Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
TPHA0J007508.263ON52252225940.0
TDEL0F039008.263ON55952317610.0
SAKL0H17006g8.263ON53152117570.0
Kpol_392.58.263ON51251817280.0
NCAS0B050208.263ON56849117290.0
YLR089C (ALT1)8.263ON59249617180.0
Suva_10.1738.263ON59249817150.0
KNAG0G020408.263ON59149617070.0
Skud_12.1578.263ON59249617070.0
Smik_12.1488.263ON59249616970.0
CAGL0L12254g8.263ON57449216850.0
ZYRO0C01628g8.263ON53448616630.0
NDAI0B019908.263ON58851216650.0
KLLA0F19162g8.263ON52852016540.0
KAFR0B027308.263ON53949216480.0
KLTH0G13662g8.263ON51952215980.0
Kwal_56.237918.263ON51848415780.0
NCAS0B038408.263ON49749715550.0
TBLA0E044408.263ON56248315400.0
YDR111C (ALT2)8.263ON50749815260.0
Smik_4.3578.263ON50750015200.0
KAFR0B055308.263ON51448915120.0
Ecym_43078.263ON53448715120.0
Suva_2.2718.263ON50750015080.0
Skud_4.3728.263ON50749214940.0
Kpol_543.398.263ON49249014840.0
KNAG0M012108.263ON52148814820.0
KAFR0B05520singletonON51048914800.0
AGR085W8.263ON52152214790.0
NDAI0J013608.263ON50150014720.0
TPHA0A018008.263ON49849014610.0
TBLA0F030608.263ON50050013860.0
TBLA0G01630singletonON50050013291e-180
TPHA0O014501.321ON4432551261e-06
Kwal_34.160181.472ON3791571213e-06
KLTH0G19646g1.472ON3791231133e-05
NCAS0A092001.321ON4452581125e-05
Ecym_62921.321ON4301991125e-05
SAKL0D06886g1.321ON4472421091e-04
TPHA0D033703.511ON497961091e-04
Skud_10.1561.321ON4603261081e-04
Suva_6.1361.321ON4443261062e-04
CAGL0J05126g1.321ON4333241035e-04
NDAI0G057601.321ON4483271027e-04
Kwal_14.25741.321ON443681028e-04
TPHA0O015202.102ON503631028e-04
Ecym_6319singletonON3542221018e-04
AEL170C1.321ON4582411010.001
NCAS0B072202.102ON510491010.001
ZYRO0G20636g1.321ON4533301000.001
YJL060W (BNA3)1.321ON444138990.002
KNAG0B006603.511ON49659990.002
KLLA0F10021g3.511ON49788990.002
NCAS0E006703.511ON497123960.004
KLLA0F01617g1.321ON444246960.004
SAKL0F02156g3.511ON49882960.005
TDEL0D019001.321ON443322950.006
Kpol_278.23.511ON498273940.007
KNAG0B053201.321ON433143940.007
NDAI0B045502.102ON56572930.010
Kpol_1039.222.252ON386191920.011
Kpol_1035.231.321ON444322920.012
Smik_10.1801.321ON44468920.012
CAGL0G01254g3.511ON50493920.013
KLTH0H10648g1.321ON443262920.013
Kwal_33.145822.102ON52565920.014
NCAS0G040501.472ON384135910.015
KLTH0G09614g2.252ON389125910.015
KLTH0G02002g3.511ON49659900.019
NDAI0I028303.511ON50083900.021
SAKL0E12188g2.102ON53050890.026
Ecym_32902.252ON386169880.031
KLLA0F03509g2.252ON387170870.042
SAKL0E08492g2.252ON384170870.043
KNAG0G005501.472ON387129870.049
Kwal_23.48882.252ON389168870.051
ZYRO0C06028g3.511ON49682870.054
ADL249W2.252ON387195860.054
CAGL0G06028g2.102ON53750870.056
Kwal_47.189823.511ON49682870.057
Kpol_1035.302.102ON50143860.068
SAKL0D11528g1.472ON38342850.076
YHR137W (ARO9)2.102ON513142850.084
Smik_7.693.511ON50082850.097
Skud_7.693.511ON50082850.098
KAFR0D014203.511ON49299840.11
ZYRO0A01672g2.252ON386124840.12
Suva_15.3342.102ON56063840.12
KLTH0B00176g8.204ON44861830.14
NDAI0B037302.252ON386124830.15
Suva_7.613.511ON50082830.15
Smik_5.3198.204ON44364830.16
KLTH0G19624gsingletonON46861830.17
KAFR0A017101.321ON435234820.20
Kpol_480.11.472ON380123800.31
Kwal_8.5858.204ON44667800.33
Skud_8.1982.102ON51749800.33
TPHA0F012602.252ON39286790.38
YGL202W (ARO8)3.511ON50082790.42
ZYRO0G05346g2.102ON50449790.42
KLLA0D11110g2.102ON53043790.43
Smik_8.2182.102ON513254790.45
TDEL0A016008.204ON475110790.46
YIL116W (HIS5)2.252ON385125780.52
KNAG0G016808.204ON45234780.67
KNAG0E018502.252ON384122770.74
TDEL0C040902.252ON383124760.89
NCAS0B064402.252ON385123751.2
Smik_9.532.252ON388124751.2
KLTH0E07678gna 1ON492122751.3
TDEL0D057903.511ON49782751.4
KAFR0J015802.252ON383123741.6
Skud_5.2908.204ON443106741.8
Suva_9.782.252ON386124732.2
AFR548C3.511ON49768732.2
NDAI0B050101.285ON73176714.1
YER152C8.204ON44334714.3
KLLA0E00969g8.204ON44547714.3
SAKL0H18612g8.204ON44548714.3
Skud_9.552.252ON385124704.5
KNAG0H037302.102ON52337714.6
NDAI0C059608.204ON47848704.9
KLTH0B06182gna 2ON36151705.1
ZYRO0B06688g3.84ON59339697.1
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= TPHA0J00750
         (522 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

TPHA0J00750 Chr10 complement(176561..178129) [1569 bp, 522 aa] {...  1003   0.0  
TDEL0F03900 Chr6 complement(726159..727838) [1680 bp, 559 aa] {O...   682   0.0  
SAKL0H17006g Chr8 (1493272..1494867) [1596 bp, 531 aa] {ON} high...   681   0.0  
Kpol_392.5 s392 (6873..8411) [1539 bp, 512 aa] {ON} (6873..8411)...   670   0.0  
NCAS0B05020 Chr2 complement(931456..933162) [1707 bp, 568 aa] {O...   670   0.0  
YLR089C Chr12 complement(318237..320015) [1779 bp, 592 aa] {ON} ...   666   0.0  
Suva_10.173 Chr10 complement(323066..324844) [1779 bp, 592 aa] {...   665   0.0  
KNAG0G02040 Chr7 complement(463058..464833) [1776 bp, 591 aa] {O...   662   0.0  
Skud_12.157 Chr12 complement(301427..303205) [1779 bp, 592 aa] {...   662   0.0  
Smik_12.148 Chr12 complement(298127..299905) [1779 bp, 592 aa] {...   658   0.0  
CAGL0L12254g Chr12 complement(1327111..1328835) [1725 bp, 574 aa...   653   0.0  
ZYRO0C01628g Chr3 (115665..117269) [1605 bp, 534 aa] {ON} simila...   645   0.0  
NDAI0B01990 Chr2 complement(493160..494926) [1767 bp, 588 aa] {O...   645   0.0  
KLLA0F19162g Chr6 complement(1775240..1776826) [1587 bp, 528 aa]...   641   0.0  
KAFR0B02730 Chr2 complement(558858..560477) [1620 bp, 539 aa] {O...   639   0.0  
KLTH0G13662g Chr7 (1169989..1171548) [1560 bp, 519 aa] {ON} simi...   620   0.0  
Kwal_56.23791 s56 (706946..708502) [1557 bp, 518 aa] {ON} YLR089...   612   0.0  
NCAS0B03840 Chr2 (683781..685274) [1494 bp, 497 aa] {ON} Anc_8.2...   603   0.0  
TBLA0E04440 Chr5 complement(1138820..1140508) [1689 bp, 562 aa] ...   597   0.0  
YDR111C Chr4 complement(678241..679764) [1524 bp, 507 aa] {ON}  ...   592   0.0  
Smik_4.357 Chr4 complement(639561..641084) [1524 bp, 507 aa] {ON...   590   0.0  
KAFR0B05530 Chr2 (1132895..1134439) [1545 bp, 514 aa] {ON}            587   0.0  
Ecym_4307 Chr4 (652209..653813) [1605 bp, 534 aa] {ON} similar t...   587   0.0  
Suva_2.271 Chr2 complement(472714..474237) [1524 bp, 507 aa] {ON...   585   0.0  
Skud_4.372 Chr4 complement(649872..651395) [1524 bp, 507 aa] {ON...   580   0.0  
Kpol_543.39 s543 complement(86358..87836) [1479 bp, 492 aa] {ON}...   576   0.0  
KNAG0M01210 Chr13 (220612..222177) [1566 bp, 521 aa] {ON} Anc_8....   575   0.0  
KAFR0B05520 Chr2 (1130297..1131829) [1533 bp, 510 aa] {ON} Anc_8...   574   0.0  
AGR085W Chr7 (887023..888588) [1566 bp, 521 aa] {ON} Syntenic ho...   574   0.0  
NDAI0J01360 Chr10 (313791..315296) [1506 bp, 501 aa] {ON} Anc_8....   571   0.0  
TPHA0A01800 Chr1 (364262..365758) [1497 bp, 498 aa] {ON} Anc_8.2...   567   0.0  
TBLA0F03060 Chr6 (743646..745148) [1503 bp, 500 aa] {ON} Anc_8.2...   538   0.0  
TBLA0G01630 Chr7 (428016..429518) [1503 bp, 500 aa] {ON}              516   e-180
TPHA0O01450 Chr15 complement(291591..292922) [1332 bp, 443 aa] {...    53   1e-06
Kwal_34.16018 s34 (159210..160349) [1140 bp, 379 aa] {ON} YJL060...    51   3e-06
KLTH0G19646g Chr7 complement(1699421..1700560) [1140 bp, 379 aa]...    48   3e-05
NCAS0A09200 Chr1 complement(1819134..1820471) [1338 bp, 445 aa] ...    48   5e-05
Ecym_6292 Chr6 (547563..548855) [1293 bp, 430 aa] {ON} similar t...    48   5e-05
SAKL0D06886g Chr4 complement(571478..572821) [1344 bp, 447 aa] {...    47   1e-04
TPHA0D03370 Chr4 complement(704980..706473) [1494 bp, 497 aa] {O...    47   1e-04
Skud_10.156 Chr10 complement(294149..295531) [1383 bp, 460 aa] {...    46   1e-04
Suva_6.136 Chr6 complement(227366..228700) [1335 bp, 444 aa] {ON...    45   2e-04
CAGL0J05126g Chr10 complement(487452..488753) [1302 bp, 433 aa] ...    44   5e-04
NDAI0G05760 Chr7 (1427844..1429190) [1347 bp, 448 aa] {ON} Anc_1...    44   7e-04
Kwal_14.2574 s14 complement(818144..819475) [1332 bp, 443 aa] {O...    44   8e-04
TPHA0O01520 Chr15 (304547..306058) [1512 bp, 503 aa] {ON} Anc_2....    44   8e-04
Ecym_6319 Chr6 complement(607599..608663) [1065 bp, 354 aa] {ON}...    44   8e-04
AEL170C Chr5 complement(318032..319408) [1377 bp, 458 aa] {ON} S...    44   0.001
NCAS0B07220 Chr2 (1366278..1367810) [1533 bp, 510 aa] {ON} Anc_2...    44   0.001
ZYRO0G20636g Chr7 complement(1700506..1701867) [1362 bp, 453 aa]...    43   0.001
YJL060W Chr10 (323386..324720) [1335 bp, 444 aa] {ON}  BNA3Kynur...    43   0.002
KNAG0B00660 Chr2 (115417..116907) [1491 bp, 496 aa] {ON} Anc_3.5...    43   0.002
KLLA0F10021g Chr6 (926569..928062) [1494 bp, 497 aa] {ON} simila...    43   0.002
NCAS0E00670 Chr5 (117006..118499) [1494 bp, 497 aa] {ON} Anc_3.511     42   0.004
KLLA0F01617g Chr6 complement(154025..155359) [1335 bp, 444 aa] {...    42   0.004
SAKL0F02156g Chr6 (185574..187070) [1497 bp, 498 aa] {ON} highly...    42   0.005
TDEL0D01900 Chr4 (369434..370765) [1332 bp, 443 aa] {ON} Anc_1.3...    41   0.006
Kpol_278.2 s278 (2488..3984) [1497 bp, 498 aa] {ON} (2488..3984)...    41   0.007
KNAG0B05320 Chr2 (1028845..1030146) [1302 bp, 433 aa] {ON} Anc_1...    41   0.007
NDAI0B04550 Chr2 (1132653..1134350) [1698 bp, 565 aa] {ON} Anc_2...    40   0.010
Kpol_1039.22 s1039 (68736..69896) [1161 bp, 386 aa] {ON} (68736....    40   0.011
Kpol_1035.23 s1035 complement(56123..57457) [1335 bp, 444 aa] {O...    40   0.012
Smik_10.180 Chr10 (315030..316364) [1335 bp, 444 aa] {ON} YJL060...    40   0.012
CAGL0G01254g Chr7 (119281..120795) [1515 bp, 504 aa] {ON} highly...    40   0.013
KLTH0H10648g Chr8 complement(919601..920932) [1332 bp, 443 aa] {...    40   0.013
Kwal_33.14582 s33 complement(728649..730226) [1578 bp, 525 aa] {...    40   0.014
NCAS0G04050 Chr7 complement(753216..754370) [1155 bp, 384 aa] {O...    40   0.015
KLTH0G09614g Chr7 (804939..806108) [1170 bp, 389 aa] {ON} simila...    40   0.015
KLTH0G02002g Chr7 (155219..156709) [1491 bp, 496 aa] {ON} highly...    39   0.019
NDAI0I02830 Chr9 complement(669885..671387) [1503 bp, 500 aa] {O...    39   0.021
SAKL0E12188g Chr5 (1010503..1012095) [1593 bp, 530 aa] {ON} simi...    39   0.026
Ecym_3290 Chr3 (546773..547933) [1161 bp, 386 aa] {ON} similar t...    39   0.031
KLLA0F03509g Chr6 (327598..328761) [1164 bp, 387 aa] {ON} simila...    38   0.042
SAKL0E08492g Chr5 complement(692049..693203) [1155 bp, 384 aa] {...    38   0.043
KNAG0G00550 Chr7 (96823..97986) [1164 bp, 387 aa] {ON} Anc_1.472       38   0.049
Kwal_23.4888 s23 (907745..908914) [1170 bp, 389 aa] {ON} YIL116W...    38   0.051
ZYRO0C06028g Chr3 (457564..459054) [1491 bp, 496 aa] {ON} highly...    38   0.054
ADL249W Chr4 (261227..262390) [1164 bp, 387 aa] {ON} Syntenic ho...    38   0.054
CAGL0G06028g Chr7 complement(579261..580874) [1614 bp, 537 aa] {...    38   0.056
Kwal_47.18982 s47 complement(1051414..1052904) [1491 bp, 496 aa]...    38   0.057
Kpol_1035.30 s1035 (69909..71414) [1506 bp, 501 aa] {ON} (69909....    38   0.068
SAKL0D11528g Chr4 complement(960867..962018) [1152 bp, 383 aa] {...    37   0.076
YHR137W Chr8 (375709..377250) [1542 bp, 513 aa] {ON}  ARO9Aromat...    37   0.084
Smik_7.69 Chr7 (111132..112634) [1503 bp, 500 aa] {ON} YGL202W (...    37   0.097
Skud_7.69 Chr7 (120729..122231) [1503 bp, 500 aa] {ON} YGL202W (...    37   0.098
KAFR0D01420 Chr4 (284515..285993) [1479 bp, 492 aa] {ON} Anc_3.5...    37   0.11 
ZYRO0A01672g Chr1 (136284..137444) [1161 bp, 386 aa] {ON} highly...    37   0.12 
Suva_15.334 Chr15 (578774..580456) [1683 bp, 560 aa] {ON} YHR137...    37   0.12 
KLTH0B00176g Chr2 (10791..12137) [1347 bp, 448 aa] {ON} similar ...    37   0.14 
NDAI0B03730 Chr2 complement(935131..936291) [1161 bp, 386 aa] {O...    37   0.15 
Suva_7.61 Chr7 (112022..113524) [1503 bp, 500 aa] {ON} YGL202W (...    37   0.15 
Smik_5.319 Chr5 complement(477840..479171) [1332 bp, 443 aa] {ON...    37   0.16 
KLTH0G19624g Chr7 complement(1697587..1698993) [1407 bp, 468 aa]...    37   0.17 
KAFR0A01710 Chr1 complement(348198..349505) [1308 bp, 435 aa] {O...    36   0.20 
Kpol_480.1 s480 (215..1357) [1143 bp, 380 aa] {ON} (215..1357) [...    35   0.31 
Kwal_8.585 s8 (15757..17097) [1341 bp, 446 aa] {ON} YER152C - Hy...    35   0.33 
Skud_8.198 Chr8 (349159..350712) [1554 bp, 517 aa] {ON} YHR137W ...    35   0.33 
TPHA0F01260 Chr6 complement(290133..291311) [1179 bp, 392 aa] {O...    35   0.38 
YGL202W Chr7 (116059..117561) [1503 bp, 500 aa] {ON}  ARO8Aromat...    35   0.42 
ZYRO0G05346g Chr7 complement(430373..431887) [1515 bp, 504 aa] {...    35   0.42 
KLLA0D11110g Chr4 (948248..949840) [1593 bp, 530 aa] {ON} simila...    35   0.43 
Smik_8.218 Chr8 (352556..354097) [1542 bp, 513 aa] {ON} YHR137W ...    35   0.45 
TDEL0A01600 Chr1 (289263..290690) [1428 bp, 475 aa] {ON} Anc_8.2...    35   0.46 
YIL116W Chr9 (142928..144085) [1158 bp, 385 aa] {ON}  HIS5Histid...    35   0.52 
KNAG0G01680 Chr7 complement(369892..371250) [1359 bp, 452 aa] {O...    35   0.67 
KNAG0E01850 Chr5 (381827..382981) [1155 bp, 384 aa] {ON} Anc_2.2...    34   0.74 
TDEL0C04090 Chr3 complement(722310..723461) [1152 bp, 383 aa] {O...    34   0.89 
NCAS0B06440 Chr2 complement(1218759..1219916) [1158 bp, 385 aa] ...    33   1.2  
Smik_9.53 Chr9 (120672..121838) [1167 bp, 388 aa] {ON} YIL116W (...    33   1.2  
KLTH0E07678g Chr5 (702610..704088) [1479 bp, 492 aa] {ON} simila...    33   1.3  
TDEL0D05790 Chr4 complement(1045218..1046711) [1494 bp, 497 aa] ...    33   1.4  
KAFR0J01580 Chr10 complement(287313..288464) [1152 bp, 383 aa] {...    33   1.6  
Skud_5.290 Chr5 complement(463643..464974) [1332 bp, 443 aa] {ON...    33   1.8  
Suva_9.78 Chr9 (137747..138907) [1161 bp, 386 aa] {ON} YIL116W (...    33   2.2  
AFR548C Chr6 complement(1422283..1423776) [1494 bp, 497 aa] {ON}...    33   2.2  
NDAI0B05010 Chr2 complement(1222173..1224368) [2196 bp, 731 aa] ...    32   4.1  
YER152C Chr5 complement(472657..473988) [1332 bp, 443 aa] {ON} P...    32   4.3  
KLLA0E00969g Chr5 (101430..102767) [1338 bp, 445 aa] {ON} simila...    32   4.3  
SAKL0H18612g Chr8 (1655787..1657124) [1338 bp, 445 aa] {ON} high...    32   4.3  
Skud_9.55 Chr9 (119747..120904) [1158 bp, 385 aa] {ON} YIL116W (...    32   4.5  
KNAG0H03730 Chr8 (690872..692443) [1572 bp, 523 aa] {ON} Anc_2.1...    32   4.6  
NDAI0C05960 Chr3 complement(1365183..1366619) [1437 bp, 478 aa] ...    32   4.9  
KLTH0B06182g Chr2 (500939..502024) [1086 bp, 361 aa] {ON} simila...    32   5.1  
ZYRO0B06688g Chr2 complement(535548..537329) [1782 bp, 593 aa] {...    31   7.1  

>TPHA0J00750 Chr10 complement(176561..178129) [1569 bp, 522 aa] {ON}
           Anc_8.263 YDR111C
          Length = 522

 Score = 1003 bits (2594), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 488/522 (93%), Positives = 488/522 (93%)

Query: 1   MMLRSRSTNCTVNAAIALSGKRLLSLTTISLKHKNFKPADKLTINDLNENVLKAKYAVRG 60
           MMLRSRSTNCTVNAAIALSGKRLLSLTTISLKHKNFKPADKLTINDLNENVLKAKYAVRG
Sbjct: 1   MMLRSRSTNCTVNAAIALSGKRLLSLTTISLKHKNFKPADKLTINDLNENVLKAKYAVRG 60

Query: 61  KIPARAEVLKQQLIDNPSSLPFKKVINANIGNPQQLNQKPLTFYRQVLSLLQYPMVLDET 120
           KIPARAEVLKQQLIDNPSSLPFKKVINANIGNPQQLNQKPLTFYRQVLSLLQYPMVLDET
Sbjct: 61  KIPARAEVLKQQLIDNPSSLPFKKVINANIGNPQQLNQKPLTFYRQVLSLLQYPMVLDET 120

Query: 121 FSGNTKTLYKQDAIERAKRILNDIXXXXXXXXXXXXXXXLRKTVAEYISRRDGGEKAYAE 180
           FSGNTKTLYKQDAIERAKRILNDI               LRKTVAEYISRRDGGEKAYAE
Sbjct: 121 FSGNTKTLYKQDAIERAKRILNDIGSSVGSYSSSQGVFGLRKTVAEYISRRDGGEKAYAE 180

Query: 181 DIFLTAGASSAVSYLLNILCKGKESGVLIPIPQYXXXXXXXXXXXXXXXXXXXEENSGWS 240
           DIFLTAGASSAVSYLLNILCKGKESGVLIPIPQY                   EENSGWS
Sbjct: 181 DIFLTAGASSAVSYLLNILCKGKESGVLIPIPQYPLYTATLALNNTNALPYYLEENSGWS 240

Query: 241 TNMEEIENVVHNAIREKIIPRVLVVINPGNPTGAILSVESIEKIFDVAAHHGIVVIADEV 300
           TNMEEIENVVHNAIREKIIPRVLVVINPGNPTGAILSVESIEKIFDVAAHHGIVVIADEV
Sbjct: 241 TNMEEIENVVHNAIREKIIPRVLVVINPGNPTGAILSVESIEKIFDVAAHHGIVVIADEV 300

Query: 301 YQENIFPGNEFHSMKKVLRDLQRRVPGKYENVQLASLHSTSKGVSGECGQRGGYMELTGF 360
           YQENIFPGNEFHSMKKVLRDLQRRVPGKYENVQLASLHSTSKGVSGECGQRGGYMELTGF
Sbjct: 301 YQENIFPGNEFHSMKKVLRDLQRRVPGKYENVQLASLHSTSKGVSGECGQRGGYMELTGF 360

Query: 361 STEIKHEILKLCSISLCPVVTGQALVDLMTCPPKKGEASYEQDQMERSTIHSELYERATY 420
           STEIKHEILKLCSISLCPVVTGQALVDLMTCPPKKGEASYEQDQMERSTIHSELYERATY
Sbjct: 361 STEIKHEILKLCSISLCPVVTGQALVDLMTCPPKKGEASYEQDQMERSTIHSELYERATY 420

Query: 421 LWKAFNEMEGVSCQKPQGSMYLFPKIDIPHKALEKAQELDITPDELYCAELLEATGICTV 480
           LWKAFNEMEGVSCQKPQGSMYLFPKIDIPHKALEKAQELDITPDELYCAELLEATGICTV
Sbjct: 421 LWKAFNEMEGVSCQKPQGSMYLFPKIDIPHKALEKAQELDITPDELYCAELLEATGICTV 480

Query: 481 PGSGFGQKPGTFHLRTTFLAPGTSWIDQWREFHQIFCNKYRD 522
           PGSGFGQKPGTFHLRTTFLAPGTSWIDQWREFHQIFCNKYRD
Sbjct: 481 PGSGFGQKPGTFHLRTTFLAPGTSWIDQWREFHQIFCNKYRD 522

>TDEL0F03900 Chr6 complement(726159..727838) [1680 bp, 559 aa] {ON}
           Anc_8.263 YDR111C
          Length = 559

 Score =  682 bits (1761), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 333/523 (63%), Positives = 396/523 (75%), Gaps = 16/523 (3%)

Query: 4   RSRSTNCTVNAAIALSGKRLLSLTTISLKHKNFKPADKLTINDLNENVLKAKYAVRGKIP 63
           R+RST+ T      +  K+          H++F PA+ LT+ DLNENVLKAKYAVRG IP
Sbjct: 49  RARSTSSTAAGLHHIYHKKC---------HQDFYPAESLTVRDLNENVLKAKYAVRGSIP 99

Query: 64  ARAEVLKQQLIDNPSSLPFKKVINANIGNPQQLNQKPLTFYRQVLSLLQYPMVLDETFSG 123
            RAE L++QL  +PSSLPF K++NANIGNPQQLNQKPL+FYRQVLS+LQYP VL++   G
Sbjct: 100 MRAEELQEQLKRDPSSLPFDKIVNANIGNPQQLNQKPLSFYRQVLSILQYPEVLEQ---G 156

Query: 124 N----TKTLYKQDAIERAKRILNDIXXXXXXXXXXXXXXXLRKTVAEYISRRDGGEKAYA 179
                +K ++K+DAIERAKRIL D+               +RKTVA++I+ RD GE AY 
Sbjct: 157 EEELISKGVFKRDAIERAKRILRDVGGSVGAYSSSQGVYGIRKTVADFITERDSGEPAYP 216

Query: 180 EDIFLTAGASSAVSYLLNILCKGKESGVLIPIPQYXXXXXXXXXXXXXXXXXXXEENSGW 239
           EDIFLTAGAS+AVSYLL+ILC+G+E+GVLIPIPQY                   +E SGW
Sbjct: 217 EDIFLTAGASAAVSYLLSILCRGQETGVLIPIPQYPLYTATLALNNSHVLPYYLDEESGW 276

Query: 240 STNMEEIENVVHNAIREKIIPRVLVVINPGNPTGAILSVESIEKIFDVAAHHGIVVIADE 299
           STN  EIE VV  +I   I P VLVVINPGNPTG++LSVE+IEKIF VAA +GIVVIADE
Sbjct: 277 STNTAEIEGVVTESIESGIRPSVLVVINPGNPTGSVLSVEAIEKIFQVAAKYGIVVIADE 336

Query: 300 VYQENIFPGNEFHSMKKVLRDLQRRVPGKYENVQLASLHSTSKGVSGECGQRGGYMELTG 359
           VYQENIF G+EFHSMKKVLR LQ+  PG Y+NVQL SLHSTSKGVSGECGQRGGYMELTG
Sbjct: 337 VYQENIFAGSEFHSMKKVLRQLQKEHPGIYDNVQLVSLHSTSKGVSGECGQRGGYMELTG 396

Query: 360 FSTEIKHEILKLCSISLCPVVTGQALVDLMTCPPKKGEASYEQDQMERSTIHSELYERAT 419
           F+ EI+  +LKL SISLCPVVTGQALVDLM CPPK G+ SYEQD+ ER  IH EL  RA 
Sbjct: 397 FTHEIRQVVLKLASISLCPVVTGQALVDLMVCPPKPGDESYEQDRKEREMIHEELDHRAG 456

Query: 420 YLWKAFNEMEGVSCQKPQGSMYLFPKIDIPHKALEKAQELDITPDELYCAELLEATGICT 479
            L   FN +EG+ CQKP+G+MYLFP+I +P+KA++ AQ L+ TPDE YC +LLEATGICT
Sbjct: 457 LLHDTFNSLEGIECQKPRGAMYLFPQIKLPYKAIQAAQHLEKTPDEFYCQKLLEATGICT 516

Query: 480 VPGSGFGQKPGTFHLRTTFLAPGTSWIDQWREFHQIFCNKYRD 522
           VPGSGFGQ+PGT+HLRTTFLAPGT WI +W +FH+ F ++YRD
Sbjct: 517 VPGSGFGQEPGTYHLRTTFLAPGTEWIKKWEDFHKKFYDQYRD 559

>SAKL0H17006g Chr8 (1493272..1494867) [1596 bp, 531 aa] {ON} highly
           similar to gnl|GLV|KLLA0F19162g Kluyveromyces lactis
           KLLA0F19162g and similar to YLR089C uniprot|P52893
           Saccharomyces cerevisiae YLR089C ALT1 putative alanine
           transaminase (glutamyc pyruvic transaminase)
          Length = 531

 Score =  681 bits (1757), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 331/521 (63%), Positives = 402/521 (77%), Gaps = 2/521 (0%)

Query: 2   MLRSRSTNCTVNAAIALSGKRLLSLTTISLKHKNFKPADKLTINDLNENVLKAKYAVRGK 61
           MLR+ +T   +   +  S   L S ++  + +K F+PADKL++ DLNENVL+AKYAVRGK
Sbjct: 13  MLRT-TTAGNIAKNMPHSTLFLRSFSSNFVPYK-FQPADKLSLEDLNENVLRAKYAVRGK 70

Query: 62  IPARAEVLKQQLIDNPSSLPFKKVINANIGNPQQLNQKPLTFYRQVLSLLQYPMVLDETF 121
           IP +AE LK QL  +P SLPF ++INANIGNPQQL+QKPLTFYRQVLSLLQ P +L+E  
Sbjct: 71  IPQKAEELKNQLARDPKSLPFDRIINANIGNPQQLDQKPLTFYRQVLSLLQNPDMLEEIP 130

Query: 122 SGNTKTLYKQDAIERAKRILNDIXXXXXXXXXXXXXXXLRKTVAEYISRRDGGEKAYAED 181
                 +YK DAI+RA R+L++I                RKTVA++I++RDGGE+AYAED
Sbjct: 131 REQLSQIYKPDAIDRAARLLSNIGGSVGAYSHSQGVYGFRKTVADFITKRDGGEEAYAED 190

Query: 182 IFLTAGASSAVSYLLNILCKGKESGVLIPIPQYXXXXXXXXXXXXXXXXXXXEENSGWST 241
           IFLTAGAS+AVSY+L+ILC+G ++GVLIPIPQY                   +E S WST
Sbjct: 191 IFLTAGASAAVSYILSILCRGPQTGVLIPIPQYPLYTASLALNNSHALPYYLDEESNWST 250

Query: 242 NMEEIENVVHNAIREKIIPRVLVVINPGNPTGAILSVESIEKIFDVAAHHGIVVIADEVY 301
           N EEIE VV N+I + + P+ LVVINPGNPTGAILS ESIEKIF+VAA +GIVVIADEVY
Sbjct: 251 NPEEIEKVVTNSIAKGVEPKCLVVINPGNPTGAILSPESIEKIFEVAAKYGIVVIADEVY 310

Query: 302 QENIFPGNEFHSMKKVLRDLQRRVPGKYENVQLASLHSTSKGVSGECGQRGGYMELTGFS 361
           QEN+F G EFHSM+KVL+DLQR+  GK++N+QLASLHSTSKGVSGECGQRGGYMEL GFS
Sbjct: 311 QENVFNGAEFHSMRKVLKDLQRKHHGKFDNIQLASLHSTSKGVSGECGQRGGYMELLGFS 370

Query: 362 TEIKHEILKLCSISLCPVVTGQALVDLMTCPPKKGEASYEQDQMERSTIHSELYERATYL 421
            +++   LKL SISLCPVVTGQALVDLM CPPK G+ASYEQDQ ERS IH  L  RA+ L
Sbjct: 371 HDVRQVFLKLASISLCPVVTGQALVDLMVCPPKPGDASYEQDQKERSEIHDALDARASML 430

Query: 422 WKAFNEMEGVSCQKPQGSMYLFPKIDIPHKALEKAQELDITPDELYCAELLEATGICTVP 481
           ++ FN +EG+ CQKPQG+MYLFP++D+ +KA++KA+ L ++PDE YC ELLEATGICTVP
Sbjct: 431 YETFNRLEGIECQKPQGAMYLFPRLDLSYKAVQKAEHLSLSPDEFYCQELLEATGICTVP 490

Query: 482 GSGFGQKPGTFHLRTTFLAPGTSWIDQWREFHQIFCNKYRD 522
           GSGFGQ PGT+HLRTTFLAPGT WI  W EFH+ F N+YRD
Sbjct: 491 GSGFGQVPGTYHLRTTFLAPGTDWIKAWEEFHKKFYNEYRD 531

>Kpol_392.5 s392 (6873..8411) [1539 bp, 512 aa] {ON} (6873..8411)
           [1539 nt, 513 aa]
          Length = 512

 Score =  670 bits (1728), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 333/518 (64%), Positives = 401/518 (77%), Gaps = 9/518 (1%)

Query: 6   RSTNCTVNAAIALSGKRLLSLTTISLKHK-NFKPADKLTINDLNENVLKAKYAVRGKIPA 64
           RS NC++ + +   G R L+L+T   +HK N  PA KL ++DLN+NVLKAKYAVRG IP 
Sbjct: 3   RSGNCSI-SLVRRVGVRRLTLSTTLYEHKHNVYPAQKLRMDDLNKNVLKAKYAVRGSIPL 61

Query: 65  RAEVLKQQLIDNPSSLPFKKVINANIGNPQQLNQKPLTFYRQVLSLLQYPMVLDETFSGN 124
           RAE LK  L +    LPF  VINANIGNPQQL QKPLTFYRQVLS+LQYP +L+   SG+
Sbjct: 62  RAEELKLYL-EAGQKLPFDTVINANIGNPQQLKQKPLTFYRQVLSILQYPELLE---SGS 117

Query: 125 TKTLYKQDAIERAKRILNDIXXXXXXXXXXXXXXXLRKTVAEYISRRDGGEKAYAEDIFL 184
              ++K+DAIERA+++L +I               +RKTVA +I++RD GE +   DIFL
Sbjct: 118 N--IFKKDAIERARKLLKEIGSVGSYSSSQGIPA-IRKTVANFITKRDDGEISTPNDIFL 174

Query: 185 TAGASSAVSYLLNILCKGKESGVLIPIPQYXXXXXXXXXXXXXXXXXXXEENSGWSTNME 244
           TAGASSAV YLL+ILCK ++SGVLIPIPQY                   +E+ GWST++ 
Sbjct: 175 TAGASSAVDYLLSILCKNEKSGVLIPIPQYPLYTATLALNNAHALPYYLDESKGWSTDIN 234

Query: 245 EIENVVHNAIREKIIPRVLVVINPGNPTGAILSVESIEKIFDVAAHHGIVVIADEVYQEN 304
           EIE V+++++ + I P  LV+INPGNPTG+ILSVES+EKI +VAA HGIV+IADEVYQEN
Sbjct: 235 EIEEVINDSLDKGIKPTALVIINPGNPTGSILSVESMEKIIEVAATHGIVIIADEVYQEN 294

Query: 305 IFPGNEFHSMKKVLRDLQRRVPGKYENVQLASLHSTSKGVSGECGQRGGYMELTGFSTEI 364
           +F   +FHSMKKVLR+LQ+  PG+Y+ VQLASLHSTSKGVSGECGQRGGYMELTGF+ EI
Sbjct: 295 VFNNAKFHSMKKVLRNLQKAFPGEYDTVQLASLHSTSKGVSGECGQRGGYMELTGFNPEI 354

Query: 365 KHEILKLCSISLCPVVTGQALVDLMTCPPKKGEASYEQDQMERSTIHSELYERATYLWKA 424
           K  ILKLCSISLCPVVTGQALVDLM  PP+KG+ SYEQDQ+ERSTI ++L  RA  LW+A
Sbjct: 355 KQVILKLCSISLCPVVTGQALVDLMVSPPQKGDESYEQDQLERSTILNDLSNRAILLWEA 414

Query: 425 FNEMEGVSCQKPQGSMYLFPKIDIPHKALEKAQELDITPDELYCAELLEATGICTVPGSG 484
           FN MEGVSCQKP+G+MYLFPKID+P K L+K+QELDITPDE YC  LLEATGICTVPGSG
Sbjct: 415 FNSMEGVSCQKPEGAMYLFPKIDLPFKVLQKSQELDITPDEFYCKALLEATGICTVPGSG 474

Query: 485 FGQKPGTFHLRTTFLAPGTSWIDQWREFHQIFCNKYRD 522
           FGQ+PGT+HLRTTFLAPGT WID+W +FH  F +KYRD
Sbjct: 475 FGQQPGTYHLRTTFLAPGTEWIDRWNKFHAEFYDKYRD 512

>NCAS0B05020 Chr2 complement(931456..933162) [1707 bp, 568 aa] {ON} 
          Length = 568

 Score =  670 bits (1729), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 324/491 (65%), Positives = 386/491 (78%), Gaps = 1/491 (0%)

Query: 33  HKNFKPADKLTINDLNENVLKAKYAVRGKIPARAEVLKQQLIDNPSSLPFKKVINANIGN 92
           H NF PAD+LT+ +LN+NVLKAKYAVRG IP RAE LK QL ++PSSLPF  ++NANIGN
Sbjct: 78  HNNFLPADQLTLAELNDNVLKAKYAVRGAIPMRAEELKIQLQEDPSSLPFDHIVNANIGN 137

Query: 93  PQQLNQKPLTFYRQVLSLLQYPMVLDETFSGNTKT-LYKQDAIERAKRILNDIXXXXXXX 151
           PQQLNQKPL+FYRQVLSLLQYP +L +  S    + L+K+DA+ERAK +L++I       
Sbjct: 138 PQQLNQKPLSFYRQVLSLLQYPEILKQDESKLVASGLFKKDALERAKTLLHEIGGTVGAY 197

Query: 152 XXXXXXXXLRKTVAEYISRRDGGEKAYAEDIFLTAGASSAVSYLLNILCKGKESGVLIPI 211
                   +RKTVA +I++RD GE AY EDIFLTAGAS+AV YLL+ILCKG E+GVLIPI
Sbjct: 198 SASQGVYGIRKTVANFITKRDNGEPAYPEDIFLTAGASAAVMYLLSILCKGPETGVLIPI 257

Query: 212 PQYXXXXXXXXXXXXXXXXXXXEENSGWSTNMEEIENVVHNAIREKIIPRVLVVINPGNP 271
           PQY                   +E SGWSTN +EIE VV  A  +KI P VLVVINPGNP
Sbjct: 258 PQYPLYTASLALNNSHALPYYLDEKSGWSTNPKEIEEVVLAAKDKKIRPSVLVVINPGNP 317

Query: 272 TGAILSVESIEKIFDVAAHHGIVVIADEVYQENIFPGNEFHSMKKVLRDLQRRVPGKYEN 331
           TGA+LS +SIE IF++AA +GIVVIADEVYQEN+F   +FHSMKKVLR+LQ++ PG Y+ 
Sbjct: 318 TGAVLSEKSIEHIFEIAAKYGIVVIADEVYQENVFNEVKFHSMKKVLRNLQKKHPGVYDM 377

Query: 332 VQLASLHSTSKGVSGECGQRGGYMELTGFSTEIKHEILKLCSISLCPVVTGQALVDLMTC 391
           VQLASLHSTSKGVSGECGQRGGYMELTGF+ E++  ILKL SISLCPVVTGQALVDLM  
Sbjct: 378 VQLASLHSTSKGVSGECGQRGGYMELTGFTHEVRSVILKLASISLCPVVTGQALVDLMVS 437

Query: 392 PPKKGEASYEQDQMERSTIHSELYERATYLWKAFNEMEGVSCQKPQGSMYLFPKIDIPHK 451
           PPKKG+ S+EQDQ ER  I SEL+ RA  L+K FN +EG+ CQKPQG+MYLFP++D+P K
Sbjct: 438 PPKKGDESFEQDQAERKHIKSELHTRAMQLYKNFNTLEGIECQKPQGAMYLFPRLDLPFK 497

Query: 452 ALEKAQELDITPDELYCAELLEATGICTVPGSGFGQKPGTFHLRTTFLAPGTSWIDQWRE 511
           A++KAQ L+++PDE YC  LLEATGICTVPGSGFGQ+PGT+HLRTTFLAPGT WI++W+ 
Sbjct: 498 AVQKAQHLEMSPDEFYCKSLLEATGICTVPGSGFGQEPGTYHLRTTFLAPGTEWIEKWKI 557

Query: 512 FHQIFCNKYRD 522
           FHQ F N YRD
Sbjct: 558 FHQDFYNTYRD 568

>YLR089C Chr12 complement(318237..320015) [1779 bp, 592 aa] {ON}
           ALT1Alanine transaminase (glutamic pyruvic
           transaminase); involved in alanine biosynthetic and
           catabolic processes; the authentic, non-tagged protein
           is detected in highly purified mitochondria in
           high-throughput studies
          Length = 592

 Score =  666 bits (1718), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 318/496 (64%), Positives = 385/496 (77%), Gaps = 1/496 (0%)

Query: 28  TISLKHKNFKPADKLTINDLNENVLKAKYAVRGKIPARAEVLKQQLIDNPSSLPFKKVIN 87
           T+   +  F PA++LT+ D+NENVLKAKYAVRG IP RAE LK QL  +P SLPF ++IN
Sbjct: 97  TLKTSNNEFYPAEQLTLEDVNENVLKAKYAVRGAIPMRAEELKAQLEKDPQSLPFDRIIN 156

Query: 88  ANIGNPQQLNQKPLTFYRQVLSLLQYPMVLDETFSGNTKT-LYKQDAIERAKRILNDIXX 146
           ANIGNPQQL QKPLT+YRQVLSLLQYP +L++       + L+K DAI+RAK ++ DI  
Sbjct: 157 ANIGNPQQLQQKPLTYYRQVLSLLQYPELLNQNEQQLVDSKLFKLDAIKRAKSLMEDIGG 216

Query: 147 XXXXXXXXXXXXXLRKTVAEYISRRDGGEKAYAEDIFLTAGASSAVSYLLNILCKGKESG 206
                        +RK+VAE+I++RD GE +Y EDIFLTAGAS+AV+YLL+I C+G E+G
Sbjct: 217 SVGAYSSSQGVEGIRKSVAEFITKRDEGEISYPEDIFLTAGASAAVNYLLSIFCRGPETG 276

Query: 207 VLIPIPQYXXXXXXXXXXXXXXXXXXXEENSGWSTNMEEIENVVHNAIREKIIPRVLVVI 266
           VLIPIPQY                   +ENSGWSTN EEIE VV  AI+ +I P VLVVI
Sbjct: 277 VLIPIPQYPLYTATLALNNSQALPYYLDENSGWSTNPEEIETVVKEAIQNEIKPTVLVVI 336

Query: 267 NPGNPTGAILSVESIEKIFDVAAHHGIVVIADEVYQENIFPGNEFHSMKKVLRDLQRRVP 326
           NPGNPTGA+LS ESI +IF+VAA +G VVIADEVYQENIFPG +FHSMKK+LR LQR  P
Sbjct: 337 NPGNPTGAVLSPESIAQIFEVAAKYGTVVIADEVYQENIFPGTKFHSMKKILRHLQREHP 396

Query: 327 GKYENVQLASLHSTSKGVSGECGQRGGYMELTGFSTEIKHEILKLCSISLCPVVTGQALV 386
           GK++NVQLASLHSTSKGVSGECGQRGGYMELTGFS E++  ILKL SISLCPVVTGQALV
Sbjct: 397 GKFDNVQLASLHSTSKGVSGECGQRGGYMELTGFSHEMRQVILKLASISLCPVVTGQALV 456

Query: 387 DLMTCPPKKGEASYEQDQMERSTIHSELYERATYLWKAFNEMEGVSCQKPQGSMYLFPKI 446
           DLM  PP +GE S+E DQ ER++IH +L  RA  L++ FN +EG+ CQKPQG+MYLFPKI
Sbjct: 457 DLMVRPPVEGEESFESDQAERNSIHEKLITRAMTLYETFNSLEGIECQKPQGAMYLFPKI 516

Query: 447 DIPHKALEKAQELDITPDELYCAELLEATGICTVPGSGFGQKPGTFHLRTTFLAPGTSWI 506
           D+P KA+++A+ L++TPDE YC +LLE+TGICTVPGSGFGQ+PGT+HLRTTFLAPG  WI
Sbjct: 517 DLPFKAVQEARHLELTPDEFYCKKLLESTGICTVPGSGFGQEPGTYHLRTTFLAPGLEWI 576

Query: 507 DQWREFHQIFCNKYRD 522
            +W  FH+ F ++YRD
Sbjct: 577 KKWESFHKEFFDQYRD 592

>Suva_10.173 Chr10 complement(323066..324844) [1779 bp, 592 aa] {ON}
           YDR111C (REAL)
          Length = 592

 Score =  665 bits (1715), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 320/498 (64%), Positives = 387/498 (77%), Gaps = 5/498 (1%)

Query: 28  TISLKHKNFKPADKLTINDLNENVLKAKYAVRGKIPARAEVLKQQLIDNPSSLPFKKVIN 87
           T+   +  F PA++LT++D+NENVLKA+YAVRG IP RAE LK QL  +P SLPF K+IN
Sbjct: 97  TLKTANNEFYPAEQLTLDDVNENVLKARYAVRGAIPMRAEELKAQLEKDPQSLPFNKIIN 156

Query: 88  ANIGNPQQLNQKPLTFYRQVLSLLQYPMVL---DETFSGNTKTLYKQDAIERAKRILNDI 144
           ANIGNPQQL QKPLT+YRQVLSLLQYP +L   ++   G+   L+K DAI+RAK ++ DI
Sbjct: 157 ANIGNPQQLQQKPLTYYRQVLSLLQYPELLNHNEQELVGSK--LFKIDAIKRAKSLIKDI 214

Query: 145 XXXXXXXXXXXXXXXLRKTVAEYISRRDGGEKAYAEDIFLTAGASSAVSYLLNILCKGKE 204
                          +RK+VA++I++RDGGE AY EDIFLTAGAS+AV+YLL+I C+G E
Sbjct: 215 GGSVGAYSSSQGVEGIRKSVADFITKRDGGETAYPEDIFLTAGASAAVTYLLSIFCRGPE 274

Query: 205 SGVLIPIPQYXXXXXXXXXXXXXXXXXXXEENSGWSTNMEEIENVVHNAIREKIIPRVLV 264
           +GVLIPIPQY                   +ENSGWSTN EEIE VV  AI+ +I P VLV
Sbjct: 275 TGVLIPIPQYPLYTATLALNNSQPLPYYLDENSGWSTNPEEIETVVKEAIQNEIKPTVLV 334

Query: 265 VINPGNPTGAILSVESIEKIFDVAAHHGIVVIADEVYQENIFPGNEFHSMKKVLRDLQRR 324
           VINPGNPTGA+LS ESI +IF+VAA +G VVIADEVYQENIFPG EF+SMKKVLR LQR 
Sbjct: 335 VINPGNPTGAVLSPESIAQIFEVAAKYGTVVIADEVYQENIFPGTEFNSMKKVLRHLQRD 394

Query: 325 VPGKYENVQLASLHSTSKGVSGECGQRGGYMELTGFSTEIKHEILKLCSISLCPVVTGQA 384
            PGK++NVQLASLHSTSKGVSGECGQRGGYMELTGFS E++  ILKL SISLCPVVTGQA
Sbjct: 395 HPGKFDNVQLASLHSTSKGVSGECGQRGGYMELTGFSHEMRQVILKLASISLCPVVTGQA 454

Query: 385 LVDLMTCPPKKGEASYEQDQMERSTIHSELYERATYLWKAFNEMEGVSCQKPQGSMYLFP 444
           LVDLM  PP +GE S+E DQ ER++IH +L  RA  L++ FN +EG+ CQKPQG+MYLFP
Sbjct: 455 LVDLMVRPPVEGEESFESDQSERNSIHEKLNTRAMTLYETFNSLEGIECQKPQGAMYLFP 514

Query: 445 KIDIPHKALEKAQELDITPDELYCAELLEATGICTVPGSGFGQKPGTFHLRTTFLAPGTS 504
           KID+P KA+++A  L++TPDE YC +LLE+TGICTVPGSGFGQ+PGT+HLRTTFLAPG  
Sbjct: 515 KIDVPFKAIQEAHHLELTPDEFYCKKLLESTGICTVPGSGFGQEPGTYHLRTTFLAPGVE 574

Query: 505 WIDQWREFHQIFCNKYRD 522
           W+ +W  FH+ F ++YRD
Sbjct: 575 WMKKWEIFHKEFFDQYRD 592

>KNAG0G02040 Chr7 complement(463058..464833) [1776 bp, 591 aa] {ON}
           Anc_8.263 YDR111C
          Length = 591

 Score =  662 bits (1707), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 320/496 (64%), Positives = 384/496 (77%), Gaps = 3/496 (0%)

Query: 30  SLKHKNFKPADKLTINDLNENVLKAKYAVRGKIPARAEVLKQQLIDNPSSLPFKKVINAN 89
           S  H  F PA ++ I DLNENVLKAKYAVRG IP RAE L+ QL ++P SLPF K+INAN
Sbjct: 96  SKSHYKFTPAAQVKIADLNENVLKAKYAVRGSIPMRAEQLQHQLQEDPRSLPFDKIINAN 155

Query: 90  IGNPQQLNQKPLTFYRQVLSLLQYPMVLD--ETFSGNTKTLYKQDAIERAKRILNDIXXX 147
           IGNPQQLNQKPL+FYRQVLSLLQ+P +L+  +       +LYK DA+ RA+++L DI   
Sbjct: 156 IGNPQQLNQKPLSFYRQVLSLLQFPELLNSLKENPAAATSLYKADAVRRAEKLLEDIGGS 215

Query: 148 XXXXXXXXXXXXLRKTVAEYISRRDGGEKAYAEDIFLTAGASSAVSYLLNILCKGKESGV 207
                       +RKTVA++I+RRD  E AY EDIFLTAGAS+AVSYLL+I CKG+++GV
Sbjct: 216 VGAYSTSQGVMGIRKTVADFITRRDNNEPAYPEDIFLTAGASAAVSYLLSIFCKGEKTGV 275

Query: 208 LIPIPQYXXXXXXXXXXXXXXXXXXXEENSGWSTNMEEIENVVHNAIREKIIPRVLVVIN 267
           LIPIPQY                   +E SGWSTN +EI++VV +AI   I P VLVVIN
Sbjct: 276 LIPIPQYPLYTATLALNNSHTLPYYLDEKSGWSTNTKEIDSVVLDAIDRNIKPSVLVVIN 335

Query: 268 PGNPTGAILSVESIEKIFDVAAHHGIVVIADEVYQENIFPGN-EFHSMKKVLRDLQRRVP 326
           PGNPTGA+LS ++I +IF++AA +GIVVIADEVYQENIF  + +FHSMKKVLR LQ+  P
Sbjct: 336 PGNPTGAVLSEKAIAEIFEIAAKYGIVVIADEVYQENIFDEDVKFHSMKKVLRKLQQEHP 395

Query: 327 GKYENVQLASLHSTSKGVSGECGQRGGYMELTGFSTEIKHEILKLCSISLCPVVTGQALV 386
           GK++ VQLASLHSTSKGVSGECGQRGG+MELTGFS EI+  ILKL SISLCPVVTGQALV
Sbjct: 396 GKFDEVQLASLHSTSKGVSGECGQRGGFMELTGFSHEIRQVILKLASISLCPVVTGQALV 455

Query: 387 DLMTCPPKKGEASYEQDQMERSTIHSELYERATYLWKAFNEMEGVSCQKPQGSMYLFPKI 446
           DLM  PP++GE SYE DQ ERS IHSEL++RA  LW+ FN +EG+ CQKPQG+MYLFP++
Sbjct: 456 DLMVHPPQEGEESYELDQAERSHIHSELHKRANKLWETFNRLEGIQCQKPQGAMYLFPRL 515

Query: 447 DIPHKALEKAQELDITPDELYCAELLEATGICTVPGSGFGQKPGTFHLRTTFLAPGTSWI 506
           ++P KA++KAQ +++T DE YC ELLE TGICTVPGSGFGQ PGT+HLRTTFLAPGT WI
Sbjct: 516 NLPFKAVQKAQHMEMTADEFYCKELLENTGICTVPGSGFGQVPGTYHLRTTFLAPGTEWI 575

Query: 507 DQWREFHQIFCNKYRD 522
           D W +FH+ F NKYRD
Sbjct: 576 DLWEKFHKEFYNKYRD 591

>Skud_12.157 Chr12 complement(301427..303205) [1779 bp, 592 aa] {ON}
           YLR089C (REAL)
          Length = 592

 Score =  662 bits (1707), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 317/496 (63%), Positives = 383/496 (77%), Gaps = 1/496 (0%)

Query: 28  TISLKHKNFKPADKLTINDLNENVLKAKYAVRGKIPARAEVLKQQLIDNPSSLPFKKVIN 87
           T+   + +F PA++LT+ D+NENVLKAKYAVRG IP RAE LK QL  +P SLPF K+IN
Sbjct: 97  TLKTGNDDFYPAEQLTLEDVNENVLKAKYAVRGAIPMRAEELKAQLEKDPQSLPFDKIIN 156

Query: 88  ANIGNPQQLNQKPLTFYRQVLSLLQYPMVLDETFSGNTKT-LYKQDAIERAKRILNDIXX 146
           ANIGNPQQL QKPLT+YRQVLSLLQYP +L++       + L+K DAI+RAK ++ DI  
Sbjct: 157 ANIGNPQQLQQKPLTYYRQVLSLLQYPELLNQNEQQLVDSKLFKLDAIKRAKSLMEDIGG 216

Query: 147 XXXXXXXXXXXXXLRKTVAEYISRRDGGEKAYAEDIFLTAGASSAVSYLLNILCKGKESG 206
                        +RK+VAE+I++RD GE +Y EDIFLTAGAS+AV+YLL+I C+G E+G
Sbjct: 217 SVGAYSSSQGVEGIRKSVAEFITKRDDGEISYPEDIFLTAGASAAVNYLLSIFCRGPETG 276

Query: 207 VLIPIPQYXXXXXXXXXXXXXXXXXXXEENSGWSTNMEEIENVVHNAIREKIIPRVLVVI 266
           VLIPIPQY                   +E SGWSTN EEIE VV  AI+ +I P VLVVI
Sbjct: 277 VLIPIPQYPLYTATLALNNSQALPYYLDEQSGWSTNPEEIETVVKEAIQNEIKPTVLVVI 336

Query: 267 NPGNPTGAILSVESIEKIFDVAAHHGIVVIADEVYQENIFPGNEFHSMKKVLRDLQRRVP 326
           NPGNPTGA+LS ES+ +IF+VAA +G VVIADEVYQENIFPG +FHSMKK+LR LQR  P
Sbjct: 337 NPGNPTGAVLSPESVSQIFEVAAKYGTVVIADEVYQENIFPGTKFHSMKKILRTLQREHP 396

Query: 327 GKYENVQLASLHSTSKGVSGECGQRGGYMELTGFSTEIKHEILKLCSISLCPVVTGQALV 386
           GK++NVQLASLHSTSKGVSGECGQRGGYMELTGFS E++  ILKL SISLCPVVTGQALV
Sbjct: 397 GKFDNVQLASLHSTSKGVSGECGQRGGYMELTGFSHEMRQVILKLASISLCPVVTGQALV 456

Query: 387 DLMTCPPKKGEASYEQDQMERSTIHSELYERATYLWKAFNEMEGVSCQKPQGSMYLFPKI 446
           DLM  PP +GE S+E DQ ER++IH +L  RA  L+  FN +EG+ CQKPQG+MYLFPKI
Sbjct: 457 DLMVRPPVEGEESFELDQAERNSIHEKLITRAMTLYDTFNSLEGIECQKPQGAMYLFPKI 516

Query: 447 DIPHKALEKAQELDITPDELYCAELLEATGICTVPGSGFGQKPGTFHLRTTFLAPGTSWI 506
           D+P KA+++A+ L++TPDE YC  LLE+TGICTVPGSGFGQ+PGT+HLRTTFLAPG  WI
Sbjct: 517 DLPFKAVQEARHLELTPDEFYCKSLLESTGICTVPGSGFGQEPGTYHLRTTFLAPGLEWI 576

Query: 507 DQWREFHQIFCNKYRD 522
            +W  FH+ F ++YRD
Sbjct: 577 KKWETFHKEFFDQYRD 592

>Smik_12.148 Chr12 complement(298127..299905) [1779 bp, 592 aa] {ON}
           YLR089C (REAL)
          Length = 592

 Score =  658 bits (1697), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 315/496 (63%), Positives = 383/496 (77%), Gaps = 1/496 (0%)

Query: 28  TISLKHKNFKPADKLTINDLNENVLKAKYAVRGKIPARAEVLKQQLIDNPSSLPFKKVIN 87
           T+   +  F PA++LT++D+NENVLKAKYAVRG IP RAE LK QL  +P SLPF K+IN
Sbjct: 97  TLKTSNNEFYPAEQLTLDDVNENVLKAKYAVRGAIPMRAEELKAQLEKDPQSLPFNKIIN 156

Query: 88  ANIGNPQQLNQKPLTFYRQVLSLLQYPMVLDETFSGNTKT-LYKQDAIERAKRILNDIXX 146
           ANIGNPQQL QKPLT+YRQVLSLLQYP +L++       + L+K DAI+RAK ++ +I  
Sbjct: 157 ANIGNPQQLQQKPLTYYRQVLSLLQYPELLNQNEQQLVDSKLFKLDAIKRAKSLMEEIGG 216

Query: 147 XXXXXXXXXXXXXLRKTVAEYISRRDGGEKAYAEDIFLTAGASSAVSYLLNILCKGKESG 206
                        +R++VAE+I++RD GE +Y EDIFLTAGAS+AV+YLL+I C+G E+G
Sbjct: 217 SVGAYSSSQGVEGIRRSVAEFITKRDEGEISYPEDIFLTAGASAAVNYLLSIFCRGPETG 276

Query: 207 VLIPIPQYXXXXXXXXXXXXXXXXXXXEENSGWSTNMEEIENVVHNAIREKIIPRVLVVI 266
           VLIPIPQY                   +E+SGWSTN EEIE VV  AI  +I   VLVVI
Sbjct: 277 VLIPIPQYPLYTATLALNNSQALPYYLDESSGWSTNPEEIETVVKEAIENEIKSTVLVVI 336

Query: 267 NPGNPTGAILSVESIEKIFDVAAHHGIVVIADEVYQENIFPGNEFHSMKKVLRDLQRRVP 326
           NPGNPTGA+LS ESI +IF+VAA +G VVIADEVYQENIFPG +FHSMKK+LR LQR  P
Sbjct: 337 NPGNPTGAVLSPESIAQIFEVAAKYGTVVIADEVYQENIFPGTKFHSMKKILRHLQREHP 396

Query: 327 GKYENVQLASLHSTSKGVSGECGQRGGYMELTGFSTEIKHEILKLCSISLCPVVTGQALV 386
           GK++NVQLASLHSTSKGVSGECGQRGGYMELTGFS E++  ILKL SISLCPVVTGQALV
Sbjct: 397 GKFDNVQLASLHSTSKGVSGECGQRGGYMELTGFSHEMRQVILKLASISLCPVVTGQALV 456

Query: 387 DLMTCPPKKGEASYEQDQMERSTIHSELYERATYLWKAFNEMEGVSCQKPQGSMYLFPKI 446
           DLM  PP +GE S+E DQ ER++IH +L  RA  L+K FN +EG+ CQKPQG+MYLFPKI
Sbjct: 457 DLMVRPPLEGEESFESDQAERNSIHEKLITRAMTLYKTFNSLEGIECQKPQGAMYLFPKI 516

Query: 447 DIPHKALEKAQELDITPDELYCAELLEATGICTVPGSGFGQKPGTFHLRTTFLAPGTSWI 506
           D+P +A+++A+ L++TPDE YC +LLE+TGICTVPGSGFGQ+PGT+HLRTTFLAPG  WI
Sbjct: 517 DLPFRAVQEARHLELTPDEFYCKKLLESTGICTVPGSGFGQEPGTYHLRTTFLAPGLEWI 576

Query: 507 DQWREFHQIFCNKYRD 522
            +W  FH+ F + YRD
Sbjct: 577 KKWETFHKEFFDHYRD 592

>CAGL0L12254g Chr12 complement(1327111..1328835) [1725 bp, 574 aa]
           {ON} similar to uniprot|P52893 Saccharomyces cerevisiae
           YLR089c
          Length = 574

 Score =  653 bits (1685), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 312/492 (63%), Positives = 381/492 (77%), Gaps = 3/492 (0%)

Query: 33  HKN--FKPADKLTINDLNENVLKAKYAVRGKIPARAEVLKQQLIDNPSSLPFKKVINANI 90
           H N  F PA++ T+ D+NE VL AKYAVRG IP RAE LK QL++NP SLPF  +INANI
Sbjct: 84  HNNLPFLPAEQATLKDVNECVLNAKYAVRGAIPMRAEELKTQLMENPHSLPFNDIINANI 143

Query: 91  GNPQQLNQKPLTFYRQVLSLLQYPMVLDETFSGNTKTLYKQDAIERAKRILNDIXXXXXX 150
           GNPQQL QKPL+FYRQVLSLLQYP ++  T   N +T+ KQDAI+RAKR+L+DI      
Sbjct: 144 GNPQQLKQKPLSFYRQVLSLLQYPELI-PTLENNPQTMIKQDAIDRAKRLLDDIGGSVGA 202

Query: 151 XXXXXXXXXLRKTVAEYISRRDGGEKAYAEDIFLTAGASSAVSYLLNILCKGKESGVLIP 210
                    +RKTVA++I+ RD G  AY EDIFLTAGASSAV YLL+I C+G+E+GVLIP
Sbjct: 203 YSSSQGVLGIRKTVADFITNRDDGIIAYPEDIFLTAGASSAVDYLLSIFCRGEETGVLIP 262

Query: 211 IPQYXXXXXXXXXXXXXXXXXXXEENSGWSTNMEEIENVVHNAIREKIIPRVLVVINPGN 270
           IPQY                    E +GWST+ EE+E+++ ++I   I P VLVVINPGN
Sbjct: 263 IPQYPLYTATLALQNSHALPYYLNEETGWSTDPEELESIILDSIENNIKPSVLVVINPGN 322

Query: 271 PTGAILSVESIEKIFDVAAHHGIVVIADEVYQENIFPGNEFHSMKKVLRDLQRRVPGKYE 330
           PTGA+LS E+IE+IF +AA +GI+VIADEVYQEN+F   +FHSMKKVLR LQ + PG Y+
Sbjct: 323 PTGAVLSEEAIEQIFTLAAKYGIIVIADEVYQENVFEDVKFHSMKKVLRQLQMKQPGLYD 382

Query: 331 NVQLASLHSTSKGVSGECGQRGGYMELTGFSTEIKHEILKLCSISLCPVVTGQALVDLMT 390
           NVQLASLHSTSKGVSGECGQRGGYMEL GF+ +I+  +LKL SISLCPVVTGQALVDLM 
Sbjct: 383 NVQLASLHSTSKGVSGECGQRGGYMELVGFTHDIRQVVLKLASISLCPVVTGQALVDLMV 442

Query: 391 CPPKKGEASYEQDQMERSTIHSELYERATYLWKAFNEMEGVSCQKPQGSMYLFPKIDIPH 450
           CPP+KGE SYEQDQ ER  IH EL++RAT L  AF +++G+SCQKPQG+MYLFPK+++P+
Sbjct: 443 CPPQKGEESYEQDQEERRNIHKELHKRATLLHDAFVKLDGISCQKPQGAMYLFPKLELPY 502

Query: 451 KALEKAQELDITPDELYCAELLEATGICTVPGSGFGQKPGTFHLRTTFLAPGTSWIDQWR 510
           KA+++A   D++PDE YC  LLE TGICTVPGSGFGQ+PGT+HLRTTFLAPGT WI+ W 
Sbjct: 503 KAIQEALHQDMSPDEFYCKSLLEKTGICTVPGSGFGQEPGTYHLRTTFLAPGTKWIEDWV 562

Query: 511 EFHQIFCNKYRD 522
           +FHQ F NK+++
Sbjct: 563 DFHQEFYNKFKN 574

>ZYRO0C01628g Chr3 (115665..117269) [1605 bp, 534 aa] {ON} similar
           to uniprot|P52893 Saccharomyces cerevisiae YLR089C ALT1
           putative alanine transaminase (glutamyc pyruvic
           transaminase)
          Length = 534

 Score =  645 bits (1663), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 310/486 (63%), Positives = 372/486 (76%), Gaps = 1/486 (0%)

Query: 38  PADKLTINDLNENVLKAKYAVRGKIPARAEVLKQQLIDNPSSLPFKKVINANIGNPQQLN 97
           PA+KL ++++NENVLKAKYAVRG IP  A  L  +L  +P SLPF  +++ANIGNPQ L 
Sbjct: 49  PAEKLGLSEVNENVLKAKYAVRGAIPMLAAELNAKLKKDPHSLPFDNIVSANIGNPQHLK 108

Query: 98  QKPLTFYRQVLSLLQYPMVLDETFSGNTKT-LYKQDAIERAKRILNDIXXXXXXXXXXXX 156
           QKPLTFYRQVLSLLQYP +L+E       + LY++DAI RA+R+LNDI            
Sbjct: 109 QKPLTFYRQVLSLLQYPGLLEENEQVLIDSKLYQKDAIARARRLLNDIGSSVGAYSTSQG 168

Query: 157 XXXLRKTVAEYISRRDGGEKAYAEDIFLTAGASSAVSYLLNILCKGKESGVLIPIPQYXX 216
              +R+TVA++I+ RDGGEKAYAEDIFLTAGASSAVSYLL+ILCKG+E+GVLIPIPQY  
Sbjct: 169 IQGIRETVAQFITERDGGEKAYAEDIFLTAGASSAVSYLLSILCKGQETGVLIPIPQYPL 228

Query: 217 XXXXXXXXXXXXXXXXXEENSGWSTNMEEIENVVHNAIREKIIPRVLVVINPGNPTGAIL 276
                            +E SGWSTN  EIE+VV+NAI + I P VLVVINPGNPTGA+L
Sbjct: 229 YTASLALNNSHPLPYYLDEKSGWSTNPTEIEDVVNNAIEQNIKPSVLVVINPGNPTGAVL 288

Query: 277 SVESIEKIFDVAAHHGIVVIADEVYQENIFPGNEFHSMKKVLRDLQRRVPGKYENVQLAS 336
           S E I +IF +AA +GIVVIADEVYQEN+F G EFHSMKK+LR LQ+  PG ++NVQLAS
Sbjct: 289 SEEDISQIFAIAAKYGIVVIADEVYQENVFDGAEFHSMKKILRKLQKSNPGVFDNVQLAS 348

Query: 337 LHSTSKGVSGECGQRGGYMELTGFSTEIKHEILKLCSISLCPVVTGQALVDLMTCPPKKG 396
           LHSTSKGVSGECGQRGGYME+TGF+ +I+  ILKL SISLCPVVTGQALVDLM  PPK G
Sbjct: 349 LHSTSKGVSGECGQRGGYMEITGFNNDIRQVILKLASISLCPVVTGQALVDLMVSPPKPG 408

Query: 397 EASYEQDQMERSTIHSELYERATYLWKAFNEMEGVSCQKPQGSMYLFPKIDIPHKALEKA 456
           + SYE DQ ER +IH  L ERA  L   FN +EG+ CQKP+G+MYLFP++ +P KA++ A
Sbjct: 409 DESYELDQQERKSIHEALAERAGKLHATFNSLEGIECQKPEGAMYLFPRLLLPFKAIQSA 468

Query: 457 QELDITPDELYCAELLEATGICTVPGSGFGQKPGTFHLRTTFLAPGTSWIDQWREFHQIF 516
           +   +TPD  YC +LLEATGICTVPGSGFGQ+PGT+HLRTTFLAPGT WI++W  FH+ F
Sbjct: 469 EHEGMTPDAFYCKKLLEATGICTVPGSGFGQEPGTYHLRTTFLAPGTEWIERWENFHKAF 528

Query: 517 CNKYRD 522
             +YRD
Sbjct: 529 YEEYRD 534

>NDAI0B01990 Chr2 complement(493160..494926) [1767 bp, 588 aa] {ON}
           Anc_8.263 YDR111C
          Length = 588

 Score =  645 bits (1665), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 318/512 (62%), Positives = 381/512 (74%), Gaps = 7/512 (1%)

Query: 18  LSGKRLLSLTTIS------LKHKNFKPADKLTINDLNENVLKAKYAVRGKIPARAEVLKQ 71
              KR L   +IS       K K+F PA++LT+ DLNENVLKAKYAVRG IP RAE LK 
Sbjct: 77  FDAKRALMTRSISHHSLKVAKGKDFAPAEQLTLADLNENVLKAKYAVRGSIPMRAEELKV 136

Query: 72  QLIDNPSSLPFKKVINANIGNPQQLNQKPLTFYRQVLSLLQYPMVLDETFSGNTKT-LYK 130
           QL +NPS+LPF +++NANIGNPQQL QKPL+FYRQVLS+LQYP +L E         +YK
Sbjct: 137 QLENNPSTLPFSQIVNANIGNPQQLKQKPLSFYRQVLSILQYPDILKENEQNLIDAKVYK 196

Query: 131 QDAIERAKRILNDIXXXXXXXXXXXXXXXLRKTVAEYISRRDGGEKAYAEDIFLTAGASS 190
           +DAI+RAK +L++I               +RKTVA +I+ RDGGE AY EDIFLT     
Sbjct: 197 RDAIDRAKLLLSEIGGSVGAYSASQGVYGIRKTVANFITERDGGEPAYPEDIFLTVWCFR 256

Query: 191 AVSYLLNILCKGKESGVLIPIPQYXXXXXXXXXXXXXXXXXXXEENSGWSTNMEEIENVV 250
              YLL+ILC+G ++GVLIPIPQY                   +E SGWSTN +EIE VV
Sbjct: 257 CCCYLLSILCQGPKTGVLIPIPQYPLYTATLALNNSHALPYYLDEKSGWSTNPKEIEEVV 316

Query: 251 HNAIREKIIPRVLVVINPGNPTGAILSVESIEKIFDVAAHHGIVVIADEVYQENIFPGNE 310
            +A+   I P VLVVINPGNPTGA+L+ ESIE IF++AA +GIVVIADEVYQENI  G +
Sbjct: 317 QDAMERAINPSVLVVINPGNPTGAVLTEESIEHIFEIAAKYGIVVIADEVYQENIADGVK 376

Query: 311 FHSMKKVLRDLQRRVPGKYENVQLASLHSTSKGVSGECGQRGGYMELTGFSTEIKHEILK 370
           F+SMKKVLR LQ+  PGK++NVQLASLHSTSKGVSGECGQRGGYMEL GF+ E++  ILK
Sbjct: 377 FYSMKKVLRKLQKSHPGKFDNVQLASLHSTSKGVSGECGQRGGYMELIGFTHEVRKVILK 436

Query: 371 LCSISLCPVVTGQALVDLMTCPPKKGEASYEQDQMERSTIHSELYERATYLWKAFNEMEG 430
           L SISLCPVVTGQALVDLM  PPKKG+ASYEQDQ ER  I SEL  RA+ L++ F  +EG
Sbjct: 437 LASISLCPVVTGQALVDLMVSPPKKGDASYEQDQAERRHIKSELSIRASQLYETFVGLEG 496

Query: 431 VSCQKPQGSMYLFPKIDIPHKALEKAQELDITPDELYCAELLEATGICTVPGSGFGQKPG 490
           + CQKPQG+MYLFPK+D+P KA+++AQ L++TPDE YC  LL+ATGICTVPGSGFGQ+PG
Sbjct: 497 IECQKPQGAMYLFPKLDLPFKAVQEAQHLEMTPDEFYCKSLLDATGICTVPGSGFGQEPG 556

Query: 491 TFHLRTTFLAPGTSWIDQWREFHQIFCNKYRD 522
           T+HLRTTFLAPGT WI +W  FH+ F + YRD
Sbjct: 557 TYHLRTTFLAPGTEWIKKWEAFHKEFYDNYRD 588

>KLLA0F19162g Chr6 complement(1775240..1776826) [1587 bp, 528 aa]
           {ON} similar to uniprot|P52893 Saccharomyces cerevisiae
           YLR089C ALT1 putative alanine transaminase (glutamyc
           pyruvic transaminase)
          Length = 528

 Score =  641 bits (1654), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 312/520 (60%), Positives = 394/520 (75%), Gaps = 3/520 (0%)

Query: 4   RSRSTNCTVNA-AIALSGKRLLSLTTISLKHKNFKPADKLTINDLNENVLKAKYAVRGKI 62
           R  S    VNA A+  +   + SLT +       KPA KL+++D+NENVLKAKYAVRG+I
Sbjct: 11  RISSGMIRVNAPALKSTMPSVTSLTQLRFS-TTVKPAPKLSLDDVNENVLKAKYAVRGRI 69

Query: 63  PARAEVLKQQLIDNPSSLPFKKVINANIGNPQQLNQKPLTFYRQVLSLLQYPMVLDETFS 122
           P RAE L+ QL  +PSSLPF K+I+ANIGNPQQL+QKPLTFYR+VLSLLQ+P +L+E   
Sbjct: 70  PMRAEELRDQLKKDPSSLPFSKIISANIGNPQQLDQKPLTFYREVLSLLQHPELLEEADE 129

Query: 123 GNTKTLYKQDAIERAKRILNDIXXXXXXXXXXXXXXXLRKTVAEYISRRDGGEKAYAEDI 182
              +TLYK D+I+RAKR+L+++               +R+TVA++I++RD GE +Y EDI
Sbjct: 130 A-LQTLYKTDSIKRAKRLLSEVGGSVGAYSQSQGVQGIRETVADFITKRDDGEISYPEDI 188

Query: 183 FLTAGASSAVSYLLNILCKGKESGVLIPIPQYXXXXXXXXXXXXXXXXXXXEENSGWSTN 242
           +LTAGAS+AVSY+L+ILCKG  +GVLIPIPQY                    E   WST+
Sbjct: 189 YLTAGASAAVSYILSILCKGPNTGVLIPIPQYPLYTASLALNNSRPLPYYLREEQNWSTD 248

Query: 243 MEEIENVVHNAIREKIIPRVLVVINPGNPTGAILSVESIEKIFDVAAHHGIVVIADEVYQ 302
            EEIE VV +AI++ I P  LVVINPGNPTGAILS +SI+KIF+VAA +GIVVIADEVYQ
Sbjct: 249 PEEIEQVVLDAIQKGIKPTCLVVINPGNPTGAILSEQSIQKIFEVAAKYGIVVIADEVYQ 308

Query: 303 ENIFPGNEFHSMKKVLRDLQRRVPGKYENVQLASLHSTSKGVSGECGQRGGYMELTGFST 362
           EN+F G++F+SMKKVLR+LQ+   G+Y+N+QLASLHSTSKGVSGECGQRGGYMEL GF+ 
Sbjct: 309 ENVFKGSKFYSMKKVLRNLQKTYHGQYDNIQLASLHSTSKGVSGECGQRGGYMELVGFNH 368

Query: 363 EIKHEILKLCSISLCPVVTGQALVDLMTCPPKKGEASYEQDQMERSTIHSELYERATYLW 422
           +I+   LKL SISLCPVVTGQALVDLM  PP+ G+ SYEQDQ ER  IH  L ERA+ L+
Sbjct: 369 DIRQVFLKLASISLCPVVTGQALVDLMVSPPQPGDESYEQDQQEREDIHDALDERASKLF 428

Query: 423 KAFNEMEGVSCQKPQGSMYLFPKIDIPHKALEKAQELDITPDELYCAELLEATGICTVPG 482
           + F+ +EG+ C+KPQG+MYL+PK+D+P+K +++AQ L++ PDE YC  LLE TGICTVPG
Sbjct: 429 ETFSRLEGIECRKPQGAMYLYPKLDLPYKVIQEAQHLEMEPDEFYCKALLENTGICTVPG 488

Query: 483 SGFGQKPGTFHLRTTFLAPGTSWIDQWREFHQIFCNKYRD 522
           SGFGQ PGT+HLRTTFL PGT W++ W +FH+ F +KYRD
Sbjct: 489 SGFGQVPGTYHLRTTFLPPGTEWVETWEKFHKAFFDKYRD 528

>KAFR0B02730 Chr2 complement(558858..560477) [1620 bp, 539 aa] {ON}
           Anc_8.263 YDR111C
          Length = 539

 Score =  639 bits (1648), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 317/492 (64%), Positives = 383/492 (77%), Gaps = 4/492 (0%)

Query: 32  KHK-NFKPADKLTINDLNENVLKAKYAVRGKIPARAEVLKQQLIDNPSSLPFKKVINANI 90
           KH  NFKPA +LTI DLNENVLKAKYAVRGKIP RAE LK+QL + P+SLPF K+INANI
Sbjct: 47  KHNLNFKPAGQLTIGDLNENVLKAKYAVRGKIPTRAEELKRQLAEKPNSLPFDKIINANI 106

Query: 91  GNPQQLNQKPLTFYRQVLSLLQYPMVLD--ETFSGNTKTLYKQDAIERAKRILNDIXXXX 148
           GNPQQL Q+PL+FYRQVLSLLQYP +L   ET  G++  +YK+DAI RAK+IL DI    
Sbjct: 107 GNPQQLQQQPLSFYRQVLSLLQYPTLLHAIETKPGSS-AVYKKDAILRAKKILKDIGGSV 165

Query: 149 XXXXXXXXXXXLRKTVAEYISRRDGGEKAYAEDIFLTAGASSAVSYLLNILCKGKESGVL 208
                      +R+TVA +I+ RDGGE AY EDIFLTAGAS+AV+YLL+ILCKG+++GVL
Sbjct: 166 GAYSESQGVYGIRRTVANFITERDGGEPAYPEDIFLTAGASAAVNYLLSILCKGEKTGVL 225

Query: 209 IPIPQYXXXXXXXXXXXXXXXXXXXEENSGWSTNMEEIENVVHNAIREKIIPRVLVVINP 268
           IPIPQY                   +E +GWS N  EIENV+  A+++ I P VLVVINP
Sbjct: 226 IPIPQYPLYTATLALNNSHALPYFLDEMNGWSINPIEIENVIKKAVQDNIKPDVLVVINP 285

Query: 269 GNPTGAILSVESIEKIFDVAAHHGIVVIADEVYQENIFPGNEFHSMKKVLRDLQRRVPGK 328
           GNPTGA+LS E+I  I ++AA +GIVVIADEVYQENIF G +FHS+K VLR LQR +PGK
Sbjct: 286 GNPTGAVLSKEAIVSILEIAAKYGIVVIADEVYQENIFDGMKFHSVKGVLRRLQREIPGK 345

Query: 329 YENVQLASLHSTSKGVSGECGQRGGYMELTGFSTEIKHEILKLCSISLCPVVTGQALVDL 388
           ++NVQLASLHSTSKGVSGECGQRGGYME+ GF+ E++  ILKL SISLCPVVTGQALVDL
Sbjct: 346 FDNVQLASLHSTSKGVSGECGQRGGYMEIIGFTHEVRQVILKLASISLCPVVTGQALVDL 405

Query: 389 MTCPPKKGEASYEQDQMERSTIHSELYERATYLWKAFNEMEGVSCQKPQGSMYLFPKIDI 448
           M  PPK+GE S+  DQ +R TIHS+L +RA  LWK FN ++G+ CQKP G+MYLFPK+++
Sbjct: 406 MVSPPKRGEESFALDQAQRKTIHSQLSQRAELLWKTFNSLDGIECQKPNGAMYLFPKLNL 465

Query: 449 PHKALEKAQELDITPDELYCAELLEATGICTVPGSGFGQKPGTFHLRTTFLAPGTSWIDQ 508
           P++A+++AQ L+++PDE YC ELLE TGICTVPGSGFGQ  GT+HLRTTFLAPG  WID 
Sbjct: 466 PYRAIQEAQRLELSPDEFYCKELLEHTGICTVPGSGFGQVAGTYHLRTTFLAPGIEWIDS 525

Query: 509 WREFHQIFCNKY 520
           W++FH  F  KY
Sbjct: 526 WKQFHIEFMEKY 537

>KLTH0G13662g Chr7 (1169989..1171548) [1560 bp, 519 aa] {ON} similar
           to uniprot|P52893 Saccharomyces cerevisiae YLR089C ALT1
           putative alanine transaminase (glutamyc pyruvic
           transaminase)
          Length = 519

 Score =  620 bits (1598), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 305/522 (58%), Positives = 375/522 (71%), Gaps = 3/522 (0%)

Query: 1   MMLRSRSTNCTVNAAIALSGKRLLSLTTISLKHKNFKPADKLTINDLNENVLKAKYAVRG 60
           MML  + T    ++ + L  +RL +   +           K T+ D+N+ VL AKYAVRG
Sbjct: 1   MMLSRQLTRTMPHSRLIL--RRLSAKAAVKSDLSQKALGSKKTLRDVNQCVLNAKYAVRG 58

Query: 61  KIPARAEVLKQQLIDNPSSLPFKKVINANIGNPQQLNQKPLTFYRQVLSLLQYPMVLDET 120
            IP RAE L+ +L++ P SLPF K+INANIGNPQQL+QKPLTFYRQVLSLLQ P +++  
Sbjct: 59  PIPLRAEELRHKLVEEPGSLPFNKIINANIGNPQQLDQKPLTFYRQVLSLLQNPALIESL 118

Query: 121 FSGNTKTLYKQDAIERAKRILNDIXXXXXXXXXXXXXXXLRKTVAEYISRRDGGEKAYAE 180
            +G    L+K DA+ERAK++L  +                R++VAE+I  RDG E A A 
Sbjct: 119 PTGELHKLFKPDAVERAKKMLKQVGGSVGAYSASQGVAGFRQSVAEFIEERDG-EPASAN 177

Query: 181 DIFLTAGASSAVSYLLNILCKGKESGVLIPIPQYXXXXXXXXXXXXXXXXXXXEENSGWS 240
           DIFLTAGASSAVS +L++ C G E+G LIPIPQY                   +E SGWS
Sbjct: 178 DIFLTAGASSAVSAILSMFCTGSENGALIPIPQYPLYTATLALNDAHALPYYLDEASGWS 237

Query: 241 TNMEEIENVVHNAIREKIIPRVLVVINPGNPTGAILSVESIEKIFDVAAHHGIVVIADEV 300
            + E++E VV +AIR+ + P  LVVINPGNPTGAILS E+IEKI  VAA + +VVIADEV
Sbjct: 238 MDTEQVEQVVKDAIRKGVRPTCLVVINPGNPTGAILSPEAIEKILTVAAKYSLVVIADEV 297

Query: 301 YQENIFPGNEFHSMKKVLRDLQRRVPGKYENVQLASLHSTSKGVSGECGQRGGYMELTGF 360
           YQEN F   +F SMKKVLR LQ+  PGKY+NVQLASLHSTSKGVSGECGQRGGYMEL GF
Sbjct: 298 YQENGFDDADFVSMKKVLRVLQKTEPGKYDNVQLASLHSTSKGVSGECGQRGGYMELVGF 357

Query: 361 STEIKHEILKLCSISLCPVVTGQALVDLMTCPPKKGEASYEQDQMERSTIHSELYERATY 420
           S E+K   LKL SISLCPVVTGQALVDLM  PPKKG+ASYE D+ ER+ IH+ L++++T 
Sbjct: 358 SEEVKQVFLKLASISLCPVVTGQALVDLMVRPPKKGDASYELDRQERNAIHNSLHQKSTL 417

Query: 421 LWKAFNEMEGVSCQKPQGSMYLFPKIDIPHKALEKAQELDITPDELYCAELLEATGICTV 480
           L++ F  +EGVSCQKPQG+MYLFPK+D+  KA+ KA+ L + PDE YC ELLEATGICTV
Sbjct: 418 LYETFQSLEGVSCQKPQGAMYLFPKLDLSRKAIRKAESLGMAPDEYYCKELLEATGICTV 477

Query: 481 PGSGFGQKPGTFHLRTTFLAPGTSWIDQWREFHQIFCNKYRD 522
           PGSGF Q PGT+HLRTTFLAPGT W+D W++FHQ F +++RD
Sbjct: 478 PGSGFRQVPGTYHLRTTFLAPGTEWVDSWKKFHQKFVDEHRD 519

>Kwal_56.23791 s56 (706946..708502) [1557 bp, 518 aa] {ON} YLR089C -
           Hypothetical ORF [contig 173] FULL
          Length = 518

 Score =  612 bits (1578), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 295/484 (60%), Positives = 358/484 (73%), Gaps = 1/484 (0%)

Query: 39  ADKLTINDLNENVLKAKYAVRGKIPARAEVLKQQLIDNPSSLPFKKVINANIGNPQQLNQ 98
             K T+ D+NE VL AKYAVRG IP RAE LKQ+L++ P SLPF K+INANIGNPQQL+Q
Sbjct: 36  GSKKTLQDINECVLNAKYAVRGLIPLRAEELKQKLLEEPGSLPFDKIINANIGNPQQLDQ 95

Query: 99  KPLTFYRQVLSLLQYPMVLDETFSGNTKTLYKQDAIERAKRILNDIXXXXXXXXXXXXXX 158
           KPLTFYRQVL+LLQ P ++ +  SG     +K DA+ERAK++L  +              
Sbjct: 96  KPLTFYRQVLALLQNPDLISDLSSGELHKFFKPDAVERAKKMLKQVGGSVGAYSNSQGVA 155

Query: 159 XLRKTVAEYISRRDGGEKAYAEDIFLTAGASSAVSYLLNILCKGKESGVLIPIPQYXXXX 218
             R++VAE+I  RDG E A A+DIFLT GAS AVSY+L++ C G E+G LIPIPQY    
Sbjct: 156 GFRESVAEFIEERDG-EPASAQDIFLTTGASGAVSYILSLFCNGPENGALIPIPQYPLYT 214

Query: 219 XXXXXXXXXXXXXXXEENSGWSTNMEEIENVVHNAIREKIIPRVLVVINPGNPTGAILSV 278
                          +E SGWS + E+IE VV ++I++ I P  LVVINPGNPTGA+L+ 
Sbjct: 215 ASLALNNSHALPYYLDEESGWSMDTEQIEKVVQDSIKKGIRPTCLVVINPGNPTGALLNT 274

Query: 279 ESIEKIFDVAAHHGIVVIADEVYQENIFPGNEFHSMKKVLRDLQRRVPGKYENVQLASLH 338
           ++IE +  VAA + +V+IADEVYQEN F   EF SMKKVLR LQ+  PGKY+NVQLASLH
Sbjct: 275 DTIENVIKVAAKYSMVIIADEVYQENGFNDAEFVSMKKVLRVLQKTEPGKYDNVQLASLH 334

Query: 339 STSKGVSGECGQRGGYMELTGFSTEIKHEILKLCSISLCPVVTGQALVDLMTCPPKKGEA 398
           STSKGVSGECGQRGGYMEL GFS E+K   LKL SISLCPVVTGQAL+DLM  PPKKG+A
Sbjct: 335 STSKGVSGECGQRGGYMELVGFSEEVKQVFLKLASISLCPVVTGQALIDLMVRPPKKGDA 394

Query: 399 SYEQDQMERSTIHSELYERATYLWKAFNEMEGVSCQKPQGSMYLFPKIDIPHKALEKAQE 458
           SYEQD+ ER  IH  L++R+  L++AF  MEGVSCQ+PQG+MYLFPK+++ +KA+ KA+ 
Sbjct: 395 SYEQDRQERCDIHDALHKRSGLLYQAFQSMEGVSCQEPQGAMYLFPKLELSNKAIHKAES 454

Query: 459 LDITPDELYCAELLEATGICTVPGSGFGQKPGTFHLRTTFLAPGTSWIDQWREFHQIFCN 518
             + PDE YC ELLEATGICTVPGSGFGQ PGTFHLRTTFLAPGT WID W++FH+ F  
Sbjct: 455 AGLAPDEYYCKELLEATGICTVPGSGFGQVPGTFHLRTTFLAPGTEWIDSWKKFHEKFTE 514

Query: 519 KYRD 522
            +RD
Sbjct: 515 DHRD 518

>NCAS0B03840 Chr2 (683781..685274) [1494 bp, 497 aa] {ON} Anc_8.263
           YDR111C
          Length = 497

 Score =  603 bits (1555), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 280/497 (56%), Positives = 370/497 (74%)

Query: 26  LTTISLKHKNFKPADKLTINDLNENVLKAKYAVRGKIPARAEVLKQQLIDNPSSLPFKKV 85
           ++ +SL++ +F+PA KL++ D+NENV+ AK+A+RG I  +AE L+ QL  NP  LPF ++
Sbjct: 1   MSPLSLENNDFQPAPKLSLKDINENVVDAKFAIRGSISIKAEDLQVQLNKNPHCLPFDEI 60

Query: 86  INANIGNPQQLNQKPLTFYRQVLSLLQYPMVLDETFSGNTKTLYKQDAIERAKRILNDIX 145
             ANIGNPQ+LNQKPLTF RQV+S+LQYP +L+       + ++  D+ +RA+R+L DI 
Sbjct: 61  TVANIGNPQELNQKPLTFARQVVSILQYPELLNNRDVLTKEKIFNSDSFDRAERLLRDIG 120

Query: 146 XXXXXXXXXXXXXXLRKTVAEYISRRDGGEKAYAEDIFLTAGASSAVSYLLNILCKGKES 205
                         +RKT AEYI++RDGGE +Y EDIFLT GA+SA SYLL++LC+G ++
Sbjct: 121 GSVGAYSASQGVYGIRKTAAEYITKRDGGEPSYPEDIFLTTGATSAASYLLSVLCRGPQT 180

Query: 206 GVLIPIPQYXXXXXXXXXXXXXXXXXXXEENSGWSTNMEEIENVVHNAIREKIIPRVLVV 265
           GVLIPIPQY                   +E S WSTN  EIE +V ++I++ I P V+VV
Sbjct: 181 GVLIPIPQYPLYTATLALNKSTMIPYYLDEESAWSTNTTEIEKLVLDSIKKGIKPSVIVV 240

Query: 266 INPGNPTGAILSVESIEKIFDVAAHHGIVVIADEVYQENIFPGNEFHSMKKVLRDLQRRV 325
           INPGNPTGA+LS  +I KIF +AA +GIVV+ADEVYQENIF G +FHS KKVLR LQ++ 
Sbjct: 241 INPGNPTGAVLSELAIAKIFQIAAKYGIVVLADEVYQENIFDGVQFHSTKKVLRGLQKQY 300

Query: 326 PGKYENVQLASLHSTSKGVSGECGQRGGYMELTGFSTEIKHEILKLCSISLCPVVTGQAL 385
           PGK++N+QLAS+HSTSKGV GECGQRGGYMEL GF+ E++  +LKL  +++C VVTGQA+
Sbjct: 301 PGKFDNIQLASMHSTSKGVFGECGQRGGYMELVGFTDEVRQLLLKLACLAVCSVVTGQAM 360

Query: 386 VDLMTCPPKKGEASYEQDQMERSTIHSELYERATYLWKAFNEMEGVSCQKPQGSMYLFPK 445
           VDLM  PPKKG+ASYE D+ ER  I   +YERA  L+  F++++G+ CQKPQG+MYL+P 
Sbjct: 361 VDLMLLPPKKGDASYELDKKERQEIFDAMYERARKLYAMFDKLDGIECQKPQGAMYLYPS 420

Query: 446 IDIPHKALEKAQELDITPDELYCAELLEATGICTVPGSGFGQKPGTFHLRTTFLAPGTSW 505
           + +  KA+ KA+ L++TPDE YC ELL+ATGICTVPGSGFGQK GT+HLRTTFLAPG  W
Sbjct: 421 LILSKKAIAKAESLNLTPDEFYCHELLDATGICTVPGSGFGQKKGTYHLRTTFLAPGIEW 480

Query: 506 IDQWREFHQIFCNKYRD 522
           I++W +FH+ F  KY+D
Sbjct: 481 INKWEKFHKHFYEKYQD 497

>TBLA0E04440 Chr5 complement(1138820..1140508) [1689 bp, 562 aa]
           {ON} Anc_8.263 YDR111C
          Length = 562

 Score =  597 bits (1540), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 286/483 (59%), Positives = 358/483 (74%), Gaps = 1/483 (0%)

Query: 39  ADKLTINDLNENVLKAKYAVRGKIPARAEVLKQQLIDNPSSLPFKKVINANIGNPQQLNQ 98
           A++L   DLN NV+KAKYAVRG IP+ A+ LK QL+ +P +LPF+ VIN+NIGNPQQL Q
Sbjct: 81  AERLEPEDLNPNVVKAKYAVRGAIPSYADKLKIQLLKHPGTLPFESVINSNIGNPQQLGQ 140

Query: 99  KPLTFYRQVLSLLQYPMVLDETFSGNTKTLYKQDAIERAKRILNDIXXXXXXXXXXXXXX 158
           KPL+F RQVLS+L+YP +LD   +      Y  D+IERAK +L DI              
Sbjct: 141 KPLSFGRQVLSILEYPALLDHERTLVDSMGYAPDSIERAKTLLTDIGSIGAYSNSQGVHG 200

Query: 159 XLRKTVAEYISRRDGGEKAYAEDIFLTAGASSAVSYLLNILCKGKESGVLIPIPQYXXXX 218
            +R+TVA++I+ RD GE AY +DIFLTAGASSAVS +L+ILCKG+++GVLIPIPQY    
Sbjct: 201 -IRQTVADFITNRDDGEVAYPDDIFLTAGASSAVSTILSILCKGQQTGVLIPIPQYPLYT 259

Query: 219 XXXXXXXXXXXXXXXEENSGWSTNMEEIENVVHNAIREKIIPRVLVVINPGNPTGAILSV 278
                          +E++GWST++ EI  V  +++   I P  LVVINPGNPTG++L+V
Sbjct: 260 ATLTLNDATALPYYLDESNGWSTDINEISKVAQDSLEAGIKPTCLVVINPGNPTGSVLTV 319

Query: 279 ESIEKIFDVAAHHGIVVIADEVYQENIFPGNEFHSMKKVLRDLQRRVPGKYENVQLASLH 338
           E+I+ +FDVAA +G+VVIADEVYQ+NIFPG+EFHSMKK+LR LQ+ VP KY+N+QLASLH
Sbjct: 320 EAIKNVFDVAAKYGLVVIADEVYQDNIFPGSEFHSMKKILRILQKEVPNKYDNIQLASLH 379

Query: 339 STSKGVSGECGQRGGYMELTGFSTEIKHEILKLCSISLCPVVTGQALVDLMTCPPKKGEA 398
           S SKG+ GECG RGGY E  GF+ E+K  I KL SISLC  V GQALVDLM CPPKKGE 
Sbjct: 380 SCSKGLLGECGHRGGYCEFIGFTPEVKQVITKLSSISLCSSVIGQALVDLMCCPPKKGEP 439

Query: 399 SYEQDQMERSTIHSELYERATYLWKAFNEMEGVSCQKPQGSMYLFPKIDIPHKALEKAQE 458
           SYE DQ ER TI +   +R+  L++ FN +EGV+CQKPQG+MY+FP I +P  A++ AQ 
Sbjct: 440 SYELDQHERQTIRTNHKKRSNKLYEMFNSLEGVTCQKPQGAMYMFPNIQLPFNAIKMAQN 499

Query: 459 LDITPDELYCAELLEATGICTVPGSGFGQKPGTFHLRTTFLAPGTSWIDQWREFHQIFCN 518
           LDITPDE YC ELL+ATGICTVPGSGFGQ+PGT+H+RTTFLAPG  W+ +W +FH  F  
Sbjct: 500 LDITPDEFYCRELLKATGICTVPGSGFGQQPGTYHVRTTFLAPGVEWMKRWEKFHIEFFE 559

Query: 519 KYR 521
           KYR
Sbjct: 560 KYR 562

>YDR111C Chr4 complement(678241..679764) [1524 bp, 507 aa] {ON}
           ALT2Putative alanine transaminase (glutamic pyruvic
           transaminase)
          Length = 507

 Score =  592 bits (1526), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 287/498 (57%), Positives = 362/498 (72%), Gaps = 7/498 (1%)

Query: 29  ISLKHKNFKPADKLTINDLNENVLKAKYAVRGKIPARAEVLKQQLIDNPSSLPFKKVINA 88
            + K  +FKPA K+T  DLN  V KA+YAVRG IP RA+ LK++L  NP  LPF  +INA
Sbjct: 13  FTAKDLDFKPAGKITKKDLNTGVTKAEYAVRGAIPTRADELKEELKKNPEVLPFDDIINA 72

Query: 89  NIGNPQQLNQKPLTFYRQVLSLLQYPMVL----DETFSGNTKTLYKQDAIERAKRILNDI 144
           NIGNPQQL+QKPLTF RQVL++L+YP +L    +E  S N   L+ +DA+ERA+R+LNDI
Sbjct: 73  NIGNPQQLDQKPLTFTRQVLAILEYPEILRVGHNELASLN---LFSRDALERAERLLNDI 129

Query: 145 XXXXXXXXXXXXXXXLRKTVAEYISRRDGGEKAYAEDIFLTAGASSAVSYLLNILCKGKE 204
                          +R+TVA++I+RRDGGE A  EDI+LT GASSA + LL++LCK  +
Sbjct: 130 GGSIGAYSHSQGVPGIRQTVADFITRRDGGEPATPEDIYLTTGASSAATSLLSLLCKDSQ 189

Query: 205 SGVLIPIPQYXXXXXXXXXXXXXXXXXXXEENSGWSTNMEEIENVVHNAIREKIIPRVLV 264
           +G+LIPIPQY                   +E S WSTN +EIE VV +A++++I P VL+
Sbjct: 190 TGLLIPIPQYPLYTASASLFNAQVLPYYLDEESNWSTNSDEIEKVVQDALKKQIRPSVLI 249

Query: 265 VINPGNPTGAILSVESIEKIFDVAAHHGIVVIADEVYQENIFPGNEFHSMKKVLRDLQRR 324
           VINPGNPTGA+LS E+I +I  +AA +GI +I+DEVYQENIF   +FHSMKKVLR LQ  
Sbjct: 250 VINPGNPTGAVLSEETIARICLIAAKYGITIISDEVYQENIFNDVKFHSMKKVLRKLQHL 309

Query: 325 VPGKYENVQLASLHSTSKGVSGECGQRGGYMELTGFSTEIKHEILKLCSISLCPVVTGQA 384
            PGK++NVQLASLHS SKG   ECGQRGGYME+ GFS EI+  + KL SIS+C VVTGQA
Sbjct: 310 YPGKFDNVQLASLHSISKGFMDECGQRGGYMEIIGFSQEIRDALFKLMSISICSVVTGQA 369

Query: 385 LVDLMTCPPKKGEASYEQDQMERSTIHSELYERATYLWKAFNEMEGVSCQKPQGSMYLFP 444
           +VDLM  PP+ G+ SYEQD  ER  I  E+  RA  L++ F E+EG+ CQKPQG+MYLFP
Sbjct: 370 VVDLMVKPPQPGDESYEQDHDERLKIFHEMRTRANLLYETFKELEGIECQKPQGAMYLFP 429

Query: 445 KIDIPHKALEKAQELDITPDELYCAELLEATGICTVPGSGFGQKPGTFHLRTTFLAPGTS 504
           ++ +P KAL +++ L I PDE YC  LLE+TGICTVPGSGFGQ+PGT+H+RTTFLAPGT 
Sbjct: 430 RLVLPKKALCESERLGIEPDEFYCTSLLESTGICTVPGSGFGQRPGTYHVRTTFLAPGTK 489

Query: 505 WIDQWREFHQIFCNKYRD 522
           WI  W+EFHQ F +KYR+
Sbjct: 490 WIQDWKEFHQDFFSKYRN 507

>Smik_4.357 Chr4 complement(639561..641084) [1524 bp, 507 aa] {ON}
           YDR111C (REAL)
          Length = 507

 Score =  590 bits (1520), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 285/500 (57%), Positives = 360/500 (72%), Gaps = 7/500 (1%)

Query: 27  TTISLKHKNFKPADKLTINDLNENVLKAKYAVRGKIPARAEVLKQQLIDNPSSLPFKKVI 86
           +  + K  NFKPA K+T  DLN  V KA+YAVRG IP RA+ LK++L   P  LPF  +I
Sbjct: 11  SVFTTKDLNFKPAAKITKKDLNAGVTKAEYAVRGAIPTRADELKEELKRKPGVLPFDDII 70

Query: 87  NANIGNPQQLNQKPLTFYRQVLSLLQYPMVL----DETFSGNTKTLYKQDAIERAKRILN 142
           NANIGNPQQL+QKPLTF RQVLS+L+YP +L    D+  S N   L+++DA+ RA+ +L 
Sbjct: 71  NANIGNPQQLDQKPLTFTRQVLSILEYPEILRVGPDKLASLN---LFRKDALGRAEHLLE 127

Query: 143 DIXXXXXXXXXXXXXXXLRKTVAEYISRRDGGEKAYAEDIFLTAGASSAVSYLLNILCKG 202
           DI               +R++VAE+I++RD GE A  E+I+LT GASSA + LL++LCK 
Sbjct: 128 DIGGSIGAYSHSQGVPGIRQSVAEFITKRDDGEPAAPENIYLTTGASSAATSLLSLLCKD 187

Query: 203 KESGVLIPIPQYXXXXXXXXXXXXXXXXXXXEENSGWSTNMEEIENVVHNAIREKIIPRV 262
            ++G+LIPIPQY                   +E S WST  +EIE VV +A+ + I P V
Sbjct: 188 VQTGLLIPIPQYPLYTASASLFNAQVLPYYLDEGSNWSTKSDEIEKVVKDALEKGIKPSV 247

Query: 263 LVVINPGNPTGAILSVESIEKIFDVAAHHGIVVIADEVYQENIFPGNEFHSMKKVLRDLQ 322
           L+VINPGNPTGA+LS ++I KI  +AA +GI +I+DEVYQEN+F G +FHSMKKVLR LQ
Sbjct: 248 LIVINPGNPTGAVLSEDTIAKICLIAAKYGIAIISDEVYQENVFNGVKFHSMKKVLRKLQ 307

Query: 323 RRVPGKYENVQLASLHSTSKGVSGECGQRGGYMELTGFSTEIKHEILKLCSISLCPVVTG 382
           R  PGK++NVQLASLHS SKG  GECGQRGGYME+ GFS +I+  + KL SIS+C VVTG
Sbjct: 308 RLYPGKFDNVQLASLHSISKGFMGECGQRGGYMEVVGFSKDIRDALFKLMSISICSVVTG 367

Query: 383 QALVDLMTCPPKKGEASYEQDQMERSTIHSELYERATYLWKAFNEMEGVSCQKPQGSMYL 442
           QA+VDLM  PP+ G+ SY+QD  ER  I  E+Y RAT L + FNE+EG+ CQKPQG+MYL
Sbjct: 368 QAVVDLMVKPPQPGDESYDQDHSERMKIFHEMYTRATLLHETFNELEGIECQKPQGAMYL 427

Query: 443 FPKIDIPHKALEKAQELDITPDELYCAELLEATGICTVPGSGFGQKPGTFHLRTTFLAPG 502
           FP++ +P KAL +++ L I PDE YC  LLE+TGICTVPGSGFGQ+PGT+H+RTTFLAPG
Sbjct: 428 FPRLVLPEKALRESERLGIEPDEFYCTSLLESTGICTVPGSGFGQQPGTYHVRTTFLAPG 487

Query: 503 TSWIDQWREFHQIFCNKYRD 522
           T WI  W+ FHQ F NKYRD
Sbjct: 488 TQWIQDWKHFHQDFFNKYRD 507

>KAFR0B05530 Chr2 (1132895..1134439) [1545 bp, 514 aa] {ON} 
          Length = 514

 Score =  587 bits (1512), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 288/489 (58%), Positives = 356/489 (72%), Gaps = 3/489 (0%)

Query: 35  NFKPADKLTINDLNENVLKAKYAVRGKIPARAEVLKQQLIDNPSS--LPFKKVINANIGN 92
           NFKPA K+T++DLN+NVLK++YAVRG IP RAE L+ +L++N SS  L F+ +++ANIGN
Sbjct: 27  NFKPAKKITLDDLNQNVLKSEYAVRGSIPRRAEELEFELLNNDSSDSLAFENIVHANIGN 86

Query: 93  PQQLNQKPLTFYRQVLSLLQYPMVLDETFSGNTKTLYKQDAIERAKRILNDIXXXXXXXX 152
           PQQL+QKPLTF RQV+S+LQYP +L++     +  ++K DA+ERA+ +L  I        
Sbjct: 87  PQQLDQKPLTFSRQVISILQYPELLNQRNILVSTGIFKSDAMERAETLLCHIGGSVGAYS 146

Query: 153 XXXXXXXLRKTVAEYISRRDGGEKAYAEDIFLTAGASSAVSYLLNILCKGKESGVLIPIP 212
                  +R+TVA YI+ RD GE A  +DIFLT GAS A SYLL++LCK K +GVLIPIP
Sbjct: 147 SSQGVYGIRETVANYITARDNGETASPDDIFLTEGASKAASYLLSLLCKDKNTGVLIPIP 206

Query: 213 QYXXXXXXXXXXXXXXXXXXXEENSGWSTNMEEIENVVHNAIREKIIPRVLVVINPGNPT 272
           QY                    E SGWSTN  EIE VV +AI + + P V+VVINPGNPT
Sbjct: 207 QYPLYTATITLCDAKMLPYYLNEESGWSTNTNEIEKVVLDAIADNVKPSVMVVINPGNPT 266

Query: 273 GAILSVESIEKIFDVAAHHGIVVIADEVYQENIFPGNEFHSMKKVLRDLQRRVPGKYENV 332
           G++LS + I  I ++ A +GIV+IADEVYQENIF G EFHSMKKVLR LQ++ PGKY+ V
Sbjct: 267 GSVLSKDDIIHIINIGAKYGIVLIADEVYQENIFDG-EFHSMKKVLRSLQKQYPGKYDAV 325

Query: 333 QLASLHSTSKGVSGECGQRGGYMELTGFSTEIKHEILKLCSISLCPVVTGQALVDLMTCP 392
           QLASLHSTSKGVSGECGQRGGYMEL GF  EI+  ILKL SISLC V+TGQALVDLM  P
Sbjct: 326 QLASLHSTSKGVSGECGQRGGYMELVGFKDEIRQAILKLASISLCSVITGQALVDLMVNP 385

Query: 393 PKKGEASYEQDQMERSTIHSELYERATYLWKAFNEMEGVSCQKPQGSMYLFPKIDIPHKA 452
           PKKG+ SYE D  ER  IH  L ERA  L+  F +++GV CQKPQG+MYLFPK+  P   
Sbjct: 386 PKKGDESYELDNFERKNIHETLKERAEKLYNLFCQLKGVECQKPQGAMYLFPKLHFPQTL 445

Query: 453 LEKAQELDITPDELYCAELLEATGICTVPGSGFGQKPGTFHLRTTFLAPGTSWIDQWREF 512
           + +A   +++PDE YC  LLEATGICTVPGSGFGQK GT+HLRTTFLAPG  W ++W+ F
Sbjct: 446 ITEAINQNMSPDEFYCHALLEATGICTVPGSGFGQKEGTYHLRTTFLAPGNQWTEKWKLF 505

Query: 513 HQIFCNKYR 521
           H+ F +KY+
Sbjct: 506 HEEFFSKYQ 514

>Ecym_4307 Chr4 (652209..653813) [1605 bp, 534 aa] {ON} similar to
           Ashbya gossypii AGR085W
          Length = 534

 Score =  587 bits (1512), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 287/487 (58%), Positives = 350/487 (71%), Gaps = 2/487 (0%)

Query: 36  FKPADKLTINDLNENVLKAKYAVRGKIPARAEVLKQQLIDNPSSLPFKKVINANIGNPQQ 95
           F+P D L + DLN NVL+AKYAVRGKIPARA  L++QL  +P SLPFKK+I ANIGNPQQ
Sbjct: 50  FEPGDPLKLEDLNSNVLEAKYAVRGKIPARAMELERQLSRDPDSLPFKKIIYANIGNPQQ 109

Query: 96  LNQKPLTFYRQVLSLLQYPMVLDETFSGNTKTLYKQDAIERAKRILNDIXXXXXXXXXXX 155
           L QKPL+F R+VLSLL+ P +L          +YK DA+ RAKR++ D+           
Sbjct: 110 LGQKPLSFSREVLSLLESPNLLQMPME-VLNLIYKPDAVRRAKRMMRDLQTSIGAYSHSQ 168

Query: 156 XXXXLRKTVAEYISRRDGGEKAYAEDIFLTAGASSAVSYLLNILCKGKESGVLIPIPQYX 215
                RKTVAEY+S RDG E A AEDIFLT GAS+  S ++ +LCKG+ESGVLIPIPQY 
Sbjct: 169 GVLGFRKTVAEYLSSRDG-EPASAEDIFLTTGASNGASLMIELLCKGQESGVLIPIPQYP 227

Query: 216 XXXXXXXXXXXXXXXXXXEENSGWSTNMEEIENVVHNAIREKIIPRVLVVINPGNPTGAI 275
                             +E SGWS N++++E ++  +I + + P  LVVINPGNPTGAI
Sbjct: 228 LYTATITLNNTVALPYYLDEESGWSLNIDDLERIIIESIEKGVKPACLVVINPGNPTGAI 287

Query: 276 LSVESIEKIFDVAAHHGIVVIADEVYQENIFPGNEFHSMKKVLRDLQRRVPGKYENVQLA 335
           L VES+E+IF +AA + IVVIADEVYQEN+F G +F+SMKKVLR LQRR    + NVQL 
Sbjct: 288 LPVESMERIFVIAAKYSIVVIADEVYQENVFEGLKFYSMKKVLRSLQRRYKELFSNVQLV 347

Query: 336 SLHSTSKGVSGECGQRGGYMELTGFSTEIKHEILKLCSISLCPVVTGQALVDLMTCPPKK 395
           SLHSTSKG+SGECGQRGGYMEL GFS +I+  ILK+ SI LC  V GQALVDLM   PK 
Sbjct: 348 SLHSTSKGLSGECGQRGGYMELVGFSDDIREVILKMASIQLCSPVGGQALVDLMLSRPKP 407

Query: 396 GEASYEQDQMERSTIHSELYERATYLWKAFNEMEGVSCQKPQGSMYLFPKIDIPHKALEK 455
           G+ SYE+D  ERS+I + L ER+  LW+ FN +EGV C+KPQGSMYLFP++ +P KA++ 
Sbjct: 408 GDESYERDLSERSSIRNALQERSKSLWETFNNLEGVECRKPQGSMYLFPRLVLPQKAIKA 467

Query: 456 AQELDITPDELYCAELLEATGICTVPGSGFGQKPGTFHLRTTFLAPGTSWIDQWREFHQI 515
           A+ LD+ PDE YC ELL +TGICTVPGSGFGQ P T HLRTTFL PGT WI+ W  FH+ 
Sbjct: 468 AESLDMQPDEFYCTELLNSTGICTVPGSGFGQAPDTCHLRTTFLCPGTEWIESWELFHKS 527

Query: 516 FCNKYRD 522
           F +KYRD
Sbjct: 528 FYDKYRD 534

>Suva_2.271 Chr2 complement(472714..474237) [1524 bp, 507 aa] {ON}
           YDR111C (REAL)
          Length = 507

 Score =  585 bits (1508), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 282/500 (56%), Positives = 364/500 (72%), Gaps = 7/500 (1%)

Query: 27  TTISLKHKNFKPADKLTINDLNENVLKAKYAVRGKIPARAEVLKQQLIDNPSSLPFKKVI 86
           +  + K  +FKPA KLT  DLN +V KA+YAVRG IP RAE LK++L  + +SLPF  +I
Sbjct: 11  SVFTTKDLDFKPAAKLTKKDLNASVTKAEYAVRGAIPTRAEELKEELKRSSNSLPFNSII 70

Query: 87  NANIGNPQQLNQKPLTFYRQVLSLLQYPMVL----DETFSGNTKTLYKQDAIERAKRILN 142
           NANIGNPQQL+QKPLTF RQVLS+L+YP +L    D+  S N   L+ +DA++RA+R+L+
Sbjct: 71  NANIGNPQQLDQKPLTFTRQVLSILEYPEILRVDHDKLASLN---LFAKDALKRAQRLLD 127

Query: 143 DIXXXXXXXXXXXXXXXLRKTVAEYISRRDGGEKAYAEDIFLTAGASSAVSYLLNILCKG 202
           DI               +R+TVA++I+ RDGGE A  EDI+LT GASSA + LL++LCK 
Sbjct: 128 DIGGSVGAYSHSQGVPGIRQTVADFITERDGGEPAGPEDIYLTTGASSAATSLLSLLCKD 187

Query: 203 KESGVLIPIPQYXXXXXXXXXXXXXXXXXXXEENSGWSTNMEEIENVVHNAIREKIIPRV 262
            ++G+L+PIPQY                   +E + WST  +EIE VV +A+++ I P V
Sbjct: 188 SQTGLLLPIPQYPLYTASASLYNAQVLPYYLDEEADWSTESDEIERVVLDALKKGIRPSV 247

Query: 263 LVVINPGNPTGAILSVESIEKIFDVAAHHGIVVIADEVYQENIFPGNEFHSMKKVLRDLQ 322
           LVVINPGNPTGA+L+  +I KI  +AA +GI +I+DEVYQENIF   +FHSMKK+LR LQ
Sbjct: 248 LVVINPGNPTGAVLTENTIAKICLIAAKYGITIISDEVYQENIFGDVKFHSMKKILRKLQ 307

Query: 323 RRVPGKYENVQLASLHSTSKGVSGECGQRGGYMELTGFSTEIKHEILKLCSISLCPVVTG 382
              PGK++NVQLASLHS SKG  GECGQRGGYME+ GFS +I+  + KL SIS+C V TG
Sbjct: 308 NLHPGKFDNVQLASLHSISKGFMGECGQRGGYMEIVGFSQDIRDALFKLMSISICSVATG 367

Query: 383 QALVDLMTCPPKKGEASYEQDQMERSTIHSELYERATYLWKAFNEMEGVSCQKPQGSMYL 442
           QA++DLM  PP+ G+ SY+QD+ ER  I++E+  RA  L++ FNE+EG+ CQKPQG+MYL
Sbjct: 368 QAIIDLMVKPPQPGDESYDQDRKERLKIYNEMLTRANLLYETFNELEGIKCQKPQGAMYL 427

Query: 443 FPKIDIPHKALEKAQELDITPDELYCAELLEATGICTVPGSGFGQKPGTFHLRTTFLAPG 502
           FPK+ +P KAL +++ L+I PD LYC  LLE+TGICTVPGSGFGQK GT+H+RTTFL PG
Sbjct: 428 FPKLFLPEKALRESERLNIEPDVLYCTSLLESTGICTVPGSGFGQKSGTYHVRTTFLPPG 487

Query: 503 TSWIDQWREFHQIFCNKYRD 522
           T WI  WR+FHQ F NKYRD
Sbjct: 488 TQWIQDWRQFHQDFFNKYRD 507

>Skud_4.372 Chr4 complement(649872..651395) [1524 bp, 507 aa] {ON}
           YDR111C (REAL)
          Length = 507

 Score =  580 bits (1494), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 278/492 (56%), Positives = 353/492 (71%), Gaps = 1/492 (0%)

Query: 32  KHKNFKPADKLTINDLNENVLKAKYAVRGKIPARAEVLKQQLIDNPSSLPFKKVINANIG 91
           K  +FKPA K+T  DLN +V KA+YAVRG IP RA+ LK++L  NP  LPF  +INANIG
Sbjct: 16  KDLDFKPAAKITKKDLNGSVTKAEYAVRGSIPTRADELKEELKKNPGLLPFDDIINANIG 75

Query: 92  NPQQLNQKPLTFYRQVLSLLQYPMVLDETFSG-NTKTLYKQDAIERAKRILNDIXXXXXX 150
           NPQQL+QKPLTF RQVLS+L+YP +L        +  L+ +DA++RA+ +L DI      
Sbjct: 76  NPQQLDQKPLTFTRQVLSILEYPEILQVDHEKLASLNLFSKDALKRAECLLKDIGGSVGA 135

Query: 151 XXXXXXXXXLRKTVAEYISRRDGGEKAYAEDIFLTAGASSAVSYLLNILCKGKESGVLIP 210
                    +R+TVA++I+ RDGGE A  EDI+LT GASSA + LL++LCK   +G+LIP
Sbjct: 136 YSHSQGVPGIRQTVADFITARDGGEPATPEDIYLTTGASSAATSLLSLLCKDTRTGLLIP 195

Query: 211 IPQYXXXXXXXXXXXXXXXXXXXEENSGWSTNMEEIENVVHNAIREKIIPRVLVVINPGN 270
           IPQY                   +E   WST  +EIE VV +A+ + I P VL+VINPGN
Sbjct: 196 IPQYPLYTASASLFNAQVLPYYLDEECNWSTESDEIEKVVQDALEKGIRPSVLIVINPGN 255

Query: 271 PTGAILSVESIEKIFDVAAHHGIVVIADEVYQENIFPGNEFHSMKKVLRDLQRRVPGKYE 330
           PTGA+L+ E+I +I  +AA +GI VI+DEVYQEN+F   +FHSMKKVLR LQ   PGK++
Sbjct: 256 PTGAVLTEETIARICLIAAKYGIAVISDEVYQENVFNDFKFHSMKKVLRKLQHCYPGKFD 315

Query: 331 NVQLASLHSTSKGVSGECGQRGGYMELTGFSTEIKHEILKLCSISLCPVVTGQALVDLMT 390
           NVQLASLHS SKG  GECGQRGGYME+ GFS +I+  + KL SIS+C VVTGQA+VDLM 
Sbjct: 316 NVQLASLHSISKGFMGECGQRGGYMEIVGFSQDIRDALFKLMSISICSVVTGQAIVDLMV 375

Query: 391 CPPKKGEASYEQDQMERSTIHSELYERATYLWKAFNEMEGVSCQKPQGSMYLFPKIDIPH 450
            PP+ G+ SYEQD+ ERS I +E+  RA  L++ FN +EG+ CQ PQG+MYLFP++ +P 
Sbjct: 376 NPPQPGDESYEQDRQERSKIFNEMRTRANLLYETFNGLEGIECQNPQGAMYLFPRLILPD 435

Query: 451 KALEKAQELDITPDELYCAELLEATGICTVPGSGFGQKPGTFHLRTTFLAPGTSWIDQWR 510
           KA  +++ L + PDE YCA LLE+TGICTVPGSGFGQKPGT+H+RTTFLAPGT WI  W+
Sbjct: 436 KAFRESERLGVEPDEFYCASLLESTGICTVPGSGFGQKPGTYHVRTTFLAPGTQWIQNWK 495

Query: 511 EFHQIFCNKYRD 522
            FHQ F N+YRD
Sbjct: 496 NFHQSFFNEYRD 507

>Kpol_543.39 s543 complement(86358..87836) [1479 bp, 492 aa] {ON}
           complement(86358..87836) [1479 nt, 493 aa]
          Length = 492

 Score =  576 bits (1484), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 279/490 (56%), Positives = 354/490 (72%), Gaps = 4/490 (0%)

Query: 35  NFKPADKLTINDLNENVLKAKYAVRGKIPARAEVLKQQLIDNPSSLPFKKVINANIGNPQ 94
           +F PA+KL++NDLN++ + A YAVRG IP RAE L  Q+I++P SLPF K+I ANIGNPQ
Sbjct: 2   SFVPAEKLSVNDLNQHAVHADYAVRGSIPMRAEQLHAQIINDPGSLPFDKIITANIGNPQ 61

Query: 95  QLNQKPLTFYRQVLSLLQYPMVLD--ETFSGNTKT-LYKQDAIERAKRILNDIXXXXXXX 151
           Q+ QKPLTF RQVLS+L+YP +L+  E      +  +Y++D IERA+++L+ I       
Sbjct: 62  QVGQKPLTFIRQVLSILEYPNILNDPELLEKLVQLGVYQRDVIERARKMLDSIGGSVGAY 121

Query: 152 XXXXXXXXLRKTVAEYISRRDGGEK-AYAEDIFLTAGASSAVSYLLNILCKGKESGVLIP 210
                    R+TVA++I++RDG ++ A   DIFLT GASSAV YLL+ILC G E GVLIP
Sbjct: 122 SASQGVLGFRQTVADFINKRDGCKQLASPNDIFLTGGASSAVHYLLSILCSGPEFGVLIP 181

Query: 211 IPQYXXXXXXXXXXXXXXXXXXXEENSGWSTNMEEIENVVHNAIREKIIPRVLVVINPGN 270
           IPQY                   +E++ WSTN +EIE  +  ++   + P  +V+INPGN
Sbjct: 182 IPQYPLYTATLTLSNSTAIPYYLKEHTSWSTNTKEIEINIKESMANGVKPVAIVIINPGN 241

Query: 271 PTGAILSVESIEKIFDVAAHHGIVVIADEVYQENIFPGNEFHSMKKVLRDLQRRVPGKYE 330
           PTGAILS   +  I  ++A +GI +IADEVYQENIFPG EFHSM+KVL +LQ   PG Y+
Sbjct: 242 PTGAILSESDLADIIRISAKYGIAIIADEVYQENIFPGFEFHSMRKVLLNLQSEFPGTYD 301

Query: 331 NVQLASLHSTSKGVSGECGQRGGYMELTGFSTEIKHEILKLCSISLCPVVTGQALVDLMT 390
           NVQLASLHSTSKG  GECGQRGGYMEL GF  E+   +LKL SIS+C VVTGQAL+DL+T
Sbjct: 302 NVQLASLHSTSKGFIGECGQRGGYMELIGFKDEVIAIVLKLASISICSVVTGQALMDLVT 361

Query: 391 CPPKKGEASYEQDQMERSTIHSELYERATYLWKAFNEMEGVSCQKPQGSMYLFPKIDIPH 450
           CPP+ G+ASY+ DQ ER+ I  +L  RA  L+  F  +EGV CQ+PQG+MYLFPK+ +P 
Sbjct: 362 CPPQPGDASYKLDQEERNKIKQDLMFRADRLYGLFTSLEGVECQRPQGAMYLFPKLILPD 421

Query: 451 KALEKAQELDITPDELYCAELLEATGICTVPGSGFGQKPGTFHLRTTFLAPGTSWIDQWR 510
           KA+EKA +L+I PDE YC ELL+ATGICTVPGSGFGQ PGT+HLRTTFL PGT WI++WR
Sbjct: 422 KAIEKALQLEIPPDEYYCRELLDATGICTVPGSGFGQDPGTYHLRTTFLVPGTEWIERWR 481

Query: 511 EFHQIFCNKY 520
           EFHQ F  ++
Sbjct: 482 EFHQQFYERF 491

>KNAG0M01210 Chr13 (220612..222177) [1566 bp, 521 aa] {ON} Anc_8.263
           YDR111C
          Length = 521

 Score =  575 bits (1482), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 276/488 (56%), Positives = 348/488 (71%), Gaps = 1/488 (0%)

Query: 36  FKPADKLTINDLNENVLKAKYAVRGKIPARAEVLKQQLIDNPSSLPFKKVINANIGNPQQ 95
           F+PA KL  +DLN+N++ A+YAVRG IP +AE L+ QL   P  LPF  +  ANIGNPQQ
Sbjct: 34  FEPARKLGADDLNKNIIDAEYAVRGAIPMKAEELEIQLSQQPDLLPFNAITVANIGNPQQ 93

Query: 96  LNQKPLTFYRQVLSLLQYPMVLDETFSGNTKTLYKQDAIERAKRILNDIXXXXXXXXXXX 155
           L+QKPLTF RQV+S+LQYP +LD      T   YK+DA +RA  +L  I           
Sbjct: 94  LDQKPLTFSRQVVSILQYPPLLDYEEQLVTSGAYKRDAFKRAAVLLEQIGGSVGAYSLAQ 153

Query: 156 XXXXLRKTVAEYISRRDGGEKAYAEDIFLTAGASSAVSYLLNILCKGKESGVLIPIPQYX 215
               +R++VA++I+RRD GE A  +DIFLT GAS A +YLL+ILC+   +G++IPIPQY 
Sbjct: 154 GVYGIRESVADFITRRDEGETASPDDIFLTDGASKAATYLLSILCRDSSTGIMIPIPQYP 213

Query: 216 XXXXXXXXXXXXXXXXXXEENSGWSTNMEEIENVVHNAIREKIIPRVLVVINPGNPTGAI 275
                             +E SGWST  EEIE  V ++I+  + PRV+VVINPGNPTGA+
Sbjct: 214 LYTASITMYNSVMLPYYLDEESGWSTKAEEIEQQVIDSIKRGVTPRVIVVINPGNPTGAV 273

Query: 276 LSVESIEKIFDVAAHHGIVVIADEVYQENIFPGNEFHSMKKVLRDLQRRVP-GKYENVQL 334
           LS ++I +I  +AA +GIVV+ADEVYQ NI+ G +FHSMKKVLR LQR  P G+Y+NVQL
Sbjct: 274 LSFDTIAQILTIAAKYGIVVLADEVYQNNIYKGVKFHSMKKVLRSLQRDHPNGEYDNVQL 333

Query: 335 ASLHSTSKGVSGECGQRGGYMELTGFSTEIKHEILKLCSISLCPVVTGQALVDLMTCPPK 394
           AS+HSTSKGVSGECGQRGGYMEL GFS E++  ILKL SIS+C VVTGQALVDLM  PP+
Sbjct: 334 ASMHSTSKGVSGECGQRGGYMELVGFSNEVRQVILKLASISICSVVTGQALVDLMLNPPR 393

Query: 395 KGEASYEQDQMERSTIHSELYERATYLWKAFNEMEGVSCQKPQGSMYLFPKIDIPHKALE 454
           +G+ SYE D  ER  IH+ +  R   L+  F ++EG+ CQ+PQG+MYLFPK+ +  KA+E
Sbjct: 394 EGDDSYELDVRERKEIHNNMKTRGYLLYDTFQKLEGIECQEPQGAMYLFPKLLLSKKAIE 453

Query: 455 KAQELDITPDELYCAELLEATGICTVPGSGFGQKPGTFHLRTTFLAPGTSWIDQWREFHQ 514
           +A+ L + PDE YC  LL+ TGICTVPGSGFGQK GT+H+RTTFLAPGT WI  W  FH+
Sbjct: 454 EAKSLGLQPDEFYCHRLLDTTGICTVPGSGFGQKEGTYHVRTTFLAPGTQWIKDWETFHK 513

Query: 515 IFCNKYRD 522
            F +KYRD
Sbjct: 514 AFYDKYRD 521

>KAFR0B05520 Chr2 (1130297..1131829) [1533 bp, 510 aa] {ON}
           Anc_8.263 YDR111C
          Length = 510

 Score =  574 bits (1480), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 275/489 (56%), Positives = 361/489 (73%), Gaps = 3/489 (0%)

Query: 35  NFKPADKLTINDLNENVLKAKYAVRGKIPARAEVLKQQLID--NPSSLPFKKVINANIGN 92
           +F+PA K+++ DLN+ ++ A+YAVRG I  RAE L+ +L     P S PF+++I ANIGN
Sbjct: 23  DFEPAPKISVADLNQKIINAEYAVRGSIAMRAEELEFELYHKTQPHSFPFERIIYANIGN 82

Query: 93  PQQLNQKPLTFYRQVLSLLQYPMVLDETFSGNTKTLYKQDAIERAKRILNDIXXXXXXXX 152
           PQQL+QKPLTF RQV+S+L+YP +L       ++ +YK+DA+ERA+ + + I        
Sbjct: 83  PQQLDQKPLTFSRQVMSILEYPGLLKFKDVLLSQGIYKKDALERAELLQSQIGASVGAYS 142

Query: 153 XXXXXXXLRKTVAEYISRRDGGEKAYAEDIFLTAGASSAVSYLLNILCKGKESGVLIPIP 212
                  +R+T A +IS+RD  E A A+DIFLT GAS AV+YL+  LC+ + +G+LIPIP
Sbjct: 143 LAQGVYGIRETTARFISKRDNCEAASADDIFLTDGASKAVTYLMMALCQNEHTGILIPIP 202

Query: 213 QYXXXXXXXXXXXXXXXXXXXEENSGWSTNMEEIENVVHNAIREKIIPRVLVVINPGNPT 272
           QY                   +E SGWST +EEIEN V NAI   I P  +VVINPGNPT
Sbjct: 203 QYPLYTASICIHNAKMLPYYLDEESGWSTKVEEIENSVINAIENGIKPSAMVVINPGNPT 262

Query: 273 GAILSVESIEKIFDVAAHHGIVVIADEVYQENIFPGNEFHSMKKVLRDLQRRVPGKYENV 332
           GA+LSV+ I++I  VAA +GIV+IADEVYQ+NIF G EFHSMKK+LR LQ++ PGKY+NV
Sbjct: 263 GAVLSVDVIQRIITVAAKYGIVLIADEVYQDNIFNG-EFHSMKKILRQLQKKYPGKYDNV 321

Query: 333 QLASLHSTSKGVSGECGQRGGYMELTGFSTEIKHEILKLCSISLCPVVTGQALVDLMTCP 392
           QLASLHSTSKGVSGECGQRGGYME+ GFS E++H +LKL SI++C VVTGQALVDLM  P
Sbjct: 322 QLASLHSTSKGVSGECGQRGGYMEIVGFSDEVRHLLLKLASINICSVVTGQALVDLMVDP 381

Query: 393 PKKGEASYEQDQMERSTIHSELYERATYLWKAFNEMEGVSCQKPQGSMYLFPKIDIPHKA 452
           P  G+ SYE+DQ ER+ IHS L +RA  L+  F+ +EG+ CQKPQG+MYLFP++ +P +A
Sbjct: 382 PHVGDESYEKDQEERNEIHSTLKKRADKLYDTFSNLEGIECQKPQGAMYLFPRLILPDRA 441

Query: 453 LEKAQELDITPDELYCAELLEATGICTVPGSGFGQKPGTFHLRTTFLAPGTSWIDQWREF 512
           +E+A++L +  DE YC +LLE TGICTVPGSGFGQ+ GT+H+RTTFL+PGT WID W++F
Sbjct: 442 IEEAKKLQMEADEFYCHKLLENTGICTVPGSGFGQREGTYHVRTTFLSPGTEWIDDWKKF 501

Query: 513 HQIFCNKYR 521
           H+ F  +Y+
Sbjct: 502 HEKFMKEYQ 510

>AGR085W Chr7 (887023..888588) [1566 bp, 521 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YLR089C (ALT1) and
           YDR111C (ALT2)
          Length = 521

 Score =  574 bits (1479), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 288/522 (55%), Positives = 370/522 (70%), Gaps = 6/522 (1%)

Query: 2   MLRSRSTNCTVNAAIALSGKRLLSLTTISLKHKN-FKPADKLTINDLNENVLKAKYAVRG 60
           MLR  S+   V+    L G+ L +    S+K  + F PA+ +T+ D+NENV+KAKYAVRG
Sbjct: 5   MLRRNSSGTAVSV---LQGRVLRTRRLSSVKDGSRFVPAEPMTLADVNENVVKAKYAVRG 61

Query: 61  KIPARAEVLKQQLIDNPSSLPFKKVINANIGNPQQLNQKPLTFYRQVLSLLQYPMVLDET 120
           KIP RAE L+++L ++P SLPF K+I ANIGNPQQL QKPLTFYRQV+SL+Q P +L E 
Sbjct: 62  KIPTRAEELERRLEEHPGSLPFSKIIQANIGNPQQLGQKPLTFYRQVISLMQNPQLL-EM 120

Query: 121 FSGNTKTLYKQDAIERAKRILNDIXXXXXXXXXXXXXXXLRKTVAEYISRRDGGEKAYAE 180
            +   +  +K D + RA+R+L D                 R+TVA++I RRDG   A  +
Sbjct: 121 PAEWLQQAFKADVVVRARRMLQDAGGSVGAYSASQGVKGYRRTVAQFIERRDG-IPANPD 179

Query: 181 DIFLTAGASSAVSYLLNILCKGKESGVLIPIPQYXXXXXXXXXXXXXXXXXXXEENSGWS 240
           +++LTAGASSAVS LL+  CKG E+GVLIPIPQY                    E  GWS
Sbjct: 180 NVYLTAGASSAVSCLLSTFCKGPETGVLIPIPQYPLYTATITQNNAVALPYYLNEADGWS 239

Query: 241 TNMEEIENVVHNAIREKIIPRVLVVINPGNPTGAILSVESIEKIFDVAAHHGIVVIADEV 300
           TN +E+E V+ ++ +  I P+ LVVINPGNPTG++LSV+ +E I  +AA +GIVVIADEV
Sbjct: 240 TNPDEMERVILDSKKRNIAPKCLVVINPGNPTGSVLSVKDMEAILTLAAKYGIVVIADEV 299

Query: 301 YQENIFPGNEFHSMKKVLRDLQRRVPGKYENVQLASLHSTSKGVSGECGQRGGYMELTGF 360
           YQ+N+F   +FHSM+KVL++LQ R P  Y+NVQLASLHS SKG+SGECGQRGGYMEL GF
Sbjct: 300 YQDNVFGDAKFHSMRKVLKNLQLREPTLYKNVQLASLHSISKGLSGECGQRGGYMELIGF 359

Query: 361 STEIKHEILKLCSISLCPVVTGQALVDLMTCPPKKGEASYEQDQMERSTIHSELYERATY 420
             E++   +KL SISLCPVVTGQALVDLM  PP +G+ SYEQ   E  +I+ EL ER+  
Sbjct: 360 REELRKVFVKLASISLCPVVTGQALVDLMVGPPSQGDPSYEQYTQETRSIYHELEERSQL 419

Query: 421 LWKAFNEMEGVSCQKPQGSMYLFPKIDIPHKALEKAQELDITPDELYCAELLEATGICTV 480
           LWK F  +EG+ C  PQG++YLFPK+ +P KA+E AQ+L I  DELYC+ELL+ TGICTV
Sbjct: 420 LWKTFCSLEGIECNMPQGALYLFPKLHLPQKAIEAAQKLGIPADELYCSELLDETGICTV 479

Query: 481 PGSGFGQKPGTFHLRTTFLAPGTSWIDQWREFHQIFCNKYRD 522
           PG+GFGQ PGT+H+RTTFL PGT WI+ W++FH+ F +KYRD
Sbjct: 480 PGTGFGQIPGTYHVRTTFLPPGTKWIESWKDFHKKFYDKYRD 521

>NDAI0J01360 Chr10 (313791..315296) [1506 bp, 501 aa] {ON} Anc_8.263
          Length = 501

 Score =  571 bits (1472), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 268/500 (53%), Positives = 362/500 (72%), Gaps = 3/500 (0%)

Query: 24  LSLTTISLKHKNFKPADKLTINDLNENVLKAKYAVRGKIPARAEVLKQQLIDNPSSLPFK 83
           ++  TI     +F+PA KL+I DLN NV+KA++AVRG IP +A+ L+ QL  NP SLPF 
Sbjct: 1   MATHTIQTDLHDFEPAPKLSIKDLNPNVIKAEFAVRGTIPMKAQELQTQLNKNPHSLPFN 60

Query: 84  KVINANIGNPQQLNQKPLTFYRQVLSLLQYPMVLDE--TFSGNTKTLYKQDAIERAKRIL 141
           ++  ANIGNPQ+L+QKPLTF RQV+S+LQYP +L+     +  T  +Y  D+ +RA+++L
Sbjct: 61  EITVANIGNPQELHQKPLTFARQVVSILQYPELLNRRNELTSTTPPIYNNDSFDRAEKLL 120

Query: 142 NDIXXXXXXXXXXXXXXXLRKTVAEYISRRDGGEKAYAEDIFLTAGASSAVSYLLNILCK 201
           N+I               +RKT+A YI++RD GE A   DIF+T GA++A SYLL+IL  
Sbjct: 121 NEIGGSVGAYSASQGVYGIRKTIANYITQRDLGESASPNDIFMTTGATAASSYLLSILSN 180

Query: 202 GKESGVLIPIPQYXXXXXXXXXXXXXXXXXXXEENSGWSTNMEEIENVVH-NAIREKIIP 260
           G ++GVL+PIPQY                   EE SGWS +  EIE  +  NA+ + I P
Sbjct: 181 GPQTGVLLPIPQYPLYTALLALHNATMLPYYLEEESGWSIDTNEIEKTIKKNAMTKGIQP 240

Query: 261 RVLVVINPGNPTGAILSVESIEKIFDVAAHHGIVVIADEVYQENIFPGNEFHSMKKVLRD 320
           +V+V+INPGNPTG+ILS +S+ KIF++AA +GIV+IADEVYQEN+F GN+FHS KKVLR 
Sbjct: 241 KVMVIINPGNPTGSILSEDSLIKIFNIAAKYGIVIIADEVYQENLFNGNKFHSCKKVLRS 300

Query: 321 LQRRVPGKYENVQLASLHSTSKGVSGECGQRGGYMELTGFSTEIKHEILKLCSISLCPVV 380
           LQ++ P +Y NVQLASLHSTSKG+ GECGQRGGYME+ GF+ ++++ ILKL  I +CPVV
Sbjct: 301 LQKQFPTQYNNVQLASLHSTSKGLFGECGQRGGYMEIIGFNNDVRNLILKLACIDVCPVV 360

Query: 381 TGQALVDLMTCPPKKGEASYEQDQMERSTIHSELYERATYLWKAFNEMEGVSCQKPQGSM 440
           TGQA++DLM  PPK+G+ SY+ D +ER  IH+++  RA  L+  F+ MEG+ CQKPQG+M
Sbjct: 361 TGQAMMDLMILPPKQGDQSYQLDCIERQQIHNDMLNRAKKLYDMFSHMEGIQCQKPQGAM 420

Query: 441 YLFPKIDIPHKALEKAQELDITPDELYCAELLEATGICTVPGSGFGQKPGTFHLRTTFLA 500
           YLFP++ +  K +++A++ ++ PDE YC ELL  TGICTVPGSGFGQKP T+HLRTTFLA
Sbjct: 421 YLFPRLLLSTKVIDEAKKFEMEPDEFYCHELLNETGICTVPGSGFGQKPNTYHLRTTFLA 480

Query: 501 PGTSWIDQWREFHQIFCNKY 520
           PG  WI++W +FH+ F  +Y
Sbjct: 481 PGDQWINKWEKFHKAFLKRY 500

>TPHA0A01800 Chr1 (364262..365758) [1497 bp, 498 aa] {ON} Anc_8.263
           YDR111C
          Length = 498

 Score =  567 bits (1461), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 267/490 (54%), Positives = 345/490 (70%), Gaps = 3/490 (0%)

Query: 35  NFKPADKLTINDLNENVLKAKYAVRGKIPARAEVLKQQLIDNPSSLPFKKVINANIGNPQ 94
           +F P  K+T+ DLN  ++K +YAVRG IPARAE LK QL  +P SLPF K+INANIGNPQ
Sbjct: 8   DFTPVAKVTLKDLNSKIIKTQYAVRGPIPARAEELKLQLEKDPKSLPFNKIINANIGNPQ 67

Query: 95  QLNQKPLTFYRQVLSLLQYPMVLDETFSGNTKT---LYKQDAIERAKRILNDIXXXXXXX 151
           QL QKPL+F R+VLS+LQYP +L++     T     +Y++D + RA+++L +I       
Sbjct: 68  QLGQKPLSFIRKVLSILQYPDILEDESKLQTLIELRVYQKDVVRRARKLLGEIGGSVGAY 127

Query: 152 XXXXXXXXLRKTVAEYISRRDGGEKAYAEDIFLTAGASSAVSYLLNILCKGKESGVLIPI 211
                   +++TVA+YI++RD GE AY EDIFLT GASSAVS++L + C G  +GVLIPI
Sbjct: 128 SLSQGVPGIQQTVADYITKRDSGEVAYPEDIFLTTGASSAVSFILPMFCNGPTTGVLIPI 187

Query: 212 PQYXXXXXXXXXXXXXXXXXXXEENSGWSTNMEEIENVVHNAIREKIIPRVLVVINPGNP 271
           PQY                    E   WS N  E+EN +  +I+  I P  +V+INPGNP
Sbjct: 188 PQYPLYTATITLVGATAISYYLNEEDNWSVNTVEMENTIQESIKSGIKPTTIVIINPGNP 247

Query: 272 TGAILSVESIEKIFDVAAHHGIVVIADEVYQENIFPGNEFHSMKKVLRDLQRRVPGKYEN 331
           TG+IL+ + I  I  ++A +G+++IADEVYQEN+F GNEFHS+KKVLR LQR+  G YE 
Sbjct: 248 TGSILTEKDIANIIRISAKYGLLIIADEVYQENVFSGNEFHSVKKVLRKLQRKYLGFYET 307

Query: 332 VQLASLHSTSKGVSGECGQRGGYMELTGFSTEIKHEILKLCSISLCPVVTGQALVDLMTC 391
           VQLASLHSTSKG+ GECGQRGGYMEL G + +++ E++KL SIS+C VVTGQAL+D++  
Sbjct: 308 VQLASLHSTSKGLIGECGQRGGYMELIGLTDDVRLEVVKLMSISICSVVTGQALIDMVVS 367

Query: 392 PPKKGEASYEQDQMERSTIHSELYERATYLWKAFNEMEGVSCQKPQGSMYLFPKIDIPHK 451
           PP+ G+ SYE DQ+ER+ I ++L  R+  L + F  +EGV C +PQG+MYLFPK   P K
Sbjct: 368 PPRPGDESYEMDQLERNNIKNDLISRSQKLHQLFISLEGVECLRPQGAMYLFPKFIFPQK 427

Query: 452 ALEKAQELDITPDELYCAELLEATGICTVPGSGFGQKPGTFHLRTTFLAPGTSWIDQWRE 511
            ++ AQ+L    D LYC ELLE TGICTVPGSGFGQKP T+HLRTTFL PG SWID WR+
Sbjct: 428 FIDIAQKLHTEADTLYCKELLEHTGICTVPGSGFGQKPNTYHLRTTFLVPGDSWIDLWRK 487

Query: 512 FHQIFCNKYR 521
           FH  FC +YR
Sbjct: 488 FHTEFCERYR 497

>TBLA0F03060 Chr6 (743646..745148) [1503 bp, 500 aa] {ON} Anc_8.263
           YDR111C
          Length = 500

 Score =  538 bits (1386), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 263/500 (52%), Positives = 347/500 (69%), Gaps = 7/500 (1%)

Query: 29  ISLKHKNFKPADKLTINDLNENVLKAKYAVRGKIPARAEVLKQQLIDNPSSLPFKKVINA 88
           +++  K F PA K ++ND+NE++LKA+YA+RG IP RAE L  QL++N  SLPF K++ A
Sbjct: 1   MTMNQKTFLPAPKFSLNDINESILKAEYAIRGTIPNRAEELDIQLLENSKSLPFAKIVYA 60

Query: 89  NIGNPQQLNQKPLTFYRQVLSLLQYPMVLDETFSGNTKTLYKQDAIERAKRILNDIXXXX 148
           NIGNPQQL+Q+PLTF RQV+SL+Q+P +L        + +Y +D+IERA ++LN I    
Sbjct: 61  NIGNPQQLDQQPLTFQRQVMSLVQFPDLLKSKDILLAQKIYSKDSIERATKLLNSIGGSV 120

Query: 149 XXXXXXXXXXXLRKTVAEYISRRDGGEKAY-------AEDIFLTAGASSAVSYLLNILCK 201
                      +RK VA +I +RD             A ++FLTAGAS+AV ++L +  K
Sbjct: 121 GAYSSSQGVLDIRKNVARFILKRDLHHDPTQDLIDETASNVFLTAGASTAVDHILPLFAK 180

Query: 202 GKESGVLIPIPQYXXXXXXXXXXXXXXXXXXXEENSGWSTNMEEIENVVHNAIREKIIPR 261
            +  GVL+PIPQY                    E++ WST+ ++IE +V +AI++ I P 
Sbjct: 181 DESCGVLLPIPQYPLYTAAVTLQKSKLLPYYLNESNNWSTDPKQIEQIVIDAIKQNIKPT 240

Query: 262 VLVVINPGNPTGAILSVESIEKIFDVAAHHGIVVIADEVYQENIFPGNEFHSMKKVLRDL 321
            LVVINPGNPTGAIL+ +SI  I D+AA +GIV+IADEVYQEN++   EFHS KKVL +L
Sbjct: 241 TLVVINPGNPTGAILTKDSIIDIIDIAAEYGIVIIADEVYQENVYEAFEFHSFKKVLSEL 300

Query: 322 QRRVPGKYENVQLASLHSTSKGVSGECGQRGGYMELTGFSTEIKHEILKLCSISLCPVVT 381
           ++  P KY+NVQLASLHS SKGV+GECGQRGGYME+TGFS ++K  +LK+ SIS+C VVT
Sbjct: 301 RKNYPSKYDNVQLASLHSISKGVNGECGQRGGYMEITGFSNDVKKVLLKVASISICSVVT 360

Query: 382 GQALVDLMTCPPKKGEASYEQDQMERSTIHSELYERATYLWKAFNEMEGVSCQKPQGSMY 441
           GQ LVDLM  PP+ G+ SYE DQ+ERS IHS L  ++  L+  F  + G+SCQKPQG+MY
Sbjct: 361 GQILVDLMVNPPQPGDESYELDQLERSVIHSNLILKSNTLYDVFTRLPGISCQKPQGAMY 420

Query: 442 LFPKIDIPHKALEKAQELDITPDELYCAELLEATGICTVPGSGFGQKPGTFHLRTTFLAP 501
           LFP++ +   A+  A EL++ PDE YC +LLE TGICTVPGSGFGQ PGT+HLRTTFL P
Sbjct: 421 LFPRLHLSENAINAATELNLKPDEFYCLKLLENTGICTVPGSGFGQYPGTYHLRTTFLPP 480

Query: 502 GTSWIDQWREFHQIFCNKYR 521
           G  WI+ W +FH  F  KY+
Sbjct: 481 GIEWINSWEKFHLEFMEKYK 500

>TBLA0G01630 Chr7 (428016..429518) [1503 bp, 500 aa] {ON} 
          Length = 500

 Score =  516 bits (1329), Expect = e-180,   Method: Compositional matrix adjust.
 Identities = 256/500 (51%), Positives = 337/500 (67%), Gaps = 9/500 (1%)

Query: 31  LKHKNFKPADKLTINDLNENVLKAKYAVRGKIPARAEVLKQQLIDNPSSLPFKKVINANI 90
           +  K+  PA K ++ND+++++L  +YA+RG IP RA+ L++QL  +P+ LPFKK+I ANI
Sbjct: 1   MSAKDCTPAPKFSLNDISQSILDTEYAIRGTIPTRADELQEQLNISPNQLPFKKIIYANI 60

Query: 91  GNPQQLNQKPLTFYRQVLSLLQYPMVLDETFSGNTKTLYKQDAIERAKRILNDIXXXXXX 150
           GNPQQL Q+PLTF RQVLSL++YP +++         +Y  DAI+RA+ ILN I      
Sbjct: 61  GNPQQLEQEPLTFQRQVLSLVEYPNLVNSKNILVENKIYAPDAIKRAETILNSIGGSVGA 120

Query: 151 XXXXXXXXXLRKTVAEYISRRDGGE---------KAYAEDIFLTAGASSAVSYLLNILCK 201
                    +RK VA+ I +RD  E            A +IFLT GA++AVSY+L +  K
Sbjct: 121 YSSSQGILSIRKNVAKCILQRDNDELCCNDEELINETASNIFLTDGATTAVSYILPLFAK 180

Query: 202 GKESGVLIPIPQYXXXXXXXXXXXXXXXXXXXEENSGWSTNMEEIENVVHNAIREKIIPR 261
            +  GVL+PIPQY                    E+  WST+ EEIE ++ +AI   I P 
Sbjct: 181 DENCGVLLPIPQYPLYTAAVTLQNSKLLPYYLNEDENWSTDPEEIETIIKDAISRNIKPT 240

Query: 262 VLVVINPGNPTGAILSVESIEKIFDVAAHHGIVVIADEVYQENIFPGNEFHSMKKVLRDL 321
            LV+INPGNPTGAILSVESI +I ++AA +GIV+IADEVYQ NI+   +FHS KK+L  L
Sbjct: 241 TLVIINPGNPTGAILSVESITQIINIAAKYGIVIIADEVYQNNIYQDFKFHSFKKILNSL 300

Query: 322 QRRVPGKYENVQLASLHSTSKGVSGECGQRGGYMELTGFSTEIKHEILKLCSISLCPVVT 381
           + + P KY+NVQLASLHS SKGV+GECGQRGGY EL GFS EIK  ILKL SI +C VVT
Sbjct: 301 KLQYPKKYDNVQLASLHSISKGVNGECGQRGGYFELLGFSDEIKKIILKLASIDICSVVT 360

Query: 382 GQALVDLMTCPPKKGEASYEQDQMERSTIHSELYERATYLWKAFNEMEGVSCQKPQGSMY 441
           GQ LVDLM+ PP+KG+ SY+ DQ ER+ I S L  ++  L+  F+ + G+SCQKPQG+MY
Sbjct: 361 GQILVDLMSKPPEKGDYSYKLDQRERNNIQSNLILKSNTLYDLFSRLPGISCQKPQGAMY 420

Query: 442 LFPKIDIPHKALEKAQELDITPDELYCAELLEATGICTVPGSGFGQKPGTFHLRTTFLAP 501
           LFP++ +    + +A+  ++ PDE YC +LLE TGICTVPGSGFGQK GT+H+RTTFL  
Sbjct: 421 LFPRLHLTSNMINEAKLNNLEPDEFYCLKLLENTGICTVPGSGFGQKEGTYHVRTTFLPS 480

Query: 502 GTSWIDQWREFHQIFCNKYR 521
           G  WI  W +FH  F N+Y+
Sbjct: 481 GIEWIKLWEKFHLEFMNQYK 500

>TPHA0O01450 Chr15 complement(291591..292922) [1332 bp, 443 aa] {ON}
           Anc_1.321 YJL060W
          Length = 443

 Score = 53.1 bits (126), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 51/255 (20%), Positives = 111/255 (43%), Gaps = 40/255 (15%)

Query: 239 WSTNMEEIENVVHNAIREKIIPRVLVVINPGNPTGAILSVESIEKIFDVAAHHGIVVIAD 298
           W+ + E+ ENV+ N  +       +++  P NP G + + E +++I D+   H +++I+D
Sbjct: 183 WTLDFEQFENVITNKTK------AIIINTPHNPIGKVFTREELKRIGDICVKHNVIIISD 236

Query: 299 EVYQENIFPGNEFHSMKKVLRDLQRRVPGKYENVQLASLHSTSKGVSGECGQRGGYM--- 355
           EVY +N++  +EF  +  +  ++           QL     ++       G R G++   
Sbjct: 237 EVY-DNLYFVDEFTRIATLSPEIG----------QLTLSVGSAGKTFAATGWRIGWVVSL 285

Query: 356 --ELTGFSTEIKHEILKLCSISLCPVVTGQALVDLMTCPPKKGEASYEQDQMERSTIHSE 413
             EL  F+++    I   C  S  P+   +A  + +    + G   Y ++      + +E
Sbjct: 286 NPELLNFASKAHTRI---CFASPSPI--QEACAESINIALRNG---YFEN------MRNE 331

Query: 414 LYERATYLWKAFNEMEGVSCQKPQGSMYL---FPKIDIPHKALEKAQELDITPDELYCAE 470
             ++       F+E+ G+   + +G+ +L   F ++ IP       + ++   D      
Sbjct: 332 YVKKYKIFTSVFDEL-GLPYTEAEGTYFLLVDFSRVKIPEDYKFPEEIINKGKDFRISNW 390

Query: 471 LLEATGICTVPGSGF 485
           L+   G+  +P + F
Sbjct: 391 LINELGVVAIPPTEF 405

>Kwal_34.16018 s34 (159210..160349) [1140 bp, 379 aa] {ON} YJL060W
           (BNA3) - YJL060W [contig 272] FULL
          Length = 379

 Score = 51.2 bits (121), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 42/157 (26%), Positives = 69/157 (43%), Gaps = 15/157 (9%)

Query: 160 LRKTVAEYISRRDGGEKAYAEDIFLTAGASSAVSYLLNILCKGKESGVLIPIPQYXXXXX 219
           LRK +AE  S  D       E++ LT GA +A ++L +    GK    +   P Y     
Sbjct: 64  LRKLIAEMYSNED--VTLSEENVILTNGAIAA-NFLTHYTLAGKGDHFICISPTYQQLSS 120

Query: 220 XXXXXXXXXXXXXXEENSGWSTNMEEIENVVHNAIREKIIPRVLVVINPGNPTGAILSVE 279
                          + + +  N+ E+E ++      K   + +V+  P NP  +++  E
Sbjct: 121 IPQMFGAEVELLHLRKETNYQPNIVELERMI------KPNTKCIVLNTPNNPLSSVIPTE 174

Query: 280 SIEKIFDVAAHHGIVVIADEVYQENIFPGNEFHSMKK 316
           ++ +I ++A  HGIVV  DEVY         FHS +K
Sbjct: 175 TLREIAELADKHGIVVFCDEVYSP------LFHSCEK 205

>KLTH0G19646g Chr7 complement(1699421..1700560) [1140 bp, 379 aa]
           {ON} conserved hypothetical protein
          Length = 379

 Score = 48.1 bits (113), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 29/123 (23%), Positives = 59/123 (47%), Gaps = 7/123 (5%)

Query: 179 AEDIFLTAGASSAVSYLLNILCKGKESGVLIPIPQYXXXXXXXXXXXXXXXXXXXEENSG 238
           A+++ +T GA  A ++L++    G    ++   P Y                   E   G
Sbjct: 81  ADNVLITNGAIGA-NFLVHYTAAGPGDHIICVDPTYQQLSSVPSMFGADVELLHLEAEDG 139

Query: 239 WSTNMEEIENVVHNAIREKIIPRVLVVINPGNPTGAILSVESIEKIFDVAAHHGIVVIAD 298
           ++ N++++++ V      +   + +V+ NP NP G+++S E + +I D A  + I ++ D
Sbjct: 140 YTPNIQKLKSKV------RANTKYIVLNNPNNPLGSVISTEKMTEIIDYAERNEIFIVCD 193

Query: 299 EVY 301
           EVY
Sbjct: 194 EVY 196

>NCAS0A09200 Chr1 complement(1819134..1820471) [1338 bp, 445 aa]
           {ON} Anc_1.321 YJL060W
          Length = 445

 Score = 47.8 bits (112), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 50/258 (19%), Positives = 110/258 (42%), Gaps = 38/258 (14%)

Query: 235 ENSGWSTNMEEIENVVHNAIREKIIPRVLVVIN-PGNPTGAILSVESIEKIFDVAAHHGI 293
           E + W+ +ME+ +N + +  +        V+IN P NP G + + E + +I ++     +
Sbjct: 181 EGTEWTVDMEQFKNAITSKTKA-------VIINTPHNPIGKVFTREELLQIGNICVEKNV 233

Query: 294 VVIADEVYQENIFPGNEFHSMKKVLRDLQRRVPGKYENVQLASLHSTSKGVSGECGQRGG 353
           ++I+DEVY E+++  +EF  +  +  ++ +               + + G +G+     G
Sbjct: 234 IIISDEVY-EHLYFTDEFTRIATLSPEIGQL--------------TLTVGSAGKTFAATG 278

Query: 354 YMELTGFSTEIKHEILKLCSISLCPVVTGQALVDLMTCPPKKGEASYEQDQMERS---TI 410
           +    G+   +  E+L+  S +   +            P ++  A+   D +E +    +
Sbjct: 279 WR--IGWVISLNSELLQYVSKAHTRICFASP------SPLQEACANSINDALESNYFEKM 330

Query: 411 HSELYERATYLWKAFNEMEGVSCQKPQGSMYL---FPKIDIPHKALEKAQELDITPDELY 467
             E  ++       F E+ G+   KP+G+ ++   F K+ IP       + L+   D   
Sbjct: 331 RQEYIQKFKIFTSVFEEL-GLPYTKPEGTYFVLADFSKVKIPEDYPYPKEILNKGKDFRI 389

Query: 468 CAELLEATGICTVPGSGF 485
              L+   G+  +P + F
Sbjct: 390 SHWLINELGVVAIPPTEF 407

>Ecym_6292 Chr6 (547563..548855) [1293 bp, 430 aa] {ON} similar to
           Ashbya gossypii AEL170C
          Length = 430

 Score = 47.8 bits (112), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 49/199 (24%), Positives = 86/199 (43%), Gaps = 35/199 (17%)

Query: 261 RVLVVINPGNPTGAILSVESIEKIFDVAAHHGIVVIADEVYQENIFPGNEFHSMKKVLRD 320
           +++++ NP NP G + + + + ++  +  ++G  +IADEVY+   F  N           
Sbjct: 183 KLMIINNPNNPLGKVFNRDELLEMATLCVNNGAYIIADEVYEFLQFTPNPLS-------- 234

Query: 321 LQRRVPGKYENVQLASLHSTSKG-VSGECGQRGGYM-----ELTGFSTEIKHEILKLCSI 374
              R+    E +   ++   S G +    G R G+M     EL    T + H  +  CS 
Sbjct: 235 ---RISNLSEAIAQKTITIGSAGKIFRVTGWRVGWMISKNRELVEKVTAV-HVRMGFCSP 290

Query: 375 SLCPVVTGQALVDLMTCPPKKGEASYEQDQMERSTIHSELYERATYLWKAFNEMEGVSCQ 434
           S+  V +G  +   + C    G      ++ +R    S +Y+   YL        GVS  
Sbjct: 291 SISQVASGLGIQRALEC----GYFLSMPNEFDRK--FSIIYKALDYL--------GVSYT 336

Query: 435 KPQGSMYL---FPKIDIPH 450
           KPQG+ ++   F K+ IP 
Sbjct: 337 KPQGAHFIITDFSKVKIPE 355

>SAKL0D06886g Chr4 complement(571478..572821) [1344 bp, 447 aa] {ON}
           highly similar to uniprot|P47039 Saccharomyces
           cerevisiae YJL060W BNA3 Arylformamidase involved in
           biosynthesis of nicotinic acid from tryptophan via
           kynurenine pathway potential Cdc28p substrate
          Length = 447

 Score = 46.6 bits (109), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 51/242 (21%), Positives = 105/242 (43%), Gaps = 26/242 (10%)

Query: 249 VVHNAIREKIIPRV--LVVINPGNPTGAILSVESIEKIFDVAAHHGIVVIADEVYQENIF 306
           V ++ +R  I P+   L++  P NP G + + E + +I ++   + +V+I+DEVY E+++
Sbjct: 189 VDYDELRAAITPKTKALILNTPHNPIGKVFTREELLEIGNICVENNVVIISDEVY-EHLY 247

Query: 307 PGNEFHSMKKVLRDLQRRVPGKYENVQLASLHSTSKGVSGECGQRGGYMELTGFSTEIKH 366
             +EF  +  +  ++         N+ L      S G +G+     G+    G+      
Sbjct: 248 FTSEFTRIATLSPEIG--------NLTL------SVGSAGKTFAATGWR--IGWIVSQNA 291

Query: 367 EILKLCSISLCPVVTGQALVDLMTCPPKKGEASYEQDQMERSTIHSELYERATYLWKAFN 426
           E+LK  S++   +           C  K  E + + +  E+  +  E   +     + F+
Sbjct: 292 ELLKYASMAHTRICFASPSPFQEAC-AKSIEIALQNNYFEK--MRQEYINKFDIFTRVFD 348

Query: 427 EMEGVSCQKPQGSMYL---FPKIDIPHKALEKAQELDITPDELYCAELLEATGICTVPGS 483
           E+ G+   +P+G+ ++   F K+ IP       + L    D      L+   G+  +P +
Sbjct: 349 EL-GLPYTQPEGTYFVLVDFSKVKIPEDYPFPEELLSKAKDFRISYWLINELGVVAIPPT 407

Query: 484 GF 485
            F
Sbjct: 408 EF 409

>TPHA0D03370 Chr4 complement(704980..706473) [1494 bp, 497 aa] {ON}
           Anc_3.511 YGL202W
          Length = 497

 Score = 46.6 bits (109), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 32/96 (33%), Positives = 48/96 (50%), Gaps = 11/96 (11%)

Query: 244 EEIENVVHNAIREKIIPRVLVVINPG-NPTGAILSVESIEKIFDVAAHHGIVVIADEVYQ 302
           E++E+++ N       P++L  I  G NPTG+ LS E  E I+ +A  H  ++I DE Y 
Sbjct: 191 EKLESILDNWTPGSPKPKLLYTIPTGQNPTGSSLSDERKEAIYKIACKHDFIIIEDEPYY 250

Query: 303 ENIFPGNEFHSMKKVLRDLQRRVPGKYENVQLASLH 338
                   F      L+DL++R   KYE+ Q    H
Sbjct: 251 --------FLQTGPYLKDLEQR--KKYEDQQEQQNH 276

>Skud_10.156 Chr10 complement(294149..295531) [1383 bp, 460 aa] {ON}
           YJL060W (REAL)
          Length = 460

 Score = 46.2 bits (108), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 70/326 (21%), Positives = 128/326 (39%), Gaps = 53/326 (16%)

Query: 179 AEDIFLTAGASSAV-SYLLNILCKGKESGVLIP-----IPQYXXXXXXXXXXXXXXXXXX 232
           AE++ +T GA+  + S L+ +L  G E  V  P     IP                    
Sbjct: 131 AENVTVTTGANEGILSCLMGLLNSGDEVIVFEPFFDQYIPNIELCGGKVVYVPINPPKEL 190

Query: 233 XEENSG---WSTNMEEIENVVHNAIREKIIPRVLVVIN-PGNPTGAILSVESIEKIFDVA 288
            + N+    W+ + E+ EN + +  +        V+IN P NP G + + E +  + ++ 
Sbjct: 191 DQRNTKGEEWTIDFEQFENAITSKTKA-------VIINTPHNPIGKVFTREELTTLGNIC 243

Query: 289 AHHGIVVIADEVYQENIFPGNEFHSMKKVLRDLQRRVPGKYENVQLASLHSTSKGVS-GE 347
             H +V+I+DEVY E++F  + F            R+      +   +L   S G S   
Sbjct: 244 VKHNVVIISDEVY-EHLFFTDSF-----------TRIATLSPEIGQLTLTVGSAGKSFAA 291

Query: 348 CGQRGGYM-----ELTGFSTEIKHEILKLCSISLCPVVTGQALVDLMTCPPKKGEASYEQ 402
            G R G++     EL  ++ +      ++C  S  P+           C     +A  + 
Sbjct: 292 TGWRIGWVLSLNAELLSYAAKAH---TRICFASPSPLQEA--------CANSINDA-LKI 339

Query: 403 DQMERSTIHSELYERATYLWKAFNEMEGVSCQKPQGSMYL---FPKIDIPHKALEKAQEL 459
           D  E+  +  E   +       F+++ G+    P+G+ ++   F K+ IP       + L
Sbjct: 340 DYFEK--MRQEYITKFKIFTSIFDKL-GLPYTAPEGTYFVLVDFSKVKIPEDYPYPKEIL 396

Query: 460 DITPDELYCAELLEATGICTVPGSGF 485
           D   D      L+   G+  +P + F
Sbjct: 397 DKGKDFRISHWLINELGVVAIPPTEF 422

>Suva_6.136 Chr6 complement(227366..228700) [1335 bp, 444 aa] {ON}
           YJL060W (REAL)
          Length = 444

 Score = 45.4 bits (106), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 72/326 (22%), Positives = 126/326 (38%), Gaps = 53/326 (16%)

Query: 179 AEDIFLTAGASSAV-SYLLNILCKGKESGVLIP-----IPQYXXXXXXXXXXXXXXXXXX 232
           AE++ +T GA+  + S L+ +L  G E  V  P     IP                    
Sbjct: 115 AENVVVTTGANEGILSCLMGLLNSGDEVIVFEPFFDQYIPNIELCGGKVVYVPINPPKEL 174

Query: 233 XEENSG---WSTNMEEIENVVHNAIREKIIPRVLVVIN-PGNPTGAILSVESIEKIFDVA 288
            + N+    W+ + E+ E  + +  +        V+IN P NP G + + + +  + ++ 
Sbjct: 175 DQRNTRGEEWTIDFEQFEKAITSKTKA-------VIINTPNNPIGKVFTHDELTTLGNIC 227

Query: 289 AHHGIVVIADEVYQENIFPGNEFHSMKKVLRDLQRRVPGKYENVQLASLHSTSKGVS-GE 347
             H +V+I+DEVY+   F             D   RV      +   +L   S G S   
Sbjct: 228 VKHNVVIISDEVYEHLYF------------TDSFTRVATLSPEIGQLTLTVGSAGKSFAA 275

Query: 348 CGQRGGYM-----ELTGFSTEIKHEILKLCSISLCPVVTGQALVDLMTCPPKKGEASYEQ 402
            G R G++     EL  ++ +    I   C  S  P+   +A  + +    K G   +E 
Sbjct: 276 TGWRIGWVLSLNAELLSYAAKAHTRI---CFASPSPL--QEACANSINDALKIG--YFEN 328

Query: 403 DQMERSTIHSELYERATYLWKAFNEMEGVSCQKPQGSMYL---FPKIDIPHKALEKAQEL 459
            + E  T       +   L   F+E+ G+    P+GS ++   F K+ IP       + +
Sbjct: 329 MRQEYIT-------KFKILTSVFDEL-GLPYTAPEGSYFVLVNFSKVKIPEDYPYPQEIM 380

Query: 460 DITPDELYCAELLEATGICTVPGSGF 485
           D   D      L+   G+  +P + F
Sbjct: 381 DKGKDFRISHWLINELGVVAIPPTEF 406

>CAGL0J05126g Chr10 complement(487452..488753) [1302 bp, 433 aa]
           {ON} highly similar to uniprot|P47039 Saccharomyces
           cerevisiae YJL060w
          Length = 433

 Score = 44.3 bits (103), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 68/324 (20%), Positives = 131/324 (40%), Gaps = 51/324 (15%)

Query: 180 EDIFLTAGASSAV-SYLLNILCKGKESGVLIP-----IPQYXXXXXXXXXXXXXXXXXXX 233
           +++ +T GA+  + S L+ IL  G E  V  P     IP                     
Sbjct: 105 QNVLVTTGANEGILSCLMGILNAGDEVIVFEPFFDQYIPNIELCGGVVRYVPIHPPKEMK 164

Query: 234 EENSG---WSTNMEEIENVVHNAIREKIIPRVLVVIN-PGNPTGAILSVESIEKIFDVAA 289
             N+    W  + + +E   +N  +        V+IN P NP G + + + + K+  +  
Sbjct: 165 TRNTTGDEWQIDWDALEKTFNNKTKA-------VIINTPHNPIGKVFTEQELTKLAQLCV 217

Query: 290 HHGIVVIADEVYQENIFPGNEFHSMKKVLRDLQRRVPGKYENVQLASLHSTSKGVSGECG 349
            H  VVI+DEVY E+++    F  +  +  D+         N+ L ++ S  K  +   G
Sbjct: 218 EHNTVVISDEVY-EHLYFTESFPRIANINEDIA--------NLTL-TVGSAGKSFAA-TG 266

Query: 350 QRGGYM-----ELTGFSTEIKHEILKLCSISLCPVVTGQALVDLMTCPPKKGEASYEQDQ 404
            R G++     +L  + ++      ++C  S  P+    A            E + + D 
Sbjct: 267 WRIGWIISKNDQLLNYVSKAH---TRICFASPSPLQEACA---------GSIEHALKIDY 314

Query: 405 MERSTIHSELYERATYLWKAFNEMEGVSCQKPQGSMYL---FPKIDIPHKALEKAQELDI 461
             +  +  E  ++   L  AF+++ G++  +P+G+ ++   F K+ IP   +   + L+ 
Sbjct: 315 FPK--MREEYRKKFEILTTAFDKL-GLNYTQPEGTYFILVDFSKVKIPEDYVYPEELLEK 371

Query: 462 TPDELYCAELLEATGICTVPGSGF 485
             D      L+   GI  +P + F
Sbjct: 372 AKDFRISYWLINEIGIVAIPPTEF 395

>NDAI0G05760 Chr7 (1427844..1429190) [1347 bp, 448 aa] {ON}
           Anc_1.321
          Length = 448

 Score = 43.9 bits (102), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 70/327 (21%), Positives = 127/327 (38%), Gaps = 45/327 (13%)

Query: 174 GEKAYAEDIFLTAGASSAV-SYLLNILCKGKESGVLIPI-PQYXXXXXXXXXXXX----- 226
           G++   E+I +T GA+  + S L+ +L  G E  V  P   QY                 
Sbjct: 114 GKELKQENITITTGANEGILSCLMGLLNAGDEVIVFEPFFDQYISNIELMGGKVVYVPIN 173

Query: 227 --XXXXXXXEENSGWSTNMEEIENVVHNAIREKIIPRVLVVINPGNPTGAILSVESIEKI 284
                     E + W+ + E+      NAI  K   + ++V +P NP G + + E + K+
Sbjct: 174 PPKDLDQRITEGTEWTIDFEQF----RNAITPKT--KAVIVNSPHNPIGKVFTKEELTKL 227

Query: 285 FDVAAHHGIVVIADEVYQENIFPGNEFHSMKKVLRDLQRRVPGKYENVQLASLHSTSKGV 344
            ++   + +++I+DEVY        EF         +    P      ++  L  T  G 
Sbjct: 228 GEICVENNVIIISDEVY--------EFLYFNDSFTRIATLSP------EIGQLTLTV-GS 272

Query: 345 SGECGQRGGYMELTGFSTEIKHEILKLCSISLCPVVTGQALVDLMTCPPKKGEASYEQDQ 404
           +G+     G+    G+      E+L+  S +   +            P ++  A+   D 
Sbjct: 273 AGKTFAATGWR--IGWVISQNPELLQYVSKAHTRICFASP------SPLQEACANSINDA 324

Query: 405 MERSTIHSELYERATYLWKAFN---EMEGVSCQKPQGSMYL---FPKIDIPHKALEKAQE 458
           +E S    ++ +     +K FN   E  G+   KP+G+ ++   F K+ IP       + 
Sbjct: 325 LE-SGYFEKMRKEYVQKFKIFNAVFEELGLPYTKPEGTYFVLADFSKVKIPEDYPWPEEI 383

Query: 459 LDITPDELYCAELLEATGICTVPGSGF 485
           LD   D      L+   G+  +P + F
Sbjct: 384 LDKGKDFRISHWLINELGVVAIPPTEF 410

>Kwal_14.2574 s14 complement(818144..819475) [1332 bp, 443 aa] {ON}
           YJL060W (BNA3) - 1:1 [contig 224] FULL
          Length = 443

 Score = 43.9 bits (102), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 22/68 (32%), Positives = 38/68 (55%), Gaps = 6/68 (8%)

Query: 239 WSTNMEEIENVVHNAIREKIIPRVLVVINPGNPTGAILSVESIEKIFDVAAHHGIVVIAD 298
           W+ N +E+E     AI  K   + L++  P NP G + + E + +I ++   H +V+I+D
Sbjct: 183 WTVNYDELEA----AITPKT--KALILNTPHNPVGKVFTREELLRIGEICVKHNVVIISD 236

Query: 299 EVYQENIF 306
           EVY+   F
Sbjct: 237 EVYEHLYF 244

>TPHA0O01520 Chr15 (304547..306058) [1512 bp, 503 aa] {ON} Anc_2.102
           YHR137W
          Length = 503

 Score = 43.9 bits (102), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 21/63 (33%), Positives = 37/63 (58%), Gaps = 1/63 (1%)

Query: 246 IENVVHNAIREKIIPRVLVVINPG-NPTGAILSVESIEKIFDVAAHHGIVVIADEVYQEN 304
           ++N   +  ++K  P++L  I  G NPTG  LS+E   KI+++   H I+++ D+ Y   
Sbjct: 195 LDNWETSQFKDKPKPKMLYTIATGQNPTGMTLSMEKRRKIYEICQKHDIIILEDDPYGYL 254

Query: 305 IFP 307
           +FP
Sbjct: 255 LFP 257

>Ecym_6319 Chr6 complement(607599..608663) [1065 bp, 354 aa] {ON}
           similar to Ashbya gossypii AEL170C
          Length = 354

 Score = 43.5 bits (101), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 48/222 (21%), Positives = 90/222 (40%), Gaps = 38/222 (17%)

Query: 235 ENSGWSTNMEEIENVVHNAIREKIIPRVLVVINPGNPTGAILSVESIEKIFDVAAHHGIV 294
           + S W+ + ++      +AI EK   + +++ +P NPTG + + E +  + ++     + 
Sbjct: 164 KGSEWTLDFDQF----RSAISEKT--KAVIINSPHNPTGKVFTREELLTLGNICVEKNVY 217

Query: 295 VIADEVYQENIFPGNEFHSMKKVLRDLQRRVPGKYENVQLASLHSTSKGVSGECGQRGGY 354
           +I+DEVY+   F                       E V+LASL      ++   G  G  
Sbjct: 218 IISDEVYENLYFTP---------------------ECVKLASLSPEISNITLTIGSAGKI 256

Query: 355 MELTGFS----TEIKHEILKLCSISLCPVVTGQALVDLMTCPPKKGEASYEQDQMERSTI 410
             +TG+          E+LKL S +   +         + C     + +   D  +R  +
Sbjct: 257 FAVTGWRIGWIISENVELLKLASSAHIKICFSSPSPPQLAC-AHAIDIALNSDYFDR--M 313

Query: 411 HSELYERATYLWKAFNEMEGVSCQKPQGSMYL---FPKIDIP 449
             +  E+   L   F E+ G+    P+GS ++   F K+ IP
Sbjct: 314 RKDYIEKVEILTSVFEEL-GMPYTVPEGSYFIVVDFSKLKIP 354

>AEL170C Chr5 complement(318032..319408) [1377 bp, 458 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YJL060W
           (BNA3)
          Length = 458

 Score = 43.5 bits (101), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 49/241 (20%), Positives = 99/241 (41%), Gaps = 26/241 (10%)

Query: 248 NVVHNAIREKIIPRVLVVINPGNPTGAILSVESIEKIFDVAAHHGIVVIADEVYQENIFP 307
           +++   I EK   + +++ +P NP G + + E + K+ ++    GI +I+DEVY E+++ 
Sbjct: 203 DMLRQTINEKT--KAVIINSPHNPIGKVFTREELLKLGNICVEKGIYIISDEVY-EHLYF 259

Query: 308 GNEFHSMKKVLRDLQRRVPGKYENVQLASLHSTSKGVSGECGQRGGYMELTGFSTEIKHE 367
            +EF  +  +  ++              S H+ + G +G+     G+    G+      E
Sbjct: 260 TDEFTRIATLSEEI--------------SQHTLTVGSAGKSFAATGWR--IGWVISRNKE 303

Query: 368 ILKLCSISLCPVVTGQALVDLMTCPPKKGEASYEQDQMERSTIHSELYERATYLWKAFNE 427
           +L L S +   +           C      A       +    + + YER     K F++
Sbjct: 304 LLALASKAHVRICFSSPAPLQEACAVAIEHALKTTYYADTRAAYQKKYER---FQKPFDD 360

Query: 428 MEGVSCQKPQGSMYL---FPKIDIPHKALEKAQELDITPDELYCAELLEATGICTVPGSG 484
           + G+   + +GS +L   F ++ +P       +  D   D      L+   G+  +P S 
Sbjct: 361 L-GLPYTRAEGSYFLLVDFSRLPLPADYHFPEELADKGRDFRVAYWLINELGLVAIPCSS 419

Query: 485 F 485
           F
Sbjct: 420 F 420

>NCAS0B07220 Chr2 (1366278..1367810) [1533 bp, 510 aa] {ON}
           Anc_2.102
          Length = 510

 Score = 43.5 bits (101), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 19/49 (38%), Positives = 30/49 (61%), Gaps = 1/49 (2%)

Query: 260 PRVLVVINPG-NPTGAILSVESIEKIFDVAAHHGIVVIADEVYQENIFP 307
           P++L  I+ G NP G  LS+E  EKI+ +A  H ++++ D+ Y    FP
Sbjct: 224 PKILYTISTGQNPMGMTLSMEKREKIYQIAQQHDLIILEDDPYTYLTFP 272

>ZYRO0G20636g Chr7 complement(1700506..1701867) [1362 bp, 453 aa]
           {ON} highly similar to uniprot|P47039 Saccharomyces
           cerevisiae YJL060W BNA3 Arylformamidase involved in
           biosynthesis of nicotinic acid from tryptophan via
           kynurenine pathway potential Cdc28p substrate
          Length = 453

 Score = 43.1 bits (100), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 68/330 (20%), Positives = 125/330 (37%), Gaps = 51/330 (15%)

Query: 174 GEKAYAEDIFLTAGASSAV-SYLLNILCKGKESGVLIP-----IPQYXXXXXXXXXXXXX 227
           G++   E++ +T GA+  + S L+ IL  G E  V  P     IP               
Sbjct: 117 GQELKDENVTITTGANEGILSSLMGILNPGDEVIVFEPFFDQYIPNIELLGGKVVYVPIN 176

Query: 228 XXXXXXE---ENSGWSTNMEEIENVVHNAIREKIIPRVLVVINPGNPTGAILSVESIEKI 284
                 +   E   W+ + EE+     +  +       L++  P NP G + + E + KI
Sbjct: 177 PPKDMDQRIVEGKDWTIDYEELAKAFTSKTK------ALILNTPHNPIGKVFTKEELTKI 230

Query: 285 FDVAAHHGIVVIADEVYQENIFPGNEFHSMKKVLRDLQRRVPGKYENVQLASLHSTSKGV 344
            ++   + +V+I+DEVY+   F             D   R+      +   +L   S G 
Sbjct: 231 GNLCVENNVVIISDEVYEFLYF------------TDSYTRIATLSPEIGQLTLTVGSAGK 278

Query: 345 S-GECGQRGGYM-----ELTGFSTEIKHEILKLCSISLCPVVTGQALVDLMTCPPKKGEA 398
           +    G R G++     EL  + ++  H   ++C  S  P+    A            E 
Sbjct: 279 TFAATGWRIGWVISLNPELLSYVSK-GHT--RICFSSPSPIQEAVA---------NSIED 326

Query: 399 SYEQDQMERSTIHSELYERATYLWKAFNEMEGVSCQKPQGSMYL---FPKIDIPHKALEK 455
           + + D  E   + ++   +       F EM G+    P+G+ ++   F K+++P      
Sbjct: 327 ALKGDYFE--AMRTDYIRKFEIFTSVFKEM-GLPYTIPEGTYFILVDFSKVNVPEDYPYP 383

Query: 456 AQELDITPDELYCAELLEATGICTVPGSGF 485
            + LD   D      L+   G+  +P + F
Sbjct: 384 EELLDKGKDFRISYWLINELGVVAIPPTEF 413

>YJL060W Chr10 (323386..324720) [1335 bp, 444 aa] {ON}
           BNA3Kynurenine aminotransferase, catalyzes formation of
           kynurenic acid from kynurenine; potential Cdc28p
           substrate
          Length = 444

 Score = 42.7 bits (99), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 34/138 (24%), Positives = 60/138 (43%), Gaps = 17/138 (12%)

Query: 179 AEDIFLTAGASSAV-SYLLNILCKGKESGVLIP-----IPQYXXXXXXXXXXXXXXXXXX 232
           AE++ +T GA+  + S L+ +L  G E  V  P     IP                    
Sbjct: 115 AENVTVTTGANEGILSCLMGLLNAGDEVIVFEPFFDQYIPNIELCGGKVVYVPINPPKEL 174

Query: 233 XEENSG---WSTNMEEIENVVHNAIREKIIPRVLVVIN-PGNPTGAILSVESIEKIFDVA 288
            + N+    W+ + E+ E  + +  +        V+IN P NP G + + E +  + ++ 
Sbjct: 175 DQRNTRGEEWTIDFEQFEKAITSKTKA-------VIINTPHNPIGKVFTREELTTLGNIC 227

Query: 289 AHHGIVVIADEVYQENIF 306
             H +V+I+DEVY+   F
Sbjct: 228 VKHNVVIISDEVYEHLYF 245

>KNAG0B00660 Chr2 (115417..116907) [1491 bp, 496 aa] {ON} Anc_3.511
           YGL202W
          Length = 496

 Score = 42.7 bits (99), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 23/59 (38%), Positives = 34/59 (57%), Gaps = 1/59 (1%)

Query: 244 EEIENVVHNAIREKIIPRVLVVINPG-NPTGAILSVESIEKIFDVAAHHGIVVIADEVY 301
           E++E ++ N       P++L  I  G NPTG+ LS +  EKI+ VA  H  ++I DE Y
Sbjct: 191 EKLEQILDNWTEGAPKPKLLYTIPTGQNPTGSSLSDDRKEKIYKVAQKHDFIIIEDEPY 249

>KLLA0F10021g Chr6 (926569..928062) [1494 bp, 497 aa] {ON} similar
           to uniprot|P53090 Saccharomyces cerevisiae YGL202W ARO8
           Aromatic aminotransferase expression is regulated by
           general control of amino acid biosynthesis
          Length = 497

 Score = 42.7 bits (99), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 26/88 (29%), Positives = 43/88 (48%), Gaps = 9/88 (10%)

Query: 245 EIENVVHNAIREKIIPRVLVVINPG-NPTGAILSVESIEKIFDVAAHHGIVVIADEVYQE 303
           ++E ++ N       P++L  +  G NPTG+ LS +  E+I+ +A  H  ++I DE Y  
Sbjct: 194 KLETILDNWTEGAAKPKLLYTVPTGQNPTGSSLSFDRKEEIYRIAQKHDFIIIEDEPYY- 252

Query: 304 NIFPGNEFHSMKKVLRDLQRRVPGKYEN 331
                  F  M+K  +D   RV   Y +
Sbjct: 253 -------FLQMEKYEKDPANRVVKSYAD 273

>NCAS0E00670 Chr5 (117006..118499) [1494 bp, 497 aa] {ON} Anc_3.511
          Length = 497

 Score = 41.6 bits (96), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 38/123 (30%), Positives = 53/123 (43%), Gaps = 18/123 (14%)

Query: 245 EIENVVHNAIREKIIPRVLVVINPG-NPTGAILSVESIEKIFDVAAHHGIVVIADEVYQE 303
           ++E ++ N       P++L  I  G NPTG  L+ E   +IF +A  H  ++I D  Y  
Sbjct: 193 KLEAILDNWTPGAPKPKLLYTIPTGQNPTGTSLADERKPEIFRIAQKHDFLIIEDAPYY- 251

Query: 304 NIFPGNEFHSMKKVLRDLQRRV-----PGKYENVQLASLHSTSKGVSGECGQRGGYMELT 358
                  F  M K  RDLQ+R      P +     LASL  T   V  +    G  + L 
Sbjct: 252 -------FLQMDKYERDLQKRAVTRAQPRESHKDFLASLDKTFLSVDTD----GRVIRLD 300

Query: 359 GFS 361
            FS
Sbjct: 301 SFS 303

>KLLA0F01617g Chr6 complement(154025..155359) [1335 bp, 444 aa] {ON}
           highly similar to uniprot|P47039 Saccharomyces
           cerevisiae YJL060W BNA3 Arylformamidase
          Length = 444

 Score = 41.6 bits (96), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 51/246 (20%), Positives = 107/246 (43%), Gaps = 36/246 (14%)

Query: 248 NVVHNAIREKIIPRVLVVINPGNPTGAILSVESIEKIFDVAAHHGIVVIADEVYQENIFP 307
           ++++  I E+   + +++  P NP G + + E + ++ D+   + I +I+DEVY E+++ 
Sbjct: 189 DILNKTINERT--KCIILNTPHNPIGKVFTREELTQLGDICVKNNIYIISDEVY-EHLYF 245

Query: 308 GNEFHSMKKVLRDLQRRVPGKYENVQLASLHSTSKGVSGECGQRGGYM-----ELTGFST 362
           G+EF  +  + +++              S+ S  K  +   G R G++     EL  + +
Sbjct: 246 GDEFTRIATISKEIGDLT---------LSVGSAGKSFAA-TGWRIGWVVSRNAELLSYVS 295

Query: 363 EIKHEILKLCSISLCPVVTGQALVDLMTCPPKKGEASYEQDQMERSTIHSELYERATYLW 422
           +      ++C  S  P    +A    +      G   Y ++  E      E  E+   L 
Sbjct: 296 KAH---TRICFSSPSPF--QEACAHSIDIGLHNG---YFENMRE------EYKEKFAILT 341

Query: 423 KAFNEMEGVSCQKPQGSMYL---FPKIDIPHKALEKAQELDITPDELYCAELLEATGICT 479
           + F+E+ G+   KP G+ ++   F K+ IP +     +  +   D      L+   G+  
Sbjct: 342 RVFDEL-GLPYTKPDGTYFVCVDFSKVQIPDEYPFPRELNERAKDFKLSYWLVNELGVVA 400

Query: 480 VPGSGF 485
           +P + F
Sbjct: 401 IPPTEF 406

>SAKL0F02156g Chr6 (185574..187070) [1497 bp, 498 aa] {ON} highly
           similar to uniprot|P53090 Saccharomyces cerevisiae
           YGL202W ARO8 Aromatic aminotransferase expression is
           regulated by general control of amino acid biosynthesis
          Length = 498

 Score = 41.6 bits (96), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 26/82 (31%), Positives = 42/82 (51%), Gaps = 9/82 (10%)

Query: 244 EEIENVVHNAIREKIIPRVLVVINPG-NPTGAILSVESIEKIFDVAAHHGIVVIADEVYQ 302
           E++E+++ N   E   P++L  I  G NPTG+ LS +   KI+ +A  H  ++I DE Y 
Sbjct: 194 EKLESIMDNWNPETPKPKLLYTIPTGQNPTGSSLSDDRKAKIYRIAQKHNFIIIEDEPYY 253

Query: 303 ENIFPGNEFHSMKKVLRDLQRR 324
                   F  M+  ++D   R
Sbjct: 254 --------FLQMEPYVKDASAR 267

>TDEL0D01900 Chr4 (369434..370765) [1332 bp, 443 aa] {ON} Anc_1.321
           YJL060W
          Length = 443

 Score = 41.2 bits (95), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 62/322 (19%), Positives = 127/322 (39%), Gaps = 45/322 (13%)

Query: 179 AEDIFLTAGASSAV-SYLLNILCKGKESGVLIP-----IPQYXXXXXXXXXXXXXXXXXX 232
           AE++ +T GA+  + S L+ IL  G E  V  P     IP                    
Sbjct: 114 AENVTVTTGANEGILSCLMGILNPGDEVIVFEPFFDQYIPNIELLGGKVVYVPINPPKDM 173

Query: 233 XE---ENSGWSTNMEEIENVVHNAIREKIIPRVLVVINPGNPTGAILSVESIEKIFDVAA 289
            +   + + W+ + E+  N    AI +K   + +++  P NP G + + E + +I ++  
Sbjct: 174 DQRVVKGTEWTVDYEQFAN----AITDKT--KAVIINTPHNPIGKVFTREELTRIGEICV 227

Query: 290 HHGIVVIADEVYQENIFPGNEFHSMKKVLRDLQRRVPGKYENVQLASLHSTSKGVSGECG 349
              +V+I+DEVY E+++  + F  +  +  ++ +               + S G +G+  
Sbjct: 228 KKNVVIISDEVY-EHLYFTDSFTRIATLSPEIGQL--------------TLSVGSAGKSF 272

Query: 350 QRGGYMELTGFSTEIKHEILKLCSISLCPVVTGQALVDLMTCPPKKGEASYEQDQMERS- 408
              G+    G+   +  E+L   S +   +            P ++  A+   D +E + 
Sbjct: 273 AATGWR--VGWVVSLNPELLSYVSKAHTRICFASP------SPLQEAVANSINDALEINY 324

Query: 409 --TIHSELYERATYLWKAFNEMEGVSCQKPQGSMYL---FPKIDIPHKALEKAQELDITP 463
              +  E   +       F E+ G+   +P+G+ ++   F K+ IP       +  +   
Sbjct: 325 FENMRQEYKHKYDIFTSVFKEL-GLPYTEPEGTYFILVDFSKVKIPEGYSYPEEIANKAK 383

Query: 464 DELYCAELLEATGICTVPGSGF 485
           D      L+   G+  +P + F
Sbjct: 384 DFRIAYWLINELGVVAIPPTEF 405

>Kpol_278.2 s278 (2488..3984) [1497 bp, 498 aa] {ON} (2488..3984)
           [1497 nt, 499 aa]
          Length = 498

 Score = 40.8 bits (94), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 66/273 (24%), Positives = 106/273 (38%), Gaps = 52/273 (19%)

Query: 244 EEIENVVHNAIREKIIPRVLVVINPG-NPTGAILSVESIEKIFDVAAHHGIVVIADEVYQ 302
           E++E ++ N       P++L  I  G NPTG  L+ E   +I+ +A  H  ++I DE Y 
Sbjct: 191 EKLEEILDNWTPGAPKPKLLYTIPTGQNPTGTSLADERKVEIYRIACKHDFLIIEDEPYY 250

Query: 303 ENIFPGNEFHSMKKVLRDLQRR-----VPGKYENVQLASLHSTSKGVSGEC--------- 348
                   F  M + + DL  R     VP    +  L SL  T   V  E          
Sbjct: 251 --------FLQMGEYIADLDERKKVQDVPKPTHDQFLGSLAKTFLSVDTEGRVIRMDSFS 302

Query: 349 -----GQRGGYMELTGFSTEIKHEILKLCSISLCPVVTG--QALVDLMTCPPKKGEASY- 400
                G R G+  LTG S ++    + L  +++    +G  Q+LV+ +    + G+  Y 
Sbjct: 303 KVLAPGSRLGW--LTG-SKKLLQPYISLHEMTVQ-AASGFTQSLVNGLLQ--RWGQDGYI 356

Query: 401 -------EQDQMERSTIHSELYERATYLWKAFNEMEGVSCQKPQGSMYLFPKIDIP-HKA 452
                   +  ++R      LYE A        + E      P   M+    ID   H  
Sbjct: 357 DWLIGLRHEYTLKRDNAIDALYEYAP-------KHEAFKINPPIAGMFFTINIDASIHPE 409

Query: 453 LEKAQELDITPDELYCAELLEATGICTVPGSGF 485
            E   + +    E Y  + +  +G+  VPG+ F
Sbjct: 410 FETKFQSNPAMVEQYIYDKVVRSGVLVVPGAWF 442

>KNAG0B05320 Chr2 (1028845..1030146) [1302 bp, 433 aa] {ON}
           Anc_1.321 YJL060W
          Length = 433

 Score = 40.8 bits (94), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 39/143 (27%), Positives = 66/143 (46%), Gaps = 8/143 (5%)

Query: 174 GEKAYAEDIFLTAGASSAV-SYLLNILCKGKESGVLIPI-PQYXXXXXXXXXXXXXXXXX 231
           G++  A++I +  GA+ A+ S L+ +L KG E  V  P   QY                 
Sbjct: 99  GQQLSADNITVHTGANEAIFSCLMGLLNKGDEVIVFEPFFDQYISNIELAGGVVRYVPIN 158

Query: 232 XXEENSGWSTNMEEIENVVHNAIREKII---PRVLVVINPGNPTGAILSVESIEKIFDVA 288
              E     T   E E  +   I EK I    + +++  P NP G + + E + ++  + 
Sbjct: 159 PPRELDDRVTRGTEWE--IDWDILEKTINSRTKCVIINTPHNPIGKVFTREELLRLGKIC 216

Query: 289 AHHGIVVIADEVYQENIFPGNEF 311
             + IV+I+DEVY E+++  +EF
Sbjct: 217 VDNNIVIISDEVY-EHLYFSDEF 238

>NDAI0B04550 Chr2 (1132653..1134350) [1698 bp, 565 aa] {ON}
           Anc_2.102
          Length = 565

 Score = 40.4 bits (93), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 22/72 (30%), Positives = 39/72 (54%), Gaps = 6/72 (8%)

Query: 242 NMEEIENVVHN-----AIREKIIPRVLVVINPG-NPTGAILSVESIEKIFDVAAHHGIVV 295
           ++E +EN++ N       +    P++L  I+ G NP G  LS+E   KI+ +A  H +++
Sbjct: 230 DIEYLENLLDNWGGKSNTKHLSKPKILYTISTGQNPIGVTLSMEKRRKIYTIAQRHDLII 289

Query: 296 IADEVYQENIFP 307
           + D+ Y    FP
Sbjct: 290 LEDDPYCYLTFP 301

>Kpol_1039.22 s1039 (68736..69896) [1161 bp, 386 aa] {ON}
           (68736..69896) [1161 nt, 387 aa]
          Length = 386

 Score = 40.0 bits (92), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 43/191 (22%), Positives = 83/191 (43%), Gaps = 18/191 (9%)

Query: 160 LRKTVAEYISRRD---GGEKAYAEDIFLTAGASSAVSYLLNILCKGKESGVLIPIPQYXX 216
            +  +A + +R D   G E    +++ L  G+   +  L+   C+ +   +L   P Y  
Sbjct: 62  FKTLLAGFRNRLDKTPGIEPLTEDNLCLGVGSDECIDSLIRACCRPEVDKILTLPPTYSM 121

Query: 217 XXXXXXXXXXXXXXX-XXEENSGWSTNMEEIENVVHNAIREKIIPRVLVVINPGNPTGAI 275
                              E++ +  N+ E+ + + N  + K+    L + +PGNPTG +
Sbjct: 122 YSVCANINDVEIVECPLITEDNSFQMNVPEVLSTLKNDPKIKL----LFITSPGNPTGKL 177

Query: 276 LSVESIEKIFDVAAHHGIVVIADEVYQENIFPGNEFHSMKKVLRDLQRRVPGKYENVQLA 335
           ++ + IE I +    +G+VV+ DE Y +        +SM K++         KY N+ + 
Sbjct: 178 VNKKDIEFILE-NWTNGLVVV-DEAYIDFADAEGTTYSMAKLVT--------KYPNLTVL 227

Query: 336 SLHSTSKGVSG 346
              S S G++G
Sbjct: 228 QTLSKSFGLAG 238

>Kpol_1035.23 s1035 complement(56123..57457) [1335 bp, 444 aa] {ON}
           complement(56123..57457) [1335 nt, 445 aa]
          Length = 444

 Score = 40.0 bits (92), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 61/322 (18%), Positives = 124/322 (38%), Gaps = 47/322 (14%)

Query: 180 EDIFLTAGASSAV-SYLLNILCKGKESGVLIPI-PQYXXXXXXXXXXXXXXXXXXXEE-- 235
           E++ +T GA+  + S L+ I+  G E  V  P   QY                   +E  
Sbjct: 116 ENVLVTTGANEGILSCLMGIINPGDEVIVFEPFFDQYIPNIELCGGKVVYVPINPPKELD 175

Query: 236 -----NSGWSTNMEEIENVVHNAIREKIIPRVLVVINPGNPTGAILSVESIEKIFDVAAH 290
                 + W+ + +E       AI  K   + +++  P NP G + + E + K+ ++   
Sbjct: 176 NRVTKGTEWTVDFDEFTR----AITPKT--KAVIINTPHNPIGKVFTREELTKLGNICVE 229

Query: 291 HGIVVIADEVYQENIFPGNEFHSMKKVLRDLQRRVPGKYENVQLASLHSTSKGVSGECGQ 350
           + +++IADEVY E+++  +EF  +  +  ++ +               + S G +G+   
Sbjct: 230 NNVIIIADEVY-EHLYFVDEFPRIATLSEEIGQL--------------TLSVGSAGKSFA 274

Query: 351 RGGYMELTGFSTEIKHEILKLCSISLCPVVTGQALVDLMTCPPKKGEASYEQDQMER--- 407
             G+    G+      ++L+  S            +   +  P +   SY  D   +   
Sbjct: 275 ATGWR--IGWVVSQNPDLLQYAS-------KAHTRICFASPSPIQEACSYSIDHALKIDY 325

Query: 408 -STIHSELYERATYLWKAFNEMEGVSCQKPQGSMYL---FPKIDIPHKALEKAQELDITP 463
              +  E  ++       F+E+ G+    P+GS ++   F K+ IP       + +    
Sbjct: 326 FENMRQEYVKKFKIFTSVFDEL-GLPYTIPEGSYFVLADFSKVKIPDSYQFPEEIMSKGK 384

Query: 464 DELYCAELLEATGICTVPGSGF 485
           D      L+   G+  +P + F
Sbjct: 385 DFRISNWLINELGVVAIPPTEF 406

>Smik_10.180 Chr10 (315030..316364) [1335 bp, 444 aa] {ON} YJL060W
           (REAL)
          Length = 444

 Score = 40.0 bits (92), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 18/68 (26%), Positives = 36/68 (52%), Gaps = 6/68 (8%)

Query: 239 WSTNMEEIENVVHNAIREKIIPRVLVVINPGNPTGAILSVESIEKIFDVAAHHGIVVIAD 298
           W+ + E+ E     AI  K   + +++  P NP G + + E +  + ++   H +++I+D
Sbjct: 184 WTIDFEQFEK----AITPKT--KAVIINTPHNPIGKVFTREELTTLGNICVKHNVIIISD 237

Query: 299 EVYQENIF 306
           EVY+   F
Sbjct: 238 EVYEHLYF 245

>CAGL0G01254g Chr7 (119281..120795) [1515 bp, 504 aa] {ON} highly
           similar to uniprot|P53090 Saccharomyces cerevisiae
           YGL202w ARO8
          Length = 504

 Score = 40.0 bits (92), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 25/93 (26%), Positives = 46/93 (49%), Gaps = 9/93 (9%)

Query: 244 EEIENVVHNAIREKIIPRVLVVINPG-NPTGAILSVESIEKIFDVAAHHGIVVIADEVYQ 302
           E++E ++ N       P++L  I  G NPTG+ L+ E  ++I+ +A  H  ++I DE Y 
Sbjct: 191 EKLEALLDNWTEGAPKPKLLYTIPTGQNPTGSSLNAERKKEIYRIAQKHDFLIIEDEPYY 250

Query: 303 ENIFPGNEFHSMKKVLRDLQRRVPGKYENVQLA 335
                   F  + + + DL +R     +N  ++
Sbjct: 251 --------FLQVGEYISDLSKRAEVAQKNANIS 275

>KLTH0H10648g Chr8 complement(919601..920932) [1332 bp, 443 aa] {ON}
           highly similar to uniprot|P47039 Saccharomyces
           cerevisiae YJL060W BNA3 Arylformamidase involved in
           biosynthesis of nicotinic acid from tryptophan via
           kynurenine pathway potential Cdc28p substrate
          Length = 443

 Score = 40.0 bits (92), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 58/262 (22%), Positives = 107/262 (40%), Gaps = 46/262 (17%)

Query: 235 ENSGWSTNMEEIENVVHNAIREKIIPRV--LVVINPGNPTGAILSVESIEKIFDVAAHHG 292
           E + W+ + +E+        R  I P+   L++  P NP G + + E + +I  +   + 
Sbjct: 179 EGTEWTVDYDEL--------RAAITPKTKALILNTPHNPVGKVFTREELLQIGQICVENN 230

Query: 293 IVVIADEVYQENIFPGNEFHSMKKVLRDLQRRVPGKYENVQLASLHSTSKGVS-GECGQR 351
           +V+I+DEVY E+++   EF            RV      +   +L   S G S    G R
Sbjct: 231 VVIISDEVY-EHLYFTPEF-----------TRVATLSPEIGQITLTIGSAGKSFAATGWR 278

Query: 352 GGYM-----ELTGFSTEIKHEILKLCSISLCPVVTGQALVDLMTCPPKKGEASYEQDQME 406
            G++     EL  +++ + H   ++C  S  P+    A        P   +  Y + +M 
Sbjct: 279 IGWIVSLNPELLEYAS-MAHT--RICFASPSPLQEACA-----NALPIALDNGYFK-KMR 329

Query: 407 RSTIHSELYERATYLWKAFNEMEGVSCQKPQGSMYL---FPKIDIPHKALEKAQELDITP 463
              IH     +     + F+E+ G+   KP+G+ ++   F K+ IP       +      
Sbjct: 330 EEYIH-----KFNIFTRVFDEL-GLPYTKPEGTYFVLVDFSKVKIPEDYPFPEELRSKAK 383

Query: 464 DELYCAELLEATGICTVPGSGF 485
           D      L+   G+  +P + F
Sbjct: 384 DFRISYWLINELGVVAIPPTEF 405

>Kwal_33.14582 s33 complement(728649..730226) [1578 bp, 525 aa] {ON}
           YHR137W (ARO9) - aromatic amino acid aminotransferase II
           [contig 102] FULL
          Length = 525

 Score = 40.0 bits (92), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 22/65 (33%), Positives = 34/65 (52%), Gaps = 1/65 (1%)

Query: 244 EEIENVVHNAIREKIIPRVLVVINPG-NPTGAILSVESIEKIFDVAAHHGIVVIADEVYQ 302
           E ++N V         P++L  I  G NPTG  LS E  ++I+D+A  H  +++ D+ Y 
Sbjct: 224 ELLDNWVQGPYAHLSRPKLLYTIPTGQNPTGMTLSREKRQQIYDLAEKHDFIIVEDDPYG 283

Query: 303 ENIFP 307
              FP
Sbjct: 284 YLKFP 288

>NCAS0G04050 Chr7 complement(753216..754370) [1155 bp, 384 aa] {ON}
           Anc_1.472
          Length = 384

 Score = 39.7 bits (91), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 29/135 (21%), Positives = 60/135 (44%), Gaps = 13/135 (9%)

Query: 180 EDIFLTAGASSAVSYLLNILCKGKESGVLIPIPQYXXXXXXXXXXXXXXXXXXXEENSGW 239
           +++ +T GA +A ++L+     G    V+   P Y                   ++  G+
Sbjct: 79  DNVLVTNGAIAA-NFLIYYTLVGPGDHVICVDPTYAQLYSVPKMFGAEVSLLKLQKEDGF 137

Query: 240 STNMEEIENVVHNAIREKIIPRVLVVINPGNPTGAILSVESIEKIFDVAAHHGIVVIADE 299
             N+E ++ ++ +  +      ++++ NP NP G+ +S E++  I  +   + I +  DE
Sbjct: 138 IPNIETLKKMIKSNTK------LIIINNPNNPLGSAISTETLNDICQLCEENNIYLHCDE 191

Query: 300 VYQENIFPGNEFHSM 314
           VY+        FHSM
Sbjct: 192 VYKP------IFHSM 200

>KLTH0G09614g Chr7 (804939..806108) [1170 bp, 389 aa] {ON} similar
           to uniprot|P07172 Saccharomyces cerevisiae YIL116W HIS5
           Histidinol-phosphate aminotransferase catalyzes the
           seventh step in histidine biosynthesis responsive to
           general control of amino acid biosynthesis mutations
           cause histidine auxotrophy and sensitivity to Cu Co and
           Ni salts
          Length = 389

 Score = 39.7 bits (91), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 35/125 (28%), Positives = 54/125 (43%), Gaps = 9/125 (7%)

Query: 179 AEDIFLTAGASSAVSYLLNILCKGKESGVLIPIPQYXXXXXXXXXXXXXXXXX--XXEEN 236
           A+++ L  G+  ++  L+   C   +  +LI  P Y                     E+N
Sbjct: 87  ADNLCLGVGSDESIDALIRACCVPGKDKILIMTPTYGMYSICADINDVEIIKVPLIVEDN 146

Query: 237 SGWSTNMEEIENVVHNAIREKIIPRVLVVINPGNPTGAILSVESIEKIFDVAAHHGIVVI 296
           S +  N +++   +      KI      V +PGNPTGA++ + SIEKI       GIV I
Sbjct: 147 S-FQMNTDKVIETLQGDSNIKIA----FVTSPGNPTGALIDIASIEKILS-QWQSGIVAI 200

Query: 297 ADEVY 301
            DE Y
Sbjct: 201 -DEAY 204

>KLTH0G02002g Chr7 (155219..156709) [1491 bp, 496 aa] {ON} highly
           similar to uniprot|P53090 Saccharomyces cerevisiae
           YGL202W ARO8 Aromatic aminotransferase expression is
           regulated by general control of amino acid biosynthesis
          Length = 496

 Score = 39.3 bits (90), Expect = 0.019,   Method: Compositional matrix adjust.
 Identities = 21/59 (35%), Positives = 34/59 (57%), Gaps = 1/59 (1%)

Query: 244 EEIENVVHNAIREKIIPRVLVVINPG-NPTGAILSVESIEKIFDVAAHHGIVVIADEVY 301
           E +E ++ N   E   P++L  I  G NPTG+ LS +  ++I+ +A  H  ++I DE Y
Sbjct: 194 ERLEAILDNWNPETPKPKLLYTIPTGQNPTGSSLSDDRKKEIYRIAQKHDFIIIEDEPY 252

>NDAI0I02830 Chr9 complement(669885..671387) [1503 bp, 500 aa] {ON}
           Anc_3.511
          Length = 500

 Score = 39.3 bits (90), Expect = 0.021,   Method: Compositional matrix adjust.
 Identities = 23/83 (27%), Positives = 39/83 (46%), Gaps = 9/83 (10%)

Query: 244 EEIENVVHNAIREKIIPRVLVVINPG-NPTGAILSVESIEKIFDVAAHHGIVVIADEVYQ 302
           E++E ++ N       P++L  I  G NPTG  L    +E+I+ +A  H  +++ D  Y 
Sbjct: 192 EKLEKILDNWTPGAPKPKLLYTIPTGQNPTGTSLPAHRMEEIYRIAQKHDFLIVEDAPYY 251

Query: 303 ENIFPGNEFHSMKKVLRDLQRRV 325
                   F  M K ++D+  R 
Sbjct: 252 --------FLQMDKYVKDVNERT 266

>SAKL0E12188g Chr5 (1010503..1012095) [1593 bp, 530 aa] {ON} similar
           to uniprot|P38840 Saccharomyces cerevisiae YHR137W ARO9
           Aromatic aminotransferase catalyzes the first step of
           tryptophan phenylalanine and tyrosine catabolism
          Length = 530

 Score = 38.9 bits (89), Expect = 0.026,   Method: Compositional matrix adjust.
 Identities = 20/50 (40%), Positives = 28/50 (56%), Gaps = 1/50 (2%)

Query: 260 PRVLVVINPG-NPTGAILSVESIEKIFDVAAHHGIVVIADEVYQENIFPG 308
           PRVL  I  G NPTG  LS E  + I+++A  H  +++ D+ Y    FP 
Sbjct: 246 PRVLYTIATGQNPTGMTLSPEKRKAIYELAETHNFIIVEDDPYGYLKFPA 295

>Ecym_3290 Chr3 (546773..547933) [1161 bp, 386 aa] {ON} similar to
           Ashbya gossypii ADL249W
          Length = 386

 Score = 38.5 bits (88), Expect = 0.031,   Method: Compositional matrix adjust.
 Identities = 46/169 (27%), Positives = 72/169 (42%), Gaps = 21/169 (12%)

Query: 180 EDIFLTAGASSAVSYLLNILCKGKESGVLIPIPQYXXXXXXXXXXXXXXXX--XXXEENS 237
           ++I L  G+   V  L+   C  K   VL+  P Y                     E+NS
Sbjct: 88  KNICLGVGSDEGVDSLIRATCVPKTDKVLVLPPTYSMYSVFAMINDTEVVECPLITEDNS 147

Query: 238 GWSTNMEEIENVVHNAIREKIIPRVLVVINPGNPTGAILSVESIEKIFDVAAHHGIVVIA 297
               +M+ ++NV+     +  I ++L +  PGNPTGA +S + IE + +     GIVV+ 
Sbjct: 148 ---FDMD-LDNVLETLSNDDSI-KLLFITTPGNPTGASISTQKIEMLLN-NWSAGIVVV- 200

Query: 298 DEVYQENIFPGNEFHSMKKVLRDLQRRVPGKYENVQLASLHSTSKGVSG 346
           DE Y        +F S      D    +  KY N+ +    S S G++G
Sbjct: 201 DEAYI-------DFSS-----SDSAAPLVNKYPNLVVIQTLSKSFGLAG 237

>KLLA0F03509g Chr6 (327598..328761) [1164 bp, 387 aa] {ON} similar
           to uniprot|P07172 Saccharomyces cerevisiae YIL116W HIS5
           Histidinol-phosphate aminotransferase catalyzes the
           seventh step in histidine biosynthesis responsive to
           general control of amino acid biosynthesis mutations
           cause histidine auxotrophy and sensitivity to Cu Co and
           Ni salts
          Length = 387

 Score = 38.1 bits (87), Expect = 0.042,   Method: Compositional matrix adjust.
 Identities = 40/170 (23%), Positives = 70/170 (41%), Gaps = 17/170 (10%)

Query: 179 AEDIFLTAGASSAVSYLLNILCKGKESGVLIPIPQYXXXX--XXXXXXXXXXXXXXXEEN 236
           A+++ L  G+  ++  L+   C   +  +LI    Y                      E 
Sbjct: 87  ADNLCLGVGSDESIDALIRACCVPAKEKILIAPATYGMYTICSQVNDVEYVTVPLLLSEE 146

Query: 237 SGWSTNMEEIENVVHNAIREKIIPRVLVVINPGNPTGAILSVESIEKIFDVAAHHGIVVI 296
             +  + E+I   + N    K++     + +PGNPTG  + V  IEKI       G+VV+
Sbjct: 147 DKFQIDEEKILETLQNDPSIKLV----FITSPGNPTGTFIDVNRIEKILS-QWQTGLVVV 201

Query: 297 ADEVYQENIFPGNEFHSMKKVLRDLQRRVPGKYENVQLASLHSTSKGVSG 346
            DE Y + +  G++  S+          +  KYEN+ +    S S G++G
Sbjct: 202 -DEAYIDFV-EGSDKGSLAP--------LATKYENIAVLQTLSKSFGLAG 241

>SAKL0E08492g Chr5 complement(692049..693203) [1155 bp, 384 aa] {ON}
           similar to uniprot|P07172 Saccharomyces cerevisiae
           YIL116W HIS5 Histidinol-phosphate aminotransferase
           catalyzes the seventh step in histidine biosynthesis
           responsive to general control of amino acid biosynthesis
           mutations cause histidine auxotrophy and sensitivity to
           Cu Co and Ni salts
          Length = 384

 Score = 38.1 bits (87), Expect = 0.043,   Method: Compositional matrix adjust.
 Identities = 37/170 (21%), Positives = 68/170 (40%), Gaps = 22/170 (12%)

Query: 179 AEDIFLTAGASSAVSYLLNILCKGKESGVLIPIPQYXXXXXXXXXXXX--XXXXXXXEEN 236
           AE+I L  G+  ++  L+ + C   +  ++I  P Y                     E+N
Sbjct: 87  AENICLGVGSDESIDALIRVCCVPSKDKIMIMPPTYGMYSICADINDVGCVKVPLVAEDN 146

Query: 237 SGWSTNMEEIENVVHNAIREKIIPRVLVVINPGNPTGAILSVESIEKIFDVAAHHGIVVI 296
           S      + +E +  +        +++ + +PGNPT A++    IEK+ +     G +V+
Sbjct: 147 SFQMDTSKVLETLAQDPTI-----KLIFITSPGNPTAALIDTAEIEKVLN--NWTGGLVV 199

Query: 297 ADEVYQENIFPGNEFHSMKKVLRDLQRRVPGKYENVQLASLHSTSKGVSG 346
            DE Y +  F G     +             KY N+ +    S S G++G
Sbjct: 200 VDEAYID--FCGGSTTPLVN-----------KYPNLAVIQTMSKSFGLAG 236

>KNAG0G00550 Chr7 (96823..97986) [1164 bp, 387 aa] {ON} Anc_1.472
          Length = 387

 Score = 38.1 bits (87), Expect = 0.049,   Method: Compositional matrix adjust.
 Identities = 28/129 (21%), Positives = 55/129 (42%), Gaps = 7/129 (5%)

Query: 174 GEKAYAEDIFLTAGASSAVSYLLNILCKGKESGVLIPIPQYXXXXXXXXXXXXXXXXXXX 233
           G +  A+++ +T GA  A ++LL     GK   V+   P Y                   
Sbjct: 74  GVQFSADNVLVTNGAIGA-NFLLYYTLVGKGDHVICVHPTYSQLYSVPKMFGAEVTLLEL 132

Query: 234 EENSGWSTNMEEIENVVHNAIREKIIPRVLVVINPGNPTGAILSVESIEKIFDVAAHHGI 293
            E   +  N++ ++  +      K   +++++ NP NP G ++S E +  I ++     +
Sbjct: 133 SEKDSFLPNLDTLKKAI------KSNTKLIIINNPNNPLGCVISDELLTSICELCKEKNV 186

Query: 294 VVIADEVYQ 302
            +  DEVY+
Sbjct: 187 YLHCDEVYR 195

>Kwal_23.4888 s23 (907745..908914) [1170 bp, 389 aa] {ON} YIL116W
           (HIS5) - histidinol-phosphate aminotransferase [contig
           5] FULL
          Length = 389

 Score = 38.1 bits (87), Expect = 0.051,   Method: Compositional matrix adjust.
 Identities = 38/168 (22%), Positives = 67/168 (39%), Gaps = 18/168 (10%)

Query: 180 EDIFLTAGASSAVSYLLNILCKGKESGVLIPIPQYXXXXXXXXXXXXXXXXX-XXEENSG 238
           E++ L  G+   +  L+   C   +  +LI  P Y                     E++ 
Sbjct: 88  ENLCLGVGSDECIDALIRACCVPGKDKILIMPPTYGMYSICTDINDVEYVKVPLVVEDNS 147

Query: 239 WSTNMEEIENVVHNAIREKIIPRVLVVINPGNPTGAILSVESIEKIFDVAAHHGIVVIAD 298
           +  + E++   + N    K++     + +PGNPTGA++  E+IEK+       G VV+ D
Sbjct: 148 FQMDTEKVIETLQNDPSIKLV----FITSPGNPTGALIKPENIEKLLS-QWQSGFVVV-D 201

Query: 299 EVYQENIFPGNEFHSMKKVLRDLQRRVPGKYENVQLASLHSTSKGVSG 346
           E Y +    G     +             KY N+ +    S S G++G
Sbjct: 202 EAYIDFCTTGGSVAPLV-----------NKYPNLAVLQTLSKSFGLAG 238

>ZYRO0C06028g Chr3 (457564..459054) [1491 bp, 496 aa] {ON} highly
           similar to uniprot|P53090 Saccharomyces cerevisiae
           YGL202W ARO8 Aromatic aminotransferase expression is
           regulated by general control of amino acid biosynthesis
          Length = 496

 Score = 38.1 bits (87), Expect = 0.054,   Method: Compositional matrix adjust.
 Identities = 23/82 (28%), Positives = 40/82 (48%), Gaps = 9/82 (10%)

Query: 244 EEIENVVHNAIREKIIPRVLVVINPG-NPTGAILSVESIEKIFDVAAHHGIVVIADEVYQ 302
           E++E+++ N       P++L  I  G NPTG  L  +  E I+ +A  H  +++ DE Y 
Sbjct: 190 EKLEDLLDNWTPNAPKPKLLYTIPTGQNPTGTSLPNDRREAIYRIAQKHDFLIVEDEPYY 249

Query: 303 ENIFPGNEFHSMKKVLRDLQRR 324
                   F  +   + DL++R
Sbjct: 250 --------FLQVGDYIEDLKKR 263

>ADL249W Chr4 (261227..262390) [1164 bp, 387 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YIL116W (HIS5)
          Length = 387

 Score = 37.7 bits (86), Expect = 0.054,   Method: Compositional matrix adjust.
 Identities = 52/195 (26%), Positives = 84/195 (43%), Gaps = 22/195 (11%)

Query: 170 RRDGGEKAYAEDIFLTAGASSAVSYLLNILCKGKESGVLIPIPQYXXXXXXXXXXXXXXX 229
           R +G     A++I L  G+  ++  ++   C  +E  V++  P Y               
Sbjct: 78  REEGLAPLTAKNICLGVGSDESIDAIIRATCSPREQKVMLLPPTYGMYKVCADINDVGYV 137

Query: 230 XXXXEENSGWSTNMEEIENVVHNAIREKIIPRVLVVINPGNPTGAILSVESIEKIFDVAA 289
                 +S  S  ++E + ++     +K I +V+ + +PGNPTGA + V  +EK+     
Sbjct: 138 EVPLI-SSDNSFQIDE-DRILEQLNLDKSI-KVVFITSPGNPTGACIEVGRVEKLLR-NW 193

Query: 290 HHGIVVIADEVYQENIFPGNEFHSMKKVLRDLQRRVPGKYENVQLASLHSTSKGVSGECG 349
             GIVV+ DE Y        +F + K  L  L  + P       L  L + SK  SG  G
Sbjct: 194 TAGIVVV-DEAYI-------DFSADKPSLSPLVNKHP------NLVVLQTLSKA-SGLAG 238

Query: 350 QRGGYMELTGFSTEI 364
            R G+   T  ST+I
Sbjct: 239 IRLGF---TFASTQI 250

>CAGL0G06028g Chr7 complement(579261..580874) [1614 bp, 537 aa] {ON}
           similar to uniprot|P38840 Saccharomyces cerevisiae
           YHR137w ARO9 aromatic amino acid aminotransferase II
          Length = 537

 Score = 38.1 bits (87), Expect = 0.056,   Method: Compositional matrix adjust.
 Identities = 18/50 (36%), Positives = 29/50 (58%), Gaps = 1/50 (2%)

Query: 260 PRVLVVINPG-NPTGAILSVESIEKIFDVAAHHGIVVIADEVYQENIFPG 308
           PR+L  I  G NPTG  + +E+  KI+++A  H  +++ D+ Y    FP 
Sbjct: 241 PRILYTICTGQNPTGVTIPMENRRKIYELAHKHNFLILEDDPYGYLSFPS 290

>Kwal_47.18982 s47 complement(1051414..1052904) [1491 bp, 496 aa]
           {ON} YGL202W (ARO8) - 1:1 [contig 188] FULL
          Length = 496

 Score = 38.1 bits (87), Expect = 0.057,   Method: Compositional matrix adjust.
 Identities = 24/82 (29%), Positives = 41/82 (50%), Gaps = 9/82 (10%)

Query: 244 EEIENVVHNAIREKIIPRVLVVINPG-NPTGAILSVESIEKIFDVAAHHGIVVIADEVYQ 302
           E +E ++ N   +   P++L  I  G NPTG+ LS +   +I+ +A  H +++I DE Y 
Sbjct: 194 ERLEAILDNWNPDTAKPKLLYTIPTGQNPTGSSLSDDRKVEIYRIAKKHDLLIIEDEPYY 253

Query: 303 ENIFPGNEFHSMKKVLRDLQRR 324
                   F  M    +D+ +R
Sbjct: 254 --------FLQMDAYQKDVSQR 267

>Kpol_1035.30 s1035 (69909..71414) [1506 bp, 501 aa] {ON}
           (69909..71414) [1506 nt, 502 aa]
          Length = 501

 Score = 37.7 bits (86), Expect = 0.068,   Method: Compositional matrix adjust.
 Identities = 18/43 (41%), Positives = 25/43 (58%), Gaps = 1/43 (2%)

Query: 260 PRVLVVINPG-NPTGAILSVESIEKIFDVAAHHGIVVIADEVY 301
           P VL  I  G NPTG  LS+E   KI+ +   H I+++ D+ Y
Sbjct: 209 PTVLYTIATGQNPTGMTLSMEKRRKIYKICQKHDIIIVEDDPY 251

>SAKL0D11528g Chr4 complement(960867..962018) [1152 bp, 383 aa] {ON}
           weakly similar to uniprot|P47039 Saccharomyces
           cerevisiae YJL060W BNA3 Arylformamidase, involved in
           biosynthesis of nicotinic acid from tryptophan via
           kynurenine pathway; potential Cdc28p substrate
          Length = 383

 Score = 37.4 bits (85), Expect = 0.076,   Method: Compositional matrix adjust.
 Identities = 16/42 (38%), Positives = 28/42 (66%)

Query: 261 RVLVVINPGNPTGAILSVESIEKIFDVAAHHGIVVIADEVYQ 302
           + +V+ NP NP G+++   ++E+I  +A  + I VI DEVY+
Sbjct: 156 KCIVLNNPNNPLGSVIPTATLEEIAALARKNEIRVICDEVYR 197

>YHR137W Chr8 (375709..377250) [1542 bp, 513 aa] {ON}  ARO9Aromatic
           aminotransferase II, catalyzes the first step of
           tryptophan, phenylalanine, and tyrosine catabolism
          Length = 513

 Score = 37.4 bits (85), Expect = 0.084,   Method: Compositional matrix adjust.
 Identities = 40/142 (28%), Positives = 62/142 (43%), Gaps = 20/142 (14%)

Query: 260 PRVLVVINPG-NPTGAILSVESIEKIFDVAAHHGIVVIADEVYQENIFPG--------NE 310
           PRVL  I  G NPTG  +     EKI+ +A  H  +++ D+ Y    FP         N 
Sbjct: 221 PRVLYTIATGQNPTGMSVPQWKREKIYQLAQRHDFLIVEDDPYGYLYFPSYNPQEPLENP 280

Query: 311 FHS----MKKVLRD-LQRRVPGKYENVQLASLHSTSKGVSGECGQRGGYMELTGFSTEIK 365
           +HS     ++ L D L +       + ++  L + SK  +   G R  ++    F   + 
Sbjct: 281 YHSSDLTTERYLNDFLMKSFLTLDTDARVIRLETFSKIFA--PGLRLSFIVANKF---LL 335

Query: 366 HEILKLCSISL-CPVVTGQALV 386
            +IL L  I+   P  T QA+V
Sbjct: 336 QKILDLADITTRAPSGTSQAIV 357

>Smik_7.69 Chr7 (111132..112634) [1503 bp, 500 aa] {ON} YGL202W
           (REAL)
          Length = 500

 Score = 37.4 bits (85), Expect = 0.097,   Method: Compositional matrix adjust.
 Identities = 22/82 (26%), Positives = 38/82 (46%), Gaps = 9/82 (10%)

Query: 244 EEIENVVHNAIREKIIPRVLVVINPG-NPTGAILSVESIEKIFDVAAHHGIVVIADEVYQ 302
           E++  ++ N       P++L  I  G NPTG  ++    E I+ +A  H  +++ DE Y 
Sbjct: 193 EKLAKIMDNWTPNAPKPKLLYTIPTGQNPTGTSIANHRKEAIYKIAQKHDFLIVEDEPYY 252

Query: 303 ENIFPGNEFHSMKKVLRDLQRR 324
                   F  M   ++DL+ R
Sbjct: 253 --------FLQMNPYIKDLKER 266

>Skud_7.69 Chr7 (120729..122231) [1503 bp, 500 aa] {ON} YGL202W
           (REAL)
          Length = 500

 Score = 37.4 bits (85), Expect = 0.098,   Method: Compositional matrix adjust.
 Identities = 22/82 (26%), Positives = 38/82 (46%), Gaps = 9/82 (10%)

Query: 244 EEIENVVHNAIREKIIPRVLVVINPG-NPTGAILSVESIEKIFDVAAHHGIVVIADEVYQ 302
           E++  ++ N       P++L  I  G NPTG  ++    E I+ +A  H  +++ DE Y 
Sbjct: 193 EKLAKIMDNWTAGAPKPKLLYTIPTGQNPTGTSIADHRKEAIYKIAQKHDFIIVEDEPYY 252

Query: 303 ENIFPGNEFHSMKKVLRDLQRR 324
                   F  M   ++DL+ R
Sbjct: 253 --------FLQMNPYIKDLKER 266

>KAFR0D01420 Chr4 (284515..285993) [1479 bp, 492 aa] {ON} Anc_3.511
           YGL202W
          Length = 492

 Score = 37.0 bits (84), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 28/99 (28%), Positives = 47/99 (47%), Gaps = 10/99 (10%)

Query: 244 EEIENVVHNAIREKIIPRVLVVINPG-NPTGAILSVESIEKIFDVAAHHGIVVIADEVYQ 302
           E++  ++ N   E   P++L  I  G NPTG+ L  E   +++ +A  H  +++ DE Y 
Sbjct: 191 EKLAAIMDNWNPETPKPKLLYTIPTGQNPTGSSLDAERKSQVYKIAQKHDFLIVEDEPYY 250

Query: 303 ENIFPGNEFHSMKKVLRDLQRRVPGKYENVQ-LASLHST 340
                   F  M+  ++D   R   K  + + LASL  T
Sbjct: 251 --------FLQMEDYVKDPSLRKEVKLSHDEFLASLDQT 281

>ZYRO0A01672g Chr1 (136284..137444) [1161 bp, 386 aa] {ON} highly
           similar to uniprot|P07172 Saccharomyces cerevisiae
           YIL116W HIS5 Histidinol-phosphate aminotransferase
           catalyzes the seventh step in histidine biosynthesis
           responsive to general control of amino acid biosynthesis
           mutations cause histidine auxotrophy and sensitivity to
           Cu Co and Ni salts
          Length = 386

 Score = 37.0 bits (84), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 30/124 (24%), Positives = 51/124 (41%), Gaps = 7/124 (5%)

Query: 179 AEDIFLTAGASSAVSYLLNILCKGKESGVLIPIPQYXXXXXXXXXXXXXXXXX-XXEENS 237
           AE++ L  G+  ++  ++   C   +  +L+  P Y                      ++
Sbjct: 86  AENLCLGVGSDESIDAIIRACCVPAKEKILVLPPTYSMYSVCAHINDVEIVKCPLITSDN 145

Query: 238 GWSTNMEEIENVVHNAIREKIIPRVLVVINPGNPTGAILSVESIEKIFDVAAHHGIVVIA 297
            +  N +E+     N    K+I     + +PGNPTGA +    IEKI       G+VV+ 
Sbjct: 146 SFQANTDEVIKTAQNDPSIKLI----FITSPGNPTGAKVETSRIEKILQ-NWDRGMVVV- 199

Query: 298 DEVY 301
           DE Y
Sbjct: 200 DEAY 203

>Suva_15.334 Chr15 (578774..580456) [1683 bp, 560 aa] {ON} YHR137W
           (REAL)
          Length = 560

 Score = 37.0 bits (84), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 22/63 (34%), Positives = 31/63 (49%), Gaps = 1/63 (1%)

Query: 246 IENVVHNAIREKIIPRVLVVINPG-NPTGAILSVESIEKIFDVAAHHGIVVIADEVYQEN 304
           +EN      R    PRVL  I  G NPTG  +     EKI+++A  H  +++ D+ Y   
Sbjct: 255 LENWSTGPYRHLNKPRVLYTIATGQNPTGMSVPQWKREKIYELAQRHDFLIVEDDPYGYL 314

Query: 305 IFP 307
            FP
Sbjct: 315 YFP 317

>KLTH0B00176g Chr2 (10791..12137) [1347 bp, 448 aa] {ON} similar to
           uniprot|P10356 Saccharomyces cerevisiae YER152C
           Hypothetical ORF
          Length = 448

 Score = 36.6 bits (83), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 20/61 (32%), Positives = 37/61 (60%), Gaps = 2/61 (3%)

Query: 244 EEIENVVHNAIREKIIPRVLVVINP--GNPTGAILSVESIEKIFDVAAHHGIVVIADEVY 301
           EE  ++++    +K + R ++ + P   NPTGAI S  S  K+ ++A  + I++I+D+VY
Sbjct: 171 EESLDIINAQGGQKKVYRYVIYLVPTYSNPTGAIYSRSSRLKLLELARKYDILIISDDVY 230

Query: 302 Q 302
            
Sbjct: 231 D 231

>NDAI0B03730 Chr2 complement(935131..936291) [1161 bp, 386 aa] {ON}
           Anc_2.252 YIL116W
          Length = 386

 Score = 36.6 bits (83), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 30/124 (24%), Positives = 57/124 (45%), Gaps = 7/124 (5%)

Query: 179 AEDIFLTAGASSAVSYLLNILC-KGKESGVLIPIPQYXXXXXXXXXXXXXXXXXXXEENS 237
           +E++ L  G+  ++  ++   C  GKE  +++P                        +N+
Sbjct: 88  SENLCLGVGSDESIDAIIRATCVPGKEKILVLPPTYSMYSVCAEINDIEIVECPLLYKNN 147

Query: 238 GWSTNMEEIENVVHNAIREKIIPRVLVVINPGNPTGAILSVESIEKIFDVAAHHGIVVIA 297
            +  + E +  V+ N   + +I ++L + +PGNPTGA +  E IE +       G+VV+ 
Sbjct: 148 SFQMDTESVLTVLQN---DPLI-KLLFITSPGNPTGARIETERIETVLQ-NWTDGLVVV- 201

Query: 298 DEVY 301
           DE Y
Sbjct: 202 DEAY 205

>Suva_7.61 Chr7 (112022..113524) [1503 bp, 500 aa] {ON} YGL202W
           (REAL)
          Length = 500

 Score = 36.6 bits (83), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 22/82 (26%), Positives = 38/82 (46%), Gaps = 9/82 (10%)

Query: 244 EEIENVVHNAIREKIIPRVLVVINPG-NPTGAILSVESIEKIFDVAAHHGIVVIADEVYQ 302
           E++  ++ N       P++L  I  G NPTG  ++    E I+ +A  H  +++ DE Y 
Sbjct: 193 EKLAKIMDNWTPGAPKPKLLYTIPTGQNPTGTSIADHRKEAIYKIAQKHDFLIVEDEPYY 252

Query: 303 ENIFPGNEFHSMKKVLRDLQRR 324
                   F  M   ++DL+ R
Sbjct: 253 --------FLQMNAYIKDLKER 266

>Smik_5.319 Chr5 complement(477840..479171) [1332 bp, 443 aa] {ON}
           YER152C (REAL)
          Length = 443

 Score = 36.6 bits (83), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 22/64 (34%), Positives = 36/64 (56%), Gaps = 3/64 (4%)

Query: 253 AIREKIIPRVLVVI-NPGNPTGAILSVESIEKIFDVAAHHGIVVIADEVYQ--ENIFPGN 309
           A+ +KI   VL  I    NP+G   S+E+  ++ D+A  + ++VI+D+VY   +   P N
Sbjct: 178 ALTKKIYKYVLYCIPTFANPSGNTYSLETRRRLIDIARKYDMLVISDDVYDILDYTTPSN 237

Query: 310 EFHS 313
           E  S
Sbjct: 238 ELAS 241

>KLTH0G19624g Chr7 complement(1697587..1698993) [1407 bp, 468 aa]
           {ON} similar to uniprot|P10356 Saccharomyces cerevisiae
           YER152C Hypothetical ORF
          Length = 468

 Score = 36.6 bits (83), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 21/61 (34%), Positives = 36/61 (59%), Gaps = 2/61 (3%)

Query: 244 EEIENVVHNAIREKIIPRVLVVINP--GNPTGAILSVESIEKIFDVAAHHGIVVIADEVY 301
           EE   +++    +K I R ++ + P   NPTGAI S  S  K+ ++A  + I++I+D+VY
Sbjct: 170 EESLRIINAQDGKKKIYRYVIYLVPTYSNPTGAIYSRSSRLKLLELARKYDILIISDDVY 229

Query: 302 Q 302
            
Sbjct: 230 D 230

>KAFR0A01710 Chr1 complement(348198..349505) [1308 bp, 435 aa] {ON}
           Anc_1.321 YJL060W
          Length = 435

 Score = 36.2 bits (82), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 49/234 (20%), Positives = 91/234 (38%), Gaps = 36/234 (15%)

Query: 261 RVLVVINPGNPTGAILSVESIEKIFDVAAHHGIVVIADEVYQENIFPGNEFHSMKKVLRD 320
           + +++  P NP G + +   + ++ D+   + +V+I+DEVY+   F            +D
Sbjct: 191 KAIIINTPHNPIGKVFTEPELRRLGDICVKNNVVIISDEVYEHLYF------------KD 238

Query: 321 LQRRVPGKYENVQLASLHSTSKGVS-GECGQRGGY-----MELTGFSTEIKHEILKLCSI 374
              R+      +   +L   S G S    G R G+      EL  ++ +    I   C  
Sbjct: 239 SFTRIATLSPEIGQLTLTVGSAGKSFAATGWRIGWALSLNQELLSYAAKAHTRI---CFA 295

Query: 375 SLCPVVTGQALVDLMTCPPKKGEASYEQDQMERSTIHSELYERATYLWKAFNEMEGVSCQ 434
           S  P+   +A+ +      K       + Q  R       YE  T      NE+ G+   
Sbjct: 296 SPSPL--QEAVANAFNDAEKVEYFKETRLQYIRK------YEIFT---NVLNEL-GLPYT 343

Query: 435 KPQGSMYL---FPKIDIPHKALEKAQELDITPDELYCAELLEATGICTVPGSGF 485
           +P+G+ ++   F K+ IP       + L+   D      L+   G+  +P + F
Sbjct: 344 EPEGTYFILVNFSKVKIPPDYKYPEELLNKAKDFRISYWLMNELGVVAIPPTEF 397

>Kpol_480.1 s480 (215..1357) [1143 bp, 380 aa] {ON} (215..1357)
           [1143 nt, 381 aa]
          Length = 380

 Score = 35.4 bits (80), Expect = 0.31,   Method: Compositional matrix adjust.
 Identities = 25/123 (20%), Positives = 56/123 (45%), Gaps = 7/123 (5%)

Query: 180 EDIFLTAGASSAVSYLLNILCKGKESGVLIPIPQYXXXXXXXXXXXXXXXXXXXEENSGW 239
           +DI LT GA  A ++L      G    V+   P Y                   ++   +
Sbjct: 79  DDILLTNGAIGA-NFLAFYTLVGAGDHVICVEPTYSQLYSVPEMFGAEVDLLTLKKEDDF 137

Query: 240 STNMEEIENVVHNAIREKIIPRVLVVINPGNPTGAILSVESIEKIFDVAAHHGIVVIADE 299
             N++ +++++ N  +      ++++ NP NP G+++  + +++I  +   + I + +DE
Sbjct: 138 LPNLQTLKSMIKNNTK------LIIINNPNNPLGSVIKKDLLKQICKLCEENDIYLHSDE 191

Query: 300 VYQ 302
           VY+
Sbjct: 192 VYR 194

>Kwal_8.585 s8 (15757..17097) [1341 bp, 446 aa] {ON} YER152C -
           Hypothetical ORF [contig 311] FULL
          Length = 446

 Score = 35.4 bits (80), Expect = 0.33,   Method: Compositional matrix adjust.
 Identities = 21/67 (31%), Positives = 36/67 (53%), Gaps = 2/67 (2%)

Query: 249 VVHNAIREKIIPRVLVVINP--GNPTGAILSVESIEKIFDVAAHHGIVVIADEVYQENIF 306
           +++ A  +K   R ++ + P   NP+GA  S E   K+ D+A  + I++I+D+VY    F
Sbjct: 177 IINAADDKKKFYRYVIYLVPTFSNPSGATYSQECRLKLLDLARRYDILIISDDVYDLLGF 236

Query: 307 PGNEFHS 313
            G    S
Sbjct: 237 HGQRTDS 243

>Skud_8.198 Chr8 (349159..350712) [1554 bp, 517 aa] {ON} YHR137W
           (REAL)
          Length = 517

 Score = 35.4 bits (80), Expect = 0.33,   Method: Compositional matrix adjust.
 Identities = 19/49 (38%), Positives = 26/49 (53%), Gaps = 1/49 (2%)

Query: 260 PRVLVVINPG-NPTGAILSVESIEKIFDVAAHHGIVVIADEVYQENIFP 307
           PRVL  I  G NPTG  +     EKI+ +A  H  +++ D+ Y    FP
Sbjct: 221 PRVLYTIATGQNPTGMSVPQWKREKIYRLAQKHDFLIVEDDPYGYLYFP 269

>TPHA0F01260 Chr6 complement(290133..291311) [1179 bp, 392 aa] {ON}
           Anc_2.252 YIL116W
          Length = 392

 Score = 35.0 bits (79), Expect = 0.38,   Method: Compositional matrix adjust.
 Identities = 27/86 (31%), Positives = 46/86 (53%), Gaps = 4/86 (4%)

Query: 261 RVLVVINPGNPTGAILSVESIEKIFDVAAHHGIVVIADEVYQENIFPGNEFHSMKKVLRD 320
           R+L + +PGNPTG I++++ I  + +    +G+VV+ DE Y +     NE    KK    
Sbjct: 163 RLLFITSPGNPTGKIIAIKDIIYVLE-HWKNGLVVV-DEAYVDFSTYFNE--ETKKTEYF 218

Query: 321 LQRRVPGKYENVQLASLHSTSKGVSG 346
              ++  KY N+ +    S S G++G
Sbjct: 219 SVAKLVTKYPNLTVLQTLSKSFGLAG 244

>YGL202W Chr7 (116059..117561) [1503 bp, 500 aa] {ON}  ARO8Aromatic
           aminotransferase I, expression is regulated by general
           control of amino acid biosynthesis
          Length = 500

 Score = 35.0 bits (79), Expect = 0.42,   Method: Compositional matrix adjust.
 Identities = 22/82 (26%), Positives = 38/82 (46%), Gaps = 9/82 (10%)

Query: 244 EEIENVVHNAIREKIIPRVLVVINPG-NPTGAILSVESIEKIFDVAAHHGIVVIADEVYQ 302
           E++  V+ N       P++L  I  G NPTG  ++    E I+ +A  +  +++ DE Y 
Sbjct: 193 EKLAKVMENWTPGAPKPKLLYTIPTGQNPTGTSIADHRKEAIYKIAQKYDFLIVEDEPYY 252

Query: 303 ENIFPGNEFHSMKKVLRDLQRR 324
                   F  M   ++DL+ R
Sbjct: 253 --------FLQMNPYIKDLKER 266

>ZYRO0G05346g Chr7 complement(430373..431887) [1515 bp, 504 aa] {ON}
           similar to uniprot|P38840 Saccharomyces cerevisiae
           YHR137W ARO9 Aromatic aminotransferase catalyzes the
           first step of tryptophan phenylalanine and tyrosine
           catabolism
          Length = 504

 Score = 35.0 bits (79), Expect = 0.42,   Method: Compositional matrix adjust.
 Identities = 16/49 (32%), Positives = 26/49 (53%), Gaps = 1/49 (2%)

Query: 260 PRVLVVINPG-NPTGAILSVESIEKIFDVAAHHGIVVIADEVYQENIFP 307
           P+ L  +  G NPTG  LS     +I+++A  H  +++ D+ Y    FP
Sbjct: 208 PKALYTVATGQNPTGMTLSPTKRRRIYEIAQKHDFLIVEDDPYGYLFFP 256

>KLLA0D11110g Chr4 (948248..949840) [1593 bp, 530 aa] {ON} similar
           to uniprot|P38840 Saccharomyces cerevisiae YHR137W ARO9
           Aromatic aminotransferase catalyzes the first step of
           tryptophan phenylalanine and tyrosine catabolism
          Length = 530

 Score = 35.0 bits (79), Expect = 0.43,   Method: Compositional matrix adjust.
 Identities = 17/43 (39%), Positives = 25/43 (58%), Gaps = 1/43 (2%)

Query: 260 PRVLVVINPG-NPTGAILSVESIEKIFDVAAHHGIVVIADEVY 301
           PR+L  I  G NPTG     E  +KI+D+   H I+++ D+ Y
Sbjct: 245 PRLLYTIVTGQNPTGMTQCKEKRQKIYDLCEKHDIIIVEDDPY 287

>Smik_8.218 Chr8 (352556..354097) [1542 bp, 513 aa] {ON} YHR137W
           (REAL)
          Length = 513

 Score = 35.0 bits (79), Expect = 0.45,   Method: Compositional matrix adjust.
 Identities = 63/254 (24%), Positives = 99/254 (38%), Gaps = 42/254 (16%)

Query: 260 PRVLVVINPG-NPTGAILSVESIEKIFDVAAHHGIVVIADEVYQENIFPG--------NE 310
           P+VL  I  G NPTG  +     EKI+ +A  H  +++ D+ Y    FP         N 
Sbjct: 221 PKVLYTIATGQNPTGMSVPRWKREKIYQLAQKHDFLIVEDDPYGYMYFPSYNPQNPLENP 280

Query: 311 FHS----MKKVLRD-LQRRVPGKYENVQLASLHSTSKGVSGECGQRGGYMELTGFSTEIK 365
           + S    +++ L D L +       + ++  L + SK  +   G R  ++    F   + 
Sbjct: 281 YDSSDLTIERYLNDFLMKSFLTLDTDARVIRLETFSKIFAP--GLRLSFIVANKF---LL 335

Query: 366 HEILKLCSISL-CPVVTGQALVDLMTCPPKKGEASYE---QDQMERSTIH------SELY 415
            +IL L  I+   P  T QA+V        + E S     +D M  S I       S+  
Sbjct: 336 QKILDLADITTRAPSGTSQAIVYSTIKAMAESEMSSSVSFRDAMFESWIKWIMQIASKYN 395

Query: 416 ERATYLWKAFNEMEG-----VSCQKPQGSMYLFPKID--IPHKALEKAQELDITPDELYC 468
            R     KA  E E       +  +P   M++  K+D  I  +     Q++DI       
Sbjct: 396 HRKNVTLKALYETESYQAGHFTVMEPSAGMFIIIKLDWGIFDRPDNLPQQMDI------L 449

Query: 469 AELLEATGICTVPG 482
            E L   G+  V G
Sbjct: 450 DEFLVKNGVKLVLG 463

>TDEL0A01600 Chr1 (289263..290690) [1428 bp, 475 aa] {ON} Anc_8.204
           YER152C
          Length = 475

 Score = 35.0 bits (79), Expect = 0.46,   Method: Compositional matrix adjust.
 Identities = 35/110 (31%), Positives = 51/110 (46%), Gaps = 10/110 (9%)

Query: 253 AIREKIIPRVLVVI-NPGNPTGAILSVESIEKIFDVAAHHGIVVIADEVYQENIF--PGN 309
           A+ +KI   V+  I    NPTG   S E+  K+ ++A  + +++IAD+VY    F  P +
Sbjct: 184 AVPKKIYKYVIYCIPTYSNPTGTTYSTETKLKLIEIARKYDMLIIADDVYDMLDFSPPFD 243

Query: 310 EFHSMKKVLRDLQRRV---PGKYENVQLASLHSTSKGVSGECGQRGGYME 356
                KK    L R     P  Y N    S  + SK ++   G R GY E
Sbjct: 244 NLPQPKKRFVHLDRETNNDPESYGNT--ISNATFSKLIA--PGLRFGYHE 289

>YIL116W Chr9 (142928..144085) [1158 bp, 385 aa] {ON}
           HIS5Histidinol-phosphate aminotransferase, catalyzes the
           seventh step in histidine biosynthesis; responsive to
           general control of amino acid biosynthesis; mutations
           cause histidine auxotrophy and sensitivity to Cu, Co,
           and Ni salts
          Length = 385

 Score = 34.7 bits (78), Expect = 0.52,   Method: Compositional matrix adjust.
 Identities = 31/125 (24%), Positives = 59/125 (47%), Gaps = 9/125 (7%)

Query: 179 AEDIFLTAGASSAVSYLLNILC-KGKESGVLIPIPQYXXXXXXXXXXXXXXXXXXXEENS 237
           A+++ L  G+  ++  ++   C  GKE  +++P P Y                     + 
Sbjct: 87  ADNLCLGVGSDESIDAIIRACCVPGKEKILVLP-PTYSMYSVCANINDIEVVQCPLTVSD 145

Query: 238 G-WSTNMEEIENVVHNAIREKIIPRVLVVINPGNPTGAILSVESIEKIFDVAAHHGIVVI 296
           G +  + E +  ++ N   + +I +++ V +PGNPTGA +    IEK+      +G+VV+
Sbjct: 146 GSFQMDTEAVLTILKN---DSLI-KLMFVTSPGNPTGAKIKTSLIEKVLQ-NWDNGLVVV 200

Query: 297 ADEVY 301
            DE Y
Sbjct: 201 -DEAY 204

>KNAG0G01680 Chr7 complement(369892..371250) [1359 bp, 452 aa] {ON}
           Anc_8.204 YER152C
          Length = 452

 Score = 34.7 bits (78), Expect = 0.67,   Method: Compositional matrix adjust.
 Identities = 13/34 (38%), Positives = 24/34 (70%)

Query: 269 GNPTGAILSVESIEKIFDVAAHHGIVVIADEVYQ 302
            NP+G   S+E+ +K+ D+A  + +++IAD+VY 
Sbjct: 205 ANPSGMSFSLETKKKLLDLARKYDMLIIADDVYD 238

>KNAG0E01850 Chr5 (381827..382981) [1155 bp, 384 aa] {ON} Anc_2.252
           YIL116W
          Length = 384

 Score = 34.3 bits (77), Expect = 0.74,   Method: Compositional matrix adjust.
 Identities = 27/122 (22%), Positives = 53/122 (43%), Gaps = 7/122 (5%)

Query: 181 DIFLTAGASSAVSYLLNILCKGKESGVLIPIPQYXXXXXXXXXXXXXXXXX-XXEENSGW 239
           +I L  G+  ++  ++   C      +L+  P Y                     E++ +
Sbjct: 89  NICLGVGSDESIDAIIRATCVPAREKILVLPPTYSMYSVCAKINDVEVVTCPLITEDNSF 148

Query: 240 STNMEEIENVVHNAIREKIIPRVLVVINPGNPTGAILSVESIEKIFDVAAHHGIVVIADE 299
             + +++ ++++N    K+    L + +PGNPTGA +    IEK+       G+VV+ DE
Sbjct: 149 QMDSDKVLDILNNDQEIKL----LFITSPGNPTGAQIETARIEKVLQ-NWDRGLVVV-DE 202

Query: 300 VY 301
            Y
Sbjct: 203 AY 204

>TDEL0C04090 Chr3 complement(722310..723461) [1152 bp, 383 aa] {ON}
           Anc_2.252 YIL116W
          Length = 383

 Score = 33.9 bits (76), Expect = 0.89,   Method: Compositional matrix adjust.
 Identities = 28/124 (22%), Positives = 54/124 (43%), Gaps = 7/124 (5%)

Query: 179 AEDIFLTAGASSAVSYLLNILC-KGKESGVLIPIPQYXXXXXXXXXXXXXXXXXXXEENS 237
           AE++ L  G+  ++  ++   C  GKE  + +P                         ++
Sbjct: 84  AENLCLGVGSDESIDAIIRATCVPGKEKIMAMPPTYGMYSVCASVNDVEIVKCPLVTSDN 143

Query: 238 GWSTNMEEIENVVHNAIREKIIPRVLVVINPGNPTGAILSVESIEKIFDVAAHHGIVVIA 297
            +  + E     V + +++  + +++ + +PGNPTGA +    IEKI       GI+V+ 
Sbjct: 144 SFQVDTE----AVLDTLKKDPLIKLVFITSPGNPTGAKIETSRIEKILQ-NWDQGILVV- 197

Query: 298 DEVY 301
           DE Y
Sbjct: 198 DEAY 201

>NCAS0B06440 Chr2 complement(1218759..1219916) [1158 bp, 385 aa]
           {ON} Anc_2.252 YIL116W
          Length = 385

 Score = 33.5 bits (75), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 26/123 (21%), Positives = 58/123 (47%), Gaps = 7/123 (5%)

Query: 180 EDIFLTAGASSAVSYLLNILCKGKESGVLIPIPQYXXXXXXXXXXXXXXXXX-XXEENSG 238
           E++ L  G+  ++  ++   C   +  +L+  P Y                     E++ 
Sbjct: 88  ENLCLGVGSDESIDAIIRACCVPAKEKILVLPPTYSMYSVCANINDIEVVECPLIYEDNS 147

Query: 239 WSTNMEEIENVVHNAIREKIIPRVLVVINPGNPTGAILSVESIEKIFDVAAHHGIVVIAD 298
           +  N +++ +++ N   + +I +++ + +PGNPTG  +  + IEK+      +G+VV+ D
Sbjct: 148 FQLNSDKVLDILKN---DPLI-KLVFITSPGNPTGVKIETKRIEKVLQ-NWDNGLVVV-D 201

Query: 299 EVY 301
           E Y
Sbjct: 202 EAY 204

>Smik_9.53 Chr9 (120672..121838) [1167 bp, 388 aa] {ON} YIL116W
           (REAL)
          Length = 388

 Score = 33.5 bits (75), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 28/124 (22%), Positives = 57/124 (45%), Gaps = 7/124 (5%)

Query: 179 AEDIFLTAGASSAVSYLLNILC-KGKESGVLIPIPQYXXXXXXXXXXXXXXXXXXXEENS 237
           A+++ L  G+  ++  ++   C  GKE  +++P                         ++
Sbjct: 87  ADNLCLGVGSDESIDAIIRACCVPGKEKILVLPPTYSMYSVCANINDVEVVQCPLTVSDN 146

Query: 238 GWSTNMEEIENVVHNAIREKIIPRVLVVINPGNPTGAILSVESIEKIFDVAAHHGIVVIA 297
            +  N E +  +++N   + +I +++   +PGNPTGA +    IE++      +GIVV+ 
Sbjct: 147 SFQMNTEAVLTILNN---DPLI-KIMFATSPGNPTGAKIKTCLIEEVLQ-KWDNGIVVV- 200

Query: 298 DEVY 301
           DE Y
Sbjct: 201 DEAY 204

>KLTH0E07678g Chr5 (702610..704088) [1479 bp, 492 aa] {ON} similar
           to uniprot|P53090 Saccharomyces cerevisiae YGL202W ARO8
           Aromatic aminotransferase expression is regulated by
           general control of amino acid biosynthesis
          Length = 492

 Score = 33.5 bits (75), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 30/122 (24%), Positives = 47/122 (38%), Gaps = 2/122 (1%)

Query: 181 DIFLTAGASSAVSYLLNILCKGKESGVLIPIPQYXXXXXXXXXXXXXXXXXXXEENSGWS 240
           DI  T G++      L I C  K   VL+    Y                   +      
Sbjct: 132 DIITTTGSTQGWDASLRIFCN-KGDTVLLEDYTYSSSVEAADAQGLNCVPMPLDGEGIVP 190

Query: 241 TNMEEIENVVHNAIREKIIPRVLVVINPG-NPTGAILSVESIEKIFDVAAHHGIVVIADE 299
           + +EE+     +   E  +P++L  I  G NPTG  LS      I+ +A  + I++I D+
Sbjct: 191 SKLEEMLANWSSLYGEMPMPKLLYTIPTGQNPTGCTLSDNRKPHIYRLAQQYDIIIIEDD 250

Query: 300 VY 301
            Y
Sbjct: 251 PY 252

>TDEL0D05790 Chr4 complement(1045218..1046711) [1494 bp, 497 aa]
           {ON} Anc_3.511 YGL202W
          Length = 497

 Score = 33.5 bits (75), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 22/82 (26%), Positives = 39/82 (47%), Gaps = 9/82 (10%)

Query: 244 EEIENVVHNAIREKIIPRVLVVINPG-NPTGAILSVESIEKIFDVAAHHGIVVIADEVYQ 302
           E++E ++         P++L  I  G NPTG  L+ +  ++I+ +A  H  ++I DE Y 
Sbjct: 190 EKLEKILDEWTPGAPRPKLLYTIPTGQNPTGTSLADDRKKEIYRIAQKHDFLIIEDEPYY 249

Query: 303 ENIFPGNEFHSMKKVLRDLQRR 324
                   F  M   + D+ +R
Sbjct: 250 --------FLQMDPYVEDVGKR 263

>KAFR0J01580 Chr10 complement(287313..288464) [1152 bp, 383 aa] {ON}
           Anc_2.252 YIL116W
          Length = 383

 Score = 33.1 bits (74), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 27/123 (21%), Positives = 56/123 (45%), Gaps = 7/123 (5%)

Query: 180 EDIFLTAGASSAVSYLLNILCKGKESGVLIPIPQYXXXXXXXXXXXXXXXXX-XXEENSG 238
           E+  L  G+  ++  ++   C   +  +L+  P Y                     E++ 
Sbjct: 87  ENFCLGVGSDESIDAIIRASCVPSKEKILVLPPTYSMYSVCANINDVDVVTCPLITEDNS 146

Query: 239 WSTNMEEIENVVHNAIREKIIPRVLVVINPGNPTGAILSVESIEKIFDVAAHHGIVVIAD 298
           +  +  EI N++ N   + +I +++ + +PGNPTGA + ++ IE +       G+V++ D
Sbjct: 147 FQIDATEILNILAN---DPLI-KLVFITSPGNPTGAKIEIDRIEYLLK-NWDQGLVIV-D 200

Query: 299 EVY 301
           E Y
Sbjct: 201 EAY 203

>Skud_5.290 Chr5 complement(463643..464974) [1332 bp, 443 aa] {ON}
           YER152C (REAL)
          Length = 443

 Score = 33.1 bits (74), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 26/106 (24%), Positives = 48/106 (45%), Gaps = 3/106 (2%)

Query: 254 IREKIIPRVLVVINP-GNPTGAILSVESIEKIFDVAAHHGIVVIADEVYQ--ENIFPGNE 310
           + +KI   V+  I    NP+G   S+E+  ++ D+A  + ++VI D+VY   +   P +E
Sbjct: 179 LSKKIFKYVMYCIPTFANPSGNTYSLETRRRLIDIARQYDMLVITDDVYDILDYTTPADE 238

Query: 311 FHSMKKVLRDLQRRVPGKYENVQLASLHSTSKGVSGECGQRGGYME 356
             S    +  + R      E+    ++ + +       G R GY E
Sbjct: 239 LPSPPLRMVHIDRSTAASSEDSFGNTVSNATFSKLIAPGLRFGYHE 284

>Suva_9.78 Chr9 (137747..138907) [1161 bp, 386 aa] {ON} YIL116W
           (REAL)
          Length = 386

 Score = 32.7 bits (73), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 27/124 (21%), Positives = 58/124 (46%), Gaps = 7/124 (5%)

Query: 179 AEDIFLTAGASSAVSYLLNILC-KGKESGVLIPIPQYXXXXXXXXXXXXXXXXXXXEENS 237
           A+++ L  G+  ++  ++   C  GKE  +++P                         ++
Sbjct: 87  ADNLCLGVGSDESIDAIIRACCVPGKEKILVLPPTYSMYSVCANINDIEVVQCPLVVSDN 146

Query: 238 GWSTNMEEIENVVHNAIREKIIPRVLVVINPGNPTGAILSVESIEKIFDVAAHHGIVVIA 297
            +  ++E +  ++ N   + +I +++ V +PGNPTGA +    IE++      +G+VV+ 
Sbjct: 147 SFQMDVEAVLTILEN---DPLI-KLVFVTSPGNPTGAKIKTSLIEQVLQ-NWQNGLVVV- 200

Query: 298 DEVY 301
           DE Y
Sbjct: 201 DEAY 204

>AFR548C Chr6 complement(1422283..1423776) [1494 bp, 497 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YGL202W
           (ARO8)
          Length = 497

 Score = 32.7 bits (73), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 19/68 (27%), Positives = 32/68 (47%), Gaps = 9/68 (13%)

Query: 260 PRVLVVINPG-NPTGAILSVESIEKIFDVAAHHGIVVIADEVYQENIFPGNEFHSMKKVL 318
           P++L  +  G NPTG  LS +  + ++ +A  H ++++ DE Y         F  +    
Sbjct: 210 PKLLYTVPTGQNPTGTCLSNDRRQAVYRLAQQHDLLIVEDEPYY--------FLQLDPYE 261

Query: 319 RDLQRRVP 326
            D  RR P
Sbjct: 262 ADAGRRAP 269

>NDAI0B05010 Chr2 complement(1222173..1224368) [2196 bp, 731 aa]
           {ON} Anc_1.285 YJL082W
          Length = 731

 Score = 32.0 bits (71), Expect = 4.1,   Method: Compositional matrix adjust.
 Identities = 24/76 (31%), Positives = 35/76 (46%), Gaps = 5/76 (6%)

Query: 364 IKHEILKLCSISLCPVVTGQALVDLMTCPP----KKGEASYEQDQMERSTIHSELYERAT 419
           IK+ +L L    L  V  G  L+D    P     + G+  Y +   +     + LYERA 
Sbjct: 623 IKNILLSLVFRRLGDVQEGADLLDKKVLPKIFSLQNGKVKYAKKTEDPWAYPTALYERAL 682

Query: 420 YLWKAFNEMEGVSCQK 435
           + WK  N MEG++  K
Sbjct: 683 FSWK-LNGMEGIAESK 697

>YER152C Chr5 complement(472657..473988) [1332 bp, 443 aa] {ON}
           Protein with 2-aminoadipate transaminase activity;
           shares amino acid similarity with the aminotransferases
           Aro8p and Aro9p; YER152C is not an essential gene
          Length = 443

 Score = 32.0 bits (71), Expect = 4.3,   Method: Compositional matrix adjust.
 Identities = 11/34 (32%), Positives = 22/34 (64%)

Query: 269 GNPTGAILSVESIEKIFDVAAHHGIVVIADEVYQ 302
            NP+G   S+E+  ++ D+A  + +++I D+VY 
Sbjct: 195 ANPSGNTYSLETRRRLIDIARKYDMLIITDDVYD 228

>KLLA0E00969g Chr5 (101430..102767) [1338 bp, 445 aa] {ON} similar
           to uniprot|P10356 Saccharomyces cerevisiae YER152C
           Hypothetical ORF
          Length = 445

 Score = 32.0 bits (71), Expect = 4.3,   Method: Compositional matrix adjust.
 Identities = 14/47 (29%), Positives = 29/47 (61%), Gaps = 2/47 (4%)

Query: 257 KIIPRVLVVINP--GNPTGAILSVESIEKIFDVAAHHGIVVIADEVY 301
           K + R ++ + P   NP G   S+E+  K+ ++A  H +++++D+VY
Sbjct: 182 KKVYRYVIYLVPTYSNPGGQTYSLETRVKLIELARKHDMLIVSDDVY 228

>SAKL0H18612g Chr8 (1655787..1657124) [1338 bp, 445 aa] {ON} highly
           similar to gnl|GLV|KLLA0E00935g Kluyveromyces lactis
           KLLA0E00935g and similar to YER152C uniprot|P10356
           Saccharomyces cerevisiae YER152C Hypothetical ORF
          Length = 445

 Score = 32.0 bits (71), Expect = 4.3,   Method: Compositional matrix adjust.
 Identities = 16/48 (33%), Positives = 28/48 (58%), Gaps = 1/48 (2%)

Query: 256 EKIIPRVLVVI-NPGNPTGAILSVESIEKIFDVAAHHGIVVIADEVYQ 302
           +KI   VL  +    NP G   ++E+  K+ D+A  H +++I+D+VY 
Sbjct: 183 KKIYKYVLYFVPTYSNPGGKTYNLETRLKLIDLARKHDMLIISDDVYD 230

>Skud_9.55 Chr9 (119747..120904) [1158 bp, 385 aa] {ON} YIL116W
           (REAL)
          Length = 385

 Score = 31.6 bits (70), Expect = 4.5,   Method: Compositional matrix adjust.
 Identities = 30/124 (24%), Positives = 53/124 (42%), Gaps = 7/124 (5%)

Query: 179 AEDIFLTAGASSAVSYLLNILC-KGKESGVLIPIPQYXXXXXXXXXXXXXXXXXXXEENS 237
           A+++ L  G+  ++  ++   C  GKE  +++P                         ++
Sbjct: 87  ADNLCLGVGSDESIDAIIRACCVPGKEKILVLPPTYSMYSVCANINDVEVVQCPLTVSDN 146

Query: 238 GWSTNMEEIENVVHNAIREKIIPRVLVVINPGNPTGAILSVESIEKIFDVAAHHGIVVIA 297
            +  + E    ++ N    K+I     V +PGNPTGA +    IEKI      +G+VV+ 
Sbjct: 147 SFQMDTEAALTILKNDPLIKLI----FVTSPGNPTGAKIKTCLIEKILQ-NWENGLVVV- 200

Query: 298 DEVY 301
           DE Y
Sbjct: 201 DEAY 204

>KNAG0H03730 Chr8 (690872..692443) [1572 bp, 523 aa] {ON} Anc_2.102
           YHR137W
          Length = 523

 Score = 32.0 bits (71), Expect = 4.6,   Method: Compositional matrix adjust.
 Identities = 13/37 (35%), Positives = 21/37 (56%)

Query: 265 VINPGNPTGAILSVESIEKIFDVAAHHGIVVIADEVY 301
           V+   NPTG  LS E   +I+ +A  H  +++ D+ Y
Sbjct: 248 VVTGQNPTGVSLSYEKRRQIYALAQRHNFIIVEDDPY 284

>NDAI0C05960 Chr3 complement(1365183..1366619) [1437 bp, 478 aa]
           {ON} Anc_8.204 YER152C
          Length = 478

 Score = 31.6 bits (70), Expect = 4.9,   Method: Compositional matrix adjust.
 Identities = 16/48 (33%), Positives = 30/48 (62%), Gaps = 1/48 (2%)

Query: 256 EKIIPRVLVVI-NPGNPTGAILSVESIEKIFDVAAHHGIVVIADEVYQ 302
           +KI   VL  + +  NP+G   S+++  K+ D+A  + I++I D+VY+
Sbjct: 211 KKIYKYVLYCVPSFANPSGKSYSLKTKRKLIDLACLYDILIITDDVYE 258

>KLTH0B06182g Chr2 (500939..502024) [1086 bp, 361 aa] {ON} similar
           to uniprot|P53183 Saccharomyces cerevisiae YGL039W and
           similar to uniprot|Q12068 Saccharomyces cerevisiae
           YOL151W GRE2
          Length = 361

 Score = 31.6 bits (70), Expect = 5.1,   Method: Compositional matrix adjust.
 Identities = 21/51 (41%), Positives = 30/51 (58%), Gaps = 1/51 (1%)

Query: 17  ALSGKRLLSLTTISLKHKNFKPADKLTINDLNENVLKAKYAVRGKIPARAE 67
           AL+G+RL  L   SLK  N++ A + T+  + E + K    VRGKI A A+
Sbjct: 264 ALAGQRLFPLNGTSLKQHNYEDA-RYTLQRILEILNKQFPEVRGKISAGAD 313

>ZYRO0B06688g Chr2 complement(535548..537329) [1782 bp, 593 aa] {ON}
           similar to uniprot|P30606 Saccharomyces cerevisiae
           YOL103W ITR2 Myo-inositol transporter with strong
           similarity to the major myo-inositol transporter Itr1p,
           member of the sugar transporter superfamily; expressed
           constitutively and similar to YDR497C uniprot|P30605
           Saccharomyces cerevisiae YDR497C ITR1 Myo-inositol
           transporter with strong similarity to the minor myo-
           inositol transporter Itr2p, member of the sugar
           transporter superfamily; expression is repressed by
           inositol and choline via Opi1p and derepressed via Ino2p
           and Ino4p
          Length = 593

 Score = 31.2 bits (69), Expect = 7.1,   Method: Compositional matrix adjust.
 Identities = 13/39 (33%), Positives = 22/39 (56%)

Query: 309 NEFHSMKKVLRDLQRRVPGKYENVQLASLHSTSKGVSGE 347
           N+  S +KVLR   RR P +  + ++  LH  + G+ G+
Sbjct: 285 NDVESARKVLRRTYRRAPDRVIDAKVKELHELNDGIDGK 323

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.317    0.134    0.392 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 51,480,933
Number of extensions: 2108954
Number of successful extensions: 5582
Number of sequences better than 10.0: 131
Number of HSP's gapped: 5652
Number of HSP's successfully gapped: 131
Length of query: 522
Length of database: 53,481,399
Length adjustment: 114
Effective length of query: 408
Effective length of database: 40,409,475
Effective search space: 16487065800
Effective search space used: 16487065800
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 68 (30.8 bits)