Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
TPHA0J007408.262ON40840821730.0
Kpol_392.68.262ON4573725862e-70
Kpol_543.388.262ON4423465016e-58
SAKL0H17028g8.262ON5503975061e-57
Ecym_43088.262ON5293725031e-57
Kwal_56.237998.262ON4883514897e-56
TDEL0F038908.262ON4763974852e-55
KAFR0B055408.262ON5193634812e-54
AGR086C8.262ON5343364752e-53
ZYRO0C01650g8.262ON5863604755e-53
Smik_4.3568.262ON5763834544e-50
YDR110W (FOB1)8.262ON5663834464e-49
KLTH0G13684g8.262ON5083494418e-49
Skud_4.3718.262ON5803724343e-47
Suva_2.2708.262ON6323724321e-46
TBLA0E044308.262ON4813844198e-46
NDAI0J013808.262ON6243844268e-46
CAGL0B01771g8.262ON5363774192e-45
KLLA0F19140g8.262ON5273834173e-45
NCAS0B038508.262ON5883783951e-41
TBLA0F030708.262ON4453853512e-36
KNAG0H032408.262ON5193603515e-36
TPHA0A018108.262ON4572802191e-18
NCAS0A06040na 1ON588247970.003
NDAI0D03010na 1ON778138960.004
Ecym_31481.519ON1052161870.048
NDAI0B06160singletonON140372860.066
KAFR0B06620singletonON118563840.088
NDAI0G00550singletonON41244820.13
SAKL0F06809g2singletonON175569810.22
Kwal_39.16423singletonON7462730.23
Kwal_23.3713singletonON7862720.33
Kwal_47.17033singletonON11762730.53
Kwal_36.16338singletonON60480770.57
Kwal_9.616singletonON34795760.65
Kwal_39.16409singletonON73480770.69
Kwal_33.15089singletonON47873760.70
Kwal_1.407singletonON18688740.74
Kwal_27.11219singletonON74480760.76
Kwal_50.19418singletonON34862760.77
Kwal_26.7891singletonON31080750.89
Kwal_47.17665singletonON62562760.89
SAKL0C11913g1singletonON175569760.94
SAKL0B11583g2singletonON175569760.95
Kwal_27.12438singletonON64173751.0
Kwal_54.19470singletonON54273751.1
Kwal_60.24910singletonON52480751.1
Kwal_13.691singletonON86573751.1
Kwal_2.424singletonON23960731.1
YNL054W-BsingletonOFF174969751.3
NDAI0G00600singletonON48840741.4
KNAG0G002501.519ON1065162741.5
Kwal_55.19799singletonON35473731.7
Ecym_5175singletonON1410242731.8
Kwal_14.764singletonON35873721.8
Smik_49.2singletonON55069722.3
KNAG0A058102.378ON15938692.8
TPHA0O002201.519ON1112102723.0
NDAI0D03060singletonON1303134723.0
Ecym_54985.634ON85794704.7
Skud_12.300singletonON39842678.0
TDEL0E00260singletonON124842688.0
KLLA0F15708g5.206ON1900191688.0
Smik_12.962.407ON473106678.8
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= TPHA0J00740
         (408 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

TPHA0J00740 Chr10 (175036..176262) [1227 bp, 408 aa] {ON} Anc_8....   841   0.0  
Kpol_392.6 s392 complement(8453..9826) [1374 bp, 457 aa] {ON} co...   230   2e-70
Kpol_543.38 s543 (84712..86040) [1329 bp, 442 aa] {ON} (84712..8...   197   6e-58
SAKL0H17028g Chr8 complement(1495187..1496839) [1653 bp, 550 aa]...   199   1e-57
Ecym_4308 Chr4 complement(654030..655619) [1590 bp, 529 aa] {ON}...   198   1e-57
Kwal_56.23799 s56 complement(708590..710056) [1467 bp, 488 aa] {...   192   7e-56
TDEL0F03890 Chr6 (724664..726094) [1431 bp, 476 aa] {ON} Anc_8.2...   191   2e-55
KAFR0B05540 Chr2 complement(1134547..1136106) [1560 bp, 519 aa] ...   189   2e-54
AGR086C Chr7 complement(888758..890362) [1605 bp, 534 aa] {ON} S...   187   2e-53
ZYRO0C01650g Chr3 complement(117323..119083) [1761 bp, 586 aa] {...   187   5e-53
Smik_4.356 Chr4 (637418..639148) [1731 bp, 576 aa] {ON} YDR110W ...   179   4e-50
YDR110W Chr4 (676102..677802) [1701 bp, 566 aa] {ON}  FOB1Nucleo...   176   4e-49
KLTH0G13684g Chr7 complement(1171645..1173171) [1527 bp, 508 aa]...   174   8e-49
Skud_4.371 Chr4 (647726..649468) [1743 bp, 580 aa] {ON} YDR110W ...   171   3e-47
Suva_2.270 Chr2 (470408..472306) [1899 bp, 632 aa] {ON} YDR110W ...   171   1e-46
TBLA0E04430 Chr5 (1136737..1138182) [1446 bp, 481 aa] {ON} Anc_8...   166   8e-46
NDAI0J01380 Chr10 complement(317185..319059) [1875 bp, 624 aa] {...   168   8e-46
CAGL0B01771g Chr2 (163063..164673) [1611 bp, 536 aa] {ON} weakly...   166   2e-45
KLLA0F19140g Chr6 (1773327..1774910) [1584 bp, 527 aa] {ON} some...   165   3e-45
NCAS0B03850 Chr2 complement(685424..687190) [1767 bp, 588 aa] {O...   156   1e-41
TBLA0F03070 Chr6 complement(745795..747132) [1338 bp, 445 aa] {O...   139   2e-36
KNAG0H03240 Chr8 complement(603920..605479) [1560 bp, 519 aa] {O...   139   5e-36
TPHA0A01810 Chr1 complement(365982..367355) [1374 bp, 457 aa] {O...    89   1e-18
NCAS0A06040 Chr1 complement(1193225..1194991) [1767 bp, 588 aa] ...    42   0.003
NDAI0D03010 Chr4 complement(712188..714524) [2337 bp, 778 aa] {O...    42   0.004
Ecym_3148 Chr3 (272390..275548) [3159 bp, 1052 aa] {ON} similar ...    38   0.048
NDAI0B06160 Chr2 (1494425..1498636) [4212 bp, 1403 aa] {ON}            38   0.066
KAFR0B06620 Chr2 complement(1376088..1379645) [3558 bp, 1185 aa]...    37   0.088
NDAI0G00550 Chr7 complement(116985..118223) [1239 bp, 412 aa] {O...    36   0.13 
SAKL0F06809g2 Chr6 (518357..519658,519660..523625) [5268 bp, 175...    36   0.22 
Kwal_39.16423 s39 (13455..13676) [222 bp, 74 aa] {ON} YDR261W-B ...    33   0.23 
Kwal_23.3713 s23 (400838..401074) [237 bp, 78 aa] {ON} YLR035C-A...    32   0.33 
Kwal_47.17033 s47 complement(218594..218947) [354 bp, 117 aa] {O...    33   0.53 
Kwal_36.16338 s36 (3460..5271) [1812 bp, 604 aa] {ON} YPL060C-A ...    34   0.57 
Kwal_9.616 s9 (909..1952) [1044 bp, 347 aa] {ON} YLR410W-B - TyB...    34   0.65 
Kwal_39.16409 s39 (7556..9760) [2205 bp, 734 aa] {ON} YLR035C-A ...    34   0.69 
Kwal_33.15089 s33 complement(956930..958366) [1437 bp, 478 aa] {...    34   0.70 
Kwal_1.407 s1 (1976..2536) [561 bp, 186 aa] {ON} YAR009C - TyB G...    33   0.74 
Kwal_27.11219 s27 complement(690913..693147) [2235 bp, 744 aa] {...    34   0.76 
Kwal_50.19418 s50 complement(1189..2235) [1047 bp, 348 aa] {ON} ...    34   0.77 
Kwal_26.7891 s26 complement(557640..558572) [933 bp, 310 aa] {ON...    33   0.89 
Kwal_47.17665 s47 complement(505870..507747) [1878 bp, 625 aa] {...    34   0.89 
SAKL0C11913g1 Chr3 complement(1069940..1073905,1073907..1075208)...    34   0.94 
SAKL0B11583g2 Chr2 (998260..999561,999563..1003528) [5268 bp, 17...    34   0.95 
Kwal_27.12438 s27 (1219039..1220964) [1926 bp, 641 aa] {ON} YOR3...    33   1.0  
Kwal_54.19470 s54 (253..1881) [1629 bp, 542 aa] {ON} YDR261C-D -...    33   1.1  
Kwal_60.24910 s60 (1218..2792) [1575 bp, 524 aa] {ON} YDR261W-B ...    33   1.1  
Kwal_13.691 s13 complement(2834..5431) [2598 bp, 865 aa] {ON} YB...    33   1.1  
Kwal_2.424 s2 (2177..2896) [720 bp, 239 aa] {ON} YBL101W-B - TyB...    33   1.1  
YNL054W-B Chr14 (519456..520760,520762..524706) [5250 bp, 1749 a...    33   1.3  
NDAI0G00600 Chr7 complement(130877..132343) [1467 bp, 488 aa] {O...    33   1.4  
KNAG0G00250 Chr7 (30786..33983) [3198 bp, 1065 aa] {ON} Anc_1.51...    33   1.5  
Kwal_55.19799 s55 complement(132471..133535) [1065 bp, 354 aa] {...    33   1.7  
Ecym_5175 Chr5 (360152..364384) [4233 bp, 1410 aa] {ON} Similar ...    33   1.8  
Kwal_14.764 s14 (32697..33773) [1077 bp, 358 aa] {ON} YLR035C-A ...    32   1.8  
Smik_49.2 Chr49 (115..1764) [1650 bp, 550 aa] {ON} YNL054W-B (RE...    32   2.3  
KNAG0A05810 Chr1 complement(867039..867518) [480 bp, 159 aa] {ON...    31   2.8  
TPHA0O00220 Chr15 (26416..29754) [3339 bp, 1112 aa] {ON} Anc_1.5...    32   3.0  
NDAI0D03060 Chr4 (723016..726927) [3912 bp, 1303 aa] {ON}              32   3.0  
Ecym_5498 Chr5 (1016519..1019092) [2574 bp, 857 aa] {ON} similar...    32   4.7  
Skud_12.300 Chr12 complement(546310..547503) [1194 bp, 398 aa] {...    30   8.0  
TDEL0E00260 Chr5 complement(46841..49489,49491..50588) [3747 bp,...    31   8.0  
KLLA0F15708g Chr6 (1447749..1453451) [5703 bp, 1900 aa] {ON} sim...    31   8.0  
Smik_12.96 Chr12 complement(197308..198729) [1422 bp, 473 aa] {O...    30   8.8  

>TPHA0J00740 Chr10 (175036..176262) [1227 bp, 408 aa] {ON} Anc_8.262
           YDR110W
          Length = 408

 Score =  841 bits (2173), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 408/408 (100%), Positives = 408/408 (100%)

Query: 1   MKTLKRKHDMIDDSNNDRIIKVDIPELDILYKIELGSDIDIERINHGRNDHLQLESVFSS 60
           MKTLKRKHDMIDDSNNDRIIKVDIPELDILYKIELGSDIDIERINHGRNDHLQLESVFSS
Sbjct: 1   MKTLKRKHDMIDDSNNDRIIKVDIPELDILYKIELGSDIDIERINHGRNDHLQLESVFSS 60

Query: 61  FLTQKMYTLIREKNFNYETFEEAMKSHYTDSGKYMGTANKKFMLMEDRYQLNELGQITDK 120
           FLTQKMYTLIREKNFNYETFEEAMKSHYTDSGKYMGTANKKFMLMEDRYQLNELGQITDK
Sbjct: 61  FLTQKMYTLIREKNFNYETFEEAMKSHYTDSGKYMGTANKKFMLMEDRYQLNELGQITDK 120

Query: 121 RNDYKLIVPPNQIYDLIMHCHFLNDHLGSTKIHHSLREKYSNISRALVRLSLQNCSHCNP 180
           RNDYKLIVPPNQIYDLIMHCHFLNDHLGSTKIHHSLREKYSNISRALVRLSLQNCSHCNP
Sbjct: 121 RNDYKLIVPPNQIYDLIMHCHFLNDHLGSTKIHHSLREKYSNISRALVRLSLQNCSHCNP 180

Query: 181 KSTYKHIEYTRHFSCDKNFAFEKIHVEIFQPFEDVDTFANKFSHVIYIRDYFTRYVWLYP 240
           KSTYKHIEYTRHFSCDKNFAFEKIHVEIFQPFEDVDTFANKFSHVIYIRDYFTRYVWLYP
Sbjct: 181 KSTYKHIEYTRHFSCDKNFAFEKIHVEIFQPFEDVDTFANKFSHVIYIRDYFTRYVWLYP 240

Query: 241 LEKISVKELANTLATHLLLSLRIPIYIESLTLDESNLLKILKRISKTTNLILGVGTTKLD 300
           LEKISVKELANTLATHLLLSLRIPIYIESLTLDESNLLKILKRISKTTNLILGVGTTKLD
Sbjct: 241 LEKISVKELANTLATHLLLSLRIPIYIESLTLDESNLLKILKRISKTTNLILGVGTTKLD 300

Query: 301 EFQASGINHMKELFVQNREYCGNNWNKYVIRCQNHYNTTYNKWIYGIPLNLMAQETLADN 360
           EFQASGINHMKELFVQNREYCGNNWNKYVIRCQNHYNTTYNKWIYGIPLNLMAQETLADN
Sbjct: 301 EFQASGINHMKELFVQNREYCGNNWNKYVIRCQNHYNTTYNKWIYGIPLNLMAQETLADN 360

Query: 361 KTYKKKRQRTILLTLSKNTILLKNGKSALYKESTENSIDLHIENRYEE 408
           KTYKKKRQRTILLTLSKNTILLKNGKSALYKESTENSIDLHIENRYEE
Sbjct: 361 KTYKKKRQRTILLTLSKNTILLKNGKSALYKESTENSIDLHIENRYEE 408

>Kpol_392.6 s392 complement(8453..9826) [1374 bp, 457 aa] {ON}
           complement(8453..9826) [1374 nt, 458 aa]
          Length = 457

 Score =  230 bits (586), Expect = 2e-70,   Method: Compositional matrix adjust.
 Identities = 121/372 (32%), Positives = 217/372 (58%), Gaps = 10/372 (2%)

Query: 24  IPELDILYKIELGSDIDIERINHGRNDHLQLESVFSSFLTQKMYTLIREKNFNYETFEEA 83
           +PE+  L ++   S ++ E  N G  D  + +S  + +L+Q++Y LI        T +  
Sbjct: 62  LPEIKNLDELISESGLNKELFNRGHQDLAKFQSTINGYLSQRIYDLIL-------TDKLT 114

Query: 84  MKSHYTDSGKYMGTANKKFMLMEDRYQLNELGQ-ITDKRNDYKLIVPPNQIYDLIMHCHF 142
            K    +  K+   +N+K+  +++RY +++ G  + D+RND K++ PPN++ ++++  H 
Sbjct: 115 PKKVSREKVKWANKSNEKYYFLKNRYYVSDKGTTVRDRRNDDKILCPPNKVLEVVLCTHL 174

Query: 143 LNDHLGSTKIHHSLREKYSNISRALVRLSLQNCSHCNPKSTYKHIEYTRHFSCDKNF-AF 201
           +N+H     +H +L ++Y+NISR + R+SL  CS CNP    K ++ ++     +    F
Sbjct: 175 INEHAAHKSVHRNLHKRYANISRTITRISLLYCSFCNPSEHVKPLKKSKKNEVYEGLLPF 234

Query: 202 EKIHVEIFQPFEDVDTFANKFSHVIYIRDYFTRYVWLYPLEKISVKELANTLATHLLLSL 261
           E+IH+EIF+PF D       +SH++YIRDY++RYVWLYPL+K + KEL  TL T+     
Sbjct: 235 ERIHIEIFKPFGDEKLIEGTYSHILYIRDYYSRYVWLYPLKKTAFKELTQTLVTYFFTIT 294

Query: 262 RIPIYIESLTLDESNLLKILKRISKTTNLILGVGTTKLDEFQASGINHMKELFVQNREYC 321
           + PIYIES T++ ++L+ ++++I+   +L +G+G      F  +G+  MK+L + + + C
Sbjct: 295 KTPIYIESSTINRNDLIAMVQKIALKYDLRIGIGIGNSSYFHYNGLETMKQLLLLHEDEC 354

Query: 322 GNNWNKYVIRCQNHYNTTYNKWIYGIPLNLMAQETLAD-NKTYKKKRQRTILLTLSKNTI 380
             +W   +   +N +N   N+ + G+P+NL+    +++ +  YK K+   I  T   N I
Sbjct: 355 LGDWGMCLKYGKNLHNNLKNRKVLGMPINLLLNSGISECSIKYKSKKNTVIDETFPHNMI 414

Query: 381 LLKNGKSALYKE 392
           +L NGKS +Y E
Sbjct: 415 VLDNGKSEIYLE 426

>Kpol_543.38 s543 (84712..86040) [1329 bp, 442 aa] {ON}
           (84712..86040) [1329 nt, 443 aa]
          Length = 442

 Score =  197 bits (501), Expect = 6e-58,   Method: Compositional matrix adjust.
 Identities = 114/346 (32%), Positives = 189/346 (54%), Gaps = 20/346 (5%)

Query: 54  LESVFSSFLTQKMYTLIREKNFNYETFEEAMKSHYTDSGKYMGTANKKFMLMEDRYQLNE 113
           L+S+  + L+Q +Y LIR+   + +T  E  +    +       AN K + ++ RY+L +
Sbjct: 76  LDSIIGT-LSQTVYELIRDDLLDVDTLSEKTRWSRIN-------ANAKCLYLKRRYKLTK 127

Query: 114 LGQITDKRNDYKLIVPPNQIYDLIMHCHFLNDHLGSTKIHHSLREKYSNISRALVRLSLQ 173
            G + D   + K++  P+  YD I+  H LN HLG   IH  L+  YSN+SR  +++ L 
Sbjct: 128 KGTVIDLTRENKIVYEPDLRYDYIISTHILNRHLGYQGIHKRLKAIYSNLSRDYIKMVLD 187

Query: 174 NCSHCNPKSTYKHIEYTRHFSC-DKNFAFEKIHVEIFQPFEDVDTFANKFSHVIYIRDYF 232
            CSHCNP     ++E T H +  +K    E++ ++IF+PFE+ +   N++SH+IYIRDY 
Sbjct: 188 FCSHCNPDKVIPNLEKTVHMNIYEKYLPLERVQLDIFEPFEN-EKIQNRYSHIIYIRDYR 246

Query: 233 TRYVWLYPLEKISVKELANTLATHLLLSLRIPIYIESLTLDESNLLKILKRISKTTNLIL 292
           +R+VW+YPL+    K LA+ +   LL   RIPIYI++ T++  ++L I KRI++   + L
Sbjct: 247 SRFVWIYPLKNTKFKTLASEIGMLLLDLPRIPIYIDTTTIERRDMLAICKRIAEKYEISL 306

Query: 293 GVGTTKLDEFQASGINHMKELFVQNREYCGNNWNKYVIRCQNHYNTTYNKWIYGIPLNLM 352
           G+GT +   F + G++ +K L  +N++ C  +WN  +     +YN        G+P  L 
Sbjct: 307 GIGTIEPSSFYSIGLSRLKCLLNENKDKCLKDWNMCLKLGSYYYNKKSITTARGVPSELF 366

Query: 353 AQETLADNKTYKKKRQRTILLTLSKNTILLKNGKSALYKESTENSI 398
             E      T++ KR   I      N++ ++N     YK ST   +
Sbjct: 367 LDEMECSATTFESKRTEII------NSLPIQNS----YKTSTNKGL 402

>SAKL0H17028g Chr8 complement(1495187..1496839) [1653 bp, 550 aa]
           {ON} similar to uniprot|O13329 Saccharomyces cerevisiae
           YDR110W FOB1 Nucleolar protein required for DNA
           replication fork blocking and recombinational hotspot
           activities binds to the replication fork barrier site in
           the rDNA region related to retroviral integrases
          Length = 550

 Score =  199 bits (506), Expect = 1e-57,   Method: Compositional matrix adjust.
 Identities = 124/397 (31%), Positives = 202/397 (50%), Gaps = 14/397 (3%)

Query: 4   LKRKHDMIDDSNNDRIIKVDIPELDILYKIELGSDIDIERINHGRNDHLQ-LESVFSSFL 62
           + +  D+     N+  +   + E  + Y     +D+++E +  G  D ++ LESV    L
Sbjct: 11  VPKSKDVCSKPTNNDYVTPKLGESQVTYS----TDLNVELLERGGRDFIKYLESVKGQ-L 65

Query: 63  TQKMYTLIREKNFNYETFEEAMKSHYTDSGKYMGTANKKFMLMEDRYQLNELGQITDKRN 122
           TQ  Y LI+       T         TD G     A  K++ ++ RY ++    + D + 
Sbjct: 66  TQAQYELIKTD-----TLTLETLLAVTD-GLIPSNAEAKYLFLKRRYYVDSDQIVRDHKR 119

Query: 123 DYKLIVPPNQIYDLIMHCHFLNDHLGSTKIHHSLREKYSNISRALVRLSLQNCSHCNPKS 182
           D  ++  P  +Y+LI+  H LN+HL   K+H  L+ +YSNI+R  V++  + CS CNP+ 
Sbjct: 120 DDTIVCEPELMYELIVSGHLLNNHLHWRKLHRFLKSQYSNITRDFVQMCARYCSECNPQE 179

Query: 183 TYKHIEYTRHFSCDKNF-AFEKIHVEIFQPFEDVDTFANKFSHVIYIRDYFTRYVWLYPL 241
             K     +H +  +     E+IHVEIF+PF   +    K+SHV+Y RDY +R+VWL PL
Sbjct: 180 EVKPFTKFKHTNAYQGLLPLERIHVEIFKPFGTDELIEEKYSHVLYCRDYHSRFVWLSPL 239

Query: 242 EKISVKELANTLATHLLLSLRIPIYIESLTLDESNLLKILKRISKTTNLILGVGTTKLDE 301
             I+ +EL   L   LL   R+PI++E+ TLD  ++  + + I++   L +G+G      
Sbjct: 240 TGITFQELVPQLTEFLLSLPRLPIFLETTTLDRQDMFDMCEYIARKYQLAIGLGLNNSSH 299

Query: 302 FQASGINHMKELFVQNREYCGNNWNKYVIRCQNHYNTTYNKWIYGIPLNLMAQETLADNK 361
           F  +GI  MK L   N++ C  +W   +     H NT YN  I G   +L+  E  +  K
Sbjct: 300 FYKNGIERMKYLLQTNKKKCAKDWGMCLKYGSYHNNTAYNPRIMGFSNDLLCNEVSSCGK 359

Query: 362 TYKKKRQRTILLTLSKNTILLKNGKSALYKESTENSI 398
            +K KR++ I    + N + LK+    +Y E+ ENS+
Sbjct: 360 KFKLKREKIIHELFAHNVVTLKDTGGMVYVEN-ENSV 395

>Ecym_4308 Chr4 complement(654030..655619) [1590 bp, 529 aa] {ON}
           similar to Ashbya gossypii AGR086C
          Length = 529

 Score =  198 bits (503), Expect = 1e-57,   Method: Compositional matrix adjust.
 Identities = 111/372 (29%), Positives = 193/372 (51%), Gaps = 11/372 (2%)

Query: 24  IPELDILYKIELGSDIDIERINHGRNDHLQLESVFSSFLTQKMYTLIREKNFNYETFEEA 83
           +P  D L   +L  ++D + ++ GRN+ ++L +     LTQ +Y LI     + +T  E 
Sbjct: 37  VPRFD-LNVYQLAPELDHDWLDTGRNELIKLINTVKGQLTQDIYELISSNTLSTQTLLEC 95

Query: 84  MKSHYTDSGKYMGTANKKFMLMEDRYQLNELGQITDKRNDYKLIVPPNQIYDLIMHCHFL 143
                       GT   KF+L++ RY + + G + D + +   ++ P+ ++D+IM  H +
Sbjct: 96  CDKVTA------GTVENKFVLLKRRYSILQ-GNVVDHKREDLPVIEPDLVFDVIMAAHLI 148

Query: 144 NDHLGSTKIHHSLREKYSNISRALVRLSLQNCSHCNPKSTYKHIEYTRHFSC-DKNFAFE 202
           N HL   KIH  L+  Y+N++R    L    CSHCN     K     +H++  DK    E
Sbjct: 149 NGHLPWRKIHQHLKNLYANVTRDFTNLVTLYCSHCNTDRNMKRFLRYKHYNVYDKVMPLE 208

Query: 203 KIHVEIFQPFEDV--DTFANKFSHVIYIRDYFTRYVWLYPLEKISVKELANTLATHLLLS 260
           + HVEIF PF+D   +   +K+SHV+Y RDY +R+VW+ PLE I+ ++L   L   L   
Sbjct: 209 RCHVEIFAPFDDDGNEKIEDKYSHVLYCRDYHSRFVWMLPLEGITFRDLVPALTQLLCSM 268

Query: 261 LRIPIYIESLTLDESNLLKILKRISKTTNLILGVGTTKLDEFQASGINHMKELFVQNREY 320
           +R+PI++E+ TLD  ++  + + I++   L +G+G     +FQ +G+  +K LF +++E 
Sbjct: 269 IRLPIFLETATLDRQDMFDVCEYIARKYKLKIGLGLNSGTDFQRNGVTRIKNLFAEHKEQ 328

Query: 321 CGNNWNKYVIRCQNHYNTTYNKWIYGIPLNLMAQETLADNKTYKKKRQRTILLTLSKNTI 380
           C   WN  +       N  Y+  + GIP +L+  E       +K K+++ I    + + +
Sbjct: 329 CIKEWNMCLRLVLTRVNQNYSDRVRGIPSDLLCNEISNIAHKFKLKQRKIIDELYAHHVV 388

Query: 381 LLKNGKSALYKE 392
             +     +Y E
Sbjct: 389 QFREAGGMIYLE 400

>Kwal_56.23799 s56 complement(708590..710056) [1467 bp, 488 aa] {ON}
           YDR110W (FOB1) - DNA replication fork blocking protein
           [contig 173] FULL
          Length = 488

 Score =  192 bits (489), Expect = 7e-56,   Method: Compositional matrix adjust.
 Identities = 104/351 (29%), Positives = 184/351 (52%), Gaps = 11/351 (3%)

Query: 36  GSDIDIERINHGRNDHLQLESVFSSFLTQKMYTLIREKNFNYETFEEAMKSHYTDSGKYM 95
           G+ ++ E +  GR D ++ +      LTQ+ + L+R      E          T    + 
Sbjct: 32  GNGLNDELLARGRLDFIKYQESVKGQLTQEQFDLVRSSALTAENLMS------TSDKLHS 85

Query: 96  GTANKKFMLMEDRYQLNELGQITDKRNDYKLIVPPNQIYDLIMHCHFLNDHLGSTKIHHS 155
           G    KF+L++ R+ ++  G + D + D  ++  P  ++DLIM  H  N H+   ++HH 
Sbjct: 86  GNIETKFLLLKRRFYVDADGTVRDFKCDDTVVCEPESLFDLIMCGHLKNGHIHWRRLHHY 145

Query: 156 LREKYSNISRALVRLSLQNCSHCNPKSTYKHIEYTRHFSCDKNF-AFEKIHVEIFQPFED 214
           LR KY+N +RA  ++ ++ CS CNP+   +     RH +        E++HVEI  PF  
Sbjct: 146 LRRKYANTTRAFAQICVRYCSECNPEEVLRPYRKFRHTNIYSGLLPLERVHVEIIAPFPK 205

Query: 215 VDTFANKFSHVIYIRDYFTRYVWLYPLEKISVKELANTLATHLLLSLRIPIYIESLTLDE 274
           +      +SHV+Y+RDY++R+VW+ PL    V E+     T LL   R+PI++E+ TL  
Sbjct: 206 L--IEGLYSHVLYLRDYYSRFVWMQPLASERVSEITKAFLTFLLSLPRVPIFVETSTLKR 263

Query: 275 SNLLKILKRISKTTNLILGVGTTKLDEFQASGINHMKELFVQNREYCGNNWNKYVIRCQN 334
            +L ++ + I+    L +G+G ++   FQ +G+  ++ L  QN E C  +W+  +     
Sbjct: 264 QDLFEVCENIASQYGLSIGLGMSRSTTFQRNGVERLRYLLQQNEEPCLKSWHMCLKFGVT 323

Query: 335 HYNTTYNKWIYGIPLNLMAQETLAD-NKTYKKKRQRTILLTLSKNTILLKN 384
           ++N TYN  + G+P NL+   T++D  + ++ KR+  I    + N + L+N
Sbjct: 324 NHNMTYNARVLGLPGNLL-HSTVSDYGRQFELKREELIEKLFASNVVELRN 373

>TDEL0F03890 Chr6 (724664..726094) [1431 bp, 476 aa] {ON} Anc_8.262
           YDR110W
          Length = 476

 Score =  191 bits (485), Expect = 2e-55,   Method: Compositional matrix adjust.
 Identities = 121/397 (30%), Positives = 208/397 (52%), Gaps = 23/397 (5%)

Query: 3   TLKRKHDMID----DSNNDRII--------KVDIPELDILYKIELGSDIDIERINHGRND 50
           TL+R++ + D    D+  D+I+        +   P +   YK    S +++E +  G  D
Sbjct: 8   TLQRRNVLFDEAHSDTQEDKILDEYNGVKSQFLAPSMGESYKEYANSYMNMELLERGEQD 67

Query: 51  HLQLESVFSSFLTQKMYTLIREKNFNYETFEEAMKSHYTDSGKY-MGTANKKFMLMEDRY 109
            L+ +   +  +   +Y LIR  +   ET         ++S K+   +A  K+M +  RY
Sbjct: 68  LLKYQESINGQVLHPIYELIRTNSLTPETLA-------SNSDKWDKDSAESKYMFLMRRY 120

Query: 110 QLNELGQITDKRNDYKLIVPPNQIYDLIMHCHFLNDHLGSTKIHHSLREKYSNISRALVR 169
              E G + D+R   K++  P  I+DLIM  H +NDH+    I+  L + YSNI+R  V+
Sbjct: 121 -YAENGIVRDRRKGDKIVCEPLCIFDLIMCAHLMNDHMTYRPIYTCLNKIYSNITRDFVQ 179

Query: 170 LSLQNCSHCNPKSTYKHIEYTRHFSCDKNF-AFEKIHVEIFQPFEDVDTFANKFSHVIYI 228
           ++++ CS CNP   ++ +E  RH +  K     E++H+EIF+ F D ++ +NKF++V+Y 
Sbjct: 180 MAVRYCSSCNPDGHFRPLEKYRHKNIFKGLLPLERVHIEIFEVF-DNESISNKFTNVLYC 238

Query: 229 RDYFTRYVWLYPLEKISVKELANTLATHLLLSLRIPIYIESLTLDESNLLKILKRISKTT 288
           RDY TR+VWL PL+    K L + + T LL    +PI++ES TLD+ +L  I +++    
Sbjct: 239 RDYHTRFVWLAPLKNTKFKHLVSAVGTLLLGMTYVPIFMESSTLDKQDLFDICEQLCGKY 298

Query: 289 NLILGVGTTKLDEFQASGINHMKELFVQNREYCGNNWNKYVIRCQNHYNTTYNKWIYGIP 348
           N+ LG+G     +F  +GI  MK+L    +  C ++WN  +     H N  +N    GIP
Sbjct: 299 NMKLGLGANSSSQFHINGIKRMKKLLNTRKVDCISDWNMCLRYGPYHLNRRHNTLAGGIP 358

Query: 349 LNLMAQETLADNKTYKKKRQRTILLTLSKNTILLKNG 385
            +L+      + K ++ K++  I    ++N + +  G
Sbjct: 359 NDLLYHSDHTNRKHFRPKQEMIIDELPAQNVVHVNKG 395

>KAFR0B05540 Chr2 complement(1134547..1136106) [1560 bp, 519 aa]
           {ON} Anc_8.262 YDR110W
          Length = 519

 Score =  189 bits (481), Expect = 2e-54,   Method: Compositional matrix adjust.
 Identities = 109/363 (30%), Positives = 195/363 (53%), Gaps = 8/363 (2%)

Query: 24  IPELDILYKIELGSDIDIERINHGRNDHLQLESVFSSFLTQKMYTLIREKNFNYETFEEA 83
           +P +   Y     S +++E +  G  +  + +   +  LT++ Y LIR  +   ET    
Sbjct: 49  VPRMGESYTSYTDSFMNLELLKRGEREVFKFQQSINGHLTEETYDLIRTDSLTPETLAS- 107

Query: 84  MKSHYTDSGKYMGTANKKFMLMEDRYQLNELGQITDKRNDYKLIVPPNQIYDLIMHCHFL 143
                T+      TA  +++ ++ RY  +  G I D     K++  P  ++D+IM CH +
Sbjct: 108 -----TNPKWTKITAEPRYLFLKRRYYRDNNGLIHDHLRKDKIVCEPVYVFDMIMGCHLM 162

Query: 144 NDHLGSTKIHHSLREKYSNISRALVRLSLQNCSHCNPKSTYKHIEYTRHFSC-DKNFAFE 202
           N+H    KIHHSL   YSNI+R L   +L+ CS CNP+     +E  +H +  ++    E
Sbjct: 163 NNHGFVKKIHHSLSTFYSNITRDLCLKALKFCSVCNPEQKIGKLEKFKHRNIYNELMPLE 222

Query: 203 KIHVEIFQPFEDVDTFANKFSHVIYIRDYFTRYVWLYPLEKISVKELANTLATHLLLSLR 262
           ++H+EIF+PF + +    K+SH++Y RDY +RY+W+ PL+    K L  T+A+  L  +R
Sbjct: 223 RVHIEIFEPFPN-EKIEKKYSHILYCRDYHSRYIWMLPLKNTKFKHLVPTMASLFLSFIR 281

Query: 263 IPIYIESLTLDESNLLKILKRISKTTNLILGVGTTKLDEFQASGINHMKELFVQNREYCG 322
            PI+IE+ +LD  ++  I ++I+   +L +G+GT+K + F A+GI  MK     +RE C 
Sbjct: 282 QPIFIETASLDWQDMFDICEKIAFEYDLQIGLGTSKPNTFHAAGIRQMKAKLEAHREECL 341

Query: 323 NNWNKYVIRCQNHYNTTYNKWIYGIPLNLMAQETLADNKTYKKKRQRTILLTLSKNTILL 382
            +WN  +      +N  +N    G+P +L++ +    +  +K+K  + +   +S++ + +
Sbjct: 342 LSWNLCLKYGSYDHNIRHNDRAGGVPGDLLSSQIQECSLKFKEKIIQILENAVSESVLRV 401

Query: 383 KNG 385
            NG
Sbjct: 402 DNG 404

>AGR086C Chr7 complement(888758..890362) [1605 bp, 534 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDR110W
           (FOB1)
          Length = 534

 Score =  187 bits (475), Expect = 2e-53,   Method: Compositional matrix adjust.
 Identities = 101/336 (30%), Positives = 184/336 (54%), Gaps = 13/336 (3%)

Query: 24  IPELDI-LYKIELGSDIDIERINHGRNDHLQLESVFSSFLTQKMYTLIREKNFNYETFEE 82
           +P+ D+ LY+++ GS ++ E I+ GR +  ++       LTQ++Y LI     + +   E
Sbjct: 31  VPQTDLNLYQLD-GS-LEHEWIDRGRGELRKIMKTVKGQLTQEIYDLIASDTLSTQKLLE 88

Query: 83  AMKSHYTDSGKYMGTANKKFMLMEDRYQLNELGQITDKRNDYKLIVPPNQIYDLIMHCHF 142
                  +      T   K++L++ RY + + G + D++     ++ P+ ++D+IM  H 
Sbjct: 89  CCDKVTPN------TVENKYVLLKRRY-VAKGGIVIDRKRKDAPVIEPDSLFDMIMSAHL 141

Query: 143 LNDHLGSTKIHHSLREKYSNISRALVRLSLQNCSHCNPKSTYKHIEYTRHFSC-DKNFAF 201
           +NDH+   K++  ++  Y+N++R L  +    CSHCN   + +     +H++  +K    
Sbjct: 142 INDHMPWRKVYQHMKGLYANVTRELTNMVTGYCSHCNMDRSVRRFSRYKHYNVHEKLMPL 201

Query: 202 EKIHVEIFQPFED--VDTFANKFSHVIYIRDYFTRYVWLYPLEKISVKELANTLATHLLL 259
           E+ HVE+F PF+D  V+    K+SH +Y RDY +R++WL PLE I+ + L   LA  L  
Sbjct: 202 ERCHVEVFAPFDDEGVEKIQGKYSHFLYCRDYHSRFIWLLPLEGIAFRYLLPALAQLLCT 261

Query: 260 SLRIPIYIESLTLDESNLLKILKRISKTTNLILGVGTTKLDEFQASGINHMKELFVQNRE 319
            +R+PI++E+ TLD  ++  I + I++     +G+G     EFQ +GI  +K+L  + +E
Sbjct: 262 MIRVPIFLETATLDRQDMFDICEVIARRYKFKIGLGLNSGTEFQKNGIKRVKQLLSEYKE 321

Query: 320 YCGNNWNKYVIRCQNHYNTTYNKWIYGIPLNLMAQE 355
            C ++WN  +    +  N TY   + GIP +L+  E
Sbjct: 322 ECQDDWNMCLRLVLSRVNQTYADRVRGIPSDLLCNE 357

>ZYRO0C01650g Chr3 complement(117323..119083) [1761 bp, 586 aa] {ON}
           some similarities with uniprot|O13329 Saccharomyces
           cerevisiae YDR110W FOB1 Nucleolar protein required for
           DNA replication fork blocking and recombinational
           hotspot activities binds to the replication fork barrier
           site in the rDNA region related to retroviral integrases
          Length = 586

 Score =  187 bits (475), Expect = 5e-53,   Method: Compositional matrix adjust.
 Identities = 111/360 (30%), Positives = 190/360 (52%), Gaps = 22/360 (6%)

Query: 33  IELGSDIDIERINHGRNDHLQLESVFSSFLTQKMYTLIREKNFNYETFEEAMKSHYTDSG 92
           ++LG ++++  +  G  + LQ +   +  LTQ++Y LIR    +    E   + H     
Sbjct: 51  LQLGMNLNL--LEQGAEESLQFQGTVAGQLTQQIYELIRSDTLSIANLE---RCH----- 100

Query: 93  KYMGTANK-KFMLMEDRYQLNEL-GQITDKRNDYKLIVPPNQIYDLIMHCHFLNDHLGST 150
           K+ G +++ ++  +  RY ++E  G + D++ D +++  P  ++ L+M  H  N+H+ S 
Sbjct: 101 KWKGESSEIEYYYLRSRYFVSEENGMVCDRKRDDRIVCEPASMFHLVMCSHLQNNHVTSY 160

Query: 151 KIHHSLREKYSNISRALVRLSLQNCSHCNPKSTYKHIEYTRHFSCDKN-----FAFEKIH 205
            IH +L + Y+NI+R  +  ++  CS CNP    K  +  RH    KN        E++H
Sbjct: 161 NIHRNLVKTYANITRDYIVTAISYCSKCNPDLKAKPFQKKRH----KNVYWELLPLERVH 216

Query: 206 VEIFQPFEDVDTFANKFSHVIYIRDYFTRYVWLYPLEKISVKELANTLATHLLLSLRIPI 265
           +E+F+PF D +    +FSH++Y RDYF+RYVW+ PL+    K +   +++ LL   RIPI
Sbjct: 217 IEVFEPF-DGEKIQGRFSHLLYFRDYFSRYVWILPLQNDKRKHMIRAMSSFLLGLPRIPI 275

Query: 266 YIESLTLDESNLLKILKRISKTTNLILGVGTTKLDEFQASGINHMKELFVQNREYCGNNW 325
           ++ES T+D  +L  +  +I++  +L LG+G      F  +GI  MKEL   ++E C  +W
Sbjct: 276 FLESTTIDREHLFDLCGQIAEHYSLKLGLGVKNSQRFHNNGIKDMKELLGSHKEECLQDW 335

Query: 326 NKYVIRCQNHYNTTYNKWIYGIPLNLMAQETLADNKTYKKKRQRTILLTLSKNTILLKNG 385
           N  +     H N   N    G P +L+       N+ + KKR   IL T S+  + L  G
Sbjct: 336 NLCLKYGPFHINQNINVSSDGRPGDLLFTSVPDCNRKFVKKRNDVILDTPSQQVVHLGEG 395

>Smik_4.356 Chr4 (637418..639148) [1731 bp, 576 aa] {ON} YDR110W
           (REAL)
          Length = 576

 Score =  179 bits (454), Expect = 4e-50,   Method: Compositional matrix adjust.
 Identities = 120/383 (31%), Positives = 194/383 (50%), Gaps = 14/383 (3%)

Query: 13  DSNNDRIIKVDIPELDILYKIELGSDIDIERINHG-RNDHLQLESVFSSFLTQKMYTLIR 71
           DS+ DR++   +P +   Y   + S +++E +  G R   + LES+ +  LTQK+Y LI+
Sbjct: 41  DSSKDRLLI--LPSMGESYTEYVDSYLNLELLERGERETPIFLESL-TRQLTQKIYELIK 97

Query: 72  EKNFNYETFEEAMKSHYTDSGKYMGT-ANKKFMLMEDRYQLNELGQITDKRNDYKLIVPP 130
            K+   +T ++        S KY G  A  K + ++ +Y +++ G + D RN+ K+   P
Sbjct: 98  TKSLTADTLQQI-------SDKYDGVVAENKLLFLQRQYYVDDEGNVRDGRNNDKIYCEP 150

Query: 131 NQIYDLIMHCHFLNDHLGSTKIHHSLREKYSNISRALVRLSLQNCSHCNPKSTYKHI-EY 189
           N IYD++M  H +N HL    +H  L   ++NIS A++    Q CS CN K   K + EY
Sbjct: 151 NHIYDMVMATHLINKHLRGKTLHSFLFSYFANISHAIIDWVQQFCSKCNKKGKIKPLKEY 210

Query: 190 TRHFSCDKNFAFEKIHVEIFQPFEDVDTFANKFSHVIYIRDYFTRYVWLYPLEKISVKEL 249
            R    DK    E+IH+E+F+PF   +T   K+S+V+  RDY + ++WL PL+    K L
Sbjct: 211 KRPDMYDKLLPMERIHIEVFEPFSG-ETIEGKYSYVLLCRDYRSSFMWLLPLKSTKFKHL 269

Query: 250 ANTLATHLLLSLRIPIYIESLTLDESNLLKILKRISKTTNLILGVGTTKLDEFQASGINH 309
              +++  L   R+PI++ S TLD+ +L  I + I+    L +G+G      F   GI  
Sbjct: 270 IPVISSLFLSFARVPIFVTSSTLDKDDLYDICEEIASKYGLRIGLGLKSSARFHTGGILC 329

Query: 310 MKELFVQNREYCGNNWNKYVIRCQNHYNTTYNKWIYGIPLNLMAQETLADNKTYKKKRQR 369
           +       +E C  +W K +      +N   NK     P  ++  E    N  ++ KR+R
Sbjct: 330 IHYALNSYKEECLADWGKCLRYGPYRFNRRRNKRTKRKPAQVLLSEIPGHNAKFETKRER 389

Query: 370 TILLTLSKNTILLKNGKSALYKE 392
            I  T S+N      GK  +Y E
Sbjct: 390 VIENTYSRNMFKTAGGKGLIYLE 412

>YDR110W Chr4 (676102..677802) [1701 bp, 566 aa] {ON}  FOB1Nucleolar
           protein that binds the rDNA replication fork barrier
           (RFB) site; required for replication fork blocking,
           recombinational hotspot activity, condensin recruitment
           to RFB and rDNA repeat segregation; related to
           retroviral integrases
          Length = 566

 Score =  176 bits (446), Expect = 4e-49,   Method: Compositional matrix adjust.
 Identities = 115/383 (30%), Positives = 196/383 (51%), Gaps = 14/383 (3%)

Query: 13  DSNNDRIIKVDIPELDILYKIELGSDIDIERINHG-RNDHLQLESVFSSFLTQKMYTLIR 71
           +S+ DR++   +P +   Y   + S +++E +  G R   + LES+ +  LTQK+Y LI+
Sbjct: 39  ESSKDRLLI--LPSMGESYTEYVDSYLNLELLERGERETPIFLESL-TRQLTQKIYELIK 95

Query: 72  EKNFNYETFEEAMKSHYTDSGKYMGT-ANKKFMLMEDRYQLNELGQITDKRNDYKLIVPP 130
            K+   +T ++        S KY G  A  K + ++ +Y +++ G + D RN+ K+   P
Sbjct: 96  TKSLTADTLQQI-------SDKYDGVVAENKLLFLQRQYYVDDEGNVRDGRNNDKIYCEP 148

Query: 131 NQIYDLIMHCHFLNDHLGSTKIHHSLREKYSNISRALVRLSLQNCSHCNPKSTYKHI-EY 189
             +YD++M  H +N HL    +H  L   ++NIS A++    Q CS CN K   K + EY
Sbjct: 149 KHVYDMVMATHLMNKHLRGKTLHSFLFSHFANISHAIIDWVQQFCSKCNKKGKIKPLKEY 208

Query: 190 TRHFSCDKNFAFEKIHVEIFQPFEDVDTFANKFSHVIYIRDYFTRYVWLYPLEKISVKEL 249
            R    DK    E+IH+E+F+PF + +    K+S+V+  RDY + ++WL PL+    K L
Sbjct: 209 KRPDMYDKLLPMERIHIEVFEPF-NGEAIEGKYSYVLLCRDYRSSFMWLLPLKSTKFKHL 267

Query: 250 ANTLATHLLLSLRIPIYIESLTLDESNLLKILKRISKTTNLILGVGTTKLDEFQASGINH 309
              +++  L   R+PI++ S TLD+ +L  I + I+    L +G+G      F   GI  
Sbjct: 268 IPVVSSLFLTFARVPIFVTSSTLDKDDLYDICEEIASKYGLRIGLGLKSSARFHTGGILC 327

Query: 310 MKELFVQNREYCGNNWNKYVIRCQNHYNTTYNKWIYGIPLNLMAQETLADNKTYKKKRQR 369
           ++      ++ C  +W K +      +N   NK     P+ ++  E    N  ++ KR+R
Sbjct: 328 IQYALNSYKKECLADWGKCLRYGPYRFNRRRNKRTKRKPVQVLLSEVPGHNAKFETKRER 387

Query: 370 TILLTLSKNTILLKNGKSALYKE 392
            I  T S+N   +  GK  +Y E
Sbjct: 388 VIENTYSRNMFKMAGGKGLIYLE 410

>KLTH0G13684g Chr7 complement(1171645..1173171) [1527 bp, 508 aa]
           {ON} weakly similar to uniprot|O13329 Saccharomyces
           cerevisiae YDR110W FOB1 Nucleolar protein required for
           DNA replication fork blocking and recombinational
           hotspot activities binds to the replication fork barrier
           site in the rDNA region related to retroviral integrases
          Length = 508

 Score =  174 bits (441), Expect = 8e-49,   Method: Compositional matrix adjust.
 Identities = 101/349 (28%), Positives = 181/349 (51%), Gaps = 15/349 (4%)

Query: 39  IDIERINHGRNDHLQLESVFSSFLTQKMYTLIREKNFNYETFEEAMKSHYTDSGK-YMGT 97
           +++E +  GR D ++ +      LTQ  + L+R  +   +          T S K + G 
Sbjct: 35  LNLELLERGRLDFIKYQESVKGQLTQDQFDLVRSCSLTEDNL-------MTTSDKLHAGN 87

Query: 98  ANKKFMLMEDRYQLNELGQITDKRNDYKLIVPPNQIYDLIMHCHFLNDHLGSTKIHHSLR 157
              KF+L++ RY ++  G + D +    ++  P  ++DLIM  H  N HL   ++H  LR
Sbjct: 88  VETKFLLLKRRYYVDADGIVRDYKCSDTVVCEPELMFDLIMCGHLKNGHLHWRRLHSYLR 147

Query: 158 EKYSNISRALVRLSLQNCSHCNPKS---TYKHIEYTRHFSCDKNFAFEKIHVEIFQPFED 214
             Y+N +RA  ++ ++ CS CNP+     YK   +T  +S       E++HVEI  PF +
Sbjct: 148 HNYANTTRAFAQICVKYCSQCNPEEELRPYKKFRHTNIYS--GLLPLERVHVEIISPFSE 205

Query: 215 VDTFANKFSHVIYIRDYFTRYVWLYPLEKISVKELANTLATHLLLSLRIPIYIESLTLDE 274
                  +SHV++ RDY++R+VW+ PL+   V+++   L   LLL  RIPI+IE+ T+D 
Sbjct: 206 A--IEGTYSHVLFFRDYYSRFVWMQPLKGDDVRDITKGLLATLLLLPRIPIFIETSTIDR 263

Query: 275 SNLLKILKRISKTTNLILGVGTTKLDEFQASGINHMKELFVQNREYCGNNWNKYVIRCQN 334
            +L +  + ++   +L +G+G ++   FQ +G+  ++ L  +N E C  +W   +     
Sbjct: 264 QDLFEACEDVAGQYSLYIGLGMSQSSTFQKNGVERLRYLLQRNEEQCLRSWYMCLKYGAT 323

Query: 335 HYNTTYNKWIYGIPLNLMAQETLADNKTYKKKRQRTILLTLSKNTILLK 383
           ++N  YN  I G+P NL+        + ++ KR+  I    ++N + +K
Sbjct: 324 NHNLNYNARILGVPGNLLHSTVCDYGRQFELKREDLIEKLFARNVVEIK 372

>Skud_4.371 Chr4 (647726..649468) [1743 bp, 580 aa] {ON} YDR110W
           (REAL)
          Length = 580

 Score =  171 bits (434), Expect = 3e-47,   Method: Compositional matrix adjust.
 Identities = 111/372 (29%), Positives = 183/372 (49%), Gaps = 12/372 (3%)

Query: 24  IPELDILYKIELGSDIDIERINHG-RNDHLQLESVFSSFLTQKMYTLIREKNFNYETFEE 82
           +P +   Y   + S +++E +  G R   + LES+ +  LTQ++Y LI+ K+   +T ++
Sbjct: 51  LPSMGESYTAYVDSYLNLELLERGERETPIFLESL-TRQLTQQIYELIKTKSLTADTLQQ 109

Query: 83  AMKSHYTDSGKYMGT-ANKKFMLMEDRYQLNELGQITDKRNDYKLIVPPNQIYDLIMHCH 141
                   S KY G  A  K + ++ +Y ++  G + D RN+ K+   P  IYD++M  H
Sbjct: 110 I-------SDKYDGVVAENKLLFLQRQYYVDNEGNVRDGRNNDKIYCEPKHIYDMVMATH 162

Query: 142 FLNDHLGSTKIHHSLREKYSNISRALVRLSLQNCSHCNPKSTYKHI-EYTRHFSCDKNFA 200
            +N HL    +H  L   ++N S A++    Q CS CN K   K + EY R    DK   
Sbjct: 163 LMNKHLRGKTLHSFLFSHFANTSHAIIDWVQQFCSKCNKKGKIKPLKEYKRPDMYDKLLP 222

Query: 201 FEKIHVEIFQPFEDVDTFANKFSHVIYIRDYFTRYVWLYPLEKISVKELANTLATHLLLS 260
            E+IH+E+F+PF        K+ +V+  RDY + ++WL PL+    K L   +++  L  
Sbjct: 223 MERIHIEVFEPFTG-GAIEGKYPYVLLCRDYRSSFMWLLPLKSTKFKHLIPVISSLFLSF 281

Query: 261 LRIPIYIESLTLDESNLLKILKRISKTTNLILGVGTTKLDEFQASGINHMKELFVQNREY 320
            R+PI++ S TLD+ +L  I + I+    L +G+G      F   GI  ++      +E 
Sbjct: 282 ARVPIFVTSSTLDKDDLYDICEEIASKYGLCIGLGLKSSARFHTGGILCIQYALNSYKEE 341

Query: 321 CGNNWNKYVIRCQNHYNTTYNKWIYGIPLNLMAQETLADNKTYKKKRQRTILLTLSKNTI 380
           C  +W K +      +N   NK     P  ++  E    N  ++ KR+R I  T S+N  
Sbjct: 342 CLADWGKCLRYGPYRFNRRRNKRTKRKPAQVLLSEVPGHNAKFETKRERVIENTYSRNMF 401

Query: 381 LLKNGKSALYKE 392
            +  GK  +Y E
Sbjct: 402 KMAGGKGLIYLE 413

>Suva_2.270 Chr2 (470408..472306) [1899 bp, 632 aa] {ON} YDR110W
           (REAL)
          Length = 632

 Score =  171 bits (432), Expect = 1e-46,   Method: Compositional matrix adjust.
 Identities = 113/372 (30%), Positives = 185/372 (49%), Gaps = 12/372 (3%)

Query: 24  IPELDILYKIELGSDIDIERINHG-RNDHLQLESVFSSFLTQKMYTLIREKNFNYETFEE 82
           +P +   Y   + S +++E +  G R   + LES+ +  LTQK+Y LI+ K+   ET ++
Sbjct: 101 LPLMGESYTEYVDSYLNLELLERGERETPIFLESL-TRQLTQKIYELIKTKSLTAETLQQ 159

Query: 83  AMKSHYTDSGKYMGTANK-KFMLMEDRYQLNELGQITDKRNDYKLIVPPNQIYDLIMHCH 141
                   S KY G A + K + +E +Y ++  G + D+RN+ K+   P  IYD++M  H
Sbjct: 160 I-------SDKYDGVAAENKLLFLERQYYVDNEGNVRDRRNNDKIYCEPKHIYDMVMATH 212

Query: 142 FLNDHLGSTKIHHSLREKYSNISRALVRLSLQNCSHCNPKSTYKHI-EYTRHFSCDKNFA 200
            +N HL    +H  L   ++N S A++    Q CS CN K   K + EY R    DK   
Sbjct: 213 LMNKHLRGKTLHSFLFSHFANTSHAIIDWVQQFCSKCNKKGKIKPLKEYKRPDMYDKLLP 272

Query: 201 FEKIHVEIFQPFEDVDTFANKFSHVIYIRDYFTRYVWLYPLEKISVKELANTLATHLLLS 260
            E+IH+E+F+P+        K+ +V+  RDY + ++WL PL+    K L   +++  L  
Sbjct: 273 MERIHIEVFEPY-GGKAIEGKYPYVLLCRDYRSSFMWLLPLKSTKFKHLIPVVSSLFLSF 331

Query: 261 LRIPIYIESLTLDESNLLKILKRISKTTNLILGVGTTKLDEFQASGINHMKELFVQNREY 320
            RIPI++ S TLD+ +L  I + I+    L +G+G      F   GI  ++      +E 
Sbjct: 332 ARIPIFVTSSTLDKDDLYDICEEIASKYGLRIGLGLKSSARFHTGGILCIQYALNSYKEE 391

Query: 321 CGNNWNKYVIRCQNHYNTTYNKWIYGIPLNLMAQETLADNKTYKKKRQRTILLTLSKNTI 380
           C  +W K +      +N   NK     P  ++  E    N  ++ KR+R I  T ++N  
Sbjct: 392 CLADWGKCLRYGPYRFNRRRNKRTKRKPTQVLLSEVPGHNAKFETKRERVIENTYARNMF 451

Query: 381 LLKNGKSALYKE 392
            +  GK  +Y E
Sbjct: 452 TMAGGKGLIYLE 463

>TBLA0E04430 Chr5 (1136737..1138182) [1446 bp, 481 aa] {ON}
           Anc_8.262 YDR110W
          Length = 481

 Score =  166 bits (419), Expect = 8e-46,   Method: Compositional matrix adjust.
 Identities = 114/384 (29%), Positives = 197/384 (51%), Gaps = 34/384 (8%)

Query: 34  ELGSDIDIERINHGRNDHLQLESVFSSFLTQKMYTLIREKNFNYET---FEEAMKSHYTD 90
           E  S+++IE +  G  D  +  S+ ++ LTQ+   ++     + E    ++  + +H   
Sbjct: 45  EKNSNVNIELLEKGYKDMQRYHSIKAAVLTQEYCDMLNTGTLSPENIIKYDTKLTNH--- 101

Query: 91  SGKYMGTANKKFMLMEDRYQLNELGQITDKRNDYKLIVPPNQIYDLIMHCHFLNDHLGST 150
                  A +K+     RY LNE   I DKR   ++I  P  +YD+++  H L  H  S 
Sbjct: 102 -----SKALEKYNFTSRRYYLNEDNNIIDKRKPGRIICEPKYMYDIVIAYH-LKLH-SSY 154

Query: 151 KIHHSLREKYSNISRALVRLSLQNCSHCNPKSTYKHIEYTRHFSCD---KN--------- 198
            +   L++ +SN+ R  +    + CS C P  T    E+ + F+ D   KN         
Sbjct: 155 AVSERLKKFFSNVGRQYIDYCAKYCSKCFPDET----EHMKLFTDDITFKNIRNNIIDRP 210

Query: 199 -FAFEKIHVEIFQPFEDVDTFANKFSHVIYIRDYFTRYVWLYPLEKISVKELANTLATHL 257
            F  E+IH+EIF PF+D+    NK+  ++YIRDY TRY+W + L+K+ +K + N L    
Sbjct: 211 LFPMERIHIEIFNPFDDL-KIENKYQRILYIRDYSTRYIWTFTLKKLKLKHITNILTEFF 269

Query: 258 L-LSLRIPIYIESLTLDESNLLKILKRISKTTNLILGVGT-TKLDEFQASGINHMKELFV 315
           L ++  +PI+++S T+D ++L  I ++IS+  ++ LG+GT  K D F  SGI   K+L  
Sbjct: 270 LSIATNVPIFLQSSTIDNTDLFDICEKISREYHISLGLGTNNKHDHFHLSGIEMFKQLVN 329

Query: 316 QNREYCGNNWNKYVIRCQNHYNTTYNKWIYGIPLNLMAQETLADN-KTYKKKRQRTILLT 374
            N+  C  +W+ +++     +N  +N  I   P++++    LA   K ++ +R R I  T
Sbjct: 330 LNKSKCLKSWSNFLVFGSVLHNNKFNSRILSKPIDIINCNNLAQGKKKFRDRRLRIIKQT 389

Query: 375 LSKNTILLKNGKSALYKESTENSI 398
           ++ N + L N  S ++ E    SI
Sbjct: 390 ITDNYVKLGNVASIIFIEDEATSI 413

>NDAI0J01380 Chr10 complement(317185..319059) [1875 bp, 624 aa] {ON}
           Anc_8.262 YDR110W
          Length = 624

 Score =  168 bits (426), Expect = 8e-46,   Method: Compositional matrix adjust.
 Identities = 110/384 (28%), Positives = 191/384 (49%), Gaps = 25/384 (6%)

Query: 24  IPELDILYKIELGSDIDIERINHGRNDHLQLESVFSSFLTQKMYTLIREKNFNYETFEEA 83
           IP +   Y   +  ++D++ +  G    L  +      L + +Y LIR K+   ET   A
Sbjct: 93  IPNVGESYMDYVDPEVDVDLLKRGEVTFLNFQRSIHGQLDEVVYELIRTKSLTEETLA-A 151

Query: 84  MKSHYTDSGKYMGTANKKFMLMEDRYQLNELGQITDKRNDYKLIVPPNQIYDLIMHCHFL 143
              H+         A  +  L + RY  +  G++ D+    +++  P  +Y+++M CH +
Sbjct: 152 NFPHFH--------APTRCALFKRRYVADNEGRVRDQLRGNRIVCDPVLLYEMMMTCHLM 203

Query: 144 NDHLGSTKIHHSLREKYSNISRALVRLSLQNCSHCNPKS------TYKHIEYTRHFSCDK 197
           NDH    + H +L   Y+NI+R  +  ++Q CS CNP         +KH+ Y +      
Sbjct: 204 NDHAQYRRCHVALSSIYANITRDFLYKAVQFCSVCNPSKLVGPLLKFKHVNYYKGM---- 259

Query: 198 NFAFEKIHVEIFQPFEDVDTFANKFSHVIYIRDYFTRYVWLYPLEKISVKELANTLATHL 257
               E++H+EIF+PF +      K+SHVIY RDY +RY+ L PL+    K L + +A  L
Sbjct: 260 -LPLERVHIEIFEPF-NGKKIEGKYSHVIYCRDYRSRYIMLEPLKNTKFKNLVSAIAKLL 317

Query: 258 LLSLRIPIYIESLTLDESNLLKILKRISKTTNLILGVGTTKLDEFQASGINHMKELFVQN 317
               RIPI+IE+++L+  +   I + I +   + +G+G      F   G+  MK L   +
Sbjct: 318 FNLPRIPIFIETVSLNTQDAFDIFEAIVEKYQINVGLGMKTAKRFHTRGVKQMKILLEGH 377

Query: 318 REYCGNNWNKYVIRCQNHYNTTYNKWIYGIPLNLMAQETL-ADNKTYKKKRQRTILLTLS 376
           R+ C N+W   +    ++YNT +N    G+P++L+        +K+ +K  Q  I+ TL 
Sbjct: 378 RKECLNDWTMCLKYGPHNYNTKHNDRACGVPVDLLTCNVKDVTHKSIEKYEQ--IIRTLP 435

Query: 377 KNTIL-LKNGKSALYKESTENSID 399
           K+ I+ + NG   L ++  + +ID
Sbjct: 436 KDNIVQIGNGSIYLEEKVKDPNID 459

>CAGL0B01771g Chr2 (163063..164673) [1611 bp, 536 aa] {ON} weakly
           similar to uniprot|O13329 Saccharomyces cerevisiae
           YDR110w FOB1 DNA replication fork blocking protein
          Length = 536

 Score =  166 bits (419), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 107/377 (28%), Positives = 184/377 (48%), Gaps = 32/377 (8%)

Query: 24  IPELDILYK---IELGSDIDIERINHGRNDHLQLESVFSSFLTQKMYTLIREKNFNYETF 80
           +P LD  Y+   +   S ID++ +  G  D  +     +  LTQ+ YTL+   N   ET 
Sbjct: 62  MPALDETYEDYLVGEDSTIDVDFLKRGEKDMRRFAEGLAGKLTQETYTLLMNNNLTMETV 121

Query: 81  EEAMKSHYTDSGKYMGTANKKFMLMEDRYQLNELGQITDKRNDYKLIVPPNQIYDLIMHC 140
            +AM     ++      A  K+  +  R+  ++ G I D + D  +++ P+++++LI+  
Sbjct: 122 MKAMNIWPPNA------AETKYSNLIKRFYKDKEGNIRDAKVDNNIVLEPDKLFNLILTA 175

Query: 141 HFLNDHLGSTKIHHSLREKYSNISRALVRLSLQNCSHCNPKSTYKHIEYTRHFSCDKN-F 199
           H  N HL +  +   LRE Y+N +R  V+ +L  C+ CNP    K IE  RH + ++   
Sbjct: 176 HLKNGHLKTAVLFQCLREVYANCTRDFVQTALFYCNRCNPDRYIKPIEKVRHRNINEELL 235

Query: 200 AFEKIHVEIFQPFEDVDT-------------FANKFSHVIYIRDYFTRYVWLYPLEKISV 246
             E++H+E+F PFE  +                 K+SHV Y RD+ TRYVW +PL+ +  
Sbjct: 236 PLERVHIEVFAPFEKEEGDIKQEDSQNPYIKIEGKYSHVFYCRDFRTRYVWCFPLKNMKF 295

Query: 247 KELANTLATHLLLSL-RIPIYIESLTLDESNLLKILKRISKTTNLILGVGTTKLDEFQAS 305
           K L + +AT  +  L   PI++ES T+D  +L +I + ++    L LG+G     +F A 
Sbjct: 296 KTLVDNIATFFMTVLYDPPIFVESSTIDRDDLKEIFELLASKYGLKLGLGFANFTKFHAQ 355

Query: 306 GINHMKELFVQNREYCGNNWNKYVIRCQNHYNTTYNKWI---YGIPLNLMAQETLAD-NK 361
           GI   K    + +  C ++W    + C      + N+ I    G   N++  E +    +
Sbjct: 356 GIKRFKTHLHRAKSECADDW----LMCLKQGTYSANRVIERQLGKASNILFTELMGQFER 411

Query: 362 TYKKKRQRTILLTLSKN 378
             +KK+ + I  + S+N
Sbjct: 412 DMRKKKLKYIEQSFSEN 428

>KLLA0F19140g Chr6 (1773327..1774910) [1584 bp, 527 aa] {ON} some
           similarities with uniprot|O13329 Saccharomyces
           cerevisiae YDR110W FOB1 Nucleolar protein required for
           DNA replication fork blocking and recombinational
           hotspot activities binds to the replication fork barrier
           site in the rDNA region related to retroviral integrases
          Length = 527

 Score =  165 bits (417), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 111/383 (28%), Positives = 191/383 (49%), Gaps = 27/383 (7%)

Query: 34  ELGS---DIDIERINHGRNDHLQLESVFSSF---LTQKMYTLIREKNFNYETFEEAMKSH 87
           +LGS   ++D + +  GR   LQLE   ++    LTQ +Y L+       E    A    
Sbjct: 65  DLGSFCGELDQDMLIEGR---LQLEKEINTVKGQLTQPIYDLLHSDALTKENLLRA-SDK 120

Query: 88  YTDSGKYMGTANKKFMLMEDRYQLNELGQITDKRNDYKLIVPPNQIYDLIMHCHFLNDHL 147
            T+S     T   KF+L++ RY + E      KR D  ++  PN+++DLIM  H LN H+
Sbjct: 121 VTNS-----TVENKFVLLKRRYYVQENLLHDVKRKDL-VVYEPNELFDLIMSVHVLNSHV 174

Query: 148 GSTKIHHSLREKYSNISRALVRLSLQNCSHCNPKSTYKHIEYTRHFSCDKNF-AFEKIHV 206
            S  I++ L   Y+N++++  +L    CS CN        +  +H +   N     + HV
Sbjct: 175 SSKGIYNELSTFYANVTQSFCKLVTSFCSKCNESGNKISYKKFKHENIHANLIPLGRCHV 234

Query: 207 EIFQPFE---------DVDTFANKFSHVIYIRDYFTRYVWLYPLEKISVKELANTLATHL 257
           EIF PF+         D      K+  V+Y RDY++RYVWL PL+ +++ +L   +   L
Sbjct: 235 EIFAPFDSAYQGNDNTDELKIEGKYPFVLYCRDYYSRYVWLEPLKSVTLSDLLPVMTKLL 294

Query: 258 LLSLRIPIYIESLTLDESNLLKILKRISKTTNLILGVGTTKLDEFQASGINHMKELFVQN 317
              +R+PI+I++ TLD  ++  + + I++   + +G+G      FQ +GI  MK LF+Q+
Sbjct: 295 FSMIRMPIFIDTCTLDRQDMFDVCENIARIYKIKIGLGMNSSTSFQKTGIKRMKSLFLQH 354

Query: 318 REYCGNNWNKYVIRCQNHYNTTYNKWIYGIPLNLMAQETLADNKTYKKKRQRTILLTLSK 377
           +E C ++WN  +    +  N  Y+  + G+P +L+       +K ++  ++  I   L  
Sbjct: 355 KEECLHDWNMCLKLVVSRLNQNYSDRVRGVPSDLLCSTQQDLHKKFRTLQRNVISRLLGH 414

Query: 378 NTILLKNGKSALYKESTENSIDL 400
           + +  +     +Y E  ENS +L
Sbjct: 415 HVVQFEEAGGMIYLED-ENSPNL 436

>NCAS0B03850 Chr2 complement(685424..687190) [1767 bp, 588 aa] {ON}
           Anc_8.262 YDR110W
          Length = 588

 Score =  156 bits (395), Expect = 1e-41,   Method: Compositional matrix adjust.
 Identities = 103/378 (27%), Positives = 179/378 (47%), Gaps = 26/378 (6%)

Query: 24  IPELDILYKIELGSDIDIERINHGRNDHLQLESVFSSFLTQKMYTLIREKNFNYETFEE- 82
           IP +   YK  +  D+D+  +  G  +  + +   +  L +  Y LI+  +   ET    
Sbjct: 84  IPNIGEKYKDYVDEDMDLAFVQRGEREFFEFQKTINGQLNESTYELIKTNSLTQETLSAT 143

Query: 83  AMKSHYTDSGKYMGTANKKFMLMEDRYQLNELGQITDKRNDYKLIVPPNQIYDLIMHCHF 142
           A+K       K+   A  + + +  RY L+E G + DK    +++  P  IYD+IM  H 
Sbjct: 144 ALKMD-----KFR--AASRLVFLNRRYGLDEQGNVRDKLRQNRMVCEPVFIYDMIMTWHL 196

Query: 143 LNDHLGSTKIHHSLREKYSNISRALVRLSLQNCSHCNPKST------YKHIEYTRHFSCD 196
           +NDH    K H  L   YSNI+R  V    Q CS CNP         YKHI + +     
Sbjct: 197 INDHGRPRKCHQLLGPMYSNITRFFVERICQFCSVCNPSKETIPFKKYKHINWFKGL--- 253

Query: 197 KNFAFEKIHVEIFQPFEDVDTFANKFSHVIYIRDYFTRYVWLYPLEKISVKELANTLATH 256
                E++ VE+F+PF   +    K+  ++Y RDY +R++W+ PL       L + ++  
Sbjct: 254 --LPLERVQVEVFEPFPG-EKLGGKYPQILYFRDYRSRFIWMVPLRNSKFGHLVDLISKM 310

Query: 257 LLLSLRIPIYIESLTLDESNLLKILKRISKTTNLILGVGTTKLDEFQASGINHMKELFVQ 316
           +   +RIPI+ E+ T++  +   I ++I +   + +G+GT    +   +G+  +++L   
Sbjct: 311 IFSMIRIPIFFETTTIENQDFFDIFEKIVEKYQINIGLGTKLGGKRLTNGLPQIRKLLGP 370

Query: 317 NREYCGNNWNKYVIRCQNHYNTTYNKWIYGIPLNLMAQETLAD--NKTYKKKRQRTILLT 374
           ++E C  +W   +    + +N   N    G+P +L+  + + D   K+Y K  Q  IL  
Sbjct: 371 HKEECLADWIMCLKYGPHTFNNKMNDRACGVPGDLLTGD-IPDLYTKSYDKIEQ--ILQD 427

Query: 375 LSKNTILLKNGKSALYKE 392
           L    I +K G+  +Y E
Sbjct: 428 LPTENI-VKIGRGCIYLE 444

>TBLA0F03070 Chr6 complement(745795..747132) [1338 bp, 445 aa] {ON}
           Anc_8.262 YDR110W
          Length = 445

 Score =  139 bits (351), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 104/385 (27%), Positives = 185/385 (48%), Gaps = 20/385 (5%)

Query: 16  NDRIIKVD---IPELDILYKIELGSDIDIERINHGRNDHLQLESVFSSFLTQKMYTLIRE 72
           N+++I +D    P +    +I   S ID + +  G  + ++  +     +T  +Y  +R+
Sbjct: 19  NEQLIDIDDFFCPPIGDDDEIYYDSYIDSDMLKRGEKETMEFRNTLKKHITSDLYYAMRD 78

Query: 73  KNFNYETFEEAMKSHYTDSGKYMGTANKKFMLMEDRYQLNELGQITDKRNDYKLIVPPNQ 132
                    E++          +     K M ++ RY  N  G + + + + KL+  P  
Sbjct: 79  ---------ESLLEDDAPIPASLKIKTSKKMYLQIRYSKNSDGDLIETKTN-KLLCEPKY 128

Query: 133 IYDLIMHCHFLNDHLGSTKIHHSLREKYSNISRALVRLSLQNCSHCNPKSTYKHIE--YT 190
           IY L M  HF+N+H+ S K++ +L  KY NI   LV L LQ CSHCN     + I   Y 
Sbjct: 129 IYKLTMKAHFMNNHMRSNKLYRNLSMKYCNIPNLLVVLVLQYCSHCNTTGKIRDIRSNYG 188

Query: 191 RHFSCDKNFAFEKIHVEIFQPFEDVDT-FANKFSHVIYIRDYFTRYVWLYPLEKISVKEL 249
           +          E++ ++I +PF D D   ANK+SH++ IRDY +RY W++PL+  ++K +
Sbjct: 189 QRNQYIDYLPLERLQIDITKPFNDSDIKIANKYSHILLIRDYHSRYSWIFPLKSPNIKNI 248

Query: 250 ANTLATHLLLSLRIPIYIESLTLDESNLLKILKRI--SKTTNLILGVGTTKLDEFQASGI 307
           +  L   L+   R PI++ S+ + ES L+KIL +I       + +G+G  K   F   GI
Sbjct: 249 STELGKFLVTLPRTPIFLHSIGIPESQLIKILTKILLEYKIKIRIGIGGIKGRMFLRKGI 308

Query: 308 NHMKEL--FVQNREYCGNNWNKYVIRCQNHYNTTYNKWIYGIPLNLMAQETLADNKTYKK 365
           + +  L    +N+E C ++W + +       N  +++        L+ ++    NK ++ 
Sbjct: 309 SRLVYLLNLKENKEKCKSDWYQCIRNTTFKENRRFDRNTGSFANFLIGKQKAELNKVFEN 368

Query: 366 KRQRTILLTLSKNTILLKNGKSALY 390
           KR   +   L +N + +    S +Y
Sbjct: 369 KRDALLSDLLEENVLKIGECGSIIY 393

>KNAG0H03240 Chr8 complement(603920..605479) [1560 bp, 519 aa] {ON}
           Anc_8.262 YDR110W
          Length = 519

 Score =  139 bits (351), Expect = 5e-36,   Method: Compositional matrix adjust.
 Identities = 97/360 (26%), Positives = 173/360 (48%), Gaps = 20/360 (5%)

Query: 39  IDIERINHGRNDHLQLESVFSSFLTQKMYTLIREKNFNYETFEEAMKSHYTDSGKYMGTA 98
           +DIE    G  D           ++Q++Y L +  +    T E   + + TD     G  
Sbjct: 51  LDIEFCKRGERDITAYAPTQPGRMSQELYALFKNDDV---TKENIARLYPTDRS---GDE 104

Query: 99  NKKFMLMEDRYQLNELGQITDKRNDYKLIVPPNQIYDLIMHCHFLNDHLGSTKIHHSLRE 158
           ++K M +  RY  +  G I D   + +++  P   +D+IM CH +N HLGS +++  LRE
Sbjct: 105 SRKMMYITRRYYKDANGMIRDATMNNRIVYDPIHTFDIIMSCHLMNKHLGSERVYRCLRE 164

Query: 159 KYSNISRALVRLSLQNCSHCNPKSTYKHIEYTRHFSCDKNFAFEKIHVEIFQPFEDVDTF 218
            Y+N    L++ +L+ CS CNP          + +  +K    E+I +EI +PF + +  
Sbjct: 165 FYANGGPLLIKRTLEYCSVCNPSLKLTPKVQPKPYLFEKALPLERITIEIIEPFPN-EKV 223

Query: 219 ANKFSHVIYIRDYFTRYVWLYPLEKISVKELANTLATHLLLSLRIPIYIESLTLDESNLL 278
             K+S+++ ++D+  R+ WL PL+    K +   +A  +L   R+PI++ES TLD S+L 
Sbjct: 224 EGKYSNMVVMKDFIGRFEWLEPLKNTKFKNIVPVVAKMILSFPRVPIWVESNTLDWSDLF 283

Query: 279 KILKRISKTTNLILGVG-TTKLDEFQASGINHMKELFVQNREYCGNNWNKYVIRCQNHYN 337
            I + I     + +G+G TT+    QA+    +      + + C  ++N     C  +  
Sbjct: 284 DIFEMIVTKYGIKIGLGCTTRSSAAQATA--RINRDLNDHHDECLFDFNN----CLKYGP 337

Query: 338 TTYNKWIY-GI---PLNLMAQETLADNKTYKKKRQRTILLTLSKNTILLKNGKSALYKES 393
           T YN+  Y G    P ++++         ++ K  R  +L  S ++ ++  G   LY ES
Sbjct: 338 TKYNQIKYLGFHKSPCDIISHSETQLKAKFRAK--RAFILKHSPSSCVMNRGMGTLYLES 395

>TPHA0A01810 Chr1 complement(365982..367355) [1374 bp, 457 aa] {ON}
           Anc_8.262 YDR110W
          Length = 457

 Score = 89.0 bits (219), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 59/280 (21%), Positives = 145/280 (51%), Gaps = 16/280 (5%)

Query: 20  IKVDIPELDILYKIELGSDIDIERINHGRNDHLQLESVFSSFLTQKMYTLIREKNFNYET 79
           IK  IP +   Y   +   +D + +  G    + + +  +++L++++Y L++  +   + 
Sbjct: 29  IKYIIPRIGQKYDSLITPLLDKQLLQKG---EIAVANSKTNYLSKELYDLVKNDDLTRKN 85

Query: 80  FEEAMKSHYTDSGKYMGTANKKFMLMEDRYQLNELGQITDKRNDYKLIVPPNQIYDLIMH 139
              A+     +       A  + + ++ RY  +    + D+    K+++ P   + ++M 
Sbjct: 86  VAVALNLDEKN-------AITRLIPLKHRYYRDSKLMVHDRSKQNKIVIDPAHRFRMVMT 138

Query: 140 CHFLNDHLGSTKIHHSLREKYSNISRALVRLSLQNCSHCNP--KSTYKHIEYTRHFSCDK 197
            H LNDHL    I+ +L + ++N+S   ++ S++ CS CN   K+  +  E     S D 
Sbjct: 139 THLLNDHLTRGAIYRTLSKCFANLSDPFIKTSIEYCSICNSNKKNIRRKKEPQLSNSPDI 198

Query: 198 NFAFEKIHVEIFQPFEDVDTFANKFSHVIYIRDYFTRYVWLYPLEKISVKELANTLATHL 257
            F +E++ +++  PF        +++H++ I D+ T+++W +PL+ + ++ + + + T  
Sbjct: 199 LF-YERLILDVVAPF-GAKKIQKRYTHILTITDFHTKFMWSFPLKNLKLRTIISKV-TEF 255

Query: 258 LLSLRI-PIYIESLTLDESNLLKILKRISKTTNLILGVGT 296
           +++L + P++I S TL  +++ ++   +++  N+ +G+GT
Sbjct: 256 IVALPVKPVFISSFTLSLNDIFELCCYLAREYNISIGLGT 295

>NCAS0A06040 Chr1 complement(1193225..1194991) [1767 bp, 588 aa]
           {ON} 
          Length = 588

 Score = 42.0 bits (97), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 56/247 (22%), Positives = 89/247 (36%), Gaps = 41/247 (16%)

Query: 69  LIREKNFNYETFEEAMKSHYTDSGKYMGTANKKFMLMEDRYQLNELGQITDKR------- 121
           L+    FN E+ + A+ S YT      G  NK   +   + +L         R       
Sbjct: 68  LLLANKFNPESLKAAVFSKYT------GAENKGTAISRSKRKLKNFCDYITARYVVIDEK 121

Query: 122 ----------NDYKLIVPPNQIYDLIMHCHFLND---------HLGSTKIHHSLREKYSN 162
                        K+  PP+ +   I+  H   D         H G    H ++ EK S 
Sbjct: 122 IYARKASKGDESPKMWCPPSLMTFFIIRYHRRQDIDESERKARHRGVAATHDAIGEKMSG 181

Query: 163 ISRALVRLSLQNCSHCNPKSTYKHIEYTRHFSCDKNFAFEKIHVEIFQPFEDVDTFA--- 219
           I+R L++    +C  CN       I Y    +      FE + ++I    +D        
Sbjct: 182 ITRQLIQDVTYDCLKCNVTKGVPII-YVPDDNPKAEVPFENLLIDIID-LKDRSCRCPKD 239

Query: 220 -NKFSHVIYIRDYFTRYVWLYPLEKI---SVKELANTLATHLLLSLRIPIYIESLTLDES 275
             K S +++I D +T Y WLY L+     ++  +   L  H  LS +     +      S
Sbjct: 240 NKKKSQILHIMDQYTEYTWLYILDDTHHDAIAMIFEVLLYHFPLSTKHVYVDDGKEFRSS 299

Query: 276 NLLKILK 282
             LKIL+
Sbjct: 300 KFLKILE 306

>NDAI0D03010 Chr4 complement(712188..714524) [2337 bp, 778 aa] {ON} 
          Length = 778

 Score = 41.6 bits (96), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 35/138 (25%), Positives = 57/138 (41%), Gaps = 14/138 (10%)

Query: 118 TDKRNDYKLIVPPNQIYDLIMHC---------HFLNDHLGSTKIHHSLREKYSNISRALV 168
           T   N  KLI  P  +   ++ C         + L  H    +I   L  KY NIS+ L+
Sbjct: 145 TSPHNKKKLIWCPPTLLHYVIACVHENWDCDDYTLRKHRDENEIQSILAAKYHNISKFLI 204

Query: 169 RLSLQNCSHCNPKSTYKHIEYTRHFSCDKNFAFEKIHVEIFQPFEDVDTFANK----FSH 224
              +  C  C P S+ K      +      ++F+++ V+I     D      K     + 
Sbjct: 205 HDVVAACPDCKPLSSKKFNITRVNVLPLTRYSFQRLQVKILS-AADYSCVCPKDNCTKNA 263

Query: 225 VIYIRDYFTRYVWLYPLE 242
           ++YI DY +  VWL+ L+
Sbjct: 264 ILYIGDYHSGAVWLFALD 281

>Ecym_3148 Chr3 (272390..275548) [3159 bp, 1052 aa] {ON} similar to
           Ashbya gossypii AFR424C
          Length = 1052

 Score = 38.1 bits (87), Expect = 0.048,   Method: Compositional matrix adjust.
 Identities = 41/161 (25%), Positives = 79/161 (49%), Gaps = 24/161 (14%)

Query: 18  RIIKVDIPELD------ILYKIELGSDIDIERINHGRNDHLQLESVFSS--FLTQKMYTL 69
           R+IK+  P+LD      +L K  L   + I+ ++   ND+  +++ F +  ++ + +  L
Sbjct: 586 RLIKITKPKLDNETISQLLSK--LAPLLTIKNLSGVTNDN-DVDTTFDNQLYIFEGVGML 642

Query: 70  IREKNFN-YETFEEAMKSHYTDSGKYMGTANKKF-MLMEDRYQLNELGQITDKRNDYKLI 127
           I  K+ + YE  +  + S ++D    + T  K   ++++  + L  +G I   R  +  +
Sbjct: 643 IGAKSTDDYEILDGVLTSLFSDLESCISTTVKTLEVVLQAHHVLMAIGTIA--RGVHAGL 700

Query: 128 VPPNQIYDLIMHCHFLNDHLGSTKIHHSLREKYSNISRALV 168
           VP NQI          N  + S  +H SL EK+SNI+  ++
Sbjct: 701 VPENQIN---------NSQVTSALVHKSLIEKFSNIAEVIL 732

>NDAI0B06160 Chr2 (1494425..1498636) [4212 bp, 1403 aa] {ON} 
          Length = 1403

 Score = 37.7 bits (86), Expect = 0.066,   Method: Compositional matrix adjust.
 Identities = 24/72 (33%), Positives = 37/72 (51%), Gaps = 6/72 (8%)

Query: 175 CSHC--NPKSTYKHIEYTRHFSCDKNF-AFEKIHVEIFQPFEDVDTFANKFSHVIYIRDY 231
           C  C     + +KHI  +R     K++  FE IH ++F P   VD  + K+   I   D 
Sbjct: 348 CKDCLAGKITKHKHIVGSR-LKYQKSYEPFEYIHTDLFGPVSGVDITSPKY--FISFTDE 404

Query: 232 FTRYVWLYPLEK 243
            TR+ W++PL+K
Sbjct: 405 NTRFRWVFPLKK 416

>KAFR0B06620 Chr2 complement(1376088..1379645) [3558 bp, 1185 aa]
           {ON} 
          Length = 1185

 Score = 37.0 bits (84), Expect = 0.088,   Method: Compositional matrix adjust.
 Identities = 22/63 (34%), Positives = 30/63 (47%), Gaps = 10/63 (15%)

Query: 200 AFEKIHVEIFQPFEDVDTFANKFSHVIYIRDYFTRYVWLYPLEKISVKELANTLATHLLL 259
            F+ IH ++F P  DV   A   ++ I   D  TR+ W+YPL   S        A H+LL
Sbjct: 666 PFQYIHTDLFGPMSDVS--ATTPTYFISFVDENTRFRWVYPLRSKS--------AEHILL 715

Query: 260 SLR 262
             R
Sbjct: 716 VFR 718

>NDAI0G00550 Chr7 complement(116985..118223) [1239 bp, 412 aa] {ON} 
          Length = 412

 Score = 36.2 bits (82), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 17/44 (38%), Positives = 25/44 (56%), Gaps = 2/44 (4%)

Query: 200 AFEKIHVEIFQPFEDVDTFANKFSHVIYIRDYFTRYVWLYPLEK 243
            FE IH ++F P   VD  + K+   I   D  TR+ W++PL+K
Sbjct: 290 PFEYIHTDLFGPVSGVDITSPKY--FISFTDENTRFRWVFPLKK 331

>SAKL0F06809g2 Chr6 (518357..519658,519660..523625) [5268 bp, 1755
           aa] {ON} Retrotransposon Gag and Pol genes
          Length = 1755

 Score = 35.8 bits (81), Expect = 0.22,   Method: Compositional matrix adjust.
 Identities = 20/69 (28%), Positives = 34/69 (49%), Gaps = 4/69 (5%)

Query: 175 CSHC--NPKSTYKHIEYTRHFSCDKNFAFEKIHVEIFQPFEDVDTFANKFSHVIYIRDYF 232
           C  C     + ++H++ +R    D    F+ +H +IF P  ++   A   S+ I   D  
Sbjct: 637 CPDCLIGKSTKHRHVKGSRVKYQDSYEPFQYLHTDIFGPVHNLPKSAP--SYFITFTDEK 694

Query: 233 TRYVWLYPL 241
           TR+ W+YPL
Sbjct: 695 TRFQWVYPL 703

>Kwal_39.16423 s39 (13455..13676) [222 bp, 74 aa] {ON} YDR261W-B -
           TyB Gag-Pol protein [contig 372] PARTIAL
          Length = 74

 Score = 32.7 bits (73), Expect = 0.23,   Method: Composition-based stats.
 Identities = 19/62 (30%), Positives = 30/62 (48%), Gaps = 2/62 (3%)

Query: 184 YKHIEYTRHFSCDKNFAFEKIHVEIFQPFEDVDTFANKFSHVIYIRDYFTRYVWLYPLEK 243
           + HI  +R    +K    E +H +IF P   + +   K+   I   D  TRY W++PL +
Sbjct: 8   HNHIANSRDTYQEKYADLEFLHTDIFGPMHHMPSGVPKY--FITFTDERTRYRWVFPLSR 65

Query: 244 IS 245
            S
Sbjct: 66  KS 67

>Kwal_23.3713 s23 (400838..401074) [237 bp, 78 aa] {ON} YLR035C-A -
           Ty ORF [contig 254] FULL
          Length = 78

 Score = 32.3 bits (72), Expect = 0.33,   Method: Composition-based stats.
 Identities = 19/62 (30%), Positives = 30/62 (48%), Gaps = 2/62 (3%)

Query: 184 YKHIEYTRHFSCDKNFAFEKIHVEIFQPFEDVDTFANKFSHVIYIRDYFTRYVWLYPLEK 243
           + HI  +R    +K    E +H +IF P   + +   K+   I   D  TRY W++PL +
Sbjct: 8   HNHIANSRDTYQEKYADLEFLHTDIFGPMHHMPSGVPKY--FITFTDERTRYRWVFPLSR 65

Query: 244 IS 245
            S
Sbjct: 66  KS 67

>Kwal_47.17033 s47 complement(218594..218947) [354 bp, 117 aa] {ON}
           YDR261W-B - TyB Gag-Pol protein [contig 215] FULL
          Length = 117

 Score = 32.7 bits (73), Expect = 0.53,   Method: Composition-based stats.
 Identities = 19/62 (30%), Positives = 30/62 (48%), Gaps = 2/62 (3%)

Query: 184 YKHIEYTRHFSCDKNFAFEKIHVEIFQPFEDVDTFANKFSHVIYIRDYFTRYVWLYPLEK 243
           + HI  +R    +K    E +H +IF P   + +   K+   I   D  TRY W++PL +
Sbjct: 8   HNHIANSRDTYQEKYADLEFLHTDIFGPMHHMPSGVPKY--FITFTDERTRYRWVFPLSR 65

Query: 244 IS 245
            S
Sbjct: 66  KS 67

>Kwal_36.16338 s36 (3460..5271) [1812 bp, 604 aa] {ON} YPL060C-A -
           TyA Gag protein [contig 364] PARTIAL
          Length = 604

 Score = 34.3 bits (77), Expect = 0.57,   Method: Compositional matrix adjust.
 Identities = 22/80 (27%), Positives = 34/80 (42%), Gaps = 4/80 (5%)

Query: 168 VRLSLQNCSHC--NPKSTYKHIEYTRHFSCDKNFAFEKIHVEIFQPFEDVDTFANKFSHV 225
           + L    C  C       + HI  +R    +K    E +H +IF P   + +   K+   
Sbjct: 88  IELEWFECESCMAGKGKRHNHIANSRDTYQEKYADLEFLHTDIFGPMHHMPSGVPKY--F 145

Query: 226 IYIRDYFTRYVWLYPLEKIS 245
           I   D  TRY W++PL + S
Sbjct: 146 ITFTDERTRYRWVFPLSRKS 165

>Kwal_9.616 s9 (909..1952) [1044 bp, 347 aa] {ON} YLR410W-B - TyB
           Gag-Pol protein [contig 351] FULL
          Length = 347

 Score = 33.9 bits (76), Expect = 0.65,   Method: Compositional matrix adjust.
 Identities = 26/95 (27%), Positives = 39/95 (41%), Gaps = 8/95 (8%)

Query: 168 VRLSLQNCSHC--NPKSTYKHIEYTRHFSCDKNFAFEKIHVEIFQPFEDVDTFANKFSHV 225
           + L    C  C       + HI  +R    +K    E +H +IF P   + +   K+   
Sbjct: 249 IELEWFECESCMAGKGKRHNHIANSRDTYQEKYADLEFLHTDIFGPMHHMPSGVPKY--F 306

Query: 226 IYIRDYFTRYVWLYPLEKIS----VKELANTLATH 256
           I   D  TRY W++PL + S    V+    T  TH
Sbjct: 307 ITFTDERTRYRWVFPLSRKSDEAVVRSFQKTNCTH 341

>Kwal_39.16409 s39 (7556..9760) [2205 bp, 734 aa] {ON} YLR035C-A -
           Ty ORF [contig 372] FULL
          Length = 734

 Score = 34.3 bits (77), Expect = 0.69,   Method: Compositional matrix adjust.
 Identities = 22/80 (27%), Positives = 34/80 (42%), Gaps = 4/80 (5%)

Query: 168 VRLSLQNCSHC--NPKSTYKHIEYTRHFSCDKNFAFEKIHVEIFQPFEDVDTFANKFSHV 225
           + L    C  C       + HI  +R    +K    E +H +IF P   + +   K+   
Sbjct: 249 IELEWFECESCMAGKGKRHNHIANSRDTYQEKYADLEFLHTDIFGPMHHMPSGVPKY--F 306

Query: 226 IYIRDYFTRYVWLYPLEKIS 245
           I   D  TRY W++PL + S
Sbjct: 307 ITFTDERTRYRWVFPLSRKS 326

>Kwal_33.15089 s33 complement(956930..958366) [1437 bp, 478 aa] {ON}
           YPL060C-A - TyA Gag protein [contig 94] FULL
          Length = 478

 Score = 33.9 bits (76), Expect = 0.70,   Method: Compositional matrix adjust.
 Identities = 21/73 (28%), Positives = 32/73 (43%), Gaps = 4/73 (5%)

Query: 175 CSHC--NPKSTYKHIEYTRHFSCDKNFAFEKIHVEIFQPFEDVDTFANKFSHVIYIRDYF 232
           C  C       + HI  +R    +K    E +H +IF P   + +   K+   I   D  
Sbjct: 95  CESCMAGKGKRHNHIANSRDTYQEKYADLEFLHTDIFGPMHHMPSGVPKY--FITFTDER 152

Query: 233 TRYVWLYPLEKIS 245
           TRY W++PL + S
Sbjct: 153 TRYRWVFPLSRKS 165

>Kwal_1.407 s1 (1976..2536) [561 bp, 186 aa] {ON} YAR009C - TyB
           Gag-Pol protein [contig 695] FULL
          Length = 186

 Score = 33.1 bits (74), Expect = 0.74,   Method: Compositional matrix adjust.
 Identities = 22/88 (25%), Positives = 37/88 (42%), Gaps = 4/88 (4%)

Query: 168 VRLSLQNCSHC--NPKSTYKHIEYTRHFSCDKNFAFEKIHVEIFQPFEDVDTFANKFSHV 225
           + L    C  C       + HI  +R    +K    E +H +IF P   + +   K+   
Sbjct: 88  IELEWFECESCMAGKGKRHNHIANSRDTYQEKYADLEFLHTDIFGPMHHMPSGVPKY--F 145

Query: 226 IYIRDYFTRYVWLYPLEKISVKELANTL 253
           I   D  TRY W++PL + S + +  + 
Sbjct: 146 ITFTDERTRYRWVFPLSRKSDEAVVGSF 173

>Kwal_27.11219 s27 complement(690913..693147) [2235 bp, 744 aa] {ON}
           YPL060C-A - TyA Gag protein [contig 345] FULL
          Length = 744

 Score = 33.9 bits (76), Expect = 0.76,   Method: Compositional matrix adjust.
 Identities = 22/80 (27%), Positives = 34/80 (42%), Gaps = 4/80 (5%)

Query: 168 VRLSLQNCSHC--NPKSTYKHIEYTRHFSCDKNFAFEKIHVEIFQPFEDVDTFANKFSHV 225
           + L    C  C       + HI  +R    +K    E +H +IF P   + +   K+   
Sbjct: 143 IELEWFECESCMAGKGKRHNHIANSRDTYQEKYADLEFLHTDIFGPMHHMPSGVPKY--F 200

Query: 226 IYIRDYFTRYVWLYPLEKIS 245
           I   D  TRY W++PL + S
Sbjct: 201 ITFTDERTRYRWVFPLSRKS 220

>Kwal_50.19418 s50 complement(1189..2235) [1047 bp, 348 aa] {ON}
           YPL060C-A - TyA Gag protein [contig 328] FULL
          Length = 348

 Score = 33.9 bits (76), Expect = 0.77,   Method: Compositional matrix adjust.
 Identities = 19/62 (30%), Positives = 30/62 (48%), Gaps = 2/62 (3%)

Query: 184 YKHIEYTRHFSCDKNFAFEKIHVEIFQPFEDVDTFANKFSHVIYIRDYFTRYVWLYPLEK 243
           + HI  +R    +K    E +H +IF P   + +   K+   I   D  TRY W++PL +
Sbjct: 8   HNHIANSRDTYQEKYADLEFLHTDIFGPMHHMPSGVPKY--FITFTDERTRYRWVFPLSR 65

Query: 244 IS 245
            S
Sbjct: 66  KS 67

>Kwal_26.7891 s26 complement(557640..558572) [933 bp, 310 aa] {ON}
           YDR261C-D - TyB Gag-Pol protein [contig 55] FULL
          Length = 310

 Score = 33.5 bits (75), Expect = 0.89,   Method: Compositional matrix adjust.
 Identities = 22/80 (27%), Positives = 34/80 (42%), Gaps = 4/80 (5%)

Query: 168 VRLSLQNCSHC--NPKSTYKHIEYTRHFSCDKNFAFEKIHVEIFQPFEDVDTFANKFSHV 225
           + L    C  C       + HI  +R    +K    E +H +IF P   + +   K+   
Sbjct: 88  IELEWFECESCMAGKGKRHNHIANSRDTYQEKYADLEFLHTDIFGPMHHMPSGVPKY--F 145

Query: 226 IYIRDYFTRYVWLYPLEKIS 245
           I   D  TRY W++PL + S
Sbjct: 146 ITFTDERTRYRWVFPLSRKS 165

>Kwal_47.17665 s47 complement(505870..507747) [1878 bp, 625 aa] {ON}
           YDR261C-D - TyB Gag-Pol protein [contig 206] FULL
          Length = 625

 Score = 33.9 bits (76), Expect = 0.89,   Method: Compositional matrix adjust.
 Identities = 19/62 (30%), Positives = 30/62 (48%), Gaps = 2/62 (3%)

Query: 184 YKHIEYTRHFSCDKNFAFEKIHVEIFQPFEDVDTFANKFSHVIYIRDYFTRYVWLYPLEK 243
           + HI  +R    +K    E +H +IF P   + +   K+   I   D  TRY W++PL +
Sbjct: 8   HNHIANSRDTYQEKYADLEFLHTDIFGPMHHMPSGVPKY--FITFTDERTRYRWVFPLSR 65

Query: 244 IS 245
            S
Sbjct: 66  KS 67

>SAKL0C11913g1 Chr3 complement(1069940..1073905,1073907..1075208)
           [5268 bp, 1755 aa] {ON} Retrotransposon Gag and Pol
           genes
          Length = 1755

 Score = 33.9 bits (76), Expect = 0.94,   Method: Compositional matrix adjust.
 Identities = 19/69 (27%), Positives = 34/69 (49%), Gaps = 4/69 (5%)

Query: 175 CSHC--NPKSTYKHIEYTRHFSCDKNFAFEKIHVEIFQPFEDVDTFANKFSHVIYIRDYF 232
           C  C     + ++H++ +R    +    F+ +H +IF P  ++   A   S+ I   D  
Sbjct: 637 CPDCLIGKSTKHRHVKGSRVKYQNSYEPFQYLHTDIFGPVHNLPKSAP--SYFITFTDEK 694

Query: 233 TRYVWLYPL 241
           TR+ W+YPL
Sbjct: 695 TRFQWVYPL 703

>SAKL0B11583g2 Chr2 (998260..999561,999563..1003528) [5268 bp, 1755
           aa] {ON} Retrotransposon Gag and Pol genes
          Length = 1755

 Score = 33.9 bits (76), Expect = 0.95,   Method: Compositional matrix adjust.
 Identities = 19/69 (27%), Positives = 34/69 (49%), Gaps = 4/69 (5%)

Query: 175 CSHC--NPKSTYKHIEYTRHFSCDKNFAFEKIHVEIFQPFEDVDTFANKFSHVIYIRDYF 232
           C  C     + ++H++ +R    +    F+ +H +IF P  ++   A   S+ I   D  
Sbjct: 637 CPDCLIGKSTKHRHVKGSRVKYQNSYEPFQYLHTDIFGPVHNLPKSAP--SYFITFTDEK 694

Query: 233 TRYVWLYPL 241
           TR+ W+YPL
Sbjct: 695 TRFQWVYPL 703

>Kwal_27.12438 s27 (1219039..1220964) [1926 bp, 641 aa] {ON}
           YOR343C-B - TyB Gag-Pol protein [contig 457] FULL
          Length = 641

 Score = 33.5 bits (75), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 21/73 (28%), Positives = 32/73 (43%), Gaps = 4/73 (5%)

Query: 175 CSHC--NPKSTYKHIEYTRHFSCDKNFAFEKIHVEIFQPFEDVDTFANKFSHVIYIRDYF 232
           C  C       + HI  +R    +K    E +H +IF P   + +   K+   I   D  
Sbjct: 256 CESCMAGKGKRHNHIANSRDTYQEKYADLEFLHTDIFGPMHHMPSGVPKY--FITFTDER 313

Query: 233 TRYVWLYPLEKIS 245
           TRY W++PL + S
Sbjct: 314 TRYRWVFPLSRKS 326

>Kwal_54.19470 s54 (253..1881) [1629 bp, 542 aa] {ON} YDR261C-D -
           TyB Gag-Pol protein [contig 416] FULL
          Length = 542

 Score = 33.5 bits (75), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 21/73 (28%), Positives = 32/73 (43%), Gaps = 4/73 (5%)

Query: 175 CSHC--NPKSTYKHIEYTRHFSCDKNFAFEKIHVEIFQPFEDVDTFANKFSHVIYIRDYF 232
           C  C       + HI  +R    +K    E +H +IF P   + +   K+   I   D  
Sbjct: 191 CESCMAGKGKRHNHIANSRDTYQEKYADLEFLHTDIFGPMHHMPSGVPKY--FITFTDER 248

Query: 233 TRYVWLYPLEKIS 245
           TRY W++PL + S
Sbjct: 249 TRYRWVFPLSRKS 261

>Kwal_60.24910 s60 (1218..2792) [1575 bp, 524 aa] {ON} YDR261W-B -
           TyB Gag-Pol protein [contig 691] FULL
          Length = 524

 Score = 33.5 bits (75), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 22/80 (27%), Positives = 34/80 (42%), Gaps = 4/80 (5%)

Query: 168 VRLSLQNCSHC--NPKSTYKHIEYTRHFSCDKNFAFEKIHVEIFQPFEDVDTFANKFSHV 225
           + L    C  C       + HI  +R    +K    E +H +IF P   + +   K+   
Sbjct: 384 IELEWFECESCMAGKGKRHNHIANSRDTYQEKYADLEFLHTDIFGPMHHMPSGVPKY--F 441

Query: 226 IYIRDYFTRYVWLYPLEKIS 245
           I   D  TRY W++PL + S
Sbjct: 442 ITFTDERTRYRWVFPLSRKS 461

>Kwal_13.691 s13 complement(2834..5431) [2598 bp, 865 aa] {ON}
           YBL101W-B - TyB Gag-Pol protein [contig 696] FULL
          Length = 865

 Score = 33.5 bits (75), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 21/73 (28%), Positives = 32/73 (43%), Gaps = 4/73 (5%)

Query: 175 CSHC--NPKSTYKHIEYTRHFSCDKNFAFEKIHVEIFQPFEDVDTFANKFSHVIYIRDYF 232
           C  C       + HI  +R    +K    E +H +IF P   + +   K+   I   D  
Sbjct: 191 CESCMAGKGKRHNHIANSRDTYQEKYADLEFLHTDIFGPMHHMPSGVPKY--FITFTDER 248

Query: 233 TRYVWLYPLEKIS 245
           TRY W++PL + S
Sbjct: 249 TRYRWVFPLSRKS 261

>Kwal_2.424 s2 (2177..2896) [720 bp, 239 aa] {ON} YBL101W-B - TyB
           Gag-Pol protein [contig 305] FULL
          Length = 239

 Score = 32.7 bits (73), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 19/60 (31%), Positives = 29/60 (48%), Gaps = 2/60 (3%)

Query: 186 HIEYTRHFSCDKNFAFEKIHVEIFQPFEDVDTFANKFSHVIYIRDYFTRYVWLYPLEKIS 245
           HI  +R    +K    E +H +IF P   + +   K+   I   D  TRY W++PL + S
Sbjct: 10  HIANSRDTYQEKYADLEFLHTDIFGPMHHMPSGVPKY--FITFTDERTRYRWVFPLSRKS 67

>YNL054W-B Chr14 (519456..520760,520762..524706) [5250 bp, 1749 aa]
           {OFF} TyB Gag-Pol protein; proteolytically processed to
           make the Gag, RT, PR, and IN proteins that are required
           for retrotransposition
          Length = 1749

 Score = 33.5 bits (75), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 19/69 (27%), Positives = 34/69 (49%), Gaps = 4/69 (5%)

Query: 175 CSHC--NPKSTYKHIEYTRHFSCDKNFAFEKIHVEIFQPFEDVDTFANKFSHVIYIRDYF 232
           C  C     + ++HI+ +R    +    F+ +H +IF P  ++   A   S+ I   D  
Sbjct: 637 CPDCLIGKSTKHRHIKGSRLKYQNSYEPFQYLHTDIFGPVHNLPKSAP--SYFISFTDET 694

Query: 233 TRYVWLYPL 241
           T++ W+YPL
Sbjct: 695 TKFRWVYPL 703

>NDAI0G00600 Chr7 complement(130877..132343) [1467 bp, 488 aa] {ON} 
          Length = 488

 Score = 33.1 bits (74), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 15/40 (37%), Positives = 23/40 (57%), Gaps = 2/40 (5%)

Query: 204 IHVEIFQPFEDVDTFANKFSHVIYIRDYFTRYVWLYPLEK 243
           IH ++F P   VD  + K+   I   D  TR+ W++PL+K
Sbjct: 189 IHTDLFGPVSGVDITSPKY--FISFTDENTRFRWVFPLKK 226

>KNAG0G00250 Chr7 (30786..33983) [3198 bp, 1065 aa] {ON} Anc_1.519
           YKL205W
          Length = 1065

 Score = 33.1 bits (74), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 40/162 (24%), Positives = 79/162 (48%), Gaps = 26/162 (16%)

Query: 18  RIIKVDIPEL------DILYKIELGSDIDIERINHGRNDHLQLESVFSS--FLTQKMYTL 69
           R +K+  P+       +I+ KI    DI I+ IN   +D ++ ++VFS+  +L + +  L
Sbjct: 594 RFLKITKPKFTVSVLTEIIRKITPLLDIKIDEIN---SDGIEEDTVFSNQMYLFEGIGIL 650

Query: 70  I-REKNFNYETFEEAMKSHYTDSGKYMGTANKKF-MLMEDRYQLNELGQITDKRNDYKLI 127
           I    +  Y   +E +   +TD  + + +  +   ++++  + L  +G  T  R     +
Sbjct: 651 IGANADAQYSILDEVLIPMFTDLERCISSQVQSIEVVLQCHHILMAVG--TLARGVQGGL 708

Query: 128 VPPNQIYDLIMHCHFLNDHLGSTK-IHHSLREKYSNISRALV 168
           VP NQ+          N+ L + K IH SL E+++NI+  ++
Sbjct: 709 VPENQV----------NNTLVNKKLIHQSLTERFANITEVVL 740

>Kwal_55.19799 s55 complement(132471..133535) [1065 bp, 354 aa] {ON}
           YDR261C-D - TyB Gag-Pol protein [contig 159] FULL
          Length = 354

 Score = 32.7 bits (73), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 21/73 (28%), Positives = 32/73 (43%), Gaps = 4/73 (5%)

Query: 175 CSHC--NPKSTYKHIEYTRHFSCDKNFAFEKIHVEIFQPFEDVDTFANKFSHVIYIRDYF 232
           C  C       + HI  +R    +K    E +H +IF P   + +   K+   I   D  
Sbjct: 180 CESCMAGKGKRHNHIANSRDTYQEKYADLEFLHTDIFGPMHHMPSGVPKY--FITFTDER 237

Query: 233 TRYVWLYPLEKIS 245
           TRY W++PL + S
Sbjct: 238 TRYRWVFPLSRKS 250

>Ecym_5175 Chr5 (360152..364384) [4233 bp, 1410 aa] {ON} Similar to
            Saccharomyces cerevisiae YGR109W-B Retrotransposon TYA
            Gag and TYB Pol genes; transcribed/translated as one
            unit; polyprotein is processed to make a
            nucleocapsid-like protein (Gag), reverse transcriptase
            (RT), protease (PR), and integrase (IN); similar to
            retroviral genes [Saccharomyces cerevisiae S288c]
          Length = 1410

 Score = 32.7 bits (73), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 49/242 (20%), Positives = 99/242 (40%), Gaps = 27/242 (11%)

Query: 125  KLIVPPNQIYDL--IMHCHFL-NDHLGSTKIHHSLREKY--SNISRALVRLSLQNCSHCN 179
            ++IVP +++ ++  I H HFL   H G    ++ +   Y    +SR  V+  ++ C+ C 
Sbjct: 1135 RIIVPRSKVQEVLNIYHDHFLTGGHFGIEATYNKIALYYYWPKMSRD-VKEYVRTCTDCQ 1193

Query: 180  ------PKSTYKHIEYTRHFSCDKNFAFEKIHVEIFQPFEDVDTFANKFSHVIYIRDYFT 233
                  P S  K +   +     K  + + +          +         ++ + D F+
Sbjct: 1194 IRKHHRPNSQGKIMPLPQATGRWKELSMDFL--------TGIPESVGGNDMILVVVDRFS 1245

Query: 234  RYVWLYPLEK-ISVKELANTLATHLLLSLRIPIYIESLTLDESNLLKILKRISKTTNLIL 292
            +Y W  P +K I+ +++   LA ++     +P   ++L  D     +  K    T  L +
Sbjct: 1246 KYAWFIPCKKTITGEQVFQLLAGNIFSHKGVP---DTLVSDRDIRFEGKKYQELTKGLGI 1302

Query: 293  GVGTTKLDEFQASGINH--MKELFVQNREYCGN-NWNKYVIRCQNHYNTTYNKWIYGIPL 349
             +  +     Q  G     M+ L    ++Y  + NW+ ++   Q  YN  YN+ I  +P 
Sbjct: 1303 KLLRSTAGHPQTDGQTERVMQPLTRLLKQYAQSPNWDTHLWHVQIAYNNAYNQAIKDMPA 1362

Query: 350  NL 351
             +
Sbjct: 1363 RV 1364

>Kwal_14.764 s14 (32697..33773) [1077 bp, 358 aa] {ON} YLR035C-A -
           Ty ORF [contig 245] FULL
          Length = 358

 Score = 32.3 bits (72), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 21/73 (28%), Positives = 32/73 (43%), Gaps = 4/73 (5%)

Query: 175 CSHC--NPKSTYKHIEYTRHFSCDKNFAFEKIHVEIFQPFEDVDTFANKFSHVIYIRDYF 232
           C  C       + HI  +R    +K    E +H +IF P   + +   K+   I   D  
Sbjct: 191 CESCMAGKGKRHNHIANSRDTYQEKYADLEFLHTDIFGPMHHMPSGVPKY--FITFTDER 248

Query: 233 TRYVWLYPLEKIS 245
           TRY W++PL + S
Sbjct: 249 TRYRWVFPLSRKS 261

>Smik_49.2 Chr49 (115..1764) [1650 bp, 550 aa] {ON} YNL054W-B
           (REPEAT)
          Length = 550

 Score = 32.3 bits (72), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 19/69 (27%), Positives = 33/69 (47%), Gaps = 4/69 (5%)

Query: 175 CSHC--NPKSTYKHIEYTRHFSCDKNFAFEKIHVEIFQPFEDVDTFANKFSHVIYIRDYF 232
           C  C     + ++H++ +R    +    F+ +H +IF P   +   A   S+ I   D  
Sbjct: 209 CPDCLIGKSTKHRHVKGSRLKYQESYEPFQYLHTDIFGPVHHLPKSAP--SYFISFTDEK 266

Query: 233 TRYVWLYPL 241
           TR+ W+YPL
Sbjct: 267 TRFQWVYPL 275

>KNAG0A05810 Chr1 complement(867039..867518) [480 bp, 159 aa] {ON}
           Anc_2.378 YPL034W
          Length = 159

 Score = 31.2 bits (69), Expect = 2.8,   Method: Compositional matrix adjust.
 Identities = 15/38 (39%), Positives = 20/38 (52%), Gaps = 8/38 (21%)

Query: 152 IHHSLREKYSNISRALVRLSLQNCSHCNPKSTYKHIEY 189
           IH SL +KY           + +CS CNP  T KH+E+
Sbjct: 105 IHTSLWKKYGK--------GIVHCSGCNPSGTKKHLEW 134

>TPHA0O00220 Chr15 (26416..29754) [3339 bp, 1112 aa] {ON} Anc_1.519
           YKL205W
          Length = 1112

 Score = 32.3 bits (72), Expect = 3.0,   Method: Compositional matrix adjust.
 Identities = 25/102 (24%), Positives = 51/102 (50%), Gaps = 19/102 (18%)

Query: 74  NFNYETFEEAMKSHYTDSGKYMGTANKKF------MLMEDRYQLNELGQITDKRNDYKLI 127
           ++NY+  ++ +   +T+  K + T ++        ++++  + L  +G I   R  +  +
Sbjct: 698 DYNYDILDQVLTPLFTELEKCISTQSQTLNQQNQHVILQSHHILMAVGTIA--RGTHIGL 755

Query: 128 VPPNQIYDLIMHCHFLNDHLGSTK-IHHSLREKYSNISRALV 168
           VP NQ+          N+ L + K IH SL EK+SNI+  ++
Sbjct: 756 VPENQV----------NNALVNEKYIHKSLIEKFSNIAEVVL 787

>NDAI0D03060 Chr4 (723016..726927) [3912 bp, 1303 aa] {ON} 
          Length = 1303

 Score = 32.3 bits (72), Expect = 3.0,   Method: Compositional matrix adjust.
 Identities = 29/134 (21%), Positives = 57/134 (42%), Gaps = 25/134 (18%)

Query: 126 LIVPPN-QIYDLIMH-----CHFLNDHLGSTKIHHSLREK-----------YSNISRALV 168
           +++PP+ +I +LI        H L  H+    +  S++ K           ++ IS    
Sbjct: 325 VVIPPHARINNLIQKFPLDVVHRLLGHVNVKSLQQSIKNKTFDHFTIEDIDWTGISTFQC 384

Query: 169 RLSLQNCSHCNPKSTYKHIEYTRHFSCDKNFAFEKIHVEIFQPFEDVDTFANKFSHVIYI 228
              LQ  S  +  +    ++Y +++       F+ IH ++F P      + + F   +  
Sbjct: 385 ITCLQGKSRKHNHTVGSRLKYQKNYE-----PFQYIHTDVFGPVSVDKPYPSWF---VAF 436

Query: 229 RDYFTRYVWLYPLE 242
            D  TR+ W++PLE
Sbjct: 437 TDEATRFRWVFPLE 450

>Ecym_5498 Chr5 (1016519..1019092) [2574 bp, 857 aa] {ON} similar to
           Ashbya gossypii ACR088W
          Length = 857

 Score = 31.6 bits (70), Expect = 4.7,   Method: Compositional matrix adjust.
 Identities = 25/94 (26%), Positives = 42/94 (44%), Gaps = 7/94 (7%)

Query: 72  EKNFNYETFEEAMKSHYTD--SGKYMGTANKKFMLMEDRYQLNELGQITDKRNDYKLIVP 129
           EK   +E  E      Y D     ++G +++  + + D     ++G IT       LIV 
Sbjct: 106 EKFVEFEKDECVTDMKYDDVHGTVFVGVSSQNKVWLYDVATWGKVGTITLNAKPITLIVD 165

Query: 130 P-NQIYDLIMHCHFLN----DHLGSTKIHHSLRE 158
           P  ++  +I+    +     D LGSTK+HH L +
Sbjct: 166 PLGELLTVILQNRSVTIYQYDELGSTKVHHQLNQ 199

>Skud_12.300 Chr12 complement(546310..547503) [1194 bp, 398 aa] {ON}
           YNL054W-B (REPEAT)
          Length = 398

 Score = 30.4 bits (67), Expect = 8.0,   Method: Compositional matrix adjust.
 Identities = 15/42 (35%), Positives = 22/42 (52%), Gaps = 2/42 (4%)

Query: 200 AFEKIHVEIFQPFEDVDTFANKFSHVIYIRDYFTRYVWLYPL 241
            F+ +H +IF P   +   A   S+ I   D  TR+ W+YPL
Sbjct: 232 PFQYLHTDIFGPVHHLPKSAP--SYFISFTDEKTRFKWVYPL 271

>TDEL0E00260 Chr5 complement(46841..49489,49491..50588) [3747 bp,
           1248 aa] {ON} 
          Length = 1248

 Score = 30.8 bits (68), Expect = 8.0,   Method: Compositional matrix adjust.
 Identities = 14/42 (33%), Positives = 23/42 (54%), Gaps = 2/42 (4%)

Query: 200 AFEKIHVEIFQPFEDVDTFANKFSHVIYIRDYFTRYVWLYPL 241
            F+ IH ++F P +   T  N   +++   D  TRY W++PL
Sbjct: 589 PFQFIHTDLFGPVQV--TAVNVPRYLLAFTDECTRYKWVFPL 628

>KLLA0F15708g Chr6 (1447749..1453451) [5703 bp, 1900 aa] {ON}
           similar to uniprot|P08678 Saccharomyces cerevisiae
           YJL005W CYR1 Adenylate cyclase required for cAMP
           production and cAMP-dependent protein kinase signaling
           involved in cell cycle control and glucose and nitrogen
           repression of sporulation
          Length = 1900

 Score = 30.8 bits (68), Expect = 8.0,   Method: Compositional matrix adjust.
 Identities = 51/191 (26%), Positives = 82/191 (42%), Gaps = 22/191 (11%)

Query: 214 DVDTFANKFSHVIYIRDYFTRYVWLYPLEKISVKELANTLATHLLLSLRIPIYIESLTLD 273
           DV   AN F  + +I              K+S   + N  A+    ++     + SL L+
Sbjct: 686 DVSNNANIFLPIDFIESAV----------KLSSLRMVNVRASRFPANITQAYDLVSLDLE 735

Query: 274 ESNLLKILKRISKTTNL-ILGVGTTKLDEFQASGINHMKELFVQNREYCGNNWNKY---V 329
            + + ++ + ISK +NL IL +   +LD    SG  ++K L  Q  +   N +  Y   +
Sbjct: 736 RNFIKRVPESISKLSNLTILNLQCNQLDRL-PSGFKNLKNL--QLLDISSNAFTAYPEVI 792

Query: 330 IRCQN--HYNTTYNKWIYGIPLNLMAQETLADNKTYKKKRQRTILLTLSKN--TILLKNG 385
            RC N    + +YNK I  +PL++     LA       K Q    L+   N  T+ LKN 
Sbjct: 793 NRCTNLLQVDLSYNK-INSLPLSINELSKLAKMNLSNNKIQAVPDLSGMANLRTLNLKNN 851

Query: 386 KSALYKESTEN 396
           + A  K +  N
Sbjct: 852 RIATIKSNAPN 862

>Smik_12.96 Chr12 complement(197308..198729) [1422 bp, 473 aa] {ON}
           YLR034C (REAL)
          Length = 473

 Score = 30.4 bits (67), Expect = 8.8,   Method: Compositional matrix adjust.
 Identities = 26/106 (24%), Positives = 45/106 (42%), Gaps = 10/106 (9%)

Query: 116 QITDKRNDYKLIVPPNQIYDLIMHCHFLNDHLGSTKIHHSLREKYSNISRALVRLSLQNC 175
            I DK   +K  +P N I+      +     LG+T + HSL    S +   L    L+  
Sbjct: 175 SIPDKAELFKGFLPSNIIFKEQQALYISLGILGATVMPHSLYLGSSIVKPRLQDYDLKKY 234

Query: 176 SHCNPKSTYKHIEYTRHFSCDKNFAFEKIHVEIFQPFEDVDTFANK 221
              NP+ +   I+Y+       N+A+ ++ + +F     + TF N 
Sbjct: 235 GKVNPRPSLNAIKYSL------NYAYAELIISLFL----IATFVNS 270

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.320    0.136    0.397 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 47,468,614
Number of extensions: 2232006
Number of successful extensions: 7450
Number of sequences better than 10.0: 99
Number of HSP's gapped: 7630
Number of HSP's successfully gapped: 99
Length of query: 408
Length of database: 53,481,399
Length adjustment: 112
Effective length of query: 296
Effective length of database: 40,638,807
Effective search space: 12029086872
Effective search space used: 12029086872
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 67 (30.4 bits)