/67 (29%), Positives = 32/67 (47%)

Query: 162 YITEGDYVHVFLKERYNSEIHTLSEIIDEKEIEINLFGELFKQLHYINTINKLQIPIVIL 221
           Y  EG+++  F KE+ NS    LS II         +G L  +  Y+ +  + ++     
Sbjct: 392 YKNEGEFIGYFSKEKVNSTGFNLSCIITLPTYRRAGYGHLLMEFSYLLSRREYKLGTPEK 451

Query: 222 PLNALGL 228
           PL+ LGL
Sbjct: 452 PLSDLGL 458

>TBLA0E04430 Chr5 (1136737..1138182) [1446 bp, 481 aa] {ON}
           Anc_8.262 YDR110W
          Length = 481

 Score = 30.0 bits (66), Expect = 6.7,   Method: Compositional matrix adjust.
 Identities = 27/93 (29%), Positives = 43/93 (46%), Gaps = 16/93 (17%)

Query: 19  QIILDGLNRLPLHPNTLDLLQKQVHTKLTKNSELIE--------LLFDYNNAFINKQKPG 70
           Q   D LN   L P  +     +  TKLT +S+ +E           + +N  I+K+KPG
Sbjct: 75  QEYCDMLNTGTLSPENI----IKYDTKLTNHSKALEKYNFTSRRYYLNEDNNIIDKRKPG 130

Query: 71  QLKC----LQRIIFKTHLIFNNSYKNYDHLKAF 99
           ++ C    +  I+   HL  ++SY   + LK F
Sbjct: 131 RIICEPKYMYDIVIAYHLKLHSSYAVSERLKKF 163

>TPHA0D01170 Chr4 complement(245675..248422) [2748 bp, 915 aa] {ON}
           Anc_8.661 YPL147W
          Length = 915

 Score = 29.6 bits (65), Expect = 7.8,   Method: Compositional matrix adjust.
 Identities = 23/87 (26%), Positives = 41/87 (47%), Gaps = 3/87 (3%)

Query: 71  QLKCLQRIIFKTHLIFNNSYKNYDHLKAFKLKYNYLTHNWPYERHDILF---AANKNVPE 127
           ++K L  I+    LI + S  NY+ ++ + LKY +    + +    I+F   A+  N  E
Sbjct: 440 KVKQLYYILMDKMLIMDKSKFNYNMIEGYILKYTWSGLGYVFASFPIIFTTIASGINSEE 499

Query: 128 TKALEYLWNNCNSDNLAFMGSKFMKEI 154
               +++ N     +LA  GS+ M  I
Sbjct: 500 QNMKQFIVNKRLMLSLADAGSRLMHSI 526

>TDEL0F04050 Chr6 complement(747631..749577) [1947 bp, 648 aa] {ON}
           Anc_8.278 YLR095C
          Length = 648

 Score = 29.6 bits (65), Expect = 9.7,   Method: Compositional matrix adjust.
 Identities = 12/28 (42%), Positives = 21/28 (75%), Gaps = 2/28 (7%)

Query: 83  HLIFNNSYKNYDHLKAFKLKYNYLTHNW 110
           HL ++N+ ++Y  L++FK++YN LT  W
Sbjct: 253 HLDYSNAIQDY--LESFKVQYNVLTKGW 278

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.322    0.140    0.411 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 29,859,830
Number of extensions: 1450001
Number of successful extensions: 4884
Number of sequences better than 10.0: 66
Number of HSP's gapped: 4999
Number of HSP's successfully gapped: 71
Length of query: 249
Length of database: 53,481,399
Length adjustment: 107
Effective length of query: 142
Effective length of database: 41,212,137
Effective search space: 5852123454
Effective search space used: 5852123454
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 64 (29.3 bits)