Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
TPHA0J007308.260ON30463046154480.0
Kpol_392.78.260ON2995309964690.0
Smik_12.1468.260ON2958306659730.0
NDAI0B019808.260ON2959305859250.0
Skud_12.1558.260ON2959306759030.0
TDEL0F038708.260ON2942305958350.0
KAFR0B027208.260ON2982307057790.0
CAGL0L12210g8.260ON2981307957400.0
YLR087C (CSF1)8.260ON2958288957370.0
Suva_10.1718.260ON2958289757030.0
KNAG0G020308.260ON2998310556990.0
NCAS0B050108.260ON2952289656610.0
ZYRO0C01694g8.260ON3006309154610.0
TBLA0E044208.260ON3148258948990.0
SAKL0H17072g8.260ON2997312145540.0
KLTH0G13728g8.260ON2966292839020.0
Kwal_YGOB_56.238088.260ON2941293838610.0
Kwal_56.23810singletonOFF2763281638270.0
Ecym_43108.260ON2943292832980.0
AGR088W8.260ON2887283829460.0
KLLA0F19096g8.260ON2923150717650.0
Kwal_56.23808singletonOFF62621214e-07
KAFR0A027408.824ON11471661050.004
TBLA0A104305.272ON851129831.3
NDAI0E008108.742ON493112821.3
Skud_7.4513.505ON471125802.3
Skud_8.2694.381ON601222802.6
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= TPHA0J00730
         (3046 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

TPHA0J00730 Chr10 complement(165253..174393) [9141 bp, 3046 aa] ...  5955   0.0  
Kpol_392.7 s392 (10369..19356) [8988 bp, 2995 aa] {ON} (10369..1...  2496   0.0  
Smik_12.146 Chr12 complement(286690..295566) [8877 bp, 2958 aa] ...  2305   0.0  
NDAI0B01980 Chr2 complement(483519..492398) [8880 bp, 2959 aa] {...  2286   0.0  
Skud_12.155 Chr12 complement(290039..298918) [8880 bp, 2959 aa] ...  2278   0.0  
TDEL0F03870 Chr6 complement(713797..722625) [8829 bp, 2942 aa] {...  2252   0.0  
KAFR0B02720 Chr2 complement(549702..558650) [8949 bp, 2982 aa] {...  2230   0.0  
CAGL0L12210g Chr12 complement(1315265..1324210) [8946 bp, 2981 a...  2215   0.0  
YLR087C Chr12 complement(306855..315731) [8877 bp, 2958 aa] {ON}...  2214   0.0  
Suva_10.171 Chr10 complement(311672..320548) [8877 bp, 2958 aa] ...  2201   0.0  
KNAG0G02030 Chr7 complement(453579..462575) [8997 bp, 2998 aa] {...  2199   0.0  
NCAS0B05010 Chr2 complement(922165..931023) [8859 bp, 2952 aa] {...  2185   0.0  
ZYRO0C01694g Chr3 (121250..130270) [9021 bp, 3006 aa] {ON} simil...  2108   0.0  
TBLA0E04420 Chr5 complement(1126342..1135788) [9447 bp, 3148 aa]...  1891   0.0  
SAKL0H17072g Chr8 (1498942..1507935) [8994 bp, 2997 aa] {ON} sim...  1758   0.0  
KLTH0G13728g Chr7 (1175228..1184128) [8901 bp, 2966 aa] {ON} sim...  1507   0.0  
Kwal_YGOB_56.23808 s56 (712095..712280,712384..721023) [8826 bp,...  1491   0.0  
Kwal_56.23810 s56 (712732..721023) [8292 bp, 2763 aa] {OFF} YLR0...  1478   0.0  
Ecym_4310 Chr4 (657929..666760) [8832 bp, 2943 aa] {ON} similar ...  1274   0.0  
AGR088W Chr7 (892680..901343) [8664 bp, 2887 aa] {ON} Syntenic h...  1139   0.0  
KLLA0F19096g Chr6 complement(1762215..1770986) [8772 bp, 2923 aa...   684   0.0  
Kwal_56.23808 s56 (712095..712280) [186 bp, 62 aa] {OFF} YLR087C...    51   4e-07
KAFR0A02740 Chr1 (570430..573873) [3444 bp, 1147 aa] {ON} Anc_8....    45   0.004
TBLA0A10430 Chr1 (2564651..2567206) [2556 bp, 851 aa] {ON} Anc_5...    37   1.3  
NDAI0E00810 Chr5 complement(163826..165307) [1482 bp, 493 aa] {O...    36   1.3  
Skud_7.451 Chr7 (749618..751033) [1416 bp, 471 aa] {ON} YGR141W ...    35   2.3  
Skud_8.269 Chr8 (471255..473060) [1806 bp, 601 aa] {ON} YHR202W ...    35   2.6  

>TPHA0J00730 Chr10 complement(165253..174393) [9141 bp, 3046 aa] {ON}
            Anc_8.260 YLR087C
          Length = 3046

 Score = 5955 bits (15448), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 2942/3046 (96%), Positives = 2942/3046 (96%)

Query: 1    MSTLGTEFANVSLSQERYFSWVFLVYWILVVVATSTFVFYVAKLWGFGLTFACEWLLWKT 60
            MSTLGTEFANVSLSQERYFSWVFLVYWILVVVATSTFVFYVAKLWGFGLTFACEWLLWKT
Sbjct: 1    MSTLGTEFANVSLSQERYFSWVFLVYWILVVVATSTFVFYVAKLWGFGLTFACEWLLWKT 60

Query: 61   MNIKVTIESIRLSFLTGTIFFKNVCLIDQDKTISILECSVTWRYWLLNTRKSEYELNAKA 120
            MNIKVTIESIRLSFLTGTIFFKNVCLIDQDKTISILECSVTWRYWLLNTRKSEYELNAKA
Sbjct: 61   MNIKVTIESIRLSFLTGTIFFKNVCLIDQDKTISILECSVTWRYWLLNTRKSEYELNAKA 120

Query: 121  DTSKPNGDDMLDNNTIHDRSXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX 180
            DTSKPNGDDMLDNNTIHDRS                                        
Sbjct: 121  DTSKPNGDDMLDNNTIHDRSNNDNNDNNDNNDNNDNNNNNDNNDNNETNNYNDIDYDYNK 180

Query: 181  XKKLDSLFAINCTGFEIFLYNRKRAYETIIQNFSKEEKIQFIDFLRQHDLDDIFEEVSSE 240
             KKLDSLFAINCTGFEIFLYNRKRAYETIIQNFSKEEKIQFIDFLRQHDLDDIFEEVSSE
Sbjct: 181  NKKLDSLFAINCTGFEIFLYNRKRAYETIIQNFSKEEKIQFIDFLRQHDLDDIFEEVSSE 240

Query: 241  IKNCNEYCNHKEGNNSAHFGSSCKSDKESASNISISGDSQEXXXXXXXXXXXXKISAHIM 300
            IKNCNEYCNHKEGNNSAHFGSSCKSDKESASNISISGDSQE            KISAHIM
Sbjct: 241  IKNCNEYCNHKEGNNSAHFGSSCKSDKESASNISISGDSQENDSDRSNIDNRNKISAHIM 300

Query: 301  RKLHLDILPLDININKGAITIGNKFTRSLLVINFTEAHGLLDYALPDSKLDVFKNKVTFE 360
            RKLHLDILPLDININKGAITIGNKFTRSLLVINFTEAHGLLDYALPDSKLDVFKNKVTFE
Sbjct: 301  RKLHLDILPLDININKGAITIGNKFTRSLLVINFTEAHGLLDYALPDSKLDVFKNKVTFE 360

Query: 361  INDIDMSIKRNIGYNPELASRFNFRAGVLTRIWSYLQLVLNLIPTGRLKTWYESLRYKED 420
            INDIDMSIKRNIGYNPELASRFNFRAGVLTRIWSYLQLVLNLIPTGRLKTWYESLRYKED
Sbjct: 361  INDIDMSIKRNIGYNPELASRFNFRAGVLTRIWSYLQLVLNLIPTGRLKTWYESLRYKED 420

Query: 421  TTFVKKWDGLVLYKDSVKSSTKLGADDVDFDFANHEYAKVSNFFKAPQIIFSIESDIPGI 480
            TTFVKKWDGLVLYKDSVKSSTKLGADDVDFDFANHEYAKVSNFFKAPQIIFSIESDIPGI
Sbjct: 421  TTFVKKWDGLVLYKDSVKSSTKLGADDVDFDFANHEYAKVSNFFKAPQIIFSIESDIPGI 480

Query: 481  VPHGSHPPLSKAHGPDIGNHESPPTFLIDLQLSHASIYFGSWVNRNIVDLRDLMFPVISK 540
            VPHGSHPPLSKAHGPDIGNHESPPTFLIDLQLSHASIYFGSWVNRNIVDLRDLMFPVISK
Sbjct: 481  VPHGSHPPLSKAHGPDIGNHESPPTFLIDLQLSHASIYFGSWVNRNIVDLRDLMFPVISK 540

Query: 541  DQKPLNKLKPGLTRVHSMFNFSVSVLDDSSIRLPTREPSKDSDFLKQYLETKDDFRAFGW 600
            DQKPLNKLKPGLTRVHSMFNFSVSVLDDSSIRLPTREPSKDSDFLKQYLETKDDFRAFGW
Sbjct: 541  DQKPLNKLKPGLTRVHSMFNFSVSVLDDSSIRLPTREPSKDSDFLKQYLETKDDFRAFGW 600

Query: 601  IDLSFKKGSEFMLNIPMIPTSGGFENTLFSKFSELEVTTSVNHNLLFKSNSLNIAANIGY 660
            IDLSFKKGSEFMLNIPMIPTSGGFENTLFSKFSELEVTTSVNHNLLFKSNSLNIAANIGY
Sbjct: 601  IDLSFKKGSEFMLNIPMIPTSGGFENTLFSKFSELEVTTSVNHNLLFKSNSLNIAANIGY 660

Query: 661  PLGWNDPVNWIFNINSKQLDIFLLREHITLLSDMIIDFSTQEPTPYELFRSFTYNLNLKI 720
            PLGWNDPVNWIFNINSKQLDIFLLREHITLLSDMIIDFSTQEPTPYELFRSFTYNLNLKI
Sbjct: 661  PLGWNDPVNWIFNINSKQLDIFLLREHITLLSDMIIDFSTQEPTPYELFRSFTYNLNLKI 720

Query: 721  GGYSFYFNVNDRNIINNPLDFNENCYLSFHGDLFTSEITIPIISLAQQYVTISYEIFTPM 780
            GGYSFYFNVNDRNIINNPLDFNENCYLSFHGDLFTSEITIPIISLAQQYVTISYEIFTPM
Sbjct: 721  GGYSFYFNVNDRNIINNPLDFNENCYLSFHGDLFTSEITIPIISLAQQYVTISYEIFTPM 780

Query: 781  FRLFLNTPSWNTLSEFMRNKEIGRSHDFRVSGTYLIYSELDIDNVDSLTIDFESNSTVLY 840
            FRLFLNTPSWNTLSEFMRNKEIGRSHDFRVSGTYLIYSELDIDNVDSLTIDFESNSTVLY
Sbjct: 781  FRLFLNTPSWNTLSEFMRNKEIGRSHDFRVSGTYLIYSELDIDNVDSLTIDFESNSTVLY 840

Query: 841  CFGFVIKYMMNFQANYFGSFIKFITTEEYSELIRNNVNDNLGSINTNDLTSIEGLQKMDS 900
            CFGFVIKYMMNFQANYFGSFIKFITTEEYSELIRNNVNDNLGSINTNDLTSIEGLQKMDS
Sbjct: 841  CFGFVIKYMMNFQANYFGSFIKFITTEEYSELIRNNVNDNLGSINTNDLTSIEGLQKMDS 900

Query: 901  ITNDVEDINQKTIKRSDLLRTENETDIWLNFKVNDGALILPEELYNGDSCVSLSFGELFI 960
            ITNDVEDINQKTIKRSDLLRTENETDIWLNFKVNDGALILPEELYNGDSCVSLSFGELFI
Sbjct: 901  ITNDVEDINQKTIKRSDLLRTENETDIWLNFKVNDGALILPEELYNGDSCVSLSFGELFI 960

Query: 961  NMRTCNYYMDVYITLYDNNLNRFEKIDPHELFEYIQTRNRSSSVEGNISDITIHGHRMYG 1020
            NMRTCNYYMDVYITLYDNNLNRFEKIDPHELFEYIQTRNRSSSVEGNISDITIHGHRMYG
Sbjct: 961  NMRTCNYYMDVYITLYDNNLNRFEKIDPHELFEYIQTRNRSSSVEGNISDITIHGHRMYG 1020

Query: 1021 LPPKELTYFCQWSINIGTFLIDSDMIFLLSFIQSLNKIGFFLSNKENSLLYESDTVNDMT 1080
            LPPKELTYFCQWSINIGTFLIDSDMIFLLSFIQSLNKIGFFLSNKENSLLYESDTVNDMT
Sbjct: 1021 LPPKELTYFCQWSINIGTFLIDSDMIFLLSFIQSLNKIGFFLSNKENSLLYESDTVNDMT 1080

Query: 1081 LLSVDVESLKVILSDPLLEARAEIGASSIIIRNIDFENEKYTKRLDVNASEFYFSLDSLK 1140
            LLSVDVESLKVILSDPLLEARAEIGASSIIIRNIDFENEKYTKRLDVNASEFYFSLDSLK
Sbjct: 1081 LLSVDVESLKVILSDPLLEARAEIGASSIIIRNIDFENEKYTKRLDVNASEFYFSLDSLK 1140

Query: 1141 IDSGKKNILDVRTKLNITNFFKTDNHINHLDTQRKFIGLHDSPYHRCFFLLPEKFQESSS 1200
            IDSGKKNILDVRTKLNITNFFKTDNHINHLDTQRKFIGLHDSPYHRCFFLLPEKFQESSS
Sbjct: 1141 IDSGKKNILDVRTKLNITNFFKTDNHINHLDTQRKFIGLHDSPYHRCFFLLPEKFQESSS 1200

Query: 1201 YKELYGSITPSFSLPMLPIPHIYSTTNFIVEGILDDYSEFLLSDHHNQMSINAELNSVDT 1260
            YKELYGSITPSFSLPMLPIPHIYSTTNFIVEGILDDYSEFLLSDHHNQMSINAELNSVDT
Sbjct: 1201 YKELYGSITPSFSLPMLPIPHIYSTTNFIVEGILDDYSEFLLSDHHNQMSINAELNSVDT 1260

Query: 1261 TPLKDSFDMQITNFQNILTTEDPYETDNFVVNVKYLTVTVNPDIVFTIEKFSTEFNKKFS 1320
            TPLKDSFDMQITNFQNILTTEDPYETDNFVVNVKYLTVTVNPDIVFTIEKFSTEFNKKFS
Sbjct: 1261 TPLKDSFDMQITNFQNILTTEDPYETDNFVVNVKYLTVTVNPDIVFTIEKFSTEFNKKFS 1320

Query: 1321 MNNQIDGIEMAIVNRLSDLKENISSKINVNLNVEKIDAAWGHRDVCFIGTYINMLKFELS 1380
            MNNQIDGIEMAIVNRLSDLKENISSKINVNLNVEKIDAAWGHRDVCFIGTYINMLKFELS
Sbjct: 1321 MNNQIDGIEMAIVNRLSDLKENISSKINVNLNVEKIDAAWGHRDVCFIGTYINMLKFELS 1380

Query: 1381 QESTYNNNGGLQKDLTLLGKFRSVRIIIQNHSYNSFSDDRPPGLSLMLEGFEAWXXXXXX 1440
            QESTYNNNGGLQKDLTLLGKFRSVRIIIQNHSYNSFSDDRPPGLSLMLEGFEAW      
Sbjct: 1381 QESTYNNNGGLQKDLTLLGKFRSVRIIIQNHSYNSFSDDRPPGLSLMLEGFEAWSSTTTK 1440

Query: 1441 XXXXXXXXXFDITVDEYQIHWLIPYVKSQILLFTKIQDSVKLIYDEQASYQKTFITSLIW 1500
                     FDITVDEYQIHWLIPYVKSQILLFTKIQDSVKLIYDEQASYQKTFITSLIW
Sbjct: 1441 QLTTLNLTSFDITVDEYQIHWLIPYVKSQILLFTKIQDSVKLIYDEQASYQKTFITSLIW 1500

Query: 1501 AGEKYQIDHDPYVITKPATVLRLSAWHIRENRSWRIVTKLRHILTYXXXXXXXXXXXXXX 1560
            AGEKYQIDHDPYVITKPATVLRLSAWHIRENRSWRIVTKLRHILTY              
Sbjct: 1501 AGEKYQIDHDPYVITKPATVLRLSAWHIRENRSWRIVTKLRHILTYLPEDWEDRLDEEDL 1560

Query: 1561 IKRSGLEKEAASTFLNVFSNWRNWEVSDIEKSYIYRMIFVEEVSKRILQNSIKVFLETFY 1620
            IKRSGLEKEAASTFLNVFSNWRNWEVSDIEKSYIYRMIFVEEVSKRILQNSIKVFLETFY
Sbjct: 1561 IKRSGLEKEAASTFLNVFSNWRNWEVSDIEKSYIYRMIFVEEVSKRILQNSIKVFLETFY 1620

Query: 1621 FTIYSRNYSADQNFLITKANILINNEADQVNEVDLIRKQEEIVDVVTKIGSIKFEFTEAI 1680
            FTIYSRNYSADQNFLITKANILINNEADQVNEVDLIRKQEEIVDVVTKIGSIKFEFTEAI
Sbjct: 1621 FTIYSRNYSADQNFLITKANILINNEADQVNEVDLIRKQEEIVDVVTKIGSIKFEFTEAI 1680

Query: 1681 LKLKRDIEQIIKTSVDSKSEGDKLSITKFFKVNLSFIFDHIDFNGQFYNSSLKSRMSNVN 1740
            LKLKRDIEQIIKTSVDSKSEGDKLSITKFFKVNLSFIFDHIDFNGQFYNSSLKSRMSNVN
Sbjct: 1681 LKLKRDIEQIIKTSVDSKSEGDKLSITKFFKVNLSFIFDHIDFNGQFYNSSLKSRMSNVN 1740

Query: 1741 ILSYFENNIESSTPSGSFVYYADRTGIALKHLNNILIDCQVRNLFASTTAELHSAVNSLM 1800
            ILSYFENNIESSTPSGSFVYYADRTGIALKHLNNILIDCQVRNLFASTTAELHSAVNSLM
Sbjct: 1741 ILSYFENNIESSTPSGSFVYYADRTGIALKHLNNILIDCQVRNLFASTTAELHSAVNSLM 1800

Query: 1801 INFRCSNLHFKSVPKTEIFVNAIKAIQRDVETLSAEISKAQGTTDNINTEHTPSVHEKNK 1860
            INFRCSNLHFKSVPKTEIFVNAIKAIQRDVETLSAEISKAQGTTDNINTEHTPSVHEKNK
Sbjct: 1801 INFRCSNLHFKSVPKTEIFVNAIKAIQRDVETLSAEISKAQGTTDNINTEHTPSVHEKNK 1860

Query: 1861 MQKAKPNSKNNITLSATFTNVSSEITLLHPIYLKHETNSVNISYNTINIDELLVQVLDTD 1920
            MQKAKPNSKNNITLSATFTNVSSEITLLHPIYLKHETNSVNISYNTINIDELLVQVLDTD
Sbjct: 1861 MQKAKPNSKNNITLSATFTNVSSEITLLHPIYLKHETNSVNISYNTINIDELLVQVLDTD 1920

Query: 1921 LYLNSSHTKEQYARLSYDKLELTTFLPDLNEKLIDLEISSSILKLTTSDPRRMLFSFLQD 1980
            LYLNSSHTKEQYARLSYDKLELTTFLPDLNEKLIDLEISSSILKLTTSDPRRMLFSFLQD
Sbjct: 1921 LYLNSSHTKEQYARLSYDKLELTTFLPDLNEKLIDLEISSSILKLTTSDPRRMLFSFLQD 1980

Query: 1981 EKELKNSLTFLRSLESLNRKANSEDSETLFSSYEWIVNFKSKYMGVLLPIQATYYVFELH 2040
            EKELKNSLTFLRSLESLNRKANSEDSETLFSSYEWIVNFKSKYMGVLLPIQATYYVFELH
Sbjct: 1981 EKELKNSLTFLRSLESLNRKANSEDSETLFSSYEWIVNFKSKYMGVLLPIQATYYVFELH 2040

Query: 2041 DALSTVSNKEEPSSAVHKKFHGDLSFDHIIFLIKDQSIPHKFSKILDFSIKLSTHRTVNN 2100
            DALSTVSNKEEPSSAVHKKFHGDLSFDHIIFLIKDQSIPHKFSKILDFSIKLSTHRTVNN
Sbjct: 2041 DALSTVSNKEEPSSAVHKKFHGDLSFDHIIFLIKDQSIPHKFSKILDFSIKLSTHRTVNN 2100

Query: 2101 FDRSFEIESSFFRVCLTPFSLIQTMWGXXXXXXXXXXXXDQSTXXXXXXXXXXIDGATNS 2160
            FDRSFEIESSFFRVCLTPFSLIQTMWG            DQST          IDGATNS
Sbjct: 2101 FDRSFEIESSFFRVCLTPFSLIQTMWGYYQLLYLLNSYYDQSTVNFFVFNDNNIDGATNS 2160

Query: 2161 EKENVFSVRSFHILSYNFSIGWLYQDSDNTIPGLILGYNRLFSTYEDNHGKLTLVDGFFS 2220
            EKENVFSVRSFHILSYNFSIGWLYQDSDNTIPGLILGYNRLFSTYEDNHGKLTLVDGFFS
Sbjct: 2161 EKENVFSVRSFHILSYNFSIGWLYQDSDNTIPGLILGYNRLFSTYEDNHGKLTLVDGFFS 2220

Query: 2221 LANGSSGDTFYSSGDESSKFNRSYLPNIQILYWIKEIEKMKHLFIKFHGETLDVNFFENF 2280
            LANGSSGDTFYSSGDESSKFNRSYLPNIQILYWIKEIEKMKHLFIKFHGETLDVNFFENF
Sbjct: 2221 LANGSSGDTFYSSGDESSKFNRSYLPNIQILYWIKEIEKMKHLFIKFHGETLDVNFFENF 2280

Query: 2281 VNIIESTVRSIDLFQTLKREKINPLVKAKPERDEKSNSALTNIKGPIFGKLKQVNCEFIY 2340
            VNIIESTVRSIDLFQTLKREKINPLVKAKPERDEKSNSALTNIKGPIFGKLKQVNCEFIY
Sbjct: 2281 VNIIESTVRSIDLFQTLKREKINPLVKAKPERDEKSNSALTNIKGPIFGKLKQVNCEFIY 2340

Query: 2341 DGGLFRLFSNASMTNKLEPTLMIKSPKVKIMLSYDYFEKELKKHWINCLIDIEPTQNVLK 2400
            DGGLFRLFSNASMTNKLEPTLMIKSPKVKIMLSYDYFEKELKKHWINCLIDIEPTQNVLK
Sbjct: 2341 DGGLFRLFSNASMTNKLEPTLMIKSPKVKIMLSYDYFEKELKKHWINCLIDIEPTQNVLK 2400

Query: 2401 SGCVPFLSDFISQIKDIVELQDVNMEENMDNNVKDPINITSLLENFDICFKLISGTQHVT 2460
            SGCVPFLSDFISQIKDIVELQDVNMEENMDNNVKDPINITSLLENFDICFKLISGTQHVT
Sbjct: 2401 SGCVPFLSDFISQIKDIVELQDVNMEENMDNNVKDPINITSLLENFDICFKLISGTQHVT 2460

Query: 2461 LDCEPKAKINTDVGFGSFEFSILTPHLNPIDPLDISLKINDIKTSVKHQFSNEASASFEV 2520
            LDCEPKAKINTDVGFGSFEFSILTPHLNPIDPLDISLKINDIKTSVKHQFSNEASASFEV
Sbjct: 2461 LDCEPKAKINTDVGFGSFEFSILTPHLNPIDPLDISLKINDIKTSVKHQFSNEASASFEV 2520

Query: 2521 SKLDVILIFTHPEVFGTGLVDDVKLHFNLKQFQNISIFLDIWDVSKSTEKKLFKKDSNTL 2580
            SKLDVILIFTHPEVFGTGLVDDVKLHFNLKQFQNISIFLDIWDVSKSTEKKLFKKDSNTL
Sbjct: 2521 SKLDVILIFTHPEVFGTGLVDDVKLHFNLKQFQNISIFLDIWDVSKSTEKKLFKKDSNTL 2580

Query: 2581 VDAKSSPIAQTIVNSSTLPWSFVFIATNINGDINMGSTLGNLALNLQRTWISTDHFHNKR 2640
            VDAKSSPIAQTIVNSSTLPWSFVFIATNINGDINMGSTLGNLALNLQRTWISTDHFHNKR
Sbjct: 2581 VDAKSSPIAQTIVNSSTLPWSFVFIATNINGDINMGSTLGNLALNLQRTWISTDHFHNKR 2640

Query: 2641 QLLHLFTDNVKISSEGRLGGFVEIDDITWKLDVNYVDKYKFVVSPLVDLLFDVGKVSMKV 2700
            QLLHLFTDNVKISSEGRLGGFVEIDDITWKLDVNYVDKYKFVVSPLVDLLFDVGKVSMKV
Sbjct: 2641 QLLHLFTDNVKISSEGRLGGFVEIDDITWKLDVNYVDKYKFVVSPLVDLLFDVGKVSMKV 2700

Query: 2701 AFDYHMFLISTVKDLKFHVLSEKDIDDILPDLLTVNLTCDEIKVCTTALVASNILDIYNT 2760
            AFDYHMFLISTVKDLKFHVLSEKDIDDILPDLLTVNLTCDEIKVCTTALVASNILDIYNT
Sbjct: 2701 AFDYHMFLISTVKDLKFHVLSEKDIDDILPDLLTVNLTCDEIKVCTTALVASNILDIYNT 2760

Query: 2761 IMRTRQDNKNSYIETLLESNNNVLKRKPLYEDILKSLNLLQTSLSANIHELNLQISPSSL 2820
            IMRTRQDNKNSYIETLLESNNNVLKRKPLYEDILKSLNLLQTSLSANIHELNLQISPSSL
Sbjct: 2761 IMRTRQDNKNSYIETLLESNNNVLKRKPLYEDILKSLNLLQTSLSANIHELNLQISPSSL 2820

Query: 2821 YDAEVIIIRVQDVFSSTETRTGEKIKTDLEMRVYNATLSLTSFGKELTEEDIAEMSAETY 2880
            YDAEVIIIRVQDVFSSTETRTGEKIKTDLEMRVYNATLSLTSFGKELTEEDIAEMSAETY
Sbjct: 2821 YDAEVIIIRVQDVFSSTETRTGEKIKTDLEMRVYNATLSLTSFGKELTEEDIAEMSAETY 2880

Query: 2881 ISYASTLTSGRIFEIPQLTINMTTFQNADNMILQYTYSCSFDGKVDVTWNLGPINFIKEV 2940
            ISYASTLTSGRIFEIPQLTINMTTFQNADNMILQYTYSCSFDGKVDVTWNLGPINFIKEV
Sbjct: 2881 ISYASTLTSGRIFEIPQLTINMTTFQNADNMILQYTYSCSFDGKVDVTWNLGPINFIKEV 2940

Query: 2941 WATHVRSLEVRTVQFMGNHDISLENEGDTDESVKVLSNIEYIALEEPYIEMPQIKDLKDA 3000
            WATHVRSLEVRTVQFMGNHDISLENEGDTDESVKVLSNIEYIALEEPYIEMPQIKDLKDA
Sbjct: 2941 WATHVRSLEVRTVQFMGNHDISLENEGDTDESVKVLSNIEYIALEEPYIEMPQIKDLKDA 3000

Query: 3001 TPPLEWFGLNRKYFPSATHQSVIVPIQKLVNVAQKEYAKVLGSSKE 3046
            TPPLEWFGLNRKYFPSATHQSVIVPIQKLVNVAQKEYAKVLGSSKE
Sbjct: 3001 TPPLEWFGLNRKYFPSATHQSVIVPIQKLVNVAQKEYAKVLGSSKE 3046

>Kpol_392.7 s392 (10369..19356) [8988 bp, 2995 aa] {ON} (10369..19356)
            [8988 nt, 2996 aa]
          Length = 2995

 Score = 2496 bits (6469), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1311/3099 (42%), Positives = 1924/3099 (62%), Gaps = 168/3099 (5%)

Query: 6    TEFANVSLSQERYFSWVFLVYWILVVVATSTFVFYVAKLWGFGLTFACEWLLWKTMNIKV 65
            ++FA++SL +E+YFSWVFL YW+L  +A+ T +FY+ +++G   TF   W +WK   +K+
Sbjct: 5    SQFASISLGREKYFSWVFLAYWVLTCIASLTVIFYLPRVFGAIFTFILHWSIWKKYKVKI 64

Query: 66   TIESIRLSFLTGTIFFKNVCLIDQDKTISILECSVTWRYWLLNTRKSEYELNAKADTSKP 125
             IESIR+SFL GT+F KN+ +I+QD T+S LEC + WRYWLLN+R+ EY++ A   + + 
Sbjct: 65   NIESIRVSFLGGTVFIKNMSIINQDFTLSFLECRIKWRYWLLNSREVEYKVQANLSSEQS 124

Query: 126  NGDDMLDNNTIHDRSXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXKKLD 185
             G D  ++ TI   S                                          KL 
Sbjct: 125  QGSDASNSMTIEKNS------------------------------------------KLP 142

Query: 186  SLFAINCTGFEIFLYNRKRAYETIIQNFSKEEKIQFIDFLRQHDLDDIFEEVSSEIKNCN 245
                I C GFE+F+YNRK AYE +++ F+KEE+ +F  FL +HDL DI  E ++      
Sbjct: 143  CTILIECKGFEVFVYNRKAAYENVLRLFTKEEREKFSSFLNEHDLGDIVSEDTNVNSMDK 202

Query: 246  EYCNHKEGNNSAHFGSSCKSDKESASNISISGDSQEXXXXXXXXXXXXKISAHIMRKLHL 305
            +Y       NS+   S+  +D+    N     D +                    + +  
Sbjct: 203  DYFESVTTENSSE--STVINDRTYKKN----KDER--------------------KSILF 236

Query: 306  DILPLDININKGAITIGNKFTRSLLVINFTEAHGLLDYALPDSKLDVFKNKVTFEINDID 365
            + LP+ + +  GA+T+GN+FT SL+V ++   +G+LD +  + K+D++K+KVT +  D++
Sbjct: 237  NFLPIQLRLIHGAVTLGNRFTPSLVVASYENCNGVLDVSHANEKIDLYKSKVTMKFQDVN 296

Query: 366  MSIKRNIGYNPELASRFNFRAGVLTRIWSYLQLVLNLIPTGRLKTWYESLRYKE---DTT 422
            +S+K N+ Y+ E  +  +   G L+RIW+    ++++IP    K +++ ++ KE   ++ 
Sbjct: 297  ISVKPNLAYDSEFTNELDIDKGKLSRIWNTFIDIMDMIPNPFTKIYHKHMKKKEHDVESM 356

Query: 423  FVKKWDGLVLYKDSVKSSTKLGADDVDFDFANHEYAKVSNFFKAPQIIFSIESDIPGIVP 482
            FV KW GL LYKD+++ + + G D+  +DF N EYAK S+  K P    S   D PGIVP
Sbjct: 357  FVNKWRGLSLYKDNLRDAGRYGLDEASYDFLNREYAKFSSILKCPNFTLSYYLDSPGIVP 416

Query: 483  HGSHPPLSKAHGPDIGNHESPPTFLIDLQLSHASIYFGSWVNRNIVDLRDLMFPVISKDQ 542
            HG+H    K  GPDIGN  SPP FL+DLQ+S ASIY+G W NR +  L  ++ PV+SK+Q
Sbjct: 417  HGAHQTNVKKDGPDIGNSGSPPEFLVDLQVSKASIYYGPWTNRQVSYLIRMLSPVVSKNQ 476

Query: 543  KPLNKLKPGLTRVHSMFNFSVSVLDDSSIRLPTREPSKDSDFLKQYLETKDDFRAFGWID 602
             P+ KL+PG  R+H++F  SV ++D+SS R+PTREPSKD +F+KQ+++T DDFR FGW+D
Sbjct: 477  IPIKKLEPGSRRIHTVFKMSVHIIDESSWRIPTREPSKDKEFIKQFVKTNDDFRPFGWLD 536

Query: 603  LSFKKGSEFMLNIPMIPTSGGFENTLFSKFSELEVTTSVNHNLLFKSNSLNIAANIGYPL 662
             +  KG++   N  +IPT  G  N     F ++EVTTSVNH++L KS   ++ A+IGYPL
Sbjct: 537  FNLNKGTQATFNFSLIPTIDGLGNNFDIHFLDMEVTTSVNHDILLKSKEFDVVADIGYPL 596

Query: 663  GWNDPVNWIFNINSKQLDIFLLREHITLLSDMIIDFSTQEPTPYELFRSFTYNLNLKIGG 722
            GWN   +W F+I +KQL+ FLL+EHI+L SDM  DF++++PTPYELFR FTY+LN  I G
Sbjct: 597  GWNSQADWKFDIIAKQLETFLLKEHISLFSDMFSDFASEDPTPYELFRPFTYSLNWDIEG 656

Query: 723  YSFYFNVNDRNIINNPLDFNENCYLSFHGDLFTSEITIPIISLAQQYVTISYEIFTPMFR 782
            YS Y NVNDRNI+NNPLDFNENCYLS HGD    +  IP + ++Q Y  I++ I+TPMFR
Sbjct: 657  YSIYLNVNDRNIVNNPLDFNENCYLSLHGDELHIDSLIPNLLISQPYTEIAFNIYTPMFR 716

Query: 783  LFLNTPSWNTLSEFMRNKEIGRSHDFRVSGTYLIYSELDIDNVDSLTIDFESNSTVLYCF 842
            L LNTP WNTLSEFM++KE+GR+ DF + G+YLIYS+LDIDNVD++T++  S ST L+C+
Sbjct: 717  LLLNTPPWNTLSEFMKDKEVGRAFDFGIEGSYLIYSDLDIDNVDTITMECTSRSTTLFCY 776

Query: 843  GFVIKYMMNFQANYFGSFIKFITTEEYSELIRNN---VNDNLGSINTNDLTSIEGLQKMD 899
            G VI+Y+MN QANYFG F+ FIT+EEYSE+++ N    ND  GS   +  +S++     D
Sbjct: 777  GVVIRYLMNVQANYFGDFVHFITSEEYSEILQKNNKRSNDEQGSFTYSTTSSVQNSSSDD 836

Query: 900  SITNDVE-DINQKTIKRSDLLRTENETDIWLNFKVNDGALILPEELYNGDSCVSLSFGEL 958
            ++    E D+++  ++R+D+LRTENE DIW  F+V DGALILPE LYNG+ C SL F EL
Sbjct: 837  TVLYTKEQDLSKPHVRRADVLRTENELDIWFTFRVWDGALILPEGLYNGNLCSSLLFSEL 896

Query: 959  FINMRTCNYYMDVYITLYDNNLNRFEKIDPHELFEYIQTRNRS-SSVEGNISDITIHGHR 1017
             I+ R  NYYMD    LYD  +NRF    P E+F Y++  + + + V G +SD+TIH HR
Sbjct: 897  MISFRGSNYYMDFLTNLYDMKINRFLNFSPDEIFRYVRDPDHNLNIVHGTLSDVTIHAHR 956

Query: 1018 MYGLPPKELTYFCQWSINIGTFLIDSDMIFLLSFIQSLNKIGFFLSNKENSLLYESDTVN 1077
            M+GLPP +LTYFCQWSI+ G+ +IDS++ FL SF     K+GF  SN EN L+Y+ ++ +
Sbjct: 957  MFGLPPNKLTYFCQWSIDFGSLIIDSNIEFLSSFFGLFTKLGFGYSNLENKLVYKVESSD 1016

Query: 1078 DMTLLSVDVESLKVILSDPLLEARAEIGASSIIIRNIDFENEKYTKRLDVNASEFYFSLD 1137
            DMTLL++  E + +++SD + + +A +    + + +IDF+NE+Y+KR+++   EF  S+ 
Sbjct: 1017 DMTLLTLYGEKVLILVSDDVSQKQASLEILKLKLNSIDFQNERYSKRINLKIPEFSISIF 1076

Query: 1138 SLKIDSGKKNILDVRTKLNITNFFKTDNHINHLDTQRKFIGLHDSPYHRCFFLLPEKFQE 1197
             ++  + K  +L  +TK++ TNF   ++  N L+ QR +I LHDSPYHRCFF+LP  +QE
Sbjct: 1077 DVRNPTIKPILLGFKTKIDFTNFVIKEDFRNSLNGQRTYITLHDSPYHRCFFILPTMYQE 1136

Query: 1198 SSSYKELYGSITPSFSLPMLPIPHIYSTTNFIVEGILDDYSEFLLSDHHNQMSINAELNS 1257
            S  Y ELYG ITPSFS+P+LPIP + +T +F+VE  L +YS+ L +   N  SI    N+
Sbjct: 1137 SFLYNELYGGITPSFSIPILPIPMLPNTIDFLVEDFLKEYSDLLENPFLNIRSI----NN 1192

Query: 1258 VDTTPLKDSFDMQI---------TNFQNILTTEDPYETDNFVVNVKYLTVTVNPDIVFTI 1308
            +DT+ L + + +              +N +  +  YE DN+++NV+Y+ V +NP     I
Sbjct: 1193 LDTSSLFNEYRVDTYISEKAIFKAEEKNTVNYDPKYEYDNYILNVEYIRVDINPLFSDFI 1252

Query: 1309 EKFSTEFNKKFSMNNQIDGIEMAIVNRLSDLKENISSKINVNLNVEKIDAAWGHRDVCFI 1368
            +  ST+   + +M + ID IEM IV RL   K+ +  + N+ L +  +D  WG R+   I
Sbjct: 1253 DSMSTKLYSE-NMVDIIDEIEMIIVRRLGSPKKVLLRETNLKLKISYVDIFWGSRNSEGI 1311

Query: 1369 GTYINMLKFELSQESTYNNNGGLQKDLTLLGKFRSVRIIIQNHSYNSFSDDRPPGLSLML 1428
              Y++ L FE+ Q    + N    ++ T+L K +S+R       Y     +RPP LSL +
Sbjct: 1312 EIYLDKLDFEMRQRIFDDFNQRSLEERTILSKLKSLRCSFSETQYEEIEYERPPALSLTV 1371

Query: 1429 EGFEAWXXXXXXXXXXXXXXXFDITVDEYQIHWLIPYVKSQILLFTKIQDSVKLIYDEQA 1488
            EG E W                DITVD  Q  WLI Y+  Q+  F  ++ SV L+     
Sbjct: 1372 EGLEVWSCTNTAQSNSINILSTDITVDGSQTSWLIKYLNKQVEFFYNLKGSVDLLQKRDV 1431

Query: 1489 SYQKTFITSLIWAGEKYQIDHDPYVITKPATVLRLSAWHIRENRSWRIVTKLRHILTYXX 1548
            + QK+ I+ L  A E YQIDHDPYVITKPA ++RLS  H+RENRSWRIVT+LRHIL Y  
Sbjct: 1432 TLQKSLISKLTTASEYYQIDHDPYVITKPALIMRLSNSHVRENRSWRIVTRLRHILNYLP 1491

Query: 1549 XXXXXXXXXXXXIKRSGLEKEAASTFLNVFSNWRNWEVSDIEKSYIYRMIFVEEVSKRIL 1608
                         +    + +  + FL+VFSNWRNWEVSD+ +SYIYR +F+ ++ K ++
Sbjct: 1492 EGWEKSSIAFVEARHVYSDSDPKNVFLSVFSNWRNWEVSDVARSYIYRRVFLPDIEKNLI 1551

Query: 1609 QNSIKVFLETFYFTIYSRNYSADQNFLITKANILINNE-ADQVNEVDLIRKQEEIVDVVT 1667
             N+ K+ +E+FYFTIYS+ Y+ D N ++T+ N++I+   +D+  +     K ++I D+  
Sbjct: 1552 NNTTKIGMESFYFTIYSQRYAVDHNIVVTRINVIIDQMLSDEEPKAATANKNDKIYDITG 1611

Query: 1668 KIGSIKFEFTEAILKLKRDIEQIIKTSVDSKSEGDKLSITKFFKVNLSFIFDHIDFNGQF 1727
             +G+ K E  + +++LK+   +  K  + S+   D  SI KFFK+N+  I +  +     
Sbjct: 1612 TVGTFKGELGDQLIRLKKLYSE-DKAKIRSEKSTD-FSIPKFFKINIVLIVEKGELTLAA 1669

Query: 1728 YNSSLKSRMSNVNILSYFENNIESSTPSGSFVYYADRTGIALKHLNNILIDCQVRNLFAS 1787
             N+ L SR+ N  I  +FEN  + +  SGS VYYA RT + LKH   IL+D  + +LF S
Sbjct: 1670 ANTKLISRIKNGKISGFFENARDVANASGSIVYYATRTELWLKHNELILLDAHLDDLFIS 1729

Query: 1788 TTAELHSAVNSLMINFRCSNLHFKSVPKTEIFVNAIKAIQRDVETLSAEISKAQGTTDNI 1847
              AEL     ++++N + S+L FK++P T+  V  ++  +R++  ++  ++       + 
Sbjct: 1730 VIAELLVKKPTILVNVKSSHLRFKALPNTKNLVVFLREFEREISKITGRLTDKDNKKRHT 1789

Query: 1848 NTEHTPSVHEKNKMQKAKPNSKNNITLSATFTNVSSEITLLHPIYLKHETNSVNISYNTI 1907
            +T  +P    K          K +I+      ++SSEI +L P  +KH    + I +N  
Sbjct: 1790 ST--SPIFSTK----------KIDISFDINIFDISSEIVILSPFTVKHSMKELKIVFNRE 1837

Query: 1908 NIDELLVQVLDTDLYLNSSHTKEQYARLSYDKLELTTFLPDLNEKLIDLEISSSILKLTT 1967
              ++ +  +LD DLYL S     QY RLSY  + L   L D   KLI + I +S++KLT 
Sbjct: 1838 GDNDTIFSILDADLYLTSYQNGVQYFRLSYQDINLEAMLTDSKSKLITINIVTSLIKLTL 1897

Query: 1968 SDPRRMLFSFLQDEKELKNSLTFLRSLESLNRKANSEDSETLFSSYEWIVNFKSKYMGVL 2027
            +DP+++  S LQDEK  + SL  +++L +L        +  + + Y+++VNF   Y G+L
Sbjct: 1898 ADPKKITNSLLQDEKTFEQSLESIKTLNTLFSSNREVRTSAVDNPYKFMVNFDLTYFGLL 1957

Query: 2028 LPIQATYYVFELHDALSTVSNKEEPSSAVHKKFHGDLSFDHIIFLIKDQSIPHKFSKILD 2087
             P+  +Y++ ELH  L+T SN       + +K   +L+  + +F+IK   + ++ SK+LD
Sbjct: 1958 FPVDTSYFILELHSLLATFSNVYMNPQQLKEKITCNLALQNTLFMIKSPEVNNQVSKVLD 2017

Query: 2088 FSIKLSTHRTVNNFDRSFEIESSFFRVCLTPFSLIQTMWGXXXXXXXXXXXXDQS----- 2142
            FS+ LST   + N  RSFE+ESS FRVCL P SL++ + G            + +     
Sbjct: 2018 FSVNLSTETKILNSKRSFEVESSHFRVCLNPESLLKILQGVFQTSSSFKYYKEHTRLQIF 2077

Query: 2143 -TXXXXXXXXXXIDGATNSEKENVFSVRSFHILSYNFSIGWLYQDSDNTIPGLILGYNRL 2201
             T          + GA   E        S H LSYNF IGW++++S ++ PGLI+GY+RL
Sbjct: 2078 KTKKKASVVSENLIGAPLIE-------YSIHFLSYNFCIGWIFENSQSSYPGLIMGYDRL 2130

Query: 2202 FSTYEDNHGKLTLVDGFFSLANGSSGDTFYSSGDESSKFNRSYLPNIQILYWIKEIEKMK 2261
            FS YED++GKLT+VDGFFS+ANG S DTFYS G+E  K+NRSYLPN+QILYW+KE++ MK
Sbjct: 2131 FSAYEDSYGKLTVVDGFFSIANGFSSDTFYSQGNEKEKYNRSYLPNLQILYWLKEVDAMK 2190

Query: 2262 HLFIKFHGETLDVNFFENFVNIIESTVRSIDLFQTLKREKINPL-VKAKPERDEKSNSAL 2320
             LF++F+GET+DV F  NF  II  T+ S+  FQ +K+E +  + V+A+ +  E   S  
Sbjct: 2191 QLFVRFYGETIDVRFLSNFATIINLTIESVQHFQMIKKETVREMNVEAEKKVGEDDISTK 2250

Query: 2321 TNIKGPIFGKLKQVNCEFIYDGGLFRLFSNASMTNKLEPTLMIKSPKVKIMLSYDYFEKE 2380
             ++    F K++++NC+ IYDGG+F ++         E  + I +PKV I + Y Y    
Sbjct: 2251 FSL---FFSKVQRINCQCIYDGGVFTVYPVRGNHIDTEHAIEITTPKVIIDVDYKYRIDM 2307

Query: 2381 LKKHWINCLIDIEPTQNVLKSGCVPFLSDFISQIKDIVELQDVNMEENMDNNVKDPINIT 2440
             K HWI   I+IEPT N L S    FL++F   + ++V       +      V  PI+  
Sbjct: 2308 KKPHWIRSFINIEPTYNTLLSQFASFLTEFGESVHEMVAKFSPKEQPPAPKTVSPPIDYK 2367

Query: 2441 SLLENFDICFKLISGTQHVTLDCEPKAKINTDVGFGSFEFSILTPHLNPIDPLDISLKIN 2500
             +LE+FD+ F + +G Q V+L CEP AK++ +VGF SF FSI+T   +P +PL  SL +N
Sbjct: 2368 RILEDFDVSFSISAGKQKVSLSCEPVAKVHANVGFESFVFSIITNDDDPTEPLSCSLTVN 2427

Query: 2501 DIKTSVKHQFSNEASASFEVSKLDVILIFTHPEVFGTGLVDDVKLHFNLKQFQNISIFLD 2560
            DIKTS+ H+FS E +ASF V  +D+  +FTHP+++GT L+ DV L+FN+KQ QN+ +FLD
Sbjct: 2428 DIKTSINHEFSTEPTASFSVDFVDITTLFTHPDIYGTTLISDVSLYFNIKQLQNLMVFLD 2487

Query: 2561 IWDVSKSTEKKLFKKDSNTLVDAKSSPIAQ----------TIVNSSTLPWSFVFIATNIN 2610
            IW++     K+L K     L   KS P+ +          +  N++ +PWSF  I T+IN
Sbjct: 2488 IWNL-----KRLIK-----LRPQKSVPVKKPESRVSSSTKSSSNTTIIPWSFTVIITDIN 2537

Query: 2611 GDINMGSTLGNLALNLQRTWISTDHFHNKRQLLHLFTDNVKISSEGRLGGFVEIDDITWK 2670
            GDI++G +LGNL+L L++ WIST+HF ++R+ L  FTD++ ++S GRLGG +++ +I+W 
Sbjct: 2538 GDIHLGPSLGNLSLKLKKNWISTNHFQDRRKALRFFTDSLSLTSVGRLGGLIDVANISWI 2597

Query: 2671 LDVNYVDKYKFVVSPLVDLLFDVGKVSMKVAFDYHMFLISTVKDLKFHVLSEKDIDDILP 2730
            L+V YV+  K   SPLVD+  +V  V++K AFDYHMFLI  V ++ F++ SEKD+   LP
Sbjct: 2598 LNVRYVENEKLDQSPLVDITLNVENVAVKAAFDYHMFLIGRVHNILFNLESEKDLIGNLP 2657

Query: 2731 DLLTVNLTCDEIKVCTTALVASNILDIYNTIMRTRQDNKNSYIETLLESNNNVLKRKPLY 2790
            DLL ++L CDEI +C+TALVASNILDI NTI RTRQD++NSYIETLLESN    K    Y
Sbjct: 2658 DLLKLHLVCDEIDICSTALVASNILDISNTISRTRQDSRNSYIETLLESNPPPQKSSISY 2717

Query: 2791 EDILKSLNLLQTSLSANIHELNLQISPSSLYDAEVIIIRVQDVFSSTETRTGEKIKTDLE 2850
             DILKSLNLL+T +   IH++ +QISP SL+D EVI+  V++V + + T++GEK+ TDL+
Sbjct: 2718 TDILKSLNLLRTDVGIEIHKMQVQISPISLFDVEVIVTTVENVSARSVTQSGEKLMTDLQ 2777

Query: 2851 MRVYNATLSLTSFGKELTEEDIAEMSAETYISYASTLTSGRIFEIPQLTINMTTFQNADN 2910
            M++Y ATLSL+   +EL EE ++E+S + Y+ YA  L+ G+I  IP+L + MTT+Q  ++
Sbjct: 2778 MKIYKATLSLSKSNEELDEEAVSEISVDDYMIYAMKLSGGKILSIPKLFVGMTTWQLENS 2837

Query: 2911 MILQYTYSCSFDGKVDVTWNLGPINFIKEVWATHVRSLEVRTVQFMGNHDISLENEGDTD 2970
             I++Y ++C F  K+ V WNLGP+NFIKEVWATHV+SL VR  Q  G+ +  L   G   
Sbjct: 2838 KIIEYLFACKFHDKISVRWNLGPVNFIKEVWATHVKSLAVRRAQLKGDKEPQLV-PGIIG 2896

Query: 2971 ESVKVLSNIE-------------------------YIALEEPYIEMPQIKDLKDATPPLE 3005
            E   ++S+ E                         Y+ L+EP IEMP+IKDL+DATPPLE
Sbjct: 2897 EPSPLVSSEELEMLRSESSNADNDNNEYSEEDKFIYVPLKEPQIEMPKIKDLEDATPPLE 2956

Query: 3006 WFGLNRKYFPSATHQSVIVPIQKLVNVAQKEYAKVLGSS 3044
            WFG+NRK FP  THQ+ I+ IQK+V+VAQKEYAKVLG S
Sbjct: 2957 WFGVNRKKFPRVTHQTAIILIQKIVHVAQKEYAKVLGDS 2995

>Smik_12.146 Chr12 complement(286690..295566) [8877 bp, 2958 aa] {ON}
            YLR087C (REAL)
          Length = 2958

 Score = 2305 bits (5973), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1214/3066 (39%), Positives = 1829/3066 (59%), Gaps = 146/3066 (4%)

Query: 6    TEFANVSLSQERYFSWVFLVYWILVVVATSTFVFYVAKLWGFGLTFACEWLLWKTMNIKV 65
            ++   V L+ ++ FSWVFLV WIL +VA  T VFY+ +++ + ++F  EWLLWK   +K+
Sbjct: 5    SQLRGVPLTHQKDFSWVFLVDWILTIVACLTMVFYMGRIYAYLVSFILEWLLWKRAKVKI 64

Query: 66   TIESIRLSFLTGTIFFKNVCLIDQDKTISILECSVTWRYWLLNTRKSEYELNAKADTSKP 125
             +E++R+S L G I FK++ +I +D TISILE S+TW+YWLLN RK+E            
Sbjct: 65   NVETLRVSLLGGRIHFKHLSVIHKDYTISILEGSITWKYWLLNCRKAE------------ 112

Query: 126  NGDDMLDNNTIHDRSXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXKKLD 185
                ++DNN    ++                                          KL 
Sbjct: 113  ----LIDNNKSPSKNNV----------------------------------------KLP 128

Query: 186  SLFAINCTGFEIFLYNRKRAYETIIQNFSKEEKIQFIDFLRQHDLDDIFEEVSSEIKNCN 245
              F + C G EIF+YNR  AY+ +I   SK+E+ +F  +L +H   + F + SS  K   
Sbjct: 129  CKFCLECEGLEIFIYNRTVAYDNVINLLSKDERDKFEKYLNEHSFPEPFSDGSSADKLDE 188

Query: 246  EYCNHKEGNNSAHFGSSCKSDKESASNISISGDSQEXXXXXXXXXXXXKISAHIMRKLHL 305
            +        NS    +S  +D+          D QE             I  H      L
Sbjct: 189  DLSESAYTTNS---DASIINDR----------DYQET-----------DIGKHPQ---FL 221

Query: 306  DILPLDININKGAITIGNKFTRSLLVINFTEAHGLLDYALPDSKLDVFKNKVTFEINDID 365
              LP+++N ++G++ +GNKFT S++++++    G++D   P  ++D+++NK   E  + +
Sbjct: 222  KFLPIELNFSRGSLLLGNKFTPSVMILSYESGEGIVDVLPPKERVDLYRNKTQMEFKNFE 281

Query: 366  MSIKRNIGYNPELASRFNFRAGVLTRIWSYLQLVLNLIPTGRLKTWYESLRYKEDTTFVK 425
            +SIK+NIGY+  +  +F    G ++++W     VL L+    +    +      + +F +
Sbjct: 282  ISIKQNIGYDDAIGLKFKLDTGKVSKLWKAFIRVLQLVSKPVVSKRTKKNTRSSNDSFYQ 341

Query: 426  KWDGLVLYKDSVKSSTKLGADDVDFDFANHEYAKVSNFFKAPQIIFSIESDIPGIVPHGS 485
            KW GL LYK +   +     DD++FD  NHEYAK ++  K P++  S + D+PG+VPHG+
Sbjct: 342  KWKGLSLYKATSGEAKANDLDDIEFDLTNHEYAKFTSILKCPKVTISYDVDVPGVVPHGA 401

Query: 486  HPPLSKAHGPDIGNHESPPTFLIDLQLSHASIYFGSWVNRNIVDLRDLMFPVISKDQKPL 545
            HP +S   GPD+GN+ +PP F +D+Q+   SI +G W  R +  L+ ++ PV+S+  KP+
Sbjct: 402  HPTISDIDGPDVGNNGAPPDFALDVQIHGGSICYGPWAQRQVSHLQRVLSPVVSRTAKPI 461

Query: 546  NKLKPGLTRVHSMFNFSVSVLDDSSIRLPTREPSKDSDFLKQYLETKDDFRAFGWIDLSF 605
             KL PG  RV+++F  ++S+ +D++ R+PTRE SKD++FL+ Y ET +++R FGW+DL F
Sbjct: 462  KKLPPGSRRVYTLFRMNISITEDTTWRIPTRETSKDAEFLQHYKETSEEYRPFGWMDLRF 521

Query: 606  KKGSEFMLNIPMIPTSGGFENTLFSKFSELEVTTSVNHNLLFKSNSLNIAANIGYPLGWN 665
             K +    NI + PT  GF+N     F E E+ +SVNH++L KS   NI  +IGYPLGWN
Sbjct: 522  CKDTYANFNISVCPTVEGFQNNFHVHFVETEIRSSVNHDILLKSKVFNIDGDIGYPLGWN 581

Query: 666  DPVNWIFNINSKQLDIFLLREHITLLSDMIIDFSTQEPTPYELFRSFTYNLNLKIGGYSF 725
                WI N+ S+QL+ FLLREHITL++D + DFS  +PTPYELFR F Y +N ++ GYS 
Sbjct: 582  SKAIWIINMKSEQLEAFLLREHITLVADTLSDFSAGDPTPYELFRPFVYKVNWEMEGYSI 641

Query: 726  YFNVNDRNIINNPLDFNENCYLSFHGDLFTSEITIPIISLAQQYVTISYEIFTPMFRLFL 785
            Y NVND NI+NNPLDFNENCYLS HGD    ++T+P  S+   Y  ISYEI TPMFR+ L
Sbjct: 642  YLNVNDHNIVNNPLDFNENCYLSLHGDKLAIDVTVPRESILGTYTDISYEISTPMFRMML 701

Query: 786  NTPSWNTLSEFMRNKEIGRSHDFRVSGTYLIYSELDIDNVDSLTIDFESNSTVLYCFGFV 845
            NTP WNTL+EFM++KE+GR++DF + GTYL+YSELDIDNVD+L I+  SNSTVL+C+GFV
Sbjct: 702  NTPPWNTLNEFMKHKEVGRAYDFTIKGTYLLYSELDIDNVDTLVIECTSNSTVLHCYGFV 761

Query: 846  IKYMMNFQANYFGSFIKFITTEEYSELI-RNNVNDNLGSINTNDLTS-IEGLQKMDSITN 903
            ++Y+ N + NYFG F  F+T+EEY+ ++   +V D     +  DL S ++   +  S+ N
Sbjct: 762  MRYLTNVKMNYFGEFFNFVTSEEYTGVLGARDVGDVTTKSSVVDLASTVDSGYQNSSVKN 821

Query: 904  DVEDINQKTIKRSDLLRTENETDIWLNFKVNDGALILPEELYNGDSCVSLSFGELFINMR 963
            + E   +  +KRSDL RT NETDIW  F V +GALILPE +Y+ D C++L F EL ++ R
Sbjct: 822  NSE--AKGPMKRSDLKRTTNETDIWFTFSVWNGALILPETIYSFDPCIALHFSELVVDFR 879

Query: 964  TCNYYMDVYITLYDNNLNRFEKIDPHELFEYIQTRNRSSSVE-GNISDITIHGHRMYGLP 1022
            +CNYYMD+   L   ++ R      +E+F++I+  N +   E G++SD+TIHGHRMYGLP
Sbjct: 880  SCNYYMDIMAVLDGTSIKRHVSKQINEVFDFIRRNNGADEQEHGSLSDLTIHGHRMYGLP 939

Query: 1023 PKELTYFCQWSINIGTFLIDSDMIFLLSFIQSLNKIGFFLSNKENSLLYESDTVNDMTLL 1082
            P E TYFCQW IN+G   IDSD+ F+  F  S  KIGF  ++ EN LLY+++T++DMT L
Sbjct: 940  PTEPTYFCQWDINLGDLSIDSDVEFIKGFFSSFYKIGFGYNDLENILLYDTETIDDMTSL 999

Query: 1083 SVDVESLKVILSDPLLEARAEIGASSIIIRNIDFENEKYTKRLDVNASEFYFSLDSLKID 1142
            +V  E +++ L DP++++++ I A SI+   IDFENE Y++R+DV   +   SL+ +  D
Sbjct: 1000 TVHAERIRISLEDPVMKSQSVISAESILFTLIDFENENYSQRIDVKVPKLKISLNCVMGD 1059

Query: 1143 SGKKNILDVRTKLNITNFFKTDNHINHLDTQRKFIGLHDSPYHRCFFLLPEKFQESSSYK 1202
                + L   TKL  TNF +  +       QRK+I  HDSPYHRC FLLP  +Q+S +Y+
Sbjct: 1060 GVDMSFLKFETKLRFTNFEQYKDIDKKRSEQRKYITFHDSPYHRCSFLLPLFYQDSDTYQ 1119

Query: 1203 ELYGSITPSFSLPMLPIPHIYSTTNFIVEGILDDYSEFLLSDHHNQMSINAELNSVDTTP 1262
            +LYG+I PS S+P LP+P +  T +FI+E I+ +Y+  L + +  + S     ++V+  P
Sbjct: 1120 KLYGAIAPSSSIPTLPLPTLPDTIDFIIEDIVGEYATLLEAANPFKDSFAETPSTVE--P 1177

Query: 1263 LKDSF-------DMQITNFQNILTTEDP-YETDNFVVNVKYLTVTVNPDIVFTIEKFSTE 1314
             K SF       +   + F+    TED   E DN+VV+V Y+ + ++P ++F   K   E
Sbjct: 1178 SKASFTEDDNDEEASSSGFKPGAFTEDGDDEKDNYVVDVSYILLDIDP-LLFVFTKSLLE 1236

Query: 1315 FNKKFSMNNQIDGIEMAIVNRLSDLKENISSKINVNLNVEKIDAAWGHRDVCFIGTYINM 1374
                 +M   +D IE+ IV RLS+L+E I+S  N+++++  ++  W          Y++ 
Sbjct: 1237 QLYSENMVQVLDDIEIGIVKRLSNLQEGITSISNIDIHIAYLNLIWQETGEEGFELYLDR 1296

Query: 1375 LKFELSQESTYNNNGGLQKDLTLLGKFRSVRIIIQNHSYNSFSDDRPPGLSLMLEGFEAW 1434
            + +++ ++S   N      ++  L + ++VR+ +        S+DRPP LSL LEGFE W
Sbjct: 1297 IDYQMREKSLEKNRTTKLLEVAALARVKTVRVTVNQKKNPDLSEDRPPALSLGLEGFEIW 1356

Query: 1435 XXXXXXXXXXXXXXXFDITVDEYQIHWLIPYVKSQILLFTKIQDSVKLIYDEQASYQKTF 1494
                            DIT+DE Q+ WL  Y   Q  L  ++  S   I D + S +   
Sbjct: 1357 SSTEGRQVNSLNLTSSDITIDESQMEWLFQYCSDQANLLQEVATSFHSIQDTRTSSKTEL 1416

Query: 1495 ITSLIWAGEKYQIDHDPYVITKPATVLRLSAWHIRENRSWRIVTKLRHILTYXXXXXXXX 1554
            I+ L  A E YQI HDPYVITKPA ++RLS  H+RENRSW+I+T+LRHILTY        
Sbjct: 1417 ISELTAASEYYQISHDPYVITKPAFIMRLSKGHVRENRSWKIITRLRHILTYLPDDWQNN 1476

Query: 1555 XXXXXXIKRSGLEKEAASTFLNVFSNWRNWEVSDIEKSYIYRMIFV---EEVSKRILQNS 1611
                   ++     +A + F++VFS WRNWE SD+ +SYIY  +F    E+  + +++  
Sbjct: 1477 IDKVLKERKYTSANDAKNIFMSVFSTWRNWEFSDVARSYIYGKLFSTDNEKHKQNLIKKL 1536

Query: 1612 IKVFLETFYFTIYSRNYSADQNFLITKANILINNEADQVNEVDLIRKQEEIVDVVTKIGS 1671
            +K  + +FY T+Y   Y  + NF++  AN+++ +    V  + L R  EE +++  +IGS
Sbjct: 1537 LKCTMGSFYLTVYGEGYEVEHNFVVADANLVV-DLTPPVTSLSLNR--EETIEITGRIGS 1593

Query: 1672 IKFEFTEAILKLKRDIEQIIKTSVDSKSEGDKLSITKFFKVNLSFIFDHIDFNGQFYNSS 1731
            +K +F++ +LKL+  I  +     D KS+  K  ++K F++N   + D  +       + 
Sbjct: 1594 VKGKFSDRLLKLQDLIPLVAAVGEDDKSD-PKTELSKQFRMNTVLLVDKSELQLVMDETK 1652

Query: 1732 LKSRMSNVNILSYFENNIESSTPSGSFVYYADRTGIALKHLNNILIDCQVRNLFASTTAE 1791
            L SR     +   +EN  +S++ +GS V ++ ++ + LKH + IL + Q+R+     T E
Sbjct: 1653 LMSRTVGGRVSLLWENLKDSTSQAGSVVIFSQKSEVWLKHASIILGEAQLRDFSILATTE 1712

Query: 1792 LHSAVNSLMINFRCSNLHFKSVPKTEIFVNAIKAIQRDVETLSAEISKAQGTTDNINTEH 1851
              S   +++IN +C++LHF+++  TE  V AI  I+     +   I     +        
Sbjct: 1713 AWSHKPTILINNQCADLHFRAMSSTEQTVTAITEIRESALKIKERIKFKPKSKKKSQF-- 1770

Query: 1852 TPSVHEKNKMQKAKPNSKNNITLSATFTNVSSEITLLHPIYLKHETNSVNISYNTINIDE 1911
                             K N  L+  F+NVSSEI  L P Y++HE   ++I +N    +E
Sbjct: 1771 --------------VGQKINTVLTCYFSNVSSEIMPLSPFYIRHEAKQLDIYFNKFGSNE 1816

Query: 1912 LLVQVLDTDLYLNSSHTKEQYARLSYDKLELTTFLPDLNEKLIDLEISSSILKLTTSDPR 1971
            +L+ + DTD ++ S  TKEQY R S+  +E+   +      LI+++IS S++KLT S+PR
Sbjct: 1817 ILISIWDTDFFMTSHQTKEQYLRFSFGDIEIKGGVSKEGYSLINVDISISMIKLTFSEPR 1876

Query: 1972 RMLFSFLQDEKELKNSLTFLRSLESLNRKANSEDSETLFSSY--EWIVNFKSKYMGVLLP 2029
            R++ SFLQDEK     +  L SL+SL   +N    E    +    W ++    Y G+L+P
Sbjct: 1877 RIVNSFLQDEKLASQGINLLCSLKSLFFSSNIPKKEKQVPALMINWTLDTSISYFGILIP 1936

Query: 2030 IQATYYVFELHDALSTVSNKEEPSSAVHKKFHGDLSFDHIIFLIKDQSIPHKFSKILDFS 2089
            + +TY+VFELH  L +++N          K  G  S ++I+FLIK++S+P   SK+LDFS
Sbjct: 1937 VASTYFVFELHMLLLSLTNTNNGMLPEETKVTGQFSIENILFLIKERSLPIGLSKVLDFS 1996

Query: 2090 IKLSTHRTVNNFDRSFEIESSFFRVCLTPFSLIQTMWGXXXXXXXXXXXXDQSTXXXXXX 2149
            IK+ST +   + ++SF++ESS FRVCL+P SL++ MWG                      
Sbjct: 1997 IKVSTLQRTIDTEQSFQVESSHFRVCLSPDSLLRLMWGAHKLLDLGHYYTKHHA--PNIW 2054

Query: 2150 XXXXIDGATNSEKENVFSVRSFHILSYNFSIGWLYQDSDNTIPGLILGYNRLFSTYEDNH 2209
                  G ++  KE   + RS HILSY F IGWL+Q    + PGL+LGYNRLFS YE + 
Sbjct: 2055 NIKMFTGKSDKPKEIPLNFRSIHILSYKFCIGWLFQYGTGSDPGLMLGYNRLFSAYERDF 2114

Query: 2210 GKLTLVDGFFSLANGSSGDTFYSSGDESSKFNRSYLPNIQILYWIKEIEKMKHLFIKFHG 2269
            GK T+VD FFS+ANG++  TF+S G+E  K+NRS+LPN+QI YW K   ++K  F +FHG
Sbjct: 2115 GKFTVVDSFFSVANGNTSSTFFSEGNEKDKYNRSFLPNMQISYWFKRCGELKDWFFRFHG 2174

Query: 2270 ETLDVNFFENFVNIIESTVRSIDLFQTLKREKINPLVKAKPERDEKSN----SALTNIK- 2324
            E LDVNF  +F+++I+ST++S+  FQ LKR   N L  ++    E SN    S++ N   
Sbjct: 2175 EALDVNFVPSFMDVIDSTLQSMRAFQELKR---NILDVSENSHSEDSNIYAASSVENAPS 2231

Query: 2325 --GPIFGKLKQVNCEFIYDGGLFRLFSNASMTNKLEPTLMIKSPKVKIMLSYDYFEKELK 2382
               P    ++ VN  F YDGG+FR+++   +  K EP+  IKSP V I  +Y + E +++
Sbjct: 2232 SLAPFLNNIRSVNSNFKYDGGVFRVYTYEDIEAKSEPSFEIKSPVVTINCTYKHDEDKVR 2291

Query: 2383 KHWINCLIDIEPTQNVLKSGCVPFLSDFISQIKDIVELQDVNMEENMDNNVKDPINITSL 2442
             H I  LI ++PT N L +GC P L +F   ++ +++    + + N        ++   L
Sbjct: 2292 PHKIRTLITVDPTHNTLYAGCAPLLMEFSESLQKMIKKHSTDEKPNFTKPSPQNVDYKRL 2351

Query: 2443 LENFDICFKLISGTQHVTLDCEPKAKINTDVGFGSFEFSILTPHLNPIDPLDISLKINDI 2502
            L+ FD+  KL S  Q ++L CEPKAK+  DVGF SF FS+ T   +   PL+ SL +   
Sbjct: 2352 LDQFDVAVKLTSAKQQLSLSCEPKAKVQADVGFESFLFSVTTNEFDSEHPLEFSLTLEHT 2411

Query: 2503 KTSVKHQFSNEASASFEVSKLDVILIFTHPEV---FGTGLVDDVKLHFNLKQFQNISIFL 2559
            K S+KH FS E S SFEV  +D+ ++FTHP+V   +G GLV D+ + FN+KQ QN+ +FL
Sbjct: 2412 KASIKHIFSREVSTSFEVGFMDLTILFTHPDVISMYGIGLVSDLNVFFNVKQLQNLYLFL 2471

Query: 2560 DIWDVSKSTEKKLFKKDSNTLVDAKSSPIAQTIVNSSTLPWSFVFIATNINGDINMGSTL 2619
            DIW  S     +  ++  N  +D  S      +   + +PW F  I TN++GD+++G +L
Sbjct: 2472 DIWRFSSILHTRPAQRSVNKGIDMHSLTSTSHVDLGTEIPWCFTLIFTNVSGDVDLGPSL 2531

Query: 2620 GNLALNLQRTWISTDHFHNKRQLLHLFTDNVKISSEGRLGGFVEIDDITWKLDVNYVDKY 2679
            G ++L  QRTW++TDH+  KRQLLH FTD + ++SEGRL G  E+ + +W  +V +  + 
Sbjct: 2532 GVISLRTQRTWLATDHYDEKRQLLHAFTDGISLTSEGRLSGLFEVANASWLSEVKWSPEK 2591

Query: 2680 KFVVSPLVDLLFDVGKVSMKVAFDYHMFLISTVKDLKFHVLSEKDIDDILPDLLTVNLTC 2739
                 PLV    ++  +++K AFDYHMFLI T+ ++ F + +EKD   +LPDLL V+ + 
Sbjct: 2592 GKNTHPLVSTSLNIDDMAIKAAFDYHMFLIGTINNIHFQLHNEKDAKGVLPDLLQVSFSS 2651

Query: 2740 DEIKVCTTALVASNILDIYNTIMRTRQDNKNSYIETLLESNNNVLKRKPLYEDILKSLNL 2799
            DEI + +TALVA+NILDIYNTI+R RQDNK SY+ETL +SN    ++  LY+DIL+SL L
Sbjct: 2652 DEIILSSTALVAANILDIYNTIVRMRQDNKISYMETLRDSNPGESRQPVLYKDILRSLKL 2711

Query: 2800 LQTSLSANIHELNLQISPSSLYDAEVIIIRVQDVFSSTETRTGEKIKTDLEMRVYNATLS 2859
            L+T LS +I  L +QISP SL+D EV+++R+  V   +ET +G+K+KTDL+++V + + +
Sbjct: 2712 LRTDLSVSISSLKVQISPISLFDVEVLVVRIDKVSIRSETHSGKKLKTDLQLQVLDVSAA 2771

Query: 2860 LTSFGKELTEEDIAEMSAETYISYASTLTSGRIFEIPQLTINMTTFQNADNMILQYTYSC 2919
            L++  +EL EE  A ++ + Y+ YAS +  G I +IP+L ++MTT Q      L+Y ++C
Sbjct: 2772 LSTSKEELDEEVGASIAIDDYMHYASKIVGGTIIDIPKLAVHMTTLQEEKTNNLEYLFAC 2831

Query: 2920 SFDGKVDVTWNLGPINFIKEVWATHVRSLEVRTVQF----MGNHDISLENEGDTDESVKV 2975
            SF  K+ V WNLGP+NFIKE+W THV++L VR  Q      G  +  LE   + +E+   
Sbjct: 2832 SFSDKISVRWNLGPVNFIKEMWTTHVKALAVRRSQIANISFGQTEEELEESINKEETA-- 2889

Query: 2976 LSNIEYIALEEPYIEMPQIKDLKDATPPLEWFGLNRKYFPSATHQSVIVPIQKLVNVAQK 3035
             S   YIALEEP IE+PQI+DL DATPP+EWFG+NRK FP  THQ+ ++P+QKLV +A+K
Sbjct: 2890 -SKFNYIALEEPQIEVPQIRDLGDATPPMEWFGVNRKRFPKFTHQTAVIPVQKLVYLAEK 2948

Query: 3036 EYAKVL 3041
            +Y K+L
Sbjct: 2949 QYVKIL 2954

>NDAI0B01980 Chr2 complement(483519..492398) [8880 bp, 2959 aa] {ON}
            Anc_8.260 YLR087C
          Length = 2959

 Score = 2286 bits (5925), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1219/3058 (39%), Positives = 1839/3058 (60%), Gaps = 126/3058 (4%)

Query: 6    TEFANVSLSQERYFSWVFLVYWILVVVATSTFVFYVAKLWGFGLTFACEWLLWKTMNIKV 65
            ++F  + L++++ FSWVFLV WIL+++ T   +FY+++   +G++F  EW LWK  N+K+
Sbjct: 5    SQFQRIPLTKQKDFSWVFLVDWILILIVTLFVIFYLSRTLAYGISFILEWFLWKRSNVKI 64

Query: 66   TIESIRLSFLTGTIFFKNVCLIDQDKTISILECSVTWRYWLLNTRKSEYELNAKADTSKP 125
             IESIR+S L G +FFKNV +I QD TIS LE +VTWRYWLLN RKS Y+         P
Sbjct: 65   NIESIRISPLGGRVFFKNVVIIHQDYTISFLEANVTWRYWLLNVRKSGYD--------TP 116

Query: 126  NGDDMLDNNTIHDRSXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXKKLD 185
               D    N++                                              KL 
Sbjct: 117  ELPDKASANSV----------------------------------------------KLP 130

Query: 186  SLFAINCTGFEIFLYNRKRAYETIIQNFSKEEKIQFIDFLRQHDLDDIFEEVSSEIKNCN 245
              F +   G EIF+YNR  AY+ II  FSKEE+ QF  FL +    D   EVS+   N  
Sbjct: 131  CRFFLEFEGLEIFVYNRGVAYDNIIGQFSKEERNQFEKFLNEQVFTDSKAEVSNSESNSE 190

Query: 246  EYCNHKEGNNSAHFGSSCKSDKESASNISISGDSQEXXXXXXXXXXXXKISAHIMRKLHL 305
            E      G        + KSD  + ++     +  E                   R   L
Sbjct: 191  EDTFESAG--------TFKSDSSTTNDRVFQEELSE-------------------RPQFL 223

Query: 306  DILPLDININKGAITIGNKFTRSLLVINFTEAHGLLDYALPDSKLDVFKNKVTFEINDID 365
            D LP+D  ++ G++ IGNKFT SL++ + +   G++D   P  KLD++K +   +     
Sbjct: 224  DFLPIDFKVSHGSLIIGNKFTPSLMIGSCSSCTGMIDVCQPSEKLDLYKLRFLLDFKTFA 283

Query: 366  MSIKRNIGYNPELASRFNFRAGVLTRIWSYLQLVLNLIPTGRLKTWYESLRYKEDTTFVK 425
            + IK+NIG+N E + +F      ++++W     VL    +    +   S +  E+  F +
Sbjct: 284  IDIKQNIGFNEEFSMKFKIDRNRVSKMWQQFNKVLLTCYSHMKLSHLRSNKVSEEDPFYE 343

Query: 426  KWDGLVLYKDSVKSSTKLGADDVDFDFANHEYAKVSNFFKAPQIIFSIESDIPGIVPHGS 485
            KW GL LY+ ++   +    +D+DFDFANHEYAK S+  + PQ IF+ E DIPGIVPHG+
Sbjct: 344  KWRGLSLYRGTIFGKSNDDINDIDFDFANHEYAKFSSIVRTPQAIFTFECDIPGIVPHGA 403

Query: 486  HPPLSKAHGPDIGNHESPPTFLIDLQLSHASIYFGSWVNRNIVDLRDLMFPVISKDQKPL 545
            HP L+   GPD+GN  +PP F +++Q+S  SI FG W  R +  L  L+ P+ S++ KP 
Sbjct: 404  HPTLTATDGPDVGNSGAPPEFSLEIQISGGSICFGPWAQRQLNSLIRLLSPIASRNAKPT 463

Query: 546  NKLKPGLTRVHSMFNFSVSVLDDSSIRLPTREPSKDSDFLKQYLETKDDFRAFGWIDLSF 605
             +L PG TR+++ F  ++S  ++++ R+PTRE SKD +FL+ Y ET +++R FGWIDL F
Sbjct: 464  KRLTPGCTRIYTQFKTTISTTEETTWRIPTRESSKDPEFLQHYRETNEEYRPFGWIDLKF 523

Query: 606  KKGSEFMLNIPMIPTSGGFENTLFSKFSELEVTTSVNHNLLFKSNSLNIAANIGYPLGWN 665
             K +     +   PT  GF+NTL     + E+ +SVNH++L K  S N   +IG+PLGWN
Sbjct: 524  SKDTYICSTVAQCPTKEGFKNTLDIHLGDNEIRSSVNHDILLKCKSFNFVMDIGFPLGWN 583

Query: 666  DPVNWIFNINSKQLDIFLLREHITLLSDMIIDFSTQEPTPYELFRSFTYNLNLKIGGYSF 725
            +   W  ++ S QL+ F+LREHITL++D + DFS+ EPTPYELFR F Y +N KI GYS 
Sbjct: 584  EEATWTIDLESTQLEAFILREHITLIADTLTDFSSGEPTPYELFRPFVYRINWKINGYSL 643

Query: 726  YFNVNDRNIINNPLDFNENCYLSFHGDLFTSEITIPIISLAQQYVTISYEIFTPMFRLFL 785
            Y NVND NI+NNPLDFNENCYLSFHGD+   ++ +P   ++  +  +SY I+TPMFRL L
Sbjct: 644  YLNVNDHNIVNNPLDFNENCYLSFHGDILQIDLVVPKREVSAGFTEVSYTIYTPMFRLVL 703

Query: 786  NTPSWNTLSEFMRNKEIGRSHDFRVSGTYLIYSELDIDNVDSLTIDFESNSTVLYCFGFV 845
            NTP WNTL+EFM+NKE+GRSHDF+++G+YLIYSELDIDNVD++ I+  S STVL C+GFV
Sbjct: 704  NTPPWNTLNEFMKNKEVGRSHDFKITGSYLIYSELDIDNVDTIIIECSSQSTVLQCYGFV 763

Query: 846  IKYMMNFQANYFGSFIKFITTEEYSELIRNNVNDNLGSINT--NDLTSIEGLQKMDSITN 903
            I+Y+ N + NYFG F  F+T+EEY+  IR N   N  +      D  S+   + +++ + 
Sbjct: 764  IRYLTNVKMNYFGDFFHFVTSEEYTGEIRANEVQNQFTDRQLYEDKASLSSYESIETSSV 823

Query: 904  DVEDINQKTIKRSDLLRTENETDIWLNFKVNDGALILPEELYNGDSCVSLSFGELFINMR 963
              E      IKRSDL R  NETD+W  F V +GA++LPE +YN D C+ L FGEL I+ R
Sbjct: 824  RKEQTGDSKIKRSDLKRATNETDLWFTFTVWEGAILLPETIYNCDPCIGLHFGELLIDFR 883

Query: 964  TCNYYMDVYITLYDNNLNRFEKIDPHELFEYIQTRNRSSSVE-GNISDITIHGHRMYGLP 1022
            +CNYYMD+  ++ D +L R+     +E++E ++  N   + + G++SD+ IH HRMYGLP
Sbjct: 884  SCNYYMDLLASMNDISLRRYIGKQQNEIYESVRQDNGCGNKKYGSLSDMVIHAHRMYGLP 943

Query: 1023 PKELTYFCQWSINIGTFLIDSDMIFLLSFIQSLNKIGFFLSNKENSLLYESDTVNDMTLL 1082
            P E TYFCQW  ++GT  ++ D+ FL  FI S NKI F L + EN LLYE + ++DMT L
Sbjct: 944  PLEPTYFCQWDFSLGTLDLNCDISFLEGFITSFNKISFGLVDLENILLYEKEVIDDMTSL 1003

Query: 1083 SVDVESLKVILSDPLLEARAEIGASSIIIRNIDFENEKYTKRLDVNASEFYFSLDSLKID 1142
            +VDV+ + +++ +  ++      A  +   NI+FENEKY  RLD+    F   + ++   
Sbjct: 1004 TVDVKKISIMIRESEMDTFLLCTAEELYFSNINFENEKYCTRLDLRIPIFNLFMYTMN-G 1062

Query: 1143 SGKKNILDVRTKLNITNFFKTDNHINHLDTQRKFIGLHDSPYHRCFFLLPEKFQESSSYK 1202
            + K+ + +  TK+N++NF K ++   H   Q+++I LHD+PYHRC F+LP   Q+S  Y+
Sbjct: 1063 AKKEKLFEFETKVNLSNFEKPNDIATHKSKQQEYITLHDAPYHRCAFILPPSLQDSEIYQ 1122

Query: 1203 ELYGSITPSFSLPMLPIPHIYSTTNFIVEGILDDYSEFLLSDHHNQMSINAELNSVDTTP 1262
            +L+GSI PS SLP LPIP + +T ++IV+ +L  + E L S++  ++  +   +     P
Sbjct: 1123 DLFGSIAPSSSLPPLPIPLLPATIDYIVDDLLGCFPEILESENPFRIPFSPATSPKLGNP 1182

Query: 1263 LKDS---FDMQITNFQNILTTEDPYET---DNFVVNVKYLTVTVNPDIVFTIEKFSTEFN 1316
             + S    D ++   +    T    ET   DNFV+++ Y ++++NP +   ++     F 
Sbjct: 1183 FEGSDTESDEELDPLEFKTETSGDSETFASDNFVIDISYCSLSINPRLWSYLDNCREHFC 1242

Query: 1317 KKFSMNNQIDGIEMAIVNRLSDLKENISSKINVNLNVEKIDAAWGHRDVCFIGTYINMLK 1376
             +  +   +D IE+ IVN LSDL+E I +  N+ L +  +D  WG R    I  Y++ + 
Sbjct: 1243 SQ-DIVQILDDIEIGIVNHLSDLQEGIETARNIKLQILYLDLFWGDRQNAGISLYLDRID 1301

Query: 1377 FELSQESTYNNNGGLQKDLTLLGKFRSVRIIIQNHSYNSFSDDRPPGLSLMLEGFEAWXX 1436
             E+ Q+    NN     ++T L K RSVR  I   S    +D+RPP LSL++EG E W  
Sbjct: 1302 LEMCQKMLEENNETKITEVTFLNKIRSVRATINEASSVGKADERPPALSLVIEGSEIWSC 1361

Query: 1437 XXXXXXXXXXXXXFDITVDEYQIHWLIPYVKSQILLFTKIQDSVKLIYDEQASYQKTFIT 1496
                          DIT+DE QI WL  Y+  Q+ L  +I  +++ I + +++ +K  ++
Sbjct: 1362 ITNAQVNSLNILSADITIDEAQIDWLFQYIDKQLTLSQEIASALQSIQESRSTTRKQLVS 1421

Query: 1497 SLIWAGEKYQIDHDPYVITKPATVLRLSAWHIRENRSWRIVTKLRHILTYXXXXXXXXXX 1556
             L  A E YQI HDPYVITKPA + RLS  H+RENRSW+I+T+LRHILTY          
Sbjct: 1422 KLAVASEYYQISHDPYVITKPAFITRLSRGHVRENRSWKIITRLRHILTYLPIDWLRVID 1481

Query: 1557 XXXXIKRSGLEKEAASTFLNVFSNWRNWEVSDIEKSYIYRMIFVEEVSKR---ILQNSIK 1613
                 + S    +  + F++VFSNWRNWE SDI +SYIYR +F E  SK+    ++NSIK
Sbjct: 1482 EMRNQQDSHTLPDPGNAFISVFSNWRNWEFSDIARSYIYRNMFSEGHSKKQENSMENSIK 1541

Query: 1614 VFLETFYFTIYSRNYSADQNFLITKANILINNEADQVNEVDLIRKQEEIVDVVTKIGSIK 1673
            + L + +FT+YS  Y  + NF++T+ N+++      +++  +I  QE+I++V   +G+IK
Sbjct: 1542 LKLASLFFTVYSTGYEVEHNFILTRTNVVVET-LPAISDSSII--QEKIINVTGSLGTIK 1598

Query: 1674 FEFTEAILKLKRDIEQIIKTSVDSKSEGDKLSITKFFKVNLSFIFDHIDFNGQFYNSSLK 1733
             + +  ++ LK+ + ++       K+        + FK+N+  +F+  +       S + 
Sbjct: 1599 GKTSHKLINLKKLLPELSM----KKNLKPSTPFLRCFKLNMLLLFERSELQFVLGASKVM 1654

Query: 1734 SRMSNVNILSYFENNIESSTPSGSFVYYADRTGIALKHLNNILIDCQVRNLFASTTAELH 1793
            SR+    +   +E+  + ++ + S   YA R+ + +KH N IL + Q+R      TAE  
Sbjct: 1655 SRVFGGKLSMLWESPKDLASKAISMTVYAQRSEMWMKHHNIILAESQMREFSIIITAESW 1714

Query: 1794 SAVNSLMINFRCSNLHFKSVPKTEIFVNAIKAIQRDVETLSAEI-SKAQGTTDNINTEHT 1852
            S   ++++N +C+++HF+++  T++   ++  I  +++ L     S +      I+    
Sbjct: 1715 SYKPTVLVNLQCTDIHFRAMTATDVLAKSVGEIIENIKELEKLFYSDSDSGIQQIS---- 1770

Query: 1853 PSVHEKNKMQKAKPNSKNNITLSATFTNVSSEITLLHPIYLKHETNSVNISYNTINIDEL 1912
                     Q      K N+ L+  FTNV+ EI  L P   +H    ++I +N +  ++L
Sbjct: 1771 ---------QYPVMEQKINMVLTCYFTNVNLEIMPLSPFSFRHNAKQLDIYFNRLGSNDL 1821

Query: 1913 LVQVLDTDLYLNSSHTKEQYARLSYDKLELTTFLPDLNEKLIDLEISSSILKLTTSDPRR 1972
            ++ V DTDL+L S  TKE+Y R S+  ++L   + +     I++++S+SI+KLT  D RR
Sbjct: 1822 VLSVWDTDLFLISHLTKEEYFRFSFGNIQLKGNILENPNYTINIDVSASIVKLTLGDIRR 1881

Query: 1973 MLFSFLQDEKELKNSLTFLRSLESLNRKANSEDSETLFSSYEWIVNFKSKYMGVLLPIQA 2032
            ++ SFLQDEK L  SL    SL+   RK  +  +E    +  W +     Y G+L+PI +
Sbjct: 1882 LIPSFLQDEKILIESLEQFSSLKLFQRKKPAPSTEKSGRTVTWSLESNINYFGLLVPISS 1941

Query: 2033 TYYVFELHDALSTVSNKEEPSSAVHKKFHGDLSFDHIIFLIKDQSIPHKFSKILDFSIKL 2092
            TY++ ELH  L ++ NK +  S+ +    G  S D++ FL+K++S+P   SKILDFSIK+
Sbjct: 1942 TYFILELHMLLMSL-NKIQGISSKYNGLSGQFSIDNVCFLLKEKSLPADLSKILDFSIKV 2000

Query: 2093 STHRTVNNFDRSFEIESSFFRVCLTPFSLIQTMWGXXXXXXXXXXXXDQSTXXXXXXXXX 2152
            ST + +    RSF+IES  FRVCL+P SL   +W             + ++         
Sbjct: 2001 STLQKLKVTPRSFQIESPHFRVCLSPGSLAHMLWRGNQALTNIRYYKEHTSVAWEKVINF 2060

Query: 2153 XIDGATNSEKENVFSVRSFHILSYNFSIGWLYQDSDNTIPGLILGYNRLFSTYEDNHGKL 2212
                 TN+  E      SFH+LSYNF +GWL+    +  PGLI+GY+RLFS YE N GKL
Sbjct: 2061 K---NTNNSAEVQADFPSFHVLSYNFCVGWLFSPEFDNEPGLIIGYSRLFSAYEKNFGKL 2117

Query: 2213 TLVDGFFSLANGSSGDTFYSSGDESSKFNRSYLPNIQILYWIKEIEKMKHLFIKFHGETL 2272
            TL+D +FS+ANG + DTF+S G E  ++NRSYLPN+QI YW+K    ++ ++++FHGE L
Sbjct: 2118 TLIDAYFSVANGKTSDTFFSKGHEKDRYNRSYLPNMQISYWLKNEGLLRDVYLRFHGEAL 2177

Query: 2273 DVNFFENFVNIIESTVRSIDLFQTLKREKINPLVKAKPERDEKSNSALTNIKGPIFGKLK 2332
            DVNF  +F+++IES++ SI  FQ LKR+ +      K +    +   + +I  P F  ++
Sbjct: 2178 DVNFLASFIDVIESSLESIQKFQELKRDLVGTASNIKEQTQSTTQEPIGDI-SPFFTGIR 2236

Query: 2333 QVNCEFIYDGGLFRLFSNASMTNKLEPTLMIKSPKVKIMLSYDYFEKELK-KHWINCLID 2391
             +NC+F YDGG+F++FS+A  +N L+P+  IKSP V I ++Y Y EK+ +   WI  LI 
Sbjct: 2237 SINCQFQYDGGVFKVFSSAEASNHLKPSFEIKSPNVIIDMNYKYNEKKTQTPTWIRTLIT 2296

Query: 2392 IEPTQNVLKSGCVPFLSDFISQIKDIVELQDVNMEENMDNNVKDPINITSLLENFDICFK 2451
            I  T N L + C P +++F   I+ +V+    + E +  N  K  I+   +L++FD+  +
Sbjct: 2297 INSTHNTLFAKCAPLIAEFSEGIQKMVKRHSSDREPSGTNISKQNIDYKRMLDSFDVAVE 2356

Query: 2452 LISGTQHVTLDCEPKAKINTDVGFGSFEFSILTPHLNPIDPLDISLKINDIKTSVKHQFS 2511
            +IS  Q ++L CEP+AK+  D+GF SF F++ T   +P +PL  +L +   + S+KH FS
Sbjct: 2357 VISAKQLLSLCCEPRAKVQADIGFQSFTFTVTTNDYDPEEPLIFALSVEKTEASIKHIFS 2416

Query: 2512 NEASASFEVSKLDVILIFTHP---EVFGTGLVDDVKLHFNLKQFQNISIFLDIWDVSKST 2568
             EAS SF V  +D+ ++FTHP    + GTGL+ DV + FN+KQ QN+ +FLDIW +S   
Sbjct: 2417 REASTSFGVDFIDLTVMFTHPNSINILGTGLISDVHVFFNVKQLQNLYLFLDIWKLSNLL 2476

Query: 2569 EKKLFKKDSNTLVDAKSSPIAQTIVNSSTLPWSFVFIATNINGDINMGSTLGNLALNLQR 2628
              K   +   +  D KS    Q+    ST+PW F  I +NINGD+++G TLG L+L+ +R
Sbjct: 2477 NSKPMNEVVKSRTDLKSLSSVQSKDTDSTIPWCFTLIFSNINGDVDLGPTLGVLSLHFKR 2536

Query: 2629 TWISTDHFHNKRQLLHLFTDNVKISSEGRLGGFVEIDDITWKLDVNYVDKYKFVVSPLVD 2688
            TW +TDH+ + R++LH +T  + ++S+GRL G +E+D  +W  +VN+         PLV 
Sbjct: 2537 TWFATDHYKSTRKVLHAYTKGITLTSKGRLSGILELDGASWISEVNWPIYENINDYPLVS 2596

Query: 2689 LLFDVGKVSMKVAFDYHMFLISTVKDLKFHVLSEKDIDDILPDLLTVNLTCDEIKVCTTA 2748
            +  ++ +V  KVAFDYHMFL+  + ++  H+ SEKDI+ I PDLL VN+ C+ IK+C+TA
Sbjct: 2597 ISLNIDRVETKVAFDYHMFLVGAINNIDVHIHSEKDINGIKPDLLKVNVICEAIKLCSTA 2656

Query: 2749 LVASNILDIYNTIMRTRQDNKNSYIETLLESNNNVLKRKPLYEDILKSLNLLQTSLSANI 2808
            LVA+NILDIYNT+MR RQDNK SYIETL ESN +  ++   Y+DIL+SLNL+QT +S +I
Sbjct: 2657 LVAANILDIYNTVMRLRQDNKISYIETLKESNTSEPRQALDYKDILRSLNLIQTDVSVDI 2716

Query: 2809 HELNLQISPSSLYDAEVIIIRVQDVFSSTETRTGEKIKTDLEMRVYNATLSLTSFGKELT 2868
            + LN+QISP SL+DAE++++ ++++ + +ET  G K+KT+LEM+VY+A+++L++  +EL 
Sbjct: 2717 YTLNIQISPISLFDAEILVVNIENISARSETHAGNKLKTELEMQVYDASVALSTSKEELD 2776

Query: 2869 EEDIAEMSAETYISYASTLTSGRIFEIPQLTINMTTFQNADNMILQYTYSCSFDGKVDVT 2928
            E+ IA +S E Y+ YA  ++ G I E P+L I MTT+Q   + IL+Y Y+CSF  K+ V 
Sbjct: 2777 EDIIATISVEDYMHYAGRISGGVIIEAPRLLIAMTTYQKEKSDILEYLYTCSFGDKISVR 2836

Query: 2929 WNLGPINFIKEVWATHVRSLEVRTVQF-MGNHDISLENEGDTDESVKVLSNIEYIALEEP 2987
            WNLGP+NFIKE+WATHVR++ VR  Q  +    +S E+ G   +  +  S  +Y+ LEEP
Sbjct: 2837 WNLGPVNFIKEMWATHVRAMAVRRSQIDVTFGPVSEEDVGKRIKKEEEFSRFQYVPLEEP 2896

Query: 2988 YIEMPQIKDLKDATPPLEWFGLNRKYFPSATHQSVIVPIQKLVNVAQKEYAKVLGSSK 3045
             I+MPQI+DL DATPPLEWFGLNRK FP+ THQ+ ++ +QKLV+ A+KEY  +LG S+
Sbjct: 2897 RIDMPQIRDLGDATPPLEWFGLNRKRFPAFTHQTAVILVQKLVHTAEKEYGSILGHSQ 2954

>Skud_12.155 Chr12 complement(290039..298918) [8880 bp, 2959 aa] {ON}
            YLR087C (REAL)
          Length = 2959

 Score = 2278 bits (5903), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1207/3067 (39%), Positives = 1825/3067 (59%), Gaps = 141/3067 (4%)

Query: 6    TEFANVSLSQERYFSWVFLVYWILVVVATSTFVFYVAKLWGFGLTFACEWLLWKTMNIKV 65
            ++   V L+ ++ FSWVFLV WIL VV   T +FY+ +++ + +TF  EWLLWK  NIK+
Sbjct: 5    SQLRGVPLTHQKDFSWVFLVDWILTVVICLTMIFYMGRIYAYLVTFILEWLLWKRANIKI 64

Query: 66   TIESIRLSFLTGTIFFKNVCLIDQDKTISILECSVTWRYWLLNTRKSEYELNAKADTSKP 125
             +E++R+S L G I FK++ +I +D TIS+LE S+TW+YWLLN R        KA+  + 
Sbjct: 65   NVETLRVSLLGGRIHFKHLSVIHKDYTISVLEGSLTWKYWLLNCR--------KAELIEN 116

Query: 126  NGDDMLDNNTIHDRSXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXKKLD 185
            N D +  N                                                 KL 
Sbjct: 117  NKDSLSKN------------------------------------------------VKLP 128

Query: 186  SLFAINCTGFEIFLYNRKRAYETIIQNFSKEEKIQFIDFLRQHDLDDIFEEVSSEIKNCN 245
              F++ C G EIF+YNR  AY+ +I   SK+E+ +F  +L +H   + F + SS  K   
Sbjct: 129  CKFSLECEGLEIFIYNRTVAYDNVINLLSKDERDKFEKYLNEHSFPESFSDGSSADKLDE 188

Query: 246  EYCNHKEGNNSAHFGSSCKSDKESASNISISGDSQEXXXXXXXXXXXXKISAHIMRKL-- 303
            +        NS    +S  +D+          D QE                  + KL  
Sbjct: 189  DLSESAYTTNS---DASIINDR----------DYQETD----------------IGKLPK 219

Query: 304  HLDILPLDININKGAITIGNKFTRSLLVINFTEAHGLLDYALPDSKLDVFKNKVTFEIND 363
             L  LP+++  N+G++ +GNKFT S++++++    G++D   P  +LD+++NK   E  +
Sbjct: 220  FLKFLPIELKFNRGSLLLGNKFTPSVMILSYENGEGVIDVLPPKERLDLYRNKTQMEFKN 279

Query: 364  IDMSIKRNIGYNPELASRFNFRAGVLTRIWSYLQLVLNLIPTGRLKTWYESLRYKEDTTF 423
             ++SIK+NIGY+  +  +F    G ++++W     VL ++    +    +      D +F
Sbjct: 280  FEISIKQNIGYDDAIGLKFKLDTGKVSKLWKTFVRVLRIVTKPIISKKNKKKTGPSDDSF 339

Query: 424  VKKWDGLVLYKDSVKSSTKLGADDVDFDFANHEYAKVSNFFKAPQIIFSIESDIPGIVPH 483
             +KW GL LYK +   +     DD++FDF NHEYAK ++  K P++  + + D+ G VPH
Sbjct: 340  FQKWKGLSLYKAAPGDAKPSDLDDIEFDFTNHEYAKFTSILKCPKLTIAYDVDVSGFVPH 399

Query: 484  GSHPPLSKAHGPDIGNHESPPTFLIDLQLSHASIYFGSWVNRNIVDLRDLMFPVISKDQK 543
            G+HP +    GPD+GN+ +PP F +D+Q+   SI +G W  R +  L+ ++ PV+S+  K
Sbjct: 400  GAHPTIPDIDGPDVGNNGAPPDFALDVQIHGGSICYGPWAQRQVSHLQRVLSPVVSRTSK 459

Query: 544  PLNKLKPGLTRVHSMFNFSVSVLDDSSIRLPTREPSKDSDFLKQYLETKDDFRAFGWIDL 603
            P+ KL PG  R++++F  +V +++D++ R+PTRE SKD++FL+ Y ET +++R FGW+DL
Sbjct: 460  PVKKLPPGSRRIYTLFRMNVLIMEDTTWRIPTRETSKDAEFLQHYKETSEEYRPFGWMDL 519

Query: 604  SFKKGSEFMLNIPMIPTSGGFENTLFSKFSELEVTTSVNHNLLFKSNSLNIAANIGYPLG 663
             F K +    N+ + PT  GF+N     F E E+ +SVNH++L KS   N+  +IGYPLG
Sbjct: 520  RFCKDTYANFNVVLCPTVEGFQNNFHVHFVETEIRSSVNHDILLKSKVFNLDGDIGYPLG 579

Query: 664  WNDPVNWIFNINSKQLDIFLLREHITLLSDMIIDFSTQEPTPYELFRSFTYNLNLKIGGY 723
            WN    WI N+ S+QL+ FLLREHITL++D + DFS  EPTPYELFR F Y +N ++ GY
Sbjct: 580  WNSKAIWIINMKSQQLEAFLLREHITLVADTLSDFSAGEPTPYELFRPFVYKVNWEMEGY 639

Query: 724  SFYFNVNDRNIINNPLDFNENCYLSFHGDLFTSEITIPIISLAQQYVTISYEIFTPMFRL 783
            S Y NVND NI+NNPLDFNENCYLS HGD    +IT+P  S+   Y  ISYEI TPMFR+
Sbjct: 640  SIYLNVNDHNIVNNPLDFNENCYLSLHGDRLYIDITVPRESILGTYTDISYEISTPMFRM 699

Query: 784  FLNTPSWNTLSEFMRNKEIGRSHDFRVSGTYLIYSELDIDNVDSLTIDFESNSTVLYCFG 843
             LNTP WNTL+EFM++KE+GR++DF V G+YL+YSELDIDNVD+L I+  SNSTVL+C+G
Sbjct: 700  MLNTPPWNTLNEFMKHKEVGRAYDFTVKGSYLLYSELDIDNVDTLVIECTSNSTVLHCYG 759

Query: 844  FVIKYMMNFQANYFGSFIKFITTEEYSELI-RNNVNDNLGSINTNDLTS-IEGLQKMDSI 901
            FV++Y+ N + NYFG F  F+T+EEY+ ++    V + +   +  DL S ++   +  S+
Sbjct: 760  FVMRYLTNVKMNYFGEFFNFVTSEEYTGVLGAREVGEIITKSSVLDLASTLDSGYQNSSL 819

Query: 902  TNDVEDINQKTIKRSDLLRTENETDIWLNFKVNDGALILPEELYNGDSCVSLSFGELFIN 961
             N+ ED  +  +KRSDL RT NETDIW  F V +GALILPE +Y+ D C++L F EL ++
Sbjct: 820  KNESED--KDPVKRSDLKRTTNETDIWFTFSVWNGALILPETIYSLDPCIALHFTELVVD 877

Query: 962  MRTCNYYMDVYITLYDNNLNRFEKIDPHELFEYIQTRNRSSSVE-GNISDITIHGHRMYG 1020
             R+CNYYMD+   L   ++ R      +E+F++I+  N ++  E G +SD+TIHGHRM+G
Sbjct: 878  FRSCNYYMDIMAVLNGTSIKRHVSKPINEVFDFIRRNNGANEQEHGTLSDLTIHGHRMFG 937

Query: 1021 LPPKELTYFCQWSINIGTFLIDSDMIFLLSFIQSLNKIGFFLSNKENSLLYESDTVNDMT 1080
            LPP E TYFCQW IN+G   IDSD+ F+  F  S  KIGF  ++ EN LLY+++TV+DMT
Sbjct: 938  LPPTEPTYFCQWDINLGDLTIDSDIEFIKGFFNSFYKIGFGYNDLENILLYDTETVDDMT 997

Query: 1081 LLSVDVESLKVILSDPLLEARAEIGASSIIIRNIDFENEKYTKRLDVNASEFYFSLDSLK 1140
             L+V  E +K+  +DP++++++ + A S++   IDFENE+Y++R+DV   +   SL  + 
Sbjct: 998  SLTVHAERIKISFNDPVMKSQSVVTAESLLFTLIDFENERYSQRIDVKIPKLIISLSCVM 1057

Query: 1141 IDSGKKNILDVRTKLNITNFFKTDNHINHLDTQRKFIGLHDSPYHRCFFLLPEKFQESSS 1200
             D    + L   TKL  TNF +  +       QR++I  HDSPYHRC FLLP  +Q+S +
Sbjct: 1058 GDGVDTSFLKFETKLRFTNFEQYKDIDKKRSEQRRYITAHDSPYHRCPFLLPLFYQDSDT 1117

Query: 1201 YKELYGSITPSFSLPMLPIPHIYSTTNFIVEGILDDYSEFL-----LSDHHNQMSINAEL 1255
            Y++LYG+I PS S+P LP+P +  T +FI+E I+ +Y+  L       D   +     E 
Sbjct: 1118 YQKLYGAIAPSSSIPTLPLPTLPDTIDFIIEDIVGEYATLLETTNPFKDIFAETPSTVEP 1177

Query: 1256 NSVDTTPLKDSFDMQITNFQNILTTEDP-YETDNFVVNVKYLTVTVNPDIVFTIEKFSTE 1314
            +   +T   +        F+ I  TE   ++  N+V++V Y+ + V+P +    +    E
Sbjct: 1178 SRASSTEDDNDERADPLEFKPIAFTEGRNHQRGNYVIDVSYILLDVDPLLFVFTKSLLKE 1237

Query: 1315 FNKKFSMNNQIDGIEMAIVNRLSDLKENISSKINVNLNVEKIDAAWGHRDVCFIGTYINM 1374
            F  +  M   +D IE+ IV +LS+L+E I+S  N+++++  ++  W          Y++ 
Sbjct: 1238 FYSE-DMVQVLDDIEIGIVKQLSNLQEGITSISNIDVHIAYMNLIWQETGEEGFELYLDR 1296

Query: 1375 LKFELSQESTYNNNGGLQKDLTLLGKFRSVRIIIQNHSYNSFSDDRPPGLSLMLEGFEAW 1434
            + +++S++S   N      ++  L + ++VR+ +        S+DRPP LSL LEGFE W
Sbjct: 1297 IDYQMSEKSLEKNRTSKLLEVATLARIKTVRVTVNQKRNPDLSEDRPPALSLGLEGFEVW 1356

Query: 1435 XXXXXXXXXXXXXXXFDITVDEYQIHWLIPYVKSQILLFTKIQDSVKLIYDEQASYQKTF 1494
                            DIT+DE Q+ WL  Y   Q  L  +  +S   I   + S +   
Sbjct: 1357 SSTEDRQVNSLNLTSSDITIDESQMEWLFEYCSDQGNLIQEALNSFHSIQSTRISSKTEL 1416

Query: 1495 ITSLIWAGEKYQIDHDPYVITKPATVLRLSAWHIRENRSWRIVTKLRHILTYXXXXXXXX 1554
            I+ L  A E YQI HDPYVITKPA ++RLS  H+RENRSW+I+T+LRHILTY        
Sbjct: 1417 ISKLTAASEYYQISHDPYVITKPAFIMRLSKGHVRENRSWKIITRLRHILTYLPDDWQDN 1476

Query: 1555 XXXXXXIKRSGLEKEAASTFLNVFSNWRNWEVSDIEKSYIYRMIFV---EEVSKRILQNS 1611
                   ++    K+A + F++VFS WRNWE SD+ +SYIY  +F     E  + +++  
Sbjct: 1477 IEKVLKERKYTSAKDAKNIFMSVFSTWRNWEFSDVARSYIYGKLFSVDNAEHKQNLMKKL 1536

Query: 1612 IKVFLETFYFTIYSRNYSADQNFLITKANILINNEADQVNEVDLIRKQEEIVDVVTKIGS 1671
            +K  + +FY T+Y   Y  + NF+I  AN+++ +    V  + L R  EE +++  ++GS
Sbjct: 1537 LKCTMGSFYLTVYGEGYEVEHNFVIADANLVV-DLTPPVTSLSLNR--EETIEITGRVGS 1593

Query: 1672 IKFEFTEAILKLKRDIEQIIKTSVDSKSEGDKLSITKFFKVNLSFIFDHIDFNGQFYNSS 1731
            +K +F++ +LKL+  I  +       KS+  K  ++K FK+N   + D  +       + 
Sbjct: 1594 VKGKFSDRLLKLQDLIPLVAAVGGGDKSDA-KAELSKQFKMNTVLLVDKSEIQLVMDQTK 1652

Query: 1732 LKSRMSNVNILSYFENNIESSTPSGSFVYYADRTGIALKHLNNILIDCQVRNLFASTTAE 1791
            L SR     +   +EN  +S++ +GS V ++ ++ + LKH + IL + Q+R+     T E
Sbjct: 1653 LMSRTVGGRVSLLWENLKDSTSQAGSLVIFSQKSEVWLKHASIILCEAQLRDFSILATTE 1712

Query: 1792 LHSAVNSLMINFRCSNLHFKSVPKTEIFVNAIKAIQRDVETLSAEISKAQGTTDNINTEH 1851
              S   +++IN +C++LHF+++  TE  V  I  I+  V  +   I              
Sbjct: 1713 AWSHKPTILINNQCADLHFRAMSTTEQTVTVITEIRESVLKIKDRI-------------- 1758

Query: 1852 TPSVHEKNKMQKAKPNSKNNITLSATFTNVSSEITLLHPIYLKHETNSVNISYNTINIDE 1911
                  K+K +      K NI LS  F+NVSSEI  L P Y++HE   ++I +N    +E
Sbjct: 1759 --KFKPKSKKRSQFVGPKINIVLSCYFSNVSSEIMPLSPFYIRHEAKQLDIYFNKFGSNE 1816

Query: 1912 LLVQVLDTDLYLNSSHTKEQYARLSYDKLELTTFLPDLNEKLIDLEISSSILKLTTSDPR 1971
            +L+ + DTD ++ S  TKEQY R S+  +E+   +   +  LI+++IS S++KLT S+PR
Sbjct: 1817 VLLSIWDTDFFMTSHQTKEQYLRFSFGDIEIKGGISKEDYSLINVDISISMIKLTFSEPR 1876

Query: 1972 RMLFSFLQDEKELKNSLTFLRSLESLNRKANSEDSETLFSSYE---WIVNFKSKYMGVLL 2028
            R++ SFLQDEK     +  L SL+SL   +     +   +      W ++    Y G+L+
Sbjct: 1877 RIVNSFLQDEKLASQGINLLSSLKSLLFTSGLPKKKKKKAPARMINWTLDTSITYFGILV 1936

Query: 2029 PIQATYYVFELHDALSTVSNKEEPSSAVHKKFHGDLSFDHIIFLIKDQSIPHKFSKILDF 2088
            P+ +TY+VFELH  L +++N          K  G  S ++I+FLIK++S+P   SK+LDF
Sbjct: 1937 PVASTYFVFELHMLLLSLTNTNNGMLPEEAKVTGQFSIENILFLIKERSLPIGLSKLLDF 1996

Query: 2089 SIKLSTHRTVNNFDRSFEIESSFFRVCLTPFSLIQTMWGXXXXXXXXXXXXDQSTXXXXX 2148
            SIK+ST +   + ++SF++ESS FRVCL+P SL++ MWG             +       
Sbjct: 1997 SIKVSTLQRTVDTEQSFQVESSHFRVCLSPDSLLRLMWGAHKLLDLGHYYSRRHA--PNI 2054

Query: 2149 XXXXXIDGATNSEKENVFSVRSFHILSYNFSIGWLYQDSDNTIPGLILGYNRLFSTYEDN 2208
                   G ++  KE   + RS HILSY F IGWL+Q    + PGL+LGYNRLFS YE +
Sbjct: 2055 WDIKMFTGKSDKPKEIPINFRSIHILSYKFCIGWLFQYGAGSDPGLMLGYNRLFSAYEKD 2114

Query: 2209 HGKLTLVDGFFSLANGSSGDTFYSSGDESSKFNRSYLPNIQILYWIKEIEKMKHLFIKFH 2268
             GK T+VD FFS+ANG+   TF+S G+E  K+NRS+LPN+QI YW K   ++K  F +FH
Sbjct: 2115 FGKFTVVDAFFSVANGNKSSTFFSEGNEKDKYNRSFLPNMQISYWFKRCGELKDWFFRFH 2174

Query: 2269 GETLDVNFFENFVNIIESTVRSIDLFQTLKREKINPLVKAKPERDE----KSNSALTNIK 2324
            GE LDVNF  +F+++I+ST++S+  FQ LK+  ++    +  E D      S  + +N  
Sbjct: 2175 GEALDVNFVPSFMDVIDSTLQSVRAFQELKKNILDVSEDSHMEDDNPYATSSMESASNSL 2234

Query: 2325 GPIFGKLKQVNCEFIYDGGLFRLFSNASMTNKLEPTLMIKSPKVKIMLSYDYFEKELKKH 2384
             P    ++ VN  F YDGG+FR+++   +  K EP+  IKSP V I  +Y + E E K H
Sbjct: 2235 APFLDNIRSVNSNFKYDGGVFRVYTYDDIEAKSEPSFEIKSPVVTINCTYKHNENEAKPH 2294

Query: 2385 WINCLIDIEPTQNVLKSGCVPFLSDFISQIKDIVELQDVNMEENMDNNVKDPINITSLLE 2444
             I  LI ++PT N L +GC P L +F   ++ +++    + + +        ++   LL+
Sbjct: 2295 RIRILIAVDPTLNTLYAGCAPLLMEFSESLQKMIKKHSTDDKPSFTKPSSQNVDYKRLLD 2354

Query: 2445 NFDICFKLISGTQHVTLDCEPKAKINTDVGFGSFEFSILTPHLNPIDPLDISLKINDIKT 2504
             FD+  KL S  Q ++L CEPKAK+  DVGF SF FS+ T   +   PL+ SL +   K 
Sbjct: 2355 QFDVAVKLTSAKQQLSLSCEPKAKVQADVGFESFLFSMTTNEFDSEQPLEFSLTLQQTKA 2414

Query: 2505 SVKHQFSNEASASFEVSKLDVILIFTHPEV---FGTGLVDDVKLHFNLKQFQNISIFLDI 2561
            S++H FS E S SFEV  +D+ L+FTHP+V   +GT LV D+ + FN+KQ QN+ +FLDI
Sbjct: 2415 SIRHIFSREVSTSFEVGFMDLTLLFTHPDVISMYGTSLVSDLSVFFNVKQLQNLYLFLDI 2474

Query: 2562 WDVSKSTEKKLFKKDSNTLVDAKSSPIAQTIVNSSTLPWSFVFIATNINGDINMGSTLGN 2621
            W  S     +  +   +  +D  S      +   + +PW F  I TN++GD+++G +LG 
Sbjct: 2475 WRFSSILHTRPVQGSISKEIDMSSLTSTNYVDVGAEIPWCFTLIFTNVSGDVDLGPSLGV 2534

Query: 2622 LALNLQRTWISTDHFHNKRQLLHLFTDNVKISSEGRLGGFVEIDDITWKLDVNYVDKYKF 2681
            ++L  QRTW++TDH+  KRQLLH FTD V ++SEGRL G  E+ + +W  +V +  +   
Sbjct: 2535 ISLRTQRTWLATDHYSEKRQLLHAFTDGVSLTSEGRLSGLFEVANASWISEVKWSLEKSK 2594

Query: 2682 VVSPLVDLLFDVGKVSMKVAFDYHMFLISTVKDLKFHVLSEKDIDDILPDLLTVNLTCDE 2741
               PLV    ++  V++K AFDYHMFLI T+ +++F + +EKD   ILPDLL V+ + DE
Sbjct: 2595 NSHPLVSTSLNIDDVAVKAAFDYHMFLIGTINNIQFQLHNEKDAKGILPDLLQVSFSSDE 2654

Query: 2742 IKVCTTALVASNILDIYNTIMRTRQDNKNSYIETLLESNNNVLKRKPLYEDILKSLNLLQ 2801
            I + +TALVA+NILDIYNTI+R RQDNK SY+ETL +SN    K+  LY+DIL+SL LL+
Sbjct: 2655 ITLSSTALVAANILDIYNTIVRMRQDNKISYMETLRDSNPGESKQPILYKDILRSLKLLR 2714

Query: 2802 TSLSANIHELNLQISPSSLYDAEVIIIRVQDVFSSTETRTGEKIKTDLEMRVYNATLSLT 2861
            T LS NI  L +QISP SL+D EV+++R+++V   +ET +G+K+KTDL+++V + + +L+
Sbjct: 2715 TDLSLNISSLKVQISPISLFDVEVLVVRIKNVSIRSETHSGKKLKTDLQLQVLDVSAALS 2774

Query: 2862 SFGKELTEEDIAEMSAETYISYASTLTSGRIFEIPQLTINMTTFQNADNMILQYTYSCSF 2921
            +  +EL EE  A ++ + YI YAS +  G I +IP+L ++MTT Q      ++Y ++CSF
Sbjct: 2775 TSKEELDEEIGASIAIDDYIHYASKIVGGTIIDIPKLAVHMTTLQEEKTNNIEYLFACSF 2834

Query: 2922 DGKVDVTWNLGPINFIKEVWATHVRSLEVRTVQFMGNHDISL-ENEGDTDESVK---VLS 2977
              K+ V WNLGP+NFIKE+W THV++L VR  Q     ++S  + E + +ES+K     S
Sbjct: 2835 SDKISVKWNLGPVNFIKEMWTTHVKALAVRQSQIA---NVSFGQTEEELEESIKTKETTS 2891

Query: 2978 NIEYIALEEPYIEMPQIKDLKDATPPLEWFGLNRKYFPSATHQSVIVPIQKLVNVAQKEY 3037
               YIALEEP I++PQI+DL DATPP+EWFG+NRK FP  THQ+ ++P+QKLV +A+K+Y
Sbjct: 2892 KFNYIALEEPQIQVPQIRDLGDATPPMEWFGVNRKRFPKFTHQTAVIPVQKLVYLAEKQY 2951

Query: 3038 AKVLGSS 3044
             K+L  +
Sbjct: 2952 VKILDGT 2958

>TDEL0F03870 Chr6 complement(713797..722625) [8829 bp, 2942 aa] {ON}
            Anc_8.260 YLR087C
          Length = 2942

 Score = 2252 bits (5835), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1217/3059 (39%), Positives = 1833/3059 (59%), Gaps = 146/3059 (4%)

Query: 6    TEFANVSLSQERYFSWVFLVYWILVVVATSTFVFYVAKLWGFGLTFACEWLLWKTMNIKV 65
            ++F  VSLS ER FSWVFLV W+L+ V T T +FY+ +L+ + +T   EW LWK   +K+
Sbjct: 5    SQFERVSLSNERNFSWVFLVDWVLLCVVTLTVIFYLGRLFAYAITLVLEWFLWKHWKVKI 64

Query: 66   TIESIRLSFLTGTIFFKNVCLIDQDKTISILECSVTWRYWLLNTRKSEYELNAKADTSKP 125
            ++ES+R++ L+G+I F+N+C+I +D+TISIL+ S+ WRY LL TR+S+YE  +       
Sbjct: 65   SVESLRIAPLSGSILFRNLCIIGKDQTISILKGSLRWRYRLLATRRSQYEEASSQKDGLG 124

Query: 126  NGDDMLDNNTIHDRSXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXKKLD 185
             G++  D N++ + +                                           L 
Sbjct: 125  VGEE--DVNSMKNIT-------------------------------------------LP 139

Query: 186  SLFAINCTGFEIFLYNRKRAYETIIQNFSKEEKIQFIDFLRQHDLDDIFEEVSSEIKNCN 245
              F + C GFEIF+YNR  AYE IIQ FS+EE++QF  F+ + ++ ++F           
Sbjct: 140  CRFVLFCEGFEIFIYNRTVAYENIIQMFSREERVQFEKFMSKQEMSELF----------- 188

Query: 246  EYCNHKEGNNSAHFGSSCKSDKESASNISISGDSQEXXXXXXXXXXXXKISAHIMRK-LH 304
             +C+ +  ++     S   S      NI+     +                 H  +K + 
Sbjct: 189  -HCHSERSDDKGSTDSVLSSSVSDVPNINDRVFDE----------------VHNQKKSIF 231

Query: 305  LDILPLDININKGAITIGNKFTRSLLVINFTEAHGLLDYALPDSKLDVFKNKVTFEINDI 364
            +  LP+++ +++G+I +GNKFT SLL+ + T   G++D   P  KLD++K     +  DI
Sbjct: 232  MRFLPMELQLSRGSIVLGNKFTPSLLIASCTSGRGVVDLCQPKEKLDLYKMHFQVDFIDI 291

Query: 365  DMSIKRNIGYNPELASRFNFRAGVLTRIWSYLQLVLNLIPTGRLKTWYESLRYKEDTTFV 424
            D+SI++NI YN + A+   F+ G L+R+W+    VL+ IP         + +  E   F+
Sbjct: 292  DISIRQNIEYNRKKAT---FKNGKLSRMWATFVKVLH-IP---FYNKSHNNKGTESEPFM 344

Query: 425  KKWDGLVLYKDSVKSSTKLGADDVDFDFANHEYAKVSNFFKAPQIIFSIESDIPGIVPHG 484
             KW GL LYK           D+V FDFANHEYAKVSN  K+P+ + +   DIPG+VPHG
Sbjct: 345  TKWKGLGLYKGLTFDRDGEDYDEVHFDFANHEYAKVSNIIKSPRTVLTYSYDIPGVVPHG 404

Query: 485  SHPPLSKAHGPDIGNHESPPTFLIDLQLSHASIYFGSWVNRNIVDLRDLMFPVISKDQKP 544
            +HP L    GP++GN+ +PP F IDLQ    +I +G W  R I  L  ++ P +++   P
Sbjct: 405  AHPTL---EGPEVGNNGAPPEFGIDLQFYGVTICYGPWAQREIQHLLRMISPTVARSSVP 461

Query: 545  LNKLKPGLTRVHSMFNFSVSVLDDSSIRLPTREPSKDSDFLKQYLETKDDFRAFGWIDLS 604
            +  L PG  R++++F  +  VLD SS R+PTRE SKD +FLK++  T +++R FGW+DL 
Sbjct: 462  IKTLSPGSRRIYTVFKTTFRVLDGSSWRIPTRERSKDQEFLKKFKATSEEYRPFGWLDLK 521

Query: 605  FKKGSEFMLNIPMIPTSGGFENTLFSKFSELEVTTSVNHNLLFKSNSLNIAANIGYPLGW 664
            F   S   +   + P   GF N ++  F+E+E T+SVNH+++ K N  ++A ++GYPLGW
Sbjct: 522  FAMDSYGSVTTVLCPKEEGFPNKMYIHFAEMEATSSVNHDVMLKCNCFDVAGDVGYPLGW 581

Query: 665  NDPVNWIFNINSKQLDIFLLREHITLLSDMIIDFSTQEPTPYELFRSFTYNLNLKIGGYS 724
            N    W  N++S QL+ FLLREH+TL++D+  DFS+ EPTPYELFR F Y +N  I GYS
Sbjct: 582  NSSATWTINLHSTQLETFLLREHVTLVADIFTDFSSGEPTPYELFRPFIYQINWIIDGYS 641

Query: 725  FYFNVNDRNIINNPLDFNENCYLSFHGDLFTSEITIPIISLAQQYVTISYEIFTPMFRLF 784
             Y NVND NI+NNPLDFNENCYLS HG+    ++T P  S+   Y+ + Y+I TPMFRL 
Sbjct: 642  IYLNVNDHNIVNNPLDFNENCYLSLHGEELLIDVTAPNDSITGAYMDVPYKISTPMFRLL 701

Query: 785  LNTPSWNTLSEFMRNKEIGRSHDFRVSGTYLIYSELDIDNVDSLTIDFESNSTVLYCFGF 844
            LNTP WNTL+EFM+NKE+GRS+ F V G Y +YSELDIDNVD+L+++  S  T L+C+GF
Sbjct: 702  LNTPPWNTLNEFMKNKEVGRSYSFAVCGLYTVYSELDIDNVDTLSVECTSTGTTLHCYGF 761

Query: 845  VIKYMMNFQANYFGSFIKFITTEEYSELIRNNVNDNLGSI--------NTNDLTSIEGLQ 896
            V++Y+MN + NYFG F  FIT+EEY+ +IR    +++G          +TN  T   GL 
Sbjct: 762  VMRYLMNVKMNYFGDFFHFITSEEYTGVIRAKEKESVGKTEEESLRDNSTNLSTDSGGLS 821

Query: 897  KMDSITNDVEDINQKTIKRSDLLRTENETDIWLNFKVNDGALILPEELYNGDSCVSLSFG 956
              D       D     + RSD+ RT NETDIW  F V +GAL+LPE +YN D CV+L FG
Sbjct: 822  --DPYVRLRAD---PPVSRSDVKRTTNETDIWFTFSVWEGALVLPETIYNCDPCVALHFG 876

Query: 957  ELFINMRTCNYYMDVYITLYDNNLNRFEKIDPHELFEYIQTRN-RSSSVEGNISDITIHG 1015
            EL +++R+CNYYMD+  T+   ++ R+     HELFE I+  N R+    G+++ +TIHG
Sbjct: 877  ELIVDLRSCNYYMDLLATMSSTSIKRYVSRQSHELFESIRRDNGRTEKEHGSLAALTIHG 936

Query: 1016 HRMYGLPPKELTYFCQWSINIGTFLIDSDMIFLLSFIQSLNKIGFFLSNKENSLLYESDT 1075
            HRMYGLPP E TYFCQW I++    I+SD  F   F      IGF  +N EN+LLY+ +T
Sbjct: 937  HRMYGLPPIEPTYFCQWGIDLDGLTINSDAEFAKGFFTLFAGIGFGYTNLENTLLYDVET 996

Query: 1076 VNDMTLLSVDVESLKVILSDPLLEARAEIGASSIIIRNIDFENEKYTKRLDVNASEFYFS 1135
             +DMT ++V V  + V++ +    +RA +   ++   +IDFENE+Y++R+D+        
Sbjct: 997  PDDMTSVTVRVRDMNVVVEND--SSRAVVDVPNLTFTSIDFENERYSQRIDLKVPSLSIL 1054

Query: 1136 LDSLKIDSGKKNILDVRTKLNITNFFKTDNHINHLDTQRKFIGLHDSPYHRCFFLLPEKF 1195
            L + + DS    ++D+ TK+ +T+F +  +   H   QR +I L+DSP++RC FLLP   
Sbjct: 1055 LLTSEDDSEPIRLMDLTTKVYLTDFIQKRDFAKHRSKQRDYITLNDSPFYRCSFLLPCYL 1114

Query: 1196 QESSSYKELYGSITPSFSLPMLPIPHIYSTTNFIVEGILDDYSEFLLSDHHNQMSIN--- 1252
            QES  YK L GSI+PS SLP LP+P +  T +FI+E +L +++  L  D+  Q +++   
Sbjct: 1115 QESPLYKSLLGSISPSSSLPPLPMPLLAETIDFIIEDLLGEFAAGLKCDYDTQRTVDDPD 1174

Query: 1253 AELNSVDTTPLKDSFDM----QITNFQNILTTEDPYETDNFVVNVKYLTVTVNPDIVFTI 1308
            +   S DT+   +  D     +      IL+     + DN +++VK+L V ++P I   +
Sbjct: 1175 SPSESFDTSQEHEGPDDVRYDRFAQLPKILSPNPLEQYDNVIIDVKFLAVDLDPLICSYV 1234

Query: 1309 EKFSTEFNKKFSMNNQIDGIEMAIVNRLSDLKENISSKINVNLNVEKIDAAWGHRDVCFI 1368
            +    EF  K +  + ID IEM+IV RL  L  N +  +N+ L V  I+  WG ++   +
Sbjct: 1235 DGLLGEF-WKVNTVDIIDEIEMSIVKRLGQLWNN-TCVLNLKLYVVDINFFWGDKNAKVV 1292

Query: 1369 GTYINMLKFELSQESTYNNNGGLQKDLTLLGKFRSVRIIIQNHSYNSFSDDRPPGLSLML 1428
              Y + L F+L Q +   +   +  +   L K RSVR  + + S     ++RPP LSL +
Sbjct: 1293 DLYFDKLDFDLGQRTRDLDGETIVSEKITLSKLRSVRATVFDRSITEGVEERPPALSLAV 1352

Query: 1429 EGFEAWXXXXXXXXXXXXXXXFDITVDEYQIHWLIPYVKSQILLFTKIQDSVKLIYDEQA 1488
            EG+EA+                DITVDE Q+ WL  Y+  Q  L   +  S   +++   
Sbjct: 1353 EGWEAYSWMREKIVGSVSLLSTDITVDESQLEWLSVYIAEQRDLIKNMLTSFTKLHEYWQ 1412

Query: 1489 SYQKTFITSLIWAGEKYQIDHDPYVITKPATVLRLSAWHIRENRSWRIVTKLRHILTYXX 1548
              ++  +  +  A E YQI H+PYVITKPA ++RLS  H+REN SWRI+T+LRHILTY  
Sbjct: 1413 GTRRDLLRDITTASEHYQISHEPYVITKPAFIMRLSNGHVRENPSWRIITRLRHILTYLP 1472

Query: 1549 XXXXXXXXXXXXIKRSGLEKEAASTFLNVFSNWRNWEVSDIEKSYIYRMIFVEEVSK--- 1605
                             +     ST  +V S+WR WE+SDI +SYIYR IF+ + SK   
Sbjct: 1473 NEWRNNSAIQ-------VSPTVDSTDASVASHWRRWEISDITRSYIYRTIFLSDQSKTQC 1525

Query: 1606 RILQNSIKVFLETFYFTIYSRNYSADQNFLITKANILINN-EADQVNEVDLIRKQEEIVD 1664
            + L+  +KV   +F+FTIYS  Y    NF+IT+ANI+     A ++++V      + +++
Sbjct: 1526 QSLKKMLKVDFHSFFFTIYSEGYRVAHNFVITRANIVGEEIPAAELSKVQQALDYDNVMN 1585

Query: 1665 VVTKIGSIKFEFTEAILKLKRDIEQIIKTSVDSKSEGDKLSITKFFKVNLSFIFDHIDFN 1724
            +   +G+IK E  + +LKL R+I    +T    +S+   ++I+K +KVN+   FD  +  
Sbjct: 1586 LTVSLGAIKGELNDQLLKL-RNIFSKAQTPALKRSK-TSINISKSYKVNVLLAFDRSELQ 1643

Query: 1725 GQFYNSSLKSRMSNVNILSYFENNIESSTPSGSFVYYADRTGIALKHLNNILIDCQVRNL 1784
                 + L +R+ N       E    S+ P+ SFV++A R+   LKH + +L +   R L
Sbjct: 1644 FVLGQTRLTNRILNGKAALLLEKLKNSAAPALSFVFFAKRSESWLKHADLVLAEALSREL 1703

Query: 1785 FASTTAELHSAVNSLMINFRCSNLHFKSVPKTEIFVNAIKAIQRDVETLSAEISKAQGTT 1844
              + TAEL S + SL IN +CSN H +++  TE+ VN+IK I   +  L    +  + T 
Sbjct: 1704 SLTMTAELWSYMPSLSINIQCSNSHIRAMTSTELLVNSIKQIMESISELKRHFAMEKTTP 1763

Query: 1845 DNINTEHTPSVHEKNKMQKAKPNSKNNITLSATFTNVSSEITLLHPIYLKHETNSVNISY 1904
            +   T    S+               N  L+ +F++V++E+  L P  ++HE   + +  
Sbjct: 1764 NVQGTSTNLSI------------PLQNTALTVSFSDVTAELMPLTPFVVRHEMKQLGLYL 1811

Query: 1905 NTINIDELLVQVLDTDLYLNSSHTKEQYARLSYDKLELTTFLPDLNEKLIDLEISSSILK 1964
            N +  +E+L+ + D ++ L S  T EQY   +   L++   LP  +  ++++ +S+S++K
Sbjct: 1812 NRVQSNEILISIWDANIILKSHQTTEQYFNFALGDLQVKCNLPTESSAILNVGLSTSLMK 1871

Query: 1965 LTTSDPRRMLFSFLQDEKELKNSLTFLRSLESLNRKANSEDSETLFSSYEWIVNFKSKYM 2024
            LT S+PRR+L SFLQDEK +  SL +++ L  L        +++  S+  W ++    Y 
Sbjct: 1872 LTLSEPRRILSSFLQDEKLIGESLGYIKGLLQLFSPLARNKTQS--SALRWSLDANLNYF 1929

Query: 2025 GVLLPIQATYYVFELHDALSTVSNKEEPSSAVHKKFHGDLSFDHIIFLIKDQSIPHKFSK 2084
            G+L+P+ +T++VFE+H  L+ ++N  +          G +S ++ + LIK+ S+P   SK
Sbjct: 1930 GILVPMASTFFVFEIHMLLAAMNNASDGQDEGDHHVTGQVSIENCLLLIKEPSLPADLSK 1989

Query: 2085 ILDFSIKLSTHRTVNNFDRSFEIESSFFRVCLTPFSLIQTMWGXXXXXXXXXXXXDQSTX 2144
            +LDFSI++ + + V N  +S++IESS FRVCL+P SL+Q +WG                 
Sbjct: 1990 LLDFSIRVMSSQKVPNSPQSYQIESSHFRVCLSPGSLVQVLWGTHQLQSLLEYFRKHRKQ 2049

Query: 2145 XXXXXXXXXIDGATNSEKENVFSVRSFHILSYNFSIGWLYQDSDNTIPGLILGYNRLFST 2204
                      DG+ +++++  F  RS HILSYN  IGW++Q  D+   GLI+G++RLFS 
Sbjct: 2050 DKAISPFSLFDGSASADRQIDF--RSIHILSYNLCIGWMFQLGDDVKTGLIIGFDRLFSA 2107

Query: 2205 YEDNHGKLTLVDGFFSLANGSSGDTFYSSGDESSKFNRSYLPNIQILYWIKEIEKMKHLF 2264
            YE ++GKLTL+DG+FS+ANG S DTFYS G E  ++NRS+L N+QI YW+KEI+ MK LF
Sbjct: 2108 YEKHYGKLTLIDGYFSVANGQSTDTFYSQGSEKQRYNRSFLSNVQITYWLKEIDSMKDLF 2167

Query: 2265 IKFHGETLDVNFFENFVNIIESTVRSIDLFQTLKREKINPLVKAKPERDEKSNSALTNIK 2324
            I+ +GE L+V+   N  +IIEST+ SI  FQTLK+E+++   +    R++ +    +N  
Sbjct: 2168 IRVNGEALEVSLLSNSFDIIESTLASIQKFQTLKKERMHK--RDSGPRNKLNLENTSNNI 2225

Query: 2325 GPIFGKLKQVNCEFIYDGGLFRLFSNASMTNKLEPTLMIKSPKVKIMLSYDYFEKELKKH 2384
             P    ++ ++C+F Y GG+ +++S   +     P+L IKSP V I L Y++ E E + H
Sbjct: 2226 SPFLSHIRTIDCQFKYVGGVLKIYSLDDLNRAEGPSLEIKSPGVVIALKYNHNEAERRPH 2285

Query: 2385 WINCLIDIEPTQNVLKSGCVPFLSDFISQIKDIVELQDVNMEENMDNNVKDPINITSLLE 2444
             I CL+ I+PT N+L S CVP L+D +   + +V+    + E  ++++    I+  SLL+
Sbjct: 2286 RIRCLVSIDPTHNILYSQCVPILNDIVEASQRMVQKHSPD-ETPLESS--QSIDYKSLLD 2342

Query: 2445 NFDICFKLISGTQHVTLDCEPKAKINTDVGFGSFEFSILTPHLNPIDPLDISLKINDIKT 2504
            +FDI FK+ SG Q ++L CEP+AK+  DVGF SF F + T  L   +P  +SL +  I++
Sbjct: 2343 SFDIAFKVTSGRQQLSLSCEPRAKVQADVGFDSFTFGVTTNDLVDGNPTGVSLSVEKIQS 2402

Query: 2505 SVKHQFSNEASASFEVSKLDVILIFTHPEVFGTGLVDDVKLHFNLKQFQNISIFLDIWDV 2564
            SV+H FS E SASF V  +D   IFTHP+VFG  LV D+ + FN+KQ QN+++FLDIW +
Sbjct: 2403 SVRHIFSRETSASFSVDFVDFTSIFTHPDVFGVALVSDINVFFNMKQLQNLNLFLDIWQL 2462

Query: 2565 SKSTEKKLFKKDSNTLVDAKSSPIAQTIVNSSTLPWSFVFIATNINGDINMGSTLGNLAL 2624
            +     K   KD +     KS  +++     +++ WSF  I TN+ GD+++G +LG L+L
Sbjct: 2463 NGKLNNKGRAKDDDRKKQTKSMTLSKRTSTPTSICWSFTLIFTNVKGDVDLGPSLGVLSL 2522

Query: 2625 NLQRTWISTDHFHNKRQLLHLFTDNVKISSEGRLGGFVEIDDITWKLDVNYVDKYKFVVS 2684
             L RTW +TDH+  +R++LH F D + I SEGRL G  ++ + TW  +VNY        S
Sbjct: 2523 RLSRTWFATDHYGAQRRVLHAFADELSIKSEGRLSGVFDLKNATWISEVNYPAAGSIKGS 2582

Query: 2685 PLVDLLFDVGKVSMKVAFDYHMFLISTVKDLKFHVLSEKDIDDILPDLLTVNLTCDEIKV 2744
              + L   VG+V++K AFDYHMFLI T+ ++KFH+ SE D+  ILPDLL V L+C E+  
Sbjct: 2583 SEMSLSLSVGRVAIKTAFDYHMFLIGTIDEMKFHLRSESDLYGILPDLLVVALSCKEMDF 2642

Query: 2745 CTTALVASNILDIYNTIMRTRQDNKNSYIETLLESNNNVLKRKPLYEDILKSLNLLQTSL 2804
            C TAL A+NILDIYNTI R RQDN+ SYIETL ESN+   +   LY+DIL+SLNLL+T L
Sbjct: 2643 CATALTAANILDIYNTITRMRQDNRISYIETLRESNSTEARVTLLYDDILQSLNLLRTDL 2702

Query: 2805 SANIHELNLQISPSSLYDAEVIIIRVQDVFSSTETRTGEKIKTDLEMRVYNATLSLTSFG 2864
            S +I     QISP SL+D EV+++ + +V + +ET++GEK+KT+L ++V NA +SL++  
Sbjct: 2703 SFDITTFKAQISPISLFDVEVLVLNIDNVSARSETQSGEKLKTELHLQVSNAKVSLSTSK 2762

Query: 2865 KELTEEDIAEMSAETYISYASTLTSGRIFEIPQLTINMTTFQNADNMILQYTYSCSFDGK 2924
            +EL EE +A++S E Y+ YAS ++ G I ++P+L ++MTT+Q   + +++Y ++C F  +
Sbjct: 2763 EELDEERVAKISIEDYMLYASKISGGTIVKVPRLLVSMTTWQKPKSDLIEYLFTCRFFDR 2822

Query: 2925 VDVTWNLGPINFIKEVWATHVRSLEVRTVQFMGNHDISLEN-EGDTDESVKVLSNIEYIA 2983
            V V WNLGPINFIKE+W+TH++SL VR  Q   N  +S ++ + D D   ++ + ++Y+ 
Sbjct: 2823 VAVKWNLGPINFIKEMWSTHIKSLAVRQTQ--SNKTMSEKDKQADLDPEEEIKAKLQYVP 2880

Query: 2984 LEEPYIEMPQIKDLKDATPPLEWFGLNRKYFPSATHQSVIVPIQKLVNVAQKEYAKVLG 3042
            L+EPYIEMPQIKDL DATPP+EWFG++RK  P+ATHQ  IV IQKLV+ A+KEYAKV G
Sbjct: 2881 LDEPYIEMPQIKDLGDATPPMEWFGVHRKRLPAATHQLAIVLIQKLVHAAEKEYAKVQG 2939

>KAFR0B02720 Chr2 complement(549702..558650) [8949 bp, 2982 aa] {ON}
            Anc_8.260 YLR087C
          Length = 2982

 Score = 2230 bits (5779), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1199/3070 (39%), Positives = 1800/3070 (58%), Gaps = 124/3070 (4%)

Query: 6    TEFANVSLSQERYFSWVFLVYWILVVVATSTFVFYVAKLWGFGLTFACEWLLWKTMNIKV 65
            +EF +V +S  + FSWVFL+ WIL+VV   + +FYV +   +  +   EWLLWK  +IKV
Sbjct: 5    SEFQSVPISGGKNFSWVFLLDWILLVVLCLSVIFYVGRAIAYITSLILEWLLWKRAHIKV 64

Query: 66   TIESIRLSFLTGTIFFKNVCLIDQDKTISILECSVTWRYWLLNTRKSEYELNAKADTSKP 125
             IES+R+S L G IFFKNV +I +D TIS+L+ ++TWRYWLL TRK  Y L +K      
Sbjct: 65   NIESLRISLLGGRIFFKNVTIIHKDYTISLLQGTLTWRYWLLKTRKPSYHLESK----DS 120

Query: 126  NGDDMLDNNTIHDRSXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXKKLD 185
            NG  M  N                                                ++L 
Sbjct: 121  NGVTMKKN------------------------------------------------EQLP 132

Query: 186  SLFAINCTGFEIFLYNRKRAYETIIQNFSKEEKIQFIDFLRQHDLDDIFEEVSSEIKNCN 245
              F ++C G EIF+YNR  +Y+ II  FSKEE+I+F  FL +     IF + SS      
Sbjct: 133  CRFVLHCEGAEIFVYNRTWSYDNIINLFSKEERIKFQKFLDEQ----IFNDHSS------ 182

Query: 246  EYCNHKEGNNSAHFGSSCKSDKESASNISISGDSQEXXXXXXXXXXXXKISAHIMRKLHL 305
             Y +      ++  G S    K +  +   SG S +            +  +     L L
Sbjct: 183  -YSSKTTNGANSSTGESNSDTKLNDEDFVESGYSSQSTYNQNNDRIFDQAKSD-KDSLFL 240

Query: 306  DILPLDININKGAITIGNKFTRSLLVINFTEAHGLLDYALPDSKLDVFKNKVTFEINDID 365
               P++I +++ ++  GNKFT SL++I+     G++DY  P  KLD++K K+  E ++  
Sbjct: 241  QTFPVEIEVHRASLAFGNKFTPSLVIISSEHGTGIIDYCQPKEKLDLYKMKLAIETHNFA 300

Query: 366  MSIKRNIGYNPELASRFNFRAGVLTRIWSYLQLVLNLIPTGRLKTWYESLRYKEDTTFVK 425
            +++K NIGY  E+  +F    G L+R+W     +  +I      T  +  R +    F++
Sbjct: 301  VTVKPNIGYKEEMLLKFKIDRGKLSRLWKRFTPITGIITRPLGLTQRKKKRNEPPDLFIQ 360

Query: 426  KWDGLVLYKDSVKSSTKLGADDVDFDFANHEYAKVSNFFKAPQIIFSIESDIPGIVPHGS 485
            KW GL LYK ++   T    DD+ FDF NHEYAK S+  K P+ IF+ E DIPG VPHG+
Sbjct: 361  KWQGLSLYKGTIFEPTTDDLDDIQFDFLNHEYAKFSSVVKCPKAIFTYEYDIPGCVPHGA 420

Query: 486  HPPLSKAHGPDIGNHESPPTFLIDLQLSHASIYFGSWVNRNIVDLRDLMFPVISKDQKPL 545
            HP  S+  GPD+GN+ +PPT  +D+Q+   SI +G W  R +  +  ++ P +S+ + P+
Sbjct: 421  HPTNSEIDGPDVGNNGAPPTHSLDIQIFGGSICYGPWTQRQMNFIHSMLAPAVSRTESPV 480

Query: 546  NKLKPGLTRVHSMFNFSVSVLDDSSIRLPTREPSKDSDFLKQYLETKDDFRAFGWIDLSF 605
             +  PG TR+++    S+S++DD++ R+ TREPSKD+ FLK Y ET DD+R FGWIDL F
Sbjct: 481  KRRVPGSTRIYTATKLSISIMDDTTWRIATREPSKDNIFLKHYKETNDDYRPFGWIDLRF 540

Query: 606  KKGSEFMLNIPMIPTSGGFENTLFSKFSELEVTTSVNHNLLFKSNSLNIAANIGYPLGWN 665
             K S       ++PT+ GF+N +    ++ E+ +SVNH++L K    +   ++ YPL WN
Sbjct: 541  SKESYAYFTFALVPTTEGFKNDINIHLAQNEIRSSVNHDILMKCKFFDFDIDVSYPLVWN 600

Query: 666  DPVNWIFNINSKQLDIFLLREHITLLSDMIIDFSTQEPTPYELFRSFTYNLNLKIGGYSF 725
            D   W  ++NS QL+ FLLREHITL++D + DF++ EPTPYELFR     +N K+  Y  
Sbjct: 601  DRATWTIDMNSNQLETFLLREHITLIADTLTDFTSGEPTPYELFRPSETFINWKMDAYFI 660

Query: 726  YFNVNDRNIINNPLDFNENCYLSFHGDLFTSEITIPIISLAQQYVTISYEIFTPMFRLFL 785
            Y NVND NI+NNPLDFNENCYLS HGD     +TIP   +  Q+  I+Y I TPMFRL L
Sbjct: 661  YLNVNDHNIVNNPLDFNENCYLSLHGDDLLINVTIPSEDITAQFNEITYNITTPMFRLLL 720

Query: 786  NTPSWNTLSEFMRNKEIGRSHDFRVSGTYLIYSELDIDNVDSLTIDFESNSTVLYCFGFV 845
            NTP WNTL+EFM+ KE+GRS+DF   G+YL+YSELD+DNVD+++I  ES  T L C+GFV
Sbjct: 721  NTPPWNTLNEFMKYKEVGRSYDFSAKGSYLLYSELDVDNVDTISIICESRGTTLQCYGFV 780

Query: 846  IKYMMNFQANYFGSFIKFITTEEYSELIRN------NVNDNLGSINTNDLTSIEGLQKM- 898
            I+Y+ N + NYFG F  FIT+EEY+ + R+       ++ NL     N     +G   M 
Sbjct: 781  IRYLANVKMNYFGDFFNFITSEEYTGITRDEELEEELISSNLSDNEDNGDVYSDGESGMD 840

Query: 899  DSITNDVEDINQKTIKRSDLLRTENETDIWLNFKVNDGALILPEELYNGDSCVSLSFGEL 958
            D+I+ ++ +  + T+KRSDL RT NETD++L F V DGA+ILPE +YN D+C +L FGEL
Sbjct: 841  DAISQEIPE--RTTLKRSDLRRTANETDLFLTFSVWDGAIILPETIYNCDNCTALKFGEL 898

Query: 959  FINMRTCNYYMDVYITLYDNNLNRFEKIDPHELFEYIQTRNR-SSSVEGNISDITIHGHR 1017
             I++R+ NYYMD+  +L D  + R+ +  P ++F+ +   NR SS  +G +SD++IHGHR
Sbjct: 899  IIDLRSSNYYMDLLASLEDTVMERYTEKSPIDIFKSVLHDNRESSEAQGFLSDLSIHGHR 958

Query: 1018 MYGLPPKELTYFCQWSINIGTFLIDSDMIFLLSFIQSLNKIGFFLSNKENSLLYESDTVN 1077
            M+GLPP E TYFC+W  +IG   ++S+  FL  F+ S ++IGF   + EN LLY  + +N
Sbjct: 959  MFGLPPNEPTYFCKWDFDIGVLNVNSEFDFLKGFLTSFSRIGFGFKDLENILLYSKEVIN 1018

Query: 1078 DMTLLSVDVESLKVILSDPLLEARAEIGASSIIIRNIDFENEKYTKRLDVNASEFYFSLD 1137
            DMT L+V+ + + V L + +      +    +   +IDFE+  Y+ RLD+       S+ 
Sbjct: 1019 DMTSLTVNAQEISVNLKNEVSGIDMALKTQHVNFTSIDFESANYSSRLDLIIPSLKMSMY 1078

Query: 1138 SLKIDSGKKNILDVRTKLNITNFFKTDNHINHLDTQRKFIGLHDSPYHRCFFLLPEKFQE 1197
             L ID  K  + +  TK+++T+F +  N   H   QR +I L+D+ +HR  FLLP+ FQ+
Sbjct: 1079 GLDIDGKKARLFNFTTKVHLTDFAQKKNFKRHRSMQRNYITLNDAAFHRTSFLLPQSFQK 1138

Query: 1198 SSSYKELYGSITPSFSLPMLPIPHIYSTTNFIVEGILDDYSEFLLSDHHNQMSINAELNS 1257
               Y ELYGSI PS SLP+L +P +  T +FI+E  L +Y   L      +M   +  N+
Sbjct: 1139 KELYNELYGSIVPSSSLPVLALPILPKTVDFILEDFLGEYVSLLDDRTIFRMPFGST-NT 1197

Query: 1258 VDTTPLKDSFDMQITNFQN-ILTTEDPYETDNFVVNVKYLTVTVNPDIVFTIEKFSTEFN 1316
             +        DM    F N  ++TE  Y+ DN V++++Y++V +NP I   IE  S+   
Sbjct: 1198 PNQASTHHEEDMDPLEFSNSTVSTEKNYQCDNLVIDIEYISVEINPSISTYIESLSSTVY 1257

Query: 1317 KKFSMNNQIDGIEMAIVNRLSDLKENISSKINVNLNVEKIDAAWGHRDVCFIGTYINMLK 1376
            ++ ++   ID IE+  +  LS  +E  SS  N+ L V   D  WG RD   I  Y++ L 
Sbjct: 1258 EE-NIVQVIDDIEIETIKILSTFQEGTSSITNIKLRVLYSDIYWGERDRYGIELYLDKLD 1316

Query: 1377 FELSQESTYNNNGGLQKDLTLLGKFRSVRIIIQNHSYNSFSDDRPPGLSLMLEGFEAWXX 1436
            FE+SQ +   +      ++T+L K RS+R  I          +RPP LSL++EG E W  
Sbjct: 1317 FEMSQRNIEKDREKGLLEITMLAKTRSIRASISEEGSTKNEKERPPALSLVVEGCELWSA 1376

Query: 1437 XXXXXXXXXXXXXFDITVDEYQIHWLIPYVKSQILLFTKIQDSVKLIYDEQASYQKTFIT 1496
                          DIT+DE Q+ WL  +V  Q      I  ++  +  E    ++  I+
Sbjct: 1377 TAEKQVNSIDTISTDITIDESQLEWLFLFVNEQNQNLQNIITTLNSVQAEHTVSRRKLIS 1436

Query: 1497 SLIWAGEKYQIDHDPYVITKPATVLRLSAWHIRENRSWRIVTKLRHILTYXXXXXXXXXX 1556
             L  A + YQI HDPYVITKPA + RLS  H+RENRSW+I+T+LRHILTY          
Sbjct: 1437 KLTAANDFYQISHDPYVITKPAFITRLSKGHVRENRSWKIITRLRHILTYIPSDWESGVE 1496

Query: 1557 XXXXIKRSGLEKEAASTFLNVFSNWRNWEVSDIEKSYIYRMIFV---EEVSKRILQNSIK 1613
                 K    + EA   F++VFSNWRNWE SD+ +SYIY  +F+    E  K+ ++  IK
Sbjct: 1497 NYLKEKSLNDQDEAKKVFMSVFSNWRNWEFSDVARSYIYGRLFLTNQAEKHKQSMRRIIK 1556

Query: 1614 VFLETFYFTIYSRNYSADQNFLITKANILINNEADQVNEVDLIRKQEEIVDVVTKIGSIK 1673
            V L +F+ T Y+  Y  DQNF++T ANI+   +     E  + R  E+++++   IGS+K
Sbjct: 1557 VNLSSFFLTSYTAGYDIDQNFVLTNANIVF-EQTPPFTEAGVSR--EKLINLTGSIGSVK 1613

Query: 1674 FEFTEAILKLKRDIEQIIKTS--VDSKSEGDKLSITKFFKVNLSFIFDHIDFNGQFYNSS 1731
              F++ +L+LK  I  + K    ++        +I K FK+N   +F+  +       S 
Sbjct: 1614 GNFSDELLRLKELIPLLNKEQEKMERSPSFQVDNIPKSFKLNALLLFEKTEVQLVIGESK 1673

Query: 1732 LKSRMSNVNILSYFENNIESSTPSGSFVYYADRTGIALKHLNNILIDCQVRNLFASTTAE 1791
            L +R+ N  +    ++  E+ +P+GS + YA R+   + H N  L++ QVR+   S T E
Sbjct: 1674 LTNRILNGKVSLLLDHPKEAISPAGSIILYAKRSETLITHRNTTLVENQVRDFSLSATVE 1733

Query: 1792 LHSAVNSLMINFRCSNLHFKSVPKTEIFVNAIKAIQRDVETLSAEISKAQGTTDNINTEH 1851
              S+  +++++ +C++ H KS+ KT   VN++K + + V+ +  ++S +    +  N   
Sbjct: 1734 SWSSKPTVLVSTQCAHFHIKSMAKTATLVNSVKEMVQTVKNIDKQLSISDRLAEGEN--K 1791

Query: 1852 TPSVHEKNKMQKAKPNSKNNITLSATFTNVSSEITLLHPIYLKHETNSVNISYNTINIDE 1911
            +P    K K++  +      I +    +NVS EI  + P Y++HET   ++ +       
Sbjct: 1792 SP----KKKLKDVE------IEVVCQLSNVSFEIMPISPFYIRHETKKFDLKFKQFGSQN 1841

Query: 1912 LLVQVLDTDLYLNSSHTKEQYARLSYDKLELTTFLPDLNEKLIDLEISSSILKLTTSDPR 1971
            +++ V DTD +L S  TK+QY R+S+   ++T  L +    ++D  +S+S++KLT S+P 
Sbjct: 1842 VMIDVWDTDFFLRSDLTKQQYFRISFGDFQITYNLIEGEFIIVDANVSASMIKLTFSEPN 1901

Query: 1972 RMLFSFLQDEKELKNSLTFLRSLES-LNRKANSEDSETLFSSYEWIVNFKSKYMGVLLPI 2030
            R+L SFLQDE+    S   L++L+  L  +              W+++   KY G+L+PI
Sbjct: 1902 RILSSFLQDERTASESFKLLKALKPFLLPQTEGRLQPATTKEMRWLLDTDIKYFGILVPI 1961

Query: 2031 QATYYVFELHDALSTVSNKEEPSSAVHKKFHGDLSFDHIIFLIKDQSIPHKFSKILDFSI 2090
              TY+VFE H  + ++S+ +        +    +S ++++FLIKD+ IP   S++LDFSI
Sbjct: 1962 STTYFVFETHALVLSMSDIDTEKYTEKDETQSQVSIENVVFLIKDRGIPSALSRMLDFSI 2021

Query: 2091 KLSTHRTVNNFDRSFEIESSFFRVCLTPFSLIQTMWGXXXXXXXXXXXXDQSTXXXXXXX 2150
              ST + +   D SF++ES+ FR+ L+P+SL++ +WG            +Q         
Sbjct: 2022 SFSTIQKMMELDTSFQVESNHFRIFLSPYSLVRLVWGGQQFLGLANYYKEQRGTDLWDIK 2081

Query: 2151 XXXIDGATNSEKENVFSVRSFHILSYNFSIGWLYQDSDNTIPGLILGYNRLFSTYEDNHG 2210
               +            ++ SFH+LSYNF IGW++ +++ + PG++LG++RLFS YE  +G
Sbjct: 2082 ASKLKKEKKGSSSIGMNMSSFHVLSYNFCIGWMFPEANASAPGIMLGFSRLFSAYEGGYG 2141

Query: 2211 KLTLVDGFFSLANGSSGDTFYSSGDESSKFNRSYLPNIQILYWIKEIEKMKHLFIKFHGE 2270
            KLTLVD FFS+A G++  TFY    E    NRSYLPN+QI YW+K+   MK +FI+FHGE
Sbjct: 2142 KLTLVDAFFSVARGATSATFYPRESELESVNRSYLPNMQIAYWVKKSGLMKDVFIRFHGE 2201

Query: 2271 TLDVNFFENFVNIIESTVRSIDLFQTLKREKINPLVKAKPERDEKSNSALTNIKGPIFGK 2330
             LDV+F   F+ +IES ++S  +FQ LK   I P         E    +L     P    
Sbjct: 2202 ALDVSFLTTFITVIESMLQSFQVFQELKTSLIQPNTSTTENNTEPKIKSL----APFLSN 2257

Query: 2331 LKQVNCEFIYDGGLFRLFSNASMTNKLEPTLMIKSPKVKIMLSYDYFEKELKKHWINCLI 2390
            +K VNC+F YDGG+F++FS   + + LEP+  +K+P V I  +Y +    LK HWI  L+
Sbjct: 2258 IKSVNCQFKYDGGVFKVFSFEDIESHLEPSFELKTPGVIIDFNYKHNIGSLKPHWIRALV 2317

Query: 2391 DIEPTQNVLKSGCVPFLSDFISQIKDIVELQDVNME-ENMDNNV-KDP---INITSLLEN 2445
             I  T N L + C P +++F+  I ++V+    N + E++  N+ K P   I+   LL+ 
Sbjct: 2318 AIGSTHNTLFAVCAPLIAEFLEHIHEMVKKHSSNTKHESIATNLSKAPSQNIDYKRLLDG 2377

Query: 2446 FDICFKLISGTQHVTLDCEPKAKINTDVGFGSFEFSILTPHLNPIDPLDISLKINDIKTS 2505
            FDI FKL S  Q ++L CEPKAK+  DVGF SF   I+T +L+  +PL  SL I   K S
Sbjct: 2378 FDIAFKLTSSEQKLSLSCEPKAKVQADVGFDSFIIGIVTNNLDETEPLTFSLSIKKTKAS 2437

Query: 2506 VKHQFSNEASASFEVSKLDVILIFTHPEV---FGTGLVDDVKLHFNLKQFQNISIFLDIW 2562
            +KH FS E S SF +  +D+  +FTHP++   +GTGL+ +V L+FN+KQ QN+ +F+DIW
Sbjct: 2438 IKHIFSKETSTSFGLDLIDLNFMFTHPDIINMYGTGLISEVDLYFNVKQLQNLYLFIDIW 2497

Query: 2563 DVSKSTEKKLFKKDSNTLVDAKSSPIAQTIVNSSTLPWSFVFIATNINGDINMGSTLGNL 2622
             +S         K +N   + K   + Q       +PWSF  I TNING  ++G +LG L
Sbjct: 2498 KLSSFIRPGPKGKSNNGKRENKHLTLPQPSNLYGEIPWSFTLIFTNINGSADLGPSLGVL 2557

Query: 2623 ALNLQRTWISTDHFHNKRQLLHLFTDNVKISSEGRLGGFVEIDDITWKLDVNYVDKYKFV 2682
            +L L+RTW+++DH+ +KRQ++  FTD +   S+GRL G  E+D  +W  +V++  + +  
Sbjct: 2558 SLKLKRTWVASDHYQDKRQVIRAFTDYLSFVSKGRLSGIFELDGASWMSEVSWPKEKRTH 2617

Query: 2683 VSPLVDLLFDVGKVSMKVAFDYHMFLISTVKDLKFHVLSEKDIDDILPDLLTVNLTCDEI 2742
              PLV++  ++  +S+K AFDYHMFLI T+   KF + SEKDI   +PDLL VN TC+ I
Sbjct: 2618 NYPLVNVSVNIDNLSLKAAFDYHMFLIGTISTAKFSLHSEKDIVGTMPDLLKVNFTCEMI 2677

Query: 2743 KVCTTALVASNILDIYNTIMRTRQDNKNSYIETLLESNNNVLKRKP-LYEDILKSLNLLQ 2801
             +C+TALVA+NILD+YNT+MR RQDNK  Y+ETL ES+    +  P  Y DIL+SLNLLQ
Sbjct: 2678 NICSTALVAANILDLYNTVMRMRQDNKILYLETLRESDTLETRGNPDNYRDILRSLNLLQ 2737

Query: 2802 TSLSANIHELNLQISPSSLYDAEVIIIRVQDVFSSTETRTGEKIKTDLEMRVYNATLSLT 2861
            T +S NIH L LQ+SP +L+D EV++I ++++ +   T  GEK+KT LE+ VY+  ++L+
Sbjct: 2738 TDVSTNIHVLKLQVSPIALFDLEVLVINIENISARAGTFAGEKLKTILELEVYDGYVALS 2797

Query: 2862 SFGKELTEEDIAEMSAETYISYASTLTSGRIFEIPQLTINMTTFQNADNMILQYTYSCSF 2921
            +  +E+ E+ ++ +S   Y+ YAS ++ G I E+P+L I MT++Q  ++ IL+Y Y C+F
Sbjct: 2798 TSKREIDEDTVSAISVADYMEYASKISGGTIIEVPKLNIAMTSWQEENSDILEYLYKCTF 2857

Query: 2922 DGKVDVTWNLGPINFIKEVWATHVRSLEVRTVQFMGNHDISLENEGDTDESVKV------ 2975
            + K+ V WNLGP+NFIKE+W THV++L VR  Q +      L+ +  TDE V+       
Sbjct: 2858 EDKIAVKWNLGPVNFIKEMWTTHVKALAVRRSQNV------LDTDMQTDEEVQKRIKEEE 2911

Query: 2976 -LSNIEYIALEEPYIEMPQIKDLKDATPPLEWFGLNRKYFPSATHQSVIVPIQKLVNVAQ 3034
             +S ++Y+ +EEP I+MPQI+DL DATPPLEWFG+NRK  P+ THQ+V+VP+QKLV+ A+
Sbjct: 2912 NISKLKYVPIEEPRIDMPQIRDLGDATPPLEWFGVNRKRLPAFTHQTVVVPVQKLVHAAE 2971

Query: 3035 KEYAKVLGSS 3044
            K+YA +L +S
Sbjct: 2972 KQYASLLDNS 2981

>CAGL0L12210g Chr12 complement(1315265..1324210) [8946 bp, 2981 aa]
            {ON} similar to uniprot|Q12150 Saccharomyces cerevisiae
            YLR087c
          Length = 2981

 Score = 2215 bits (5740), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1193/3079 (38%), Positives = 1835/3079 (59%), Gaps = 148/3079 (4%)

Query: 8    FANVSLSQERYFSWVFLVYWILVVVATSTFVFYVAKLWGFGLTFACEWLLWKTMNIKVTI 67
            F   SL  +R FSWVFLV WIL V+ T   +FY+++ + +G+TF  EWLLWK   +KV+I
Sbjct: 10   FRGESLGFKRNFSWVFLVDWILTVILTLATLFYLSRAFAYGVTFILEWLLWKQAKVKVSI 69

Query: 68   ESIRLSFLTGTIFFKNVCLIDQDKTISILECSVTWRYWLLNTRKSEYELNAKADTSKPNG 127
             ++R+S L G +FFKN+ +ID+D+TI+ILE S+TWRYWL+ TRKSEY +   A  S  + 
Sbjct: 70   GALRISLLAGRVFFKNLTIIDKDRTITILEGSITWRYWLIRTRKSEYRVAQMAHASAGSS 129

Query: 128  DDMLDNNTIHDRSXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXKKLDSL 187
             +  D+                                                 KL   
Sbjct: 130  GNSEDDTKFD------------------------------------IANYMEKQLKLPCR 153

Query: 188  FAINCTGFEIFLYNRKRAYETIIQNFSKEEKIQFIDFLRQHDLDDIFEEVSSEIKNCNEY 247
            F   C GFE+F+YNR  AY+ I+   SK E+ +F  F+ ++D  D   + SS+ K     
Sbjct: 154  FLFECEGFEMFIYNRTYAYDNIVNVLSKVEREKFEKFMAENDFLDPSSDGSSDDK----- 208

Query: 248  CNHKEGNNSAHFGSSCKSDKES-ASNISISGDSQEXXXXXXXXXXXXKISAHIMRKLHLD 306
                E  +SA    +  +D+E+ A++ +   D+++                      +L+
Sbjct: 209  ---IEETSSA----TNSTDEETIANDRTFQNDTRKTLPR------------------YLE 243

Query: 307  ILPLDININKGAITIGNKFTRSLLVINFTEAHGLLDYALPDSKLDVFKNKVTFEINDIDM 366
             LP++  +NKG+I IGNKFT  +L+++F  A  L D     SKLD+++ K    + ++++
Sbjct: 244  ALPIEALLNKGSILIGNKFTPCVLILSFESAVALQDVGEAPSKLDLYRMKYEVRLKNLEI 303

Query: 367  SIKRNIGYNPELASRFNFRAGVLTRIWSYLQLVLNLIPTGRLKTWYESLRYKEDT--TFV 424
             +K+NI Y+ E +  F F  G L+R+W     +  L+P       ++S R KE     F+
Sbjct: 304  MMKQNIDYDNEKSRNFEFDKGKLSRLWHRFTRIFKLVPFP-----FKSNRRKEQPHDNFM 358

Query: 425  KKWDGLVLYKDSVKSSTKLGADDVDFDFANHEYAKVSNFFKAPQIIFSIESDIPGIVPHG 484
            +KW GL +Y++ +        DD++FD ++HEYAK ++  K+P++    + D+PG VPHG
Sbjct: 359  QKWKGLSMYRNDMFGEFD-EFDDIEFDISSHEYAKFTSLLKSPRVTIHHDYDMPGWVPHG 417

Query: 485  SHPPLSKAHGPDIGNHESPPTFLIDLQLSHASIYFGSWVNRNIVDLRDLMFPVISKDQKP 544
            +HPP S A GPD+GN+ +PP ++ ++ +   ++ +G W  R    L+ L+ P +S+  KP
Sbjct: 418  AHPPSSYADGPDVGNNMAPPQYIFEINIFGGTVCYGPWAQRQTNHLQSLLSPSVSRTAKP 477

Query: 545  LNKLKPGLTRVHSMFNFSVSVLDDSSIRLPTREPSKDSDFLKQYLETKDDFRAFGWIDLS 604
            + KLKPG  R++++   +++ ++D + R+PTRE SKD +FL  Y ET DD+R FGWID+ 
Sbjct: 478  IKKLKPGSKRIYTVLKLTINAMEDVTWRIPTRESSKDVEFLMHYKETNDDYRPFGWIDIK 537

Query: 605  FKKGSEFMLNIPMIPTSGGFENTLFSKFSELEVTTSVNHNLLFKSNSLNIAANIGYPLGW 664
              + S  + ++ M PTS GF+NT+  +  + E+ +SVNH++  KS S +   +IGYPLGW
Sbjct: 538  VSRDSCGIFDLAMCPTSKGFKNTIDVQLVDTEIRSSVNHDIFLKSKSFSFNCDIGYPLGW 597

Query: 665  NDPVNWIFNINSKQLDIFLLREHITLLSDMIIDFSTQEPTPYELFRSFTYNLNLKIGGYS 724
            N   NW   ++S QL++FLLREH+TL++D + DFS+ EP PYELFR F Y++   + GYS
Sbjct: 598  NAEANWTIIMDSNQLELFLLREHVTLIADTLTDFSSGEPVPYELFRPFVYHIKWNMKGYS 657

Query: 725  FYFNVNDRNIINNPLDFNENCYLSFHGDLFTSEITIPIISLAQQYVTISYEIFTPMFRLF 784
            FY NVND NI+NNPLDFNENCYLS HGD  T  + +P  ++  ++  ++Y+I+TPMFRL 
Sbjct: 658  FYLNVNDHNIVNNPLDFNENCYLSIHGDDLTMNVMVPKKTITSRFTNMTYDIYTPMFRLL 717

Query: 785  LNTPSWNTLSEFMRNKEIGRSHDFRVSGTYLIYSELDIDNVDSLTIDFESNSTVLYCFGF 844
            LNTP WNTL+EFMRNKE+GRSHDFR+ G+YLIYSELDIDNVD+LT++  S  T L+ +GF
Sbjct: 718  LNTPPWNTLNEFMRNKEVGRSHDFRLKGSYLIYSELDIDNVDTLTVECSSRGTALHIYGF 777

Query: 845  VIKYMMNFQANYFGSFIKFITTEEYSELIRNNVNDNLGSINT--NDLTSIEGLQKMDSIT 902
            VI+Y++N + NYFG F  F+T+EEY+   R    +N+ S +   +D +S E + ++ S +
Sbjct: 778  VIRYLINVKMNYFGEFFHFVTSEEYTGNTRPTDLENIISEDRRDDDFSSYESVSRISSNS 837

Query: 903  ND--VEDINQKTIKRSDLLRTENETDIWLNFKVNDGALILPEELYNGDSCVSLSFGELFI 960
            +D   +   + ++K+SDL RT NETDIW  F V DGALILPE +YN D C++L F EL +
Sbjct: 838  SDKNPKAKKKHSLKKSDLKRTSNETDIWFTFSVWDGALILPETIYNADPCIALHFAELIV 897

Query: 961  NMRTCNYYMDVYITLYDNNLNRFEKIDPHELFEYIQTRN-RSSSVEGNISDITIHGHRMY 1019
            ++R+CNYYMD+  T  D NL R+      E++EY+   N +   V G +SDI IHGHRMY
Sbjct: 898  DLRSCNYYMDILATACDINLKRYVGKRADEIYEYVHLNNGKDHEVHGTLSDIYIHGHRMY 957

Query: 1020 GLPPKELTYFCQWSINIGTFLIDSDMIFLLSFIQSLNKIGFFLSNKENSLLYESDTVNDM 1079
            GLPP E TYFCQW ++ G   IDS+M FL     +  KIGF   + EN LLYE++ ++DM
Sbjct: 958  GLPPTEPTYFCQWDMDFGHLNIDSNMFFLQGLFGAFYKIGFGYKDLENILLYETEIIDDM 1017

Query: 1080 TLLSVDVESLKVILSDPLLEARAEIGASSIIIRNIDFENEKYTKRLDVNASEFYFSLDSL 1139
            T L++ + ++ + L+D    A A++         IDFENE+Y+KR+D+      F++   
Sbjct: 1018 TSLTIFINTIDIRLNDVDTTAHADLKLERFCFTLIDFENERYSKRMDIKIPSLEFNI--F 1075

Query: 1140 KIDSGKKNILDVRTKLNITNFFKTDNHINHLDTQRKFIGLHDSPYHRCFFLLPEKFQESS 1199
              +    ++L+ +  +N TNF +  +   H   QR +I L+D+PYHRC FLLPE +Q+S 
Sbjct: 1076 SNEDNDLSLLNFKVDMNFTNFVQNQDFNKHRKIQRDYIVLNDAPYHRCAFLLPESYQKSR 1135

Query: 1200 SYKELYGSITPSFSLPMLPIPHIYSTTNFIVEGILDDYSEFLLSDHHNQMSI--NAELNS 1257
             Y EL+G+I PS SLP LPIP    T  +++E +L+DY      ++  + S   N EL++
Sbjct: 1136 IYNELFGAIAPSSSLPPLPIPLTADTIEYVLEDLLEDYMGLFEGNYDIKESSVENLELSA 1195

Query: 1258 VDTTPLKDSFDMQITNFQNILTTEDPYETDNFVVNVKYLTVTVNPDIVFTIEKFSTEFNK 1317
            ++ T        + T+   I  ++   E+DN+VV V+ + + +NP +  TIEK       
Sbjct: 1196 IEATRAITGIGAERTHSNPITLSDYAVESDNYVVKVESIVIDINPALYTTIEKLLKHIYD 1255

Query: 1318 KFSMNNQIDGIEMAIVNRLSDLKENISSKINVNLNVEKIDAAWGHRDVCFIGTYINMLKF 1377
            + ++   IDGIE+ IV RLS + + +++  NV + ++  +  WG ++   +  + + + F
Sbjct: 1256 QDAV-QIIDGIEIGIVKRLSSIHDGVTTMTNVKVQIKHFNLFWGEKESDNVSMFFDKMDF 1314

Query: 1378 ELSQESTYNNNGGLQKDLTLLGKFRSVRIIIQNHSYNSFSDDRPPGLSLMLEGFEAWXXX 1437
             L++++   N+     ++T+L K ++VR+ +        + +RPP +++ +EGFE W   
Sbjct: 1315 ALTEKTLEQNSEKNLLEMTVLAKIKAVRLTVVQQPGLIPTQERPPAITVGVEGFEFWSTA 1374

Query: 1438 XXXXXXXXXXXXFDITVDEYQIHWLIPYVKSQILLFTKIQDSVKLIYDEQASYQKTFITS 1497
                         DITVD+ Q+ W   Y+  Q   F  +  S   I + +   QK  I+ 
Sbjct: 1375 IEKQVNSISVSSADITVDDAQVEWFFKYIVRQKYFFLDMLQSYNRIQNNRIESQKELISR 1434

Query: 1498 LIWAGEKYQIDHDPYVITKPATVLRLSAWHIRENRSWRIVTKLRHILTYXXXXXXXXXXX 1557
            L  A E YQI HDPYVITKPA ++RLS  H+REN+SW+I+T+LRHILTY           
Sbjct: 1435 LTAASEYYQISHDPYVITKPAFIMRLSRGHVRENKSWKIITRLRHILTYLPKDWYLNVGQ 1494

Query: 1558 XXXIKRSGLEKEAASTFLNVFSNWRNWEVSDIEKSYIYRMIFV---EEVSKRILQNSIKV 1614
                ++    ++A S F+++FSNWR+WE SD+ +SYIY  +F+    E  K+ LQ   K+
Sbjct: 1495 PLRDRKFDPSQDARSIFMSIFSNWRSWEFSDVARSYIYGKLFLNDHAEKKKQSLQKLFKL 1554

Query: 1615 FLETFYFTIYSRNYSADQNFLITKANILINNEADQVNEVDLIRKQEEIVDVVTKIGSIKF 1674
             +  F+ T+YS NY  D + +++ A +L+          +   ++EE++D+   +  IK 
Sbjct: 1555 NIGNFFMTVYSTNYDVDHSIVVSNAKLLLELTPSSTEPKENSLQREELIDISGTVDVIKG 1614

Query: 1675 EFTEAILKLKRDIEQIIKTSVDSKSEGDKLSITKFFKVNLSFIFDHIDFNGQFYNSSLKS 1734
            + +  +LKL++ I  + + S     +  + +I K FK+N +F+ +  D       + L  
Sbjct: 1615 KLSTKLLKLQKLIPILTEGSEKQPVKPPQDTIPKPFKMNAAFMVNSCDIQLVMDATKLNM 1674

Query: 1735 RMSNVNILSYFENNIESSTPSGSFVYYADRTGIALKHLNNILIDCQVRNLFASTTAELHS 1794
             +++  I   +EN  +S+  +GS V ++  T + LKH+N++L + +V N +A+ T +  +
Sbjct: 1675 NVNDGRISVLWENLQDSTAQAGSVVLFSKHTELVLKHINSVLAEGRVSNFYATFTTDTWA 1734

Query: 1795 AVNSLMINFRCSNLHFKSVPKTEIFVNAIKAIQRDVETLSAEISKAQGTTDNINTEHTPS 1854
               + +I+ + S++HF+++ KTE  V AIK I+  ++ +S ++   +  T +      P+
Sbjct: 1735 QRPTYLIHSKSSSIHFRTMAKTERLVEAIKDIKLKIDQISEQLELERRLTQH------PT 1788

Query: 1855 VHEKNKMQKAKPNSKNNITLSATFTNVSSEITLLHPIYLKHETNSVNISYNTINIDELLV 1914
            V++ N         K+N+  S  F+NVS +I  + P  LK+    ++  YN  + D  L+
Sbjct: 1789 VYDPN---------KSNVIASCLFSNVSMDIMPVSPFALKNSAKQIDFFYNKFDSDSWLI 1839

Query: 1915 QVLDTDLYLNSSHTKEQYARLSYDKLELTTFLPDLNEKLIDLEISSSILKLTTSDPRRML 1974
            ++ DTD +L S  TKEQY RLS  KL++   +     KL+D+ +S++++KLT S+P+ ++
Sbjct: 1840 KLKDTDFFLTSDQTKEQYMRLSMKKLQIRVNVSSSKPKLVDINLSTNLVKLTFSEPKNIV 1899

Query: 1975 FSFLQDEKELKNSLTFLRSLESLNRKANSEDSETLFSSYE------WIVNFKSKYMGVLL 2028
            +SFL+DE+    S+  L++L+ L   + S+D E+   SY+      W ++    Y G+L+
Sbjct: 1900 YSFLKDERVASESVHLLQTLKPLF--SISDDKESTPQSYQEKTEYLWSLDSSIDYFGILI 1957

Query: 2029 PIQATYYVFELHDALSTVSNKEEPSSAVHKKFHGDLSFDHIIFLIKDQSIPHKFSKILDF 2088
            P+ +TYYV E H  +S++SN     S  +    G +S ++I+FLIK+ S+P   SK++D 
Sbjct: 1958 PMTSTYYVMEFHSYVSSISNANGAPSG-NLDITGHMSVENILFLIKESSLPDGLSKVIDI 2016

Query: 2089 SIKLSTHRTVNNFDRSFEIESSFFRVCLTPFSLIQTMWGXXXXXXXXXXXXDQSTXXXXX 2148
            ++ +ST + V++  RS ++ESS  R+CL+P SL++ +WG               +     
Sbjct: 2017 AVNVSTLQRVDDNSRSIQVESSHARICLSPDSLLRLLWGFNQGHKLSEHYLKYHSKSLWQ 2076

Query: 2149 XXXXXIDGA--TNSEKEN----VFSVRSFHILSYNFSIGWLYQDSDNTIPGLILGYNRLF 2202
                  D    TNS K N      S+ S H LSYN  +GWL++       GLI GY+RLF
Sbjct: 2077 SFAKSDDKQQDTNSIKSNETSFFSSINSIHFLSYNLCVGWLFEYELGPPKGLITGYSRLF 2136

Query: 2203 STYEDNHGKLTLVDGFFSLANGSSGDTFYSSGDESSKFNRSYLPNIQILYWIKEIEKMKH 2262
            S YE+  GKLT++D +F+ A G++  TFY   +    FNR YLPN+QIL+W K IE MK 
Sbjct: 2137 SAYENCMGKLTVIDSYFAAAQGNTSSTFYPETNVKELFNRFYLPNMQILFWWKVIEGMKD 2196

Query: 2263 LFIKFHGETLDVNFFENFVNIIESTVRSIDLFQTLKREKINPLVKAKPERD--EKSNSAL 2320
            ++++F GETLDV +  +F+  IEST+ SI +FQ LK+E    L+   P+R+         
Sbjct: 2197 VYVRFTGETLDVKYLSDFMLTIESTLHSIKMFQKLKKE----LIVETPKREVVHIKEDKP 2252

Query: 2321 TNIKGPIFGKLKQVNCEFIYDGGLFRLFSNASMTNKLEPTLMIKSPKVKIMLSYDYFEKE 2380
             N    I   +K VNC F YDGG + +F+ +  +    P + IKSP + + + Y + ++ 
Sbjct: 2253 VNSSNNILKNIKSVNCHFKYDGGTYSVFNISDGSLNPTPAIEIKSPVISVDVLYKHEKQN 2312

Query: 2381 LKKHWINCLIDIEPTQNVLKSGCVPFLSDFISQIKDIV-ELQDVNMEENMDNNVKDPINI 2439
             K H I CL++I+PT NVL + C P + +F+  ++ I    +  N            I+ 
Sbjct: 2313 TKHHSIRCLVNIDPTHNVLYATCAPLVKNFVEDVRSIFGRYESENKHSETTPTSVQNIDY 2372

Query: 2440 TSLLENFDICFKLISGTQHVTLDCEPKAKINTDVGFGSFEFSILTPHLNPIDPLDISLKI 2499
              LLE++D+   + S  Q ++L CEPKAK+  DVGF +   S+ T   +  +PL  S  I
Sbjct: 2373 EKLLEDYDLAITVTSAKQQLSLSCEPKAKVQADVGFEALTVSMTTNPFDIDEPLAFSFSI 2432

Query: 2500 NDIKTSVKHQFSNEASASFEVSKLDVILIFTHP---EVFGTGLVDDVKLHFNLKQFQNIS 2556
             D K S+KH FS E S SF V  LD+ L+FTH      +GT L+ D+ L+FN+KQ QN+ 
Sbjct: 2433 KDTKASIKHLFSRETSTSFGVGYLDLTLLFTHTNRINTYGTSLISDIDLYFNVKQLQNLY 2492

Query: 2557 IFLDIWDVSK------STEKKLFKKDSNTLVDAKSSPIAQTIVNSSTLPWSFVFIATNIN 2610
            +FLDIW +S+      S+++++ +KD    VD       + I N S LPW F  I TN+ 
Sbjct: 2493 LFLDIWQLSELLNPVTSSQEQVIRKDKKKSVD-------KPIHNESQLPWCFTLIFTNVK 2545

Query: 2611 GDINMGSTLGNLALNLQRTWISTDHFHNKRQLLHLFTDNVKISSEGRLGGFVEIDDITWK 2670
            GDI++G +LG ++L L RTW++TDHF  KRQ+LH F D++ + SEGRL G V ID  +W 
Sbjct: 2546 GDIDLGPSLGLISLRLSRTWLATDHFSGKRQILHAFVDDLLLISEGRLSGVVNIDGASWV 2605

Query: 2671 LDVNYVDKYKFVVSPLVDLLFDVGKVSMKVAFDYHMFLISTVKDLKFHVLSEKDIDDILP 2730
             +V ++   K    PLV L  +  K+ +K AFDYHMFLI TV ++ F + SE+D+  + P
Sbjct: 2606 SEVIWLQDSKRDNIPLVALSLNTDKIEIKAAFDYHMFLIGTVNNILFQLHSERDMVGVAP 2665

Query: 2731 DLLTVNLTCDEIKVCTTALVASNILDIYNTIMRTRQDNKNSYIETLLESNNNVLKRKPLY 2790
            DLL V+ +C+EIK+C+TALVA+NILDIYNTI+R RQD K SYIETL +SN    K+   Y
Sbjct: 2666 DLLKVSFSCEEIKLCSTALVAANILDIYNTIIRMRQDTKISYIETLKDSNMETNKQTLAY 2725

Query: 2791 EDILKSLNLLQTSLSANIHELNLQISPSSLYDAEVIIIRVQDVFSSTETRTGEKIKTDLE 2850
             DILKSL LL+T L+ +I  L LQISP SL+D EV++I V  V + +ET +  K+ T L 
Sbjct: 2726 RDILKSLQLLRTDLTVSICSLQLQISPISLFDVEVVVINVVSVSARSETHSEAKLTTSLN 2785

Query: 2851 MRVYNATLSLTSFGKELTEEDIAEMSAETYISYASTLTSGRIFEIPQLTINMTTFQNADN 2910
            M VY+ATLSL++  +EL E+ +++++   Y++YAS +  G I EIP++ + MTT+Q   +
Sbjct: 2786 MEVYDATLSLSTAKQELDEDALSKITVADYMTYASKIRGGTIIEIPRMGVQMTTWQEEKS 2845

Query: 2911 MILQYTYSCSFDGKVDVTWNLGPINFIKEVWATHVRSLEVRTVQFM-GNHDISLENEGDT 2969
             IL+Y YSC F  KV V WNLGP+NF+KE+W THV+++ VR  Q + G+ ++S   E D 
Sbjct: 2846 DILEYLYSCKFHDKVAVRWNLGPVNFMKEMWTTHVKAIAVRRSQVLTGSFNVS---EKDV 2902

Query: 2970 DESVKVLSNI---EYIALEEPYIEMPQIKDLKDATPPLEWFGLNRKYFPSATHQSVIVPI 3026
            ++ +K   NI    Y+ +EEP I+MPQIKDL DATPP+EWFG+NRK FP+ THQ+ +VP+
Sbjct: 2903 EKRIKEEENITKLNYVPVEEPQIDMPQIKDLGDATPPVEWFGVNRKRFPAFTHQTAVVPV 2962

Query: 3027 QKLVNVAQKEYAKVLGSSK 3045
            Q LV +AQK+YAK LG SK
Sbjct: 2963 QNLVYLAQKQYAKTLGRSK 2981

>YLR087C Chr12 complement(306855..315731) [8877 bp, 2958 aa] {ON}
            CSF1Protein required for fermentation at low temperature;
            the authentic, non-tagged protein is detected in highly
            purified mitochondria in high-throughput studies
          Length = 2958

 Score = 2214 bits (5737), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1163/2889 (40%), Positives = 1746/2889 (60%), Gaps = 90/2889 (3%)

Query: 183  KLDSLFAINCTGFEIFLYNRKRAYETIIQNFSKEEKIQFIDFLRQHDLDDIFEEVSSEIK 242
            KL    ++ C G EIF+YNR  AY+ +I   SK+E+ +F  +L +H   + F + SS  K
Sbjct: 126  KLPCKISVECEGLEIFIYNRTVAYDNVINLLSKDERDKFEKYLNEHSFPEPFSDGSSADK 185

Query: 243  NCNEYCNHKEGNNSAHFGSSCKSDKESASNISISGDSQEXXXXXXXXXXXXKISAHIMRK 302
               +        NS    +S  +D+          D QE             I  H   K
Sbjct: 186  LDEDLSESAYTTNS---DASIVNDR----------DYQET-----------DIGKH--PK 219

Query: 303  LHLDILPLDININKGAITIGNKFTRSLLVINFTEAHGLLDYALPDSKLDVFKNKVTFEIN 362
            L L  LP+++  ++G++ +GNKFT S++++++    G++D   P  +LD+++NK   E  
Sbjct: 220  L-LMFLPIELKFSRGSLLLGNKFTPSVMILSYESGKGIIDVLPPKERLDLYRNKTQMEFK 278

Query: 363  DIDMSIKRNIGYNPELASRFNFRAGVLTRIWSYLQLVLNLIPTGRLKTWYESLRYKEDTT 422
            + ++SIK+NIGY+  +  +F    G ++++W     V  ++    +    +      D  
Sbjct: 279  NFEISIKQNIGYDDAIGLKFKIDRGKVSKLWKTFVRVFQIVTKPVVPKKTKKSAGTSDDN 338

Query: 423  FVKKWDGLVLYKDSVKSSTKLGADDVDFDFANHEYAKVSNFFKAPQIIFSIESDIPGIVP 482
            F  KW GL LYK S   +     DDV+FD  NHEYAK ++  K P++  + + D+PG+VP
Sbjct: 339  FYHKWKGLSLYKASAGDAKASDLDDVEFDLTNHEYAKFTSILKCPKVTIAYDVDVPGVVP 398

Query: 483  HGSHPPLSKAHGPDIGNHESPPTFLIDLQLSHASIYFGSWVNRNIVDLRDLMFPVISKDQ 542
            HG+HP +    GPD+GN+ +PP F +D+Q+   SI +G W  R +  L+ ++ PV+S+  
Sbjct: 399  HGAHPTIPDIDGPDVGNNGAPPDFALDVQIHGGSICYGPWAQRQVSHLQRVLSPVVSRTA 458

Query: 543  KPLNKLKPGLTRVHSMFNFSVSVLDDSSIRLPTREPSKDSDFLKQYLETKDDFRAFGWID 602
            KP+ KL PG  R++++F  ++S+++D++ R+PTRE SKD +FLK Y ET +++R FGW+D
Sbjct: 459  KPIKKLPPGSRRIYTLFRMNISIMEDTTWRIPTRESSKDPEFLKHYKETNEEYRPFGWMD 518

Query: 603  LSFKKGSEFMLNIPMIPTSGGFENTLFSKFSELEVTTSVNHNLLFKSNSLNIAANIGYPL 662
            L F K +    NI + PT  GF+N     F E E+ +SVNH++L KS   +I  +IGYPL
Sbjct: 519  LRFCKDTYANFNISVCPTVQGFQNNFHVHFLETEIRSSVNHDILLKSKVFDIDGDIGYPL 578

Query: 663  GWNDPVNWIFNINSKQLDIFLLREHITLLSDMIIDFSTQEPTPYELFRSFTYNLNLKIGG 722
            GWN    WI N+ S+QL+ FLLREHITL++D + DFS  +PTPYELFR F Y +N ++ G
Sbjct: 579  GWNSKAIWIINMKSEQLEAFLLREHITLVADTLSDFSAGDPTPYELFRPFVYKVNWEMEG 638

Query: 723  YSFYFNVNDRNIINNPLDFNENCYLSFHGDLFTSEITIPIISLAQQYVTISYEIFTPMFR 782
            YS Y NVND NI+NNPLDFNENCYLS HGD  + ++T+P  S+   Y  +SYEI TPMFR
Sbjct: 639  YSIYLNVNDHNIVNNPLDFNENCYLSLHGDKLSIDVTVPRESILGTYTDMSYEISTPMFR 698

Query: 783  LFLNTPSWNTLSEFMRNKEIGRSHDFRVSGTYLIYSELDIDNVDSLTIDFESNSTVLYCF 842
            + LNTP WNTL+EFM++KE+GR++DF + G+YL+YSELDIDNVD+L I+  S STVL+C+
Sbjct: 699  MMLNTPPWNTLNEFMKHKEVGRAYDFTIKGSYLLYSELDIDNVDTLVIECNSKSTVLHCY 758

Query: 843  GFVIKYMMNFQANYFGSFIKFITTEEYSELI-RNNVNDNLGSINTNDLTS-IEGLQKMDS 900
            GFV++Y+ N + NYFG F  F+T+EEY+ ++    V D     +  DL S ++   +  S
Sbjct: 759  GFVMRYLTNVKMNYFGEFFNFVTSEEYTGVLGAREVGDVTTKSSVADLASTVDSGYQNSS 818

Query: 901  ITNDVEDINQKTIKRSDLLRTENETDIWLNFKVNDGALILPEELYNGDSCVSLSFGELFI 960
            + N+ ED  +  +KRSDL RT NETDIW  F V DGALILPE +Y+ D C++L F EL +
Sbjct: 819  LKNESED--KGPMKRSDLKRTTNETDIWFTFSVWDGALILPETIYSFDPCIALHFAELVV 876

Query: 961  NMRTCNYYMDVYITLYDNNLNRFEKIDPHELFEYIQTRNRSSSVE-GNISDITIHGHRMY 1019
            + R+CNYYMD+   L   ++ R      +E+F++I+  N +   E G +SD+TIHGHRMY
Sbjct: 877  DFRSCNYYMDIMAVLNGTSIKRHVSKQINEVFDFIRRNNGADEQEHGLLSDLTIHGHRMY 936

Query: 1020 GLPPKELTYFCQWSINIGTFLIDSDMIFLLSFIQSLNKIGFFLSNKENSLLYESDTVNDM 1079
            GLPP E TYFCQW IN+G   IDSD+ F+  F  S  KIGF  ++ EN LLY+++T+NDM
Sbjct: 937  GLPPTEPTYFCQWDINLGDLCIDSDIEFIKGFFNSFYKIGFGYNDLENILLYDTETINDM 996

Query: 1080 TLLSVDVESLKVILSDPLLEARAEIGASSIIIRNIDFENEKYTKRLDVNASEFYFSLDSL 1139
            T L+V VE +++ L DP++++++ I A SI+   IDFENEKY++R+DV   +   SL+ +
Sbjct: 997  TSLTVHVEKIRIGLKDPVMKSQSVISAESILFTLIDFENEKYSQRIDVKIPKLTISLNCV 1056

Query: 1140 KIDSGKKNILDVRTKLNITNFFKTDNHINHLDTQRKFIGLHDSPYHRCFFLLPEKFQESS 1199
              D    + L   TKL  TNF +  +       QR++I +HDSPYHRC FLLP  +Q+S 
Sbjct: 1057 MGDGVDTSFLKFETKLRFTNFEQYKDIDKKRSEQRRYITIHDSPYHRCPFLLPLFYQDSD 1116

Query: 1200 SYKELYGSITPSFSLPMLPIPHIYSTTNFIVEGILDDYSEFLLSDHHNQMSINAELNSVD 1259
            +Y+ LYG+I PS S+P LP+P +  T ++I+E I+ +Y+  LL   +   +I AE  S  
Sbjct: 1117 TYQNLYGAIAPSSSIPTLPLPTLPDTIDYIIEDIVGEYAT-LLETTNPFKNIFAETPST- 1174

Query: 1260 TTPLKDSF-------DMQITNFQNILTTEDP-YETDNFVVNVKYLTVTVNPDIVFTIEKF 1311
              P + SF       +   ++F+ +  TED  +E DN+VV+V Y+ + V+P ++F   K 
Sbjct: 1175 MEPSRASFSEDDNDEEADPSSFKPVAFTEDRNHERDNYVVDVSYILLDVDP-LLFIFAKS 1233

Query: 1312 STEFNKKFSMNNQIDGIEMAIVNRLSDLKENISSKINVNLNVEKIDAAWGHRDVCFIGTY 1371
              E     +M   +D IE+ IV RLS+L+E I+S  N+++++  ++  W          Y
Sbjct: 1234 LLEQLYSENMVQVLDDIEIGIVKRLSNLQEGITSISNIDIHIAYLNLIWQETGEEGFELY 1293

Query: 1372 INMLKFELSQESTYNNNGGLQKDLTLLGKFRSVRIIIQNHSYNSFSDDRPPGLSLMLEGF 1431
            ++ + +++S++S   N      ++  L K ++VR+ +        S+DRPP LSL +EGF
Sbjct: 1294 LDRIDYQMSEKSLEKNRTNKLLEVAALAKVKTVRVTVNQKKNPDLSEDRPPALSLGIEGF 1353

Query: 1432 EAWXXXXXXXXXXXXXXXFDITVDEYQIHWLIPYVKSQILLFTKIQDSVKLIYDEQASYQ 1491
            E W                DIT+DE Q+ WL  Y   Q  L  ++  S   I + +++ +
Sbjct: 1354 EVWSSTEDRQVNSLNLTSSDITIDESQMEWLFEYCSDQGNLIQEVCTSFNSIQNTRSNSK 1413

Query: 1492 KTFITSLIWAGEKYQIDHDPYVITKPATVLRLSAWHIRENRSWRIVTKLRHILTYXXXXX 1551
               I+ L  A E YQI HDPYVITKPA ++RLS  H+RENRSW+I+T+LRHILTY     
Sbjct: 1414 TELISKLTAASEYYQISHDPYVITKPAFIMRLSKGHVRENRSWKIITRLRHILTYLPDDW 1473

Query: 1552 XXXXXXXXXIKRSGLEKEAASTFLNVFSNWRNWEVSDIEKSYIYRMIFVEEVSKR---IL 1608
                      K+    K+A + F++VFS WRNWE SD+ +SYIY  +F  E  K    ++
Sbjct: 1474 QSNIDEVLKEKKYTSAKDAKNIFMSVFSTWRNWEFSDVARSYIYGKLFTAENEKHKQNLI 1533

Query: 1609 QNSIKVFLETFYFTIYSRNYSADQNFLITKANILINNEADQVNEVDLIRKQEEIVDVVTK 1668
            +  +K  + +FY T+Y   Y  + NF++  AN++++      +   L   +EE +++  +
Sbjct: 1534 KKLLKCTMGSFYLTVYGEGYEVEHNFVVADANLVVDLTPPVTS---LPSNREETIEITGR 1590

Query: 1669 IGSIKFEFTEAILKLKRDIEQIIKTSVDSKSEGDKLSITKFFKVNLSFIFDHIDFNGQFY 1728
            +GS+K +F++ +LKL+  I  I     D KS+  K  ++K FK+N   + D  +      
Sbjct: 1591 VGSVKGKFSDRLLKLQDLIPLIAAVGEDDKSDPKK-ELSKQFKMNTVLLVDKSELQLVMD 1649

Query: 1729 NSSLKSRMSNVNILSYFENNIESSTPSGSFVYYADRTGIALKHLNNILIDCQVRNLFAST 1788
             + L SR     +   +EN  +S++ +GS V ++ ++ + LKH + IL + Q+R+     
Sbjct: 1650 QTKLMSRTVGGRVSLLWENLKDSTSQAGSLVIFSQKSEVWLKHTSVILGEAQLRDFSVLA 1709

Query: 1789 TAELHSAVNSLMINFRCSNLHFKSVPKTEIFVNAIKAIQRDVETLSAEISKAQGTTDNIN 1848
            T E  S   +++IN +C++LHF+++  TE  V AI  I+  +  +   I     +     
Sbjct: 1710 TTEAWSHKPTILINNQCADLHFRAMSSTEQLVTAITEIRESLMMIKERIKFKPKSKKKSQ 1769

Query: 1849 TEHTPSVHEKNKMQKAKPNSKNNITLSATFTNVSSEITLLHPIYLKHETNSVNISYNTIN 1908
                              + K N  LS  F+NVSSE+  L P Y++HE   ++I +N   
Sbjct: 1770 F----------------VDQKINTVLSCYFSNVSSEVMPLSPFYIRHEAKQLDIYFNKFG 1813

Query: 1909 IDELLVQVLDTDLYLNSSHTKEQYARLSYDKLELTTFLPDLNEKLIDLEISSSILKLTTS 1968
             +E+L+ + DTD ++ S  TKEQY R S+  +E+   +      LI+++IS S++KLT S
Sbjct: 1814 SNEILLSIWDTDFFMTSHQTKEQYLRFSFGDIEIKGGISREGYSLINVDISISMIKLTFS 1873

Query: 1969 DPRRMLFSFLQDEKELKNSLTFLRSLESLNRKANSEDSETLFSS--YEWIVNFKSKYMGV 2026
            +PRR++ SFLQDEK     +  L SL+ L   +N    E    S    W ++    Y GV
Sbjct: 1874 EPRRIVNSFLQDEKLASQGINLLYSLKPLFFSSNLPKKEKQAPSIMINWTLDTSITYFGV 1933

Query: 2027 LLPIQATYYVFELHDALSTVSNKEEPSSAVHKKFHGDLSFDHIIFLIKDQSIPHKFSKIL 2086
            L+P+ +TY+VFELH  L +++N          K  G  S ++I+FLIK++S+P   SK+L
Sbjct: 1934 LVPVASTYFVFELHMLLLSLTNTNNGMLPEETKVTGQFSIENILFLIKERSLPIGLSKLL 1993

Query: 2087 DFSIKLSTHRTVNNFDRSFEIESSFFRVCLTPFSLIQTMWGXXXXXXXXXXXXDQSTXXX 2146
            DFSIK+ST +   + ++SF++ESS FRVCL+P SL++ MWG             +     
Sbjct: 1994 DFSIKVSTLQRTVDTEQSFQVESSHFRVCLSPDSLLRLMWGAHKLLDLSHYYSRRHA--P 2051

Query: 2147 XXXXXXXIDGATNSEKENVFSVRSFHILSYNFSIGWLYQDSDNTIPGLILGYNRLFSTYE 2206
                     G ++  KE   + RS HILSY F IGW++Q    + PGL+LGYNRLFS YE
Sbjct: 2052 NIWNTKMFTGKSDKSKEMPINFRSIHILSYKFCIGWIFQYGAGSNPGLMLGYNRLFSAYE 2111

Query: 2207 DNHGKLTLVDGFFSLANGSSGDTFYSSGDESSKFNRSYLPNIQILYWIKEIEKMKHLFIK 2266
             + GK T+VD FFS+ANG++  TF+S G+E  K+NRS+LPN+QI YW K   ++K  F +
Sbjct: 2112 KDFGKFTVVDAFFSVANGNTSSTFFSEGNEKDKYNRSFLPNMQISYWFKRCGELKDWFFR 2171

Query: 2267 FHGETLDVNFFENFVNIIESTVRSIDLFQTLKREKINPLVKAKPERDEKSNSALTNIK-- 2324
            FHGE LDVNF  +F+++IEST++S+  FQ LK+   N L  ++  R E  NS  +     
Sbjct: 2172 FHGEALDVNFVPSFMDVIESTLQSMRAFQELKK---NILDVSESLRAENDNSYASTSVES 2228

Query: 2325 -----GPIFGKLKQVNCEFIYDGGLFRLFSNASMTNKLEPTLMIKSPKVKIMLSYDYFEK 2379
                  P    ++ VN  F YDGG+FR+++   +  K EP+  IKSP V I  +Y + E 
Sbjct: 2229 ASSSLAPFLDNIRSVNSNFKYDGGVFRVYTYEDIETKSEPSFEIKSPVVTINCTYKHDED 2288

Query: 2380 ELKKHWINCLIDIEPTQNVLKSGCVPFLSDFISQIKDIVELQDVNMEENMDNNVKDPINI 2439
            ++K H    LI ++PT N L +GC P L +F   ++ +++    + + N        ++ 
Sbjct: 2289 KVKPHKFRTLITVDPTHNTLYAGCAPLLMEFSESLQKMIKKHSTDEKPNFTKPSSQNVDY 2348

Query: 2440 TSLLENFDICFKLISGTQHVTLDCEPKAKINTDVGFGSFEFSILTPHLNPIDPLDISLKI 2499
              LL+ FD+  KL S  Q ++L CEPKAK+  DVGF SF FS+ T   +   PL+ SL +
Sbjct: 2349 KRLLDQFDVAVKLTSAKQQLSLSCEPKAKVQADVGFESFLFSMATNEFDSEQPLEFSLTL 2408

Query: 2500 NDIKTSVKHQFSNEASASFEVSKLDVILIFTHPEV---FGTGLVDDVKLHFNLKQFQNIS 2556
               K S+KH FS E S SFEV  +D+ L+FTHP+V   +GTGLV D+ + FN+KQ QN+ 
Sbjct: 2409 EHTKASIKHIFSREVSTSFEVGFMDLTLLFTHPDVISMYGTGLVSDLSVFFNVKQLQNLY 2468

Query: 2557 IFLDIWDVSKSTEKKLFKKDSNTLVDAKSSPIAQTIVNSSTLPWSFVFIATNINGDINMG 2616
            +FLDIW  S     +  ++  N  ++  S          + +PW F  I TN++GD+++G
Sbjct: 2469 LFLDIWRFSSILHTRPVQRTVNKEIEMSSLTSTNYADAGTEIPWCFTLIFTNVSGDVDLG 2528

Query: 2617 STLGNLALNLQRTWISTDHFHNKRQLLHLFTDNVKISSEGRLGGFVEIDDITWKLDVNYV 2676
             +LG ++L  QRTW++TDH++ KRQLLH FTD + ++SEGRL G  E+ + +W  +V + 
Sbjct: 2529 PSLGMISLRTQRTWLATDHYNEKRQLLHAFTDGISLTSEGRLSGLFEVANASWLSEVKWP 2588

Query: 2677 DKYKFVVSPLVDLLFDVGKVSMKVAFDYHMFLISTVKDLKFHVLSEKDIDDILPDLLTVN 2736
             +      PLV    ++  +++K AFDYHMFLI T+ ++ FH+ +EKD   +LPDLL V+
Sbjct: 2589 PEKSKNTHPLVSTSLNIDDIAVKAAFDYHMFLIGTISNIHFHLHNEKDAKGVLPDLLQVS 2648

Query: 2737 LTCDEIKVCTTALVASNILDIYNTIMRTRQDNKNSYIETLLESNNNVLKRKPLYEDILKS 2796
             + DEI + +TALV +NILDIYNTI+R RQDNK SY+ETL +SN    ++  LY+DIL+S
Sbjct: 2649 FSSDEIILSSTALVVANILDIYNTIVRMRQDNKISYMETLRDSNPGESRQPILYKDILRS 2708

Query: 2797 LNLLQTSLSANIHELNLQISPSSLYDAEVIIIRVQDVFSSTETRTGEKIKTDLEMRVYNA 2856
            L LL+T LS NI    +QISP SL+D EV++IR+  V   +ET +G+K+KTDL+++V + 
Sbjct: 2709 LKLLRTDLSVNISSSKVQISPISLFDVEVLVIRIDKVSIRSETHSGKKLKTDLQLQVLDV 2768

Query: 2857 TLSLTSFGKELTEEDIAEMSAETYISYASTLTSGRIFEIPQLTINMTTFQNADNMILQYT 2916
            + +L++  +EL EE  A ++ + Y+ YAS +  G I +IP+L ++MTT Q      L+Y 
Sbjct: 2769 SAALSTSKEELDEEVGASIAIDDYMHYASKIVGGTIIDIPKLAVHMTTLQEEKTNNLEYL 2828

Query: 2917 YSCSFDGKVDVTWNLGPINFIKEVWATHVRSLEVRTVQFMGNHDISL-ENEGDTDESVK- 2974
            ++CSF  K+ V WNLGP++FIKE+W THV++L VR  Q     +IS  + E + +ES+K 
Sbjct: 2829 FACSFSDKISVRWNLGPVDFIKEMWTTHVKALAVRRSQVA---NISFGQTEEELEESIKK 2885

Query: 2975 --VLSNIEYIALEEPYIEMPQIKDLKDATPPLEWFGLNRKYFPSATHQSVIVPIQKLVNV 3032
                S   YIALEEP IE+PQI+DL DATPP+EWFG+NRK FP  THQ+ ++P+QKLV +
Sbjct: 2886 EEAASKFNYIALEEPQIEVPQIRDLGDATPPMEWFGVNRKKFPKFTHQTAVIPVQKLVYL 2945

Query: 3033 AQKEYAKVL 3041
            A+K+Y K+L
Sbjct: 2946 AEKQYVKIL 2954

 Score =  127 bits (320), Expect = 3e-28,   Method: Compositional matrix adjust.
 Identities = 56/119 (47%), Positives = 83/119 (69%)

Query: 6   TEFANVSLSQERYFSWVFLVYWILVVVATSTFVFYVAKLWGFGLTFACEWLLWKTMNIKV 65
           ++   V L+ ++ FSWVFLV WIL VV   T +FY+ +++ + ++F  EWLLWK   IK+
Sbjct: 5   SQLRGVPLTHQKDFSWVFLVDWILTVVVCLTMIFYMGRIYAYLVSFILEWLLWKRAKIKI 64

Query: 66  TIESIRLSFLTGTIFFKNVCLIDQDKTISILECSVTWRYWLLNTRKSEYELNAKADTSK 124
            +E++R+S L G I FKN+ +I +D TIS+LE S+TW+YWLLN RK+E   N K+ + K
Sbjct: 65  NVETLRVSLLGGRIHFKNLSVIHKDYTISVLEGSLTWKYWLLNCRKAELIENNKSSSGK 123

>Suva_10.171 Chr10 complement(311672..320548) [8877 bp, 2958 aa] {ON}
            YLR087C (REAL)
          Length = 2958

 Score = 2201 bits (5703), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1168/2897 (40%), Positives = 1763/2897 (60%), Gaps = 106/2897 (3%)

Query: 183  KLDSLFAINCTGFEIFLYNRKRAYETIIQNFSKEEKIQFIDFLRQHDLDDIFEEVSSEIK 242
            +L   F + C G E F+YNR  AY+ +I   SK+E+ +F  +L +H   + F + SS  K
Sbjct: 126  ELPCKFLLECEGLEYFIYNRTLAYDNVINLLSKDERDKFEKYLNEHSFPEPFSDGSSADK 185

Query: 243  NCNEYCNHKEGNNSAHFGSSCKSDKESASNISISGDSQEXXXXXXXXXXXXKISAHIMRK 302
               +        NS    SS  +D+          D QE                     
Sbjct: 186  LDEDLSESAYTTNS---DSSIINDR----------DYQETNIGKYPKG------------ 220

Query: 303  LHLDILPLDININKGAITIGNKFTRSLLVINFTEAHGLLDYALPDSKLDVFKNKVTFEIN 362
              L   P+++ +N+G++ +GNKFT S++++++    G++D   P  +LD+++NK   E+ 
Sbjct: 221  --LSFFPIELKLNRGSLLLGNKFTPSVMILSYENGEGIIDVLPPKERLDLYRNKTHLELK 278

Query: 363  DIDMSIKRNIGYNPELASRFNFRAGVLTRIWSYLQLVLNLIPTGRLKTWYESLRYKEDTT 422
            + ++SIK+NIGY+  +  +F    G ++++W     VL ++    +    +     +D  
Sbjct: 279  NFEISIKQNIGYDDAIGLKFKLDTGKVSKLWKTFVRVLRVVTKPVIPRRGKKAGPSDDA- 337

Query: 423  FVKKWDGLVLYKDSVKSSTKLGADDVDFDFANHEYAKVSNFFKAPQIIFSIESDIPGIVP 482
            F +KW GL LYK S   +     DD++FDF +HEYAK ++  K P++  S + D+PG+VP
Sbjct: 338  FFQKWKGLSLYKASAGDAKTSDLDDIEFDFTSHEYAKFTSILKCPKVTLSYDVDVPGVVP 397

Query: 483  HGSHPPLSKAHGPDIGNHESPPTFLIDLQLSHASIYFGSWVNRNIVDLRDLMFPVISKDQ 542
            HG+HP +    GPD+GN+ +PP F +D+Q+   SI +G W  R +  L+ ++ PV+S+  
Sbjct: 398  HGAHPTIPDIDGPDVGNNGAPPDFALDVQIHGGSICYGPWAQRQVSHLQRVLSPVVSRTA 457

Query: 543  KPLNKLKPGLTRVHSMFNFSVSVLDDSSIRLPTREPSKDSDFLKQYLETKDDFRAFGWID 602
            KP+ KL PG  RV+++F  ++ +++D++ R+PTRE SKD++FL+ Y +T +++R FGW+D
Sbjct: 458  KPIKKLPPGSRRVYTLFRMNILIMEDTTWRIPTRESSKDAEFLQHYKKTSEEYRPFGWMD 517

Query: 603  LSFKKGSEFMLNIPMIPTSGGFENTLFSKFSELEVTTSVNHNLLFKSNSLNIAANIGYPL 662
            L F K +    NI + PT  GF+N     F E E+ +SVNH++L KS   ++  +IGYPL
Sbjct: 518  LRFCKDTYANFNISVCPTVEGFKNDFHVHFVETEIRSSVNHDILLKSKVFDLDGDIGYPL 577

Query: 663  GWNDPVNWIFNINSKQLDIFLLREHITLLSDMIIDFSTQEPTPYELFRSFTYNLNLKIGG 722
            GWN    WI N+ S+QL+ FLLREHITL++D + DFS  +PTPYELFR F Y +N ++ G
Sbjct: 578  GWNSNTIWIINMKSEQLEAFLLREHITLVADTLSDFSAGDPTPYELFRPFVYKMNWEMDG 637

Query: 723  YSFYFNVNDRNIINNPLDFNENCYLSFHGDLFTSEITIPIISLAQQYVTISYEIFTPMFR 782
            YS Y NVND NI+NNPLDFNENCYLS HGD  T +IT+P  S+   Y  +SYEI TPMFR
Sbjct: 638  YSIYLNVNDHNIVNNPLDFNENCYLSLHGDKLTIDITVPRESILGTYTDMSYEISTPMFR 697

Query: 783  LFLNTPSWNTLSEFMRNKEIGRSHDFRVSGTYLIYSELDIDNVDSLTIDFESNSTVLYCF 842
            + LNTP WNTL+EFM++KE+GRS+DF + G YL+YSELDIDNVDSLTI+  SNSTVL+C+
Sbjct: 698  MMLNTPPWNTLNEFMKHKEVGRSYDFTIKGCYLLYSELDIDNVDSLTINCTSNSTVLHCY 757

Query: 843  GFVIKYMMNFQANYFGSFIKFITTEEYSELI-RNNVNDNLGSINTNDLTS-IEGLQKMDS 900
            GFV++Y++N + NYFG F  F+T+EEY+ ++    V + +   +  DL S ++   +  S
Sbjct: 758  GFVMRYLINVKMNYFGEFFNFVTSEEYTGVLGAREVGEVVTKSSVVDLASTLDSEYQNGS 817

Query: 901  ITNDVEDINQKTIKRSDLLRTENETDIWLNFKVNDGALILPEELYNGDSCVSLSFGELFI 960
            + ND ED     +KRSDL RT NETDIW  F V +GALILPE +Y+ D C++L F EL +
Sbjct: 818  MKNDAED--NGPMKRSDLKRTTNETDIWFTFSVWNGALILPETIYSFDPCIALHFTELVV 875

Query: 961  NMRTCNYYMDVYITLYDNNLNRFEKIDPHELFEYIQTRNRSSSVE-GNISDITIHGHRMY 1019
            + R+CNYYMD+   L   ++ R      +E+F++I+  N +   E G +SD+TIHGHRMY
Sbjct: 876  DFRSCNYYMDIMAVLNGTSIKRHVSKQINEVFDFIRRNNGADEQEHGVLSDLTIHGHRMY 935

Query: 1020 GLPPKELTYFCQWSINIGTFLIDSDMIFLLSFIQSLNKIGFFLSNKENSLLYESDTVNDM 1079
            GLPP E TYFCQW IN+G   I+SD+ FL  F  S  K+GF  ++ EN LLY+++T+NDM
Sbjct: 936  GLPPTEPTYFCQWDINLGELNINSDIEFLKGFFTSFYKVGFGYNDLENILLYDTETINDM 995

Query: 1080 TLLSVDVESLKVILSDPLLEARAEIGASSIIIRNIDFENEKYTKRLDVNASEFYFSLDSL 1139
            T L+V  E + + L+DP++++++ +   S++   IDFENE+Y++R+D+   +   SL  +
Sbjct: 996  TSLTVHAERINISLNDPVMKSQSIVSVESLLFTLIDFENERYSQRIDIKVPKLTVSLSCV 1055

Query: 1140 KIDSGKKNILDVRTKLNITNFFKTDNHINHLDTQRKFIGLHDSPYHRCFFLLPEKFQESS 1199
              D    + L+  TKL  TNF +  +       QR++I ++DSPYHRC FLLP  +Q+S 
Sbjct: 1056 MGDGTNTSFLNFETKLRFTNFGQYKDSDKKRSEQRRYIMMNDSPYHRCPFLLPLFYQDSD 1115

Query: 1200 SYKELYGSITPSFSLPMLPIPHIYSTTNFIVEGILDDYSEFLLSDHHNQMSINAELNSVD 1259
            +Y++LYG+I PS S+P LP+P +  T ++I+E I+ +Y+  LL   +    + AE  S  
Sbjct: 1116 TYQKLYGAIAPSSSIPTLPLPTLPDTIDYIIEDIVGEYAT-LLEATNPFKDLFAETPST- 1173

Query: 1260 TTPLKDSF----DMQITN---FQNILTTED-PYETDNFVVNVKYLTVTVNPDI-VFT--- 1307
              PL+ SF    D +  +   F+ +  TE+  +E DN+V++V Y+ + ++P + VFT   
Sbjct: 1174 VEPLRASFTEDDDEEAADPLEFKPVAFTEEINHERDNYVIDVSYILLDIDPLLFVFTKSL 1233

Query: 1308 IEKFSTEFNKKFSMNNQIDGIEMAIVNRLSDLKENISSKINVNLNVEKIDAAWGHRDVCF 1367
            +E+F +E      M   +D IE+ IV RLS+L+E I S  N++++V  ++  W       
Sbjct: 1234 LEQFYSE-----DMVQVLDDIEIGIVKRLSNLQEGIVSISNIDIHVAYLNLIWQETGEEG 1288

Query: 1368 IGTYINMLKFELSQESTYNNNGGLQKDLTLLGKFRSVRIIIQNHSYNSFSDDRPPGLSLM 1427
               Y++ + +++S++S   N      ++ +L K ++VR  +        S+DRPP LSL 
Sbjct: 1289 FELYLDRINYQMSEKSLEKNRTSKSLEVAVLAKVKTVRATVNQKKNPELSEDRPPALSLG 1348

Query: 1428 LEGFEAWXXXXXXXXXXXXXXXFDITVDEYQIHWLIPYVKSQILLFTKIQDSVKLIYDEQ 1487
            LEGFE W                DIT+DE Q+ WL  Y   Q  L  ++  SV  I + +
Sbjct: 1349 LEGFEVWSSTEDRQVNSLNLTSSDITIDESQMEWLFEYCSDQGNLIQEVFTSVNSIQNTR 1408

Query: 1488 ASYQKTFITSLIWAGEKYQIDHDPYVITKPATVLRLSAWHIRENRSWRIVTKLRHILTYX 1547
            +S +   I+ L  A E YQI HDPYVITKPA ++RLS  H+RENRSW+I+T+LRHILTY 
Sbjct: 1409 SSTKTELISKLTAASEYYQISHDPYVITKPAFIMRLSKGHVRENRSWKIITRLRHILTYL 1468

Query: 1548 XXXXXXXXXXXXXIKRSGLEKEAASTFLNVFSNWRNWEVSDIEKSYIYRMIFVEEVSKRI 1607
                          ++    K+A + F++VFS WRNWE SD+ +SYIY  +F+ + +K  
Sbjct: 1469 PDDWQTNIDKVLKERKYSFAKDAKNIFMSVFSTWRNWEFSDVARSYIYGKLFLADHAKH- 1527

Query: 1608 LQNSIKVFLE----TFYFTIYSRNYSADQNFLITKANILINNEADQVNEVDLIRKQEEIV 1663
              NSIK  L+    +FY T+Y   Y  + NF++  AN++++      +   L   +EE +
Sbjct: 1528 KGNSIKKLLKCTMGSFYLTVYGEGYEVEHNFVVADANLVVDLTPPVTS---LSSNREETI 1584

Query: 1664 DVVTKIGSIKFEFTEAILKLKRDIEQIIKTSVDSKSEGDKLSITKFFKVNLSFIFDHIDF 1723
            ++  K+GS+K +F++ +LKL+  I  ++  + D KS+  K  ++K FK+N   + D  + 
Sbjct: 1585 EITGKVGSVKGKFSDKLLKLQDLIPLVVAVTEDDKSD-PKAELSKQFKMNTVLLVDKSEI 1643

Query: 1724 NGQFYNSSLKSRMSNVNILSYFENNIESSTPSGSFVYYADRTGIALKHLNNILIDCQVRN 1783
                  + + SR     +   +EN  +S++ +GS V ++ ++ + LKH + IL + Q+ +
Sbjct: 1644 QVVMDKTKVMSRTVGGRVSLLWENLKDSTSQAGSLVIFSQKSEVWLKHGSTILGEAQLCD 1703

Query: 1784 LFASTTAELHSAVNSLMINFRCSNLHFKSVPKTEIFVNAIKAIQRDVETLSAEISKAQGT 1843
                 T E  S   ++++N +C++LHF+++  TE  VNAI  I+  V  +  +I      
Sbjct: 1704 FSILATTEAWSHKPTILVNNQCADLHFRAMSTTEQMVNAITEIKESVLKVKEQI------ 1757

Query: 1844 TDNINTEHTPSVHEKNKMQKAKPNSKNNITLSATFTNVSSEITLLHPIYLKHETNSVNIS 1903
                  +  P    KNK Q     S+ N  LS  F+NVSSEI  L P Y++HE   ++I 
Sbjct: 1758 ------KFKPK--SKNKSQFV--GSRINTVLSCYFSNVSSEIMPLSPFYIRHEAKQLDIY 1807

Query: 1904 YNTINIDELLVQVLDTDLYLNSSHTKEQYARLSYDKLELTTFLPDLNEKLIDLEISSSIL 1963
            +N    +E+L+ + DTD ++ S  TKEQY R S+  +E+          LI+++IS S++
Sbjct: 1808 FNKFGSNEILLSIWDTDFFMTSHQTKEQYLRFSFGDIEIKGGFSKEAYSLINVDISISMI 1867

Query: 1964 KLTTSDPRRMLFSFLQDEKELKNSLTFLRSLESLNRKANSEDS--ETLFSSYEWIVNFKS 2021
            KLT S+PRR++ SFLQDEK     +  L SL SL    +  ++  ET      W ++   
Sbjct: 1868 KLTFSEPRRIVNSFLQDEKLASQGINLLSSLNSLFLTTDPMNAKKETPAKMINWTLDTNI 1927

Query: 2022 KYMGVLLPIQATYYVFELHDALSTVSNKEEPSSAVHKKFHGDLSFDHIIFLIKDQSIPHK 2081
             Y G+L+P+ +TY+VFELH  L +++N          +  G LS ++I+FLIK++S+P  
Sbjct: 1928 SYFGILVPVASTYFVFELHMLLLSLTNTNNGLLPEQTRLTGQLSIENILFLIKERSLPIG 1987

Query: 2082 FSKILDFSIKLSTHRTVNNFDRSFEIESSFFRVCLTPFSLIQTMWGXXXXXXXXXXXXDQ 2141
             SK+LDFSIK+ST +   + ++SF++ESS FRVCL+P SL++ +WG             +
Sbjct: 1988 LSKLLDFSIKVSTLQRTADTEQSFQVESSHFRVCLSPDSLLRLIWGAYKLLDMVQYYSKR 2047

Query: 2142 STXXXXXXXXXXIDGATNSEKENVFSVRSFHILSYNFSIGWLYQDSDNTIPGLILGYNRL 2201
                          G ++  KE   + RS HILSY F IGWL+Q      PGL+ GYNRL
Sbjct: 2048 HA--PNIWNIRMFTGKSDKPKEIPINFRSIHILSYKFCIGWLFQYGAGDDPGLMFGYNRL 2105

Query: 2202 FSTYEDNHGKLTLVDGFFSLANGSSGDTFYSSGDESSKFNRSYLPNIQILYWIKEIEKMK 2261
            FS YE + GK T+VD FFS++NG++  TF+S G+E  K+NRS+LPN+QI YW K   ++K
Sbjct: 2106 FSAYEKDFGKFTIVDAFFSVSNGNTSSTFFSEGNEKEKYNRSFLPNMQISYWFKRCGELK 2165

Query: 2262 HLFIKFHGETLDVNFFENFVNIIESTVRSIDLFQTLKREKI---------NPLVKAKPER 2312
              F +FHGE LDVNF  +F+++I+ST++SI  FQ LK+  +         N    A P  
Sbjct: 2166 DWFFRFHGEALDVNFLPSFMDVIDSTLQSIRAFQELKKNILDMPHESNMENSSPDAAPNT 2225

Query: 2313 DEKSNSALTNIKGPIFGKLKQVNCEFIYDGGLFRLFSNASMTNKLEPTLMIKSPKVKIML 2372
            +  SNS       P    ++ VNC F YDGG+FR+++   +  K EP+  +KSP V I  
Sbjct: 2226 ENASNSL-----APFLDNIRSVNCNFKYDGGVFRVYTYDDIEAKSEPSFELKSPVVTINC 2280

Query: 2373 SYDYFEKELKKHWINCLIDIEPTQNVLKSGCVPFLSDFISQIKDIVELQDVNMEE-NMDN 2431
            +Y + E + K H I  LI ++PT N L +GC P L +F   ++++++      ++ N   
Sbjct: 2281 TYKHDESKAKPHRIRTLITVDPTHNTLYAGCAPLLMEFSESLQNMIKKHSTGEKKPNFTK 2340

Query: 2432 NVKDPINITSLLENFDICFKLISGTQHVTLDCEPKAKINTDVGFGSFEFSILTPHLNPID 2491
                 ++   LL+ FD+  KL S  Q ++L CEPKAK+  DVGF SF FS+ T   +   
Sbjct: 2341 PSTQNVDYKRLLDQFDVAVKLTSAKQQLSLSCEPKAKVQADVGFESFLFSMTTNEFDSEQ 2400

Query: 2492 PLDISLKINDIKTSVKHQFSNEASASFEVSKLDVILIFTHPEV---FGTGLVDDVKLHFN 2548
            PL  SL +   K S+KH FS E S SFEV  +D+ L+FTHP+V   +GT LV DV + FN
Sbjct: 2401 PLGFSLTLEQTKASIKHIFSREVSTSFEVGFMDLTLLFTHPDVISMYGTSLVSDVSVFFN 2460

Query: 2549 LKQFQNISIFLDIWDVSKSTEKKLFKKDSNTLVDAKSSPIAQTIVNSSTLPWSFVFIATN 2608
            +KQ QN+ +FLDIW  S     +  ++ +N  V+  +      +   + +PW F  I TN
Sbjct: 2461 VKQLQNLYLFLDIWRFSSILHTRPTQRPNNKEVNMSTLSSNSNVDVGTEIPWCFTLIFTN 2520

Query: 2609 INGDINMGSTLGNLALNLQRTWISTDHFHNKRQLLHLFTDNVKISSEGRLGGFVEIDDIT 2668
            ++GD+++G +LG ++L  QRTW++TDH+  KRQLLH FTD + ++SEGRL G  E+ + +
Sbjct: 2521 LSGDVDLGPSLGVISLRSQRTWLATDHYDEKRQLLHAFTDGISLTSEGRLSGLFEVANAS 2580

Query: 2669 WKLDVNYVDKYKFVVSPLVDLLFDVGKVSMKVAFDYHMFLISTVKDLKFHVLSEKDIDDI 2728
            W  +V +  +      PLV    ++  V++K AFDYHMFLI T+ +++FH+ +EKD   I
Sbjct: 2581 WVSEVKWPLENSKNTHPLVSTSLNIDDVAVKAAFDYHMFLIGTINNIRFHLHNEKDSKGI 2640

Query: 2729 LPDLLTVNLTCDEIKVCTTALVASNILDIYNTIMRTRQDNKNSYIETLLESNNNVLKRKP 2788
            LPDLL V+ + DEI + +TALVA+NILDIYNTI+R RQDNK SY+ETL +SN +  K+  
Sbjct: 2641 LPDLLQVSFSSDEITLSSTALVAANILDIYNTIVRMRQDNKISYMETLRDSNPSESKQPI 2700

Query: 2789 LYEDILKSLNLLQTSLSANIHELNLQISPSSLYDAEVIIIRVQDVFSSTETRTGEKIKTD 2848
            LY+DIL+SL LL+T LS NI  L +QISP SL+D EV+++R+  V   +ET +G+K+KTD
Sbjct: 2701 LYKDILRSLKLLRTDLSVNISSLKVQISPISLFDVEVLVVRIDKVSIRSETHSGKKLKTD 2760

Query: 2849 LEMRVYNATLSLTSFGKELTEEDIAEMSAETYISYASTLTSGRIFEIPQLTINMTTFQNA 2908
            L+++V + + +L++  +EL EE  A ++ + Y+ YAS +  G I +IP+L ++MTT Q  
Sbjct: 2761 LQLQVLDVSAALSTSKEELDEEIGASIAIDDYMHYASKIVGGTIIDIPKLAVHMTTLQEE 2820

Query: 2909 DNMILQYTYSCSFDGKVDVTWNLGPINFIKEVWATHVRSLEVRTVQFMGNHDISL-ENEG 2967
                L+Y ++CSF  K+ V WNLGPINFIKE+W THV++L VR  Q     +IS  + E 
Sbjct: 2821 KTNNLEYLFACSFSDKISVRWNLGPINFIKEMWTTHVKALAVRRSQ---TANISFGQTEE 2877

Query: 2968 DTDESVKV---LSNIEYIALEEPYIEMPQIKDLKDATPPLEWFGLNRKYFPSATHQSVIV 3024
            + +ES+K     S   YIALEEP IE+PQI+DL +ATPP+EWFG+NRK  P  THQ+ ++
Sbjct: 2878 ELEESIKREENASKFNYIALEEPQIEVPQIRDLGEATPPMEWFGVNRKRLPKFTHQTAVI 2937

Query: 3025 PIQKLVNVAQKEYAKVL 3041
            P+QKLV +A+K+Y K+L
Sbjct: 2938 PVQKLVYLAEKQYVKIL 2954

 Score =  127 bits (320), Expect = 3e-28,   Method: Compositional matrix adjust.
 Identities = 56/119 (47%), Positives = 84/119 (70%)

Query: 6   TEFANVSLSQERYFSWVFLVYWILVVVATSTFVFYVAKLWGFGLTFACEWLLWKTMNIKV 65
           ++   V L+ ++ FSWVFLV WIL V+A  T +FY+ +++ + ++F  EWLLWK   IK+
Sbjct: 5   SQLRGVPLTHQKDFSWVFLVDWILTVIACLTTIFYMGRIYAYLVSFILEWLLWKRAKIKI 64

Query: 66  TIESIRLSFLTGTIFFKNVCLIDQDKTISILECSVTWRYWLLNTRKSEYELNAKADTSK 124
            +E++R+S L G I+FK++ +I +D TISILE S+TW+YWLLN RK+E   N K  + K
Sbjct: 65  NVETLRISLLGGRIYFKHLSVIHKDYTISILEGSLTWKYWLLNCRKAELIENEKNSSGK 123

>KNAG0G02030 Chr7 complement(453579..462575) [8997 bp, 2998 aa] {ON}
            Anc_8.260 YLR087C
          Length = 2998

 Score = 2199 bits (5699), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1208/3105 (38%), Positives = 1830/3105 (58%), Gaps = 167/3105 (5%)

Query: 1    MSTLGTEFANVSLSQERYFSWVFLVYWILVVVATSTFVFYVAKLWGFGLTFACEWLLWKT 60
            M+   ++F ++SL + + FSWVFLV WIL ++ + T +FYV +   + ++F  EWLLWK 
Sbjct: 1    MADTVSQFNSISLDKGKDFSWVFLVDWILTLILSITVLFYVGRAIAWFISFIAEWLLWKR 60

Query: 61   MNIKVTIESIRLSFLTGTIFFKNVCLIDQDKTISILECSVTWRYWLLNTRKSEY--ELNA 118
              +KV IES+R+S L G IFFKN+ +ID+D TIS L   ++WRYWL   R  ++  ELNA
Sbjct: 61   YRLKVNIESLRVSLLGGRIFFKNLTIIDKDYTISFLIGQISWRYWLFRPRIPQFLTELNA 120

Query: 119  KADTSKPNGDDMLDNNTIHDRSXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX 178
            + D    +G  +  N                                             
Sbjct: 121  EDD----DGASLQRN--------------------------------------------- 131

Query: 179  XXXKKLDSLFAINCTGFEIFLYNRKRAYETIIQNFSKEEKIQFIDFLRQHDLDDIFEEVS 238
               +KL     + C G E+FLYNR  AY+  I+ FSKEE+ +F +FL +H   D     S
Sbjct: 132  ---EKLACRLLLECEGVELFLYNRTVAYDNTIKMFSKEERAKFEEFLNEHVFTDRASTES 188

Query: 239  SEIKNCNEYCNHKEGNNSAHFGSSCKSDKESA-SNISISGDSQEXXXXXXXXXXXXKISA 297
            S   +  E     E    ++  SS     ES  +N  I  D +                 
Sbjct: 189  SNGSSSEESKAQDEVEIKSYTESSFDESNESQMANDRIFHDEETG--------------- 233

Query: 298  HIMRKLHLDILPLDININKGAITIGNKFTRSLLVINFTEAHGLLDYALPDSKLDVFKNKV 357
               + L L+ LPL I ++  +  +GNKFT SLL+++   A G++DY  P  KLD++K K+
Sbjct: 234  ---KNLFLNYLPLQIKVSHASYVVGNKFTPSLLIVSADSAEGVMDYCQPKEKLDIYKTKL 290

Query: 358  TFEINDIDMSIKRNIGYNPELASRFNFRAGVLTRIWSYLQLVLNLI--PTGRLKTWYESL 415
            T +  ++ +S+K+NIGYN E+  +F    G L+++W         +  P G  +   +  
Sbjct: 291  TMDAKNVSVSLKQNIGYNEEVLLKFKLTTGKLSKLWDNFVKATAFVRKPLGLSRK--KKN 348

Query: 416  RYKEDTTFVKKWDGLVLYKDSVKSSTKLGADDVDFDFANHEYAKVSNFFKAPQIIFSIES 475
            R      F +KW GL LYK+ +    +   DD++FD A HEYAK ++  K P+ I + E 
Sbjct: 349  RPSVTANFHQKWRGLSLYKNYMFEDVQNDLDDIEFDLAGHEYAKFTSIIKCPRAILTYEF 408

Query: 476  DIPGIVPHGSHPPLSKAHGPDIGNHESPPTFLIDLQLSHASIYFGSWVNRNIVDLRDLMF 535
            DIPG VPHG+HP LS   GPDIGN+ +PPTF +++QL   S+ +G W  R +  ++ L+ 
Sbjct: 409  DIPGFVPHGAHPTLSSIDGPDIGNNGAPPTFGLEIQLFGGSLCYGPWAQRQVAFIQSLLA 468

Query: 536  PVISKDQKPLNKLKPGLTRVHSMFNFSVSVLDDSSIRLPTREPSKDSDFLKQYLETKDDF 595
            P IS+DQKP+  L+PG  R++++F   + V +D + R+PTRE SKD++FL+ Y  T +D+
Sbjct: 469  PQISRDQKPVKPLQPGERRMYTLFKLGIVVNEDITWRIPTRESSKDAEFLRHYKNTNEDY 528

Query: 596  RAFGWIDLSFKKGSEFMLNIPMIPTSGGFENTLFSKFSELEVTTSVNHNLLFKSNSLNIA 655
            R FGW+DL F K S    N  +  T+ G +NT+     + E+ +SVNH++  KS SL+  
Sbjct: 529  RPFGWLDLKFSKDSYASFNFALCSTADGSQNTMKIHLGDSEIRSSVNHDIFIKSKSLDFD 588

Query: 656  ANIGYPLGWNDPVNWIFNINSKQLDIFLLREHITLLSDMIIDFSTQEPTPYELFRSFTYN 715
             N+G+PLGWN+   W  N+ S QL+ FLLREHITL++D + DFST EPTPYELFR F Y 
Sbjct: 589  LNLGFPLGWNEKAKWTINVASSQLETFLLREHITLIADTMSDFSTGEPTPYELFRPFLYT 648

Query: 716  LNLKIGGYSFYFNVNDRNIINNPLDFNENCYLSFHGDLFTSEITIPIISLAQQYVTISYE 775
            +N K+ GYS Y NVND NI+NNPLDFNENCYLSFHGD+   +IT+P   +  +   ISY 
Sbjct: 649  INWKLDGYSIYLNVNDHNIVNNPLDFNENCYLSFHGDILNVDITVPKDRIDARATDISYN 708

Query: 776  IFTPMFRLFLNTPSWNTLSEFMRNKEIGRSHDFRVSGTYLIYSELDIDNVDSLTIDFESN 835
            I+TPMFRL LN P WNTL+EFM++KE+GR++DFR +G YLIY+ELD+DNVD +TI   S 
Sbjct: 709  IYTPMFRLMLNAPPWNTLNEFMKHKEVGRAYDFRTTGNYLIYNELDVDNVDMITIICSSK 768

Query: 836  STVLYCFGFVIKYMMNFQANYFGSFIKFITTEEYSELI--RNNVNDNLGSINTNDLTSIE 893
            STVL+C+GFVI+Y+MN + NYFG F  F+T+EEY+E I  +     +L    ++D ++  
Sbjct: 769  STVLHCYGFVIRYLMNIKMNYFGDFFHFVTSEEYTEKISSKGYGEGSLFEKYSDDASTFV 828

Query: 894  GLQKMDSITNDVEDINQKTIKR-SDLLRTENETDIWLNFKVNDGALILPEELYNGDSCVS 952
                 D   N+ ED   K  +  +D+ R  NETD+WL F + +GAL+LPE +YN D C++
Sbjct: 829  S----DFDKNNEEDDKVKVPRGPADVRRKTNETDLWLTFNIWEGALLLPETIYNCDPCIA 884

Query: 953  LSFGELFINMRTCNYYMDVYITLYDNNLNRFEKIDPHELFEYI-QTRNRSSSVEGNISDI 1011
            L FGEL I++R+ NYYMD+  +L D  L ++  + P+E+FE + Q   R       IS+I
Sbjct: 885  LHFGELAIDVRSTNYYMDLLASLDDIILRQYSNVQPNEIFENVRQCNGRDVKGHSYISNI 944

Query: 1012 TIHGHRMYGLPPKELTYFCQWSINIGTFLIDSDMIFLLSFIQSLNKIGFFLSNKENSLLY 1071
             IHGHRMYGLPP E TYFC+W  ++GT  ++S++ F+   + S  KIGF   + EN LLY
Sbjct: 945  NIHGHRMYGLPPTEPTYFCKWDFDLGTIKLESEVDFMKGLVTSFQKIGFGFDDLENVLLY 1004

Query: 1072 ESDTVNDMTLLSVDVESLKVILSDPLLEARAEIGASSIIIRNIDFENEKYTKRLDVNASE 1131
            E + V+DMT ++V+V+  K+I+ +P L +RAE+  +++   NIDFENEKY+ R+D+    
Sbjct: 1005 EKEVVDDMTAVTVNVKDFKIIIHNPELHSRAELILNNMQFCNIDFENEKYSTRMDIRIPL 1064

Query: 1132 FYFSLDSLKIDSGKK-NILDVRTKLNITNFFKTDNHINHLDTQRKFIGLHDSPYHRCFFL 1190
               SL     ++ K+ +  +  TK+N TNF    N + H   QR +I ++D+P+HRC F+
Sbjct: 1065 LKLSLYGYNYEASKELSFFNFETKINFTNFCNYKNCVQHRALQRDYITMNDAPFHRCGFI 1124

Query: 1191 LPEKFQESSSYKELYGSITPSFSLPMLPIPHIYSTTNFIVEGILDDY---SEFLLSDHHN 1247
            LP  +Q S  Y++LYGSI PS SLP LP+P +  T  FI++  L +Y   S+ ++ +   
Sbjct: 1125 LPASYQNSVIYQKLYGSIVPSSSLPPLPLPLLEETFEFIIQDFLHEYNTTSDCIILNLPY 1184

Query: 1248 QMSINAELNSVDTTPLKDSFDMQITNFQNILTTEDPYETDNFVVNVKYLTVTVNPDIVFT 1307
              S N   +S ++ P      +  T  +     ED  E DN+V++ +Y++++++P++ F 
Sbjct: 1185 PDSTNLNSDSFNSYPDTAPHTLSDTIIRKSPLPED--ERDNYVIDFRYISISIDPELFFY 1242

Query: 1308 IEKFSTEFNKKFSMNNQIDGIEMAIVNRLSDLKENISSKINVNLNVEKIDAAWGHRDVCF 1367
            IEK    F         ID IE+ +V RLS+ +E ISS  N  + +   D  WG RD   
Sbjct: 1243 IEKLLNHFYGD-DDTQVIDSIEIGLVKRLSNFQEGISSINNFKIRILFFDVFWGQRDTGG 1301

Query: 1368 IGTYINMLKFELSQESTYNNNGGLQKDLTLLGKFRSVRIIIQNHSYNSFSDDRPPGLSLM 1427
            I  Y++ L FE++++S   N      ++T L K  S+R  +        ++ +PP LSLM
Sbjct: 1302 IELYLDTLDFEMNEKSIEKNREKSLTEVTTLMKLNSIRASVNAKYSRGKTEGQPPALSLM 1361

Query: 1428 LEGFEAWXXXXXXXXXXXXXXXFDITVDEYQIHWLIPYVKSQILLFTKIQDSVKLIYDEQ 1487
            +EG + W                D T+DE Q+ WL  +   Q  L   +  + + +   +
Sbjct: 1362 VEGVKFWSTTAKKVINSIILTSIDATIDETQVVWLFNFFGDQKELIGSVVKTFEKVQKLR 1421

Query: 1488 ASYQKTFITSLIWAGEKYQIDHDPYVITKPATVLRLSAWHIRENRSWRIVTKLRHILTYX 1547
               +K  I+ L  A E YQI HDPYVITKPA + RLS  H+RENRSW+I+T+LRHI+TY 
Sbjct: 1422 TQSRKELISRLTVASEYYQISHDPYVITKPAFITRLSRGHVRENRSWKIITRLRHIMTYL 1481

Query: 1548 XXXXXXXXXXXXXIKRSGLEKEAASTFLNVFSNWRNWEVSDIEKSYIYRMIFV---EEVS 1604
                          ++    K+A S F++VFS+WRNWE SD+ +SYIY  +F+    E  
Sbjct: 1482 PDDWNETVAKQLKERKYNASKDAKSIFMSVFSSWRNWEFSDVARSYIYNKVFLANQAEKQ 1541

Query: 1605 KRILQNSIKVFLETFYFTIYSRNYSADQNFLITKANILINNEADQVNEVDLIRKQEEIVD 1664
            ++ +    K    + Y T+Y+     D +F++TK+N++     D          QE++++
Sbjct: 1542 QKTVNKGWKAAFVSVYITVYTAGLGVDHSFIVTKSNLVFEETPDTTESG---YNQEKVIN 1598

Query: 1665 VVTKIGSIKFEFTEAILKLKRDIEQIIKTSVDSKSEGDKLSITKFFKVNLSFIFDHIDFN 1724
            V   +GSIK + ++ + KL  ++  +++   D   +    S ++ FK+N++ +FD  D  
Sbjct: 1599 VTGNLGSIKGKISDKMFKL-HNLMNLVQQQEDPALKSIS-SFSRSFKLNIALLFDSSDLL 1656

Query: 1725 GQFYNSSLKSRMSNVNILSYFENNIESSTPSGSFVYYADRTGIALKHLNNILIDCQVRNL 1784
              F  +SL + + +      +EN    +  + S V YA R   ++KH N++L + Q+  +
Sbjct: 1657 FVFGETSLTNTIHSGKASFLWENPKGPTKETASLVLYAKRCETSMKHRNSMLFENQITGI 1716

Query: 1785 FASTTAELHSAVNSLMINFRCSNLHFKSVPKTEIFVNAIKAIQRDVETLSAEISKAQGTT 1844
              S  A+   +  S++ NF+C +++ + +P+TE+ V  ++            I+K     
Sbjct: 1717 ALSAAADSIISHPSIVANFQCDDINLRVMPQTEVIVTFLQEF----------IAKFNLVK 1766

Query: 1845 DNINTEHTPSVHEKNKMQKAKPNSKN-----NITLSATFTNVSSEITLLHPIYLKHETNS 1899
            ++  T+  P     N   K  P   N     ++  +  F+NVS +I  + P   + ET  
Sbjct: 1767 ESFETDDLPKPTPTNDSPKPTPTKINPFLLVDLDFTCFFSNVSLDIMPIVPFQFRQETKK 1826

Query: 1900 VNISYNTINIDELLVQVLDTDLYLNSSHTKEQYARLSYDKLELTTFLPDLNEKLIDLEIS 1959
            +   +++         + D+DLYL S  TK+QY RLS   + +      L   + +L++S
Sbjct: 1827 MEFKFSSQRTQNFQFNIWDSDLYLGSHLTKQQYFRLSLGNIIVGYTNGRLVNTIHNLDVS 1886

Query: 1960 SSILKLTTSDPRRMLFSFLQDEKELKNSLTFLRSLESLNRKANSEDSETLFSSYEWIVNF 2019
            +SI+KLT S+P RMLFSFLQDE+E+  S+  L+ L +L       ++    +  +W +N 
Sbjct: 1887 ASIVKLTFSEPHRMLFSFLQDEREVSRSVKKLQVLGNLFSSEPEINTIPAGAKIDWRLNA 1946

Query: 2020 KSKYMGVLLPIQATYYVFELHDALSTVSNKEEPSSAVHK---KFHGDLSFDHIIFLIKDQ 2076
              KY+G+L+P+  T++VFE+H  L+++++ +     +++   +  G +S D+I+FLIKD+
Sbjct: 1947 DIKYLGILIPVSTTFFVFEMHTLLASLADVD--YGEIYREADEASGQVSVDNILFLIKDR 2004

Query: 2077 SIPHKFSKILDFSIKLSTHRTVNNFDRSFEIESSFFRVCLTPFSLIQTMWGXXXXXXXXX 2136
            +IP   S+I+D S K+S  + +     S++IES   R C +P+SL++ +WG         
Sbjct: 2005 TIPSTLSRIIDLSFKISAIQKIMESHHSYQIESPHLRFCFSPYSLVRILWGGHQLLALHS 2064

Query: 2137 XXXDQSTXXXXXXXXXXIDGATNSEKENVFSVRSF---HILSYNFSIGWLYQDSDNTIPG 2193
                  +                 +  + FS  +F   HILSYNF +GWL+Q++ +T  G
Sbjct: 2065 HYRRHHSKNLWDFLPKKEKKVEEDKTTSFFSTLTFGSCHILSYNFCVGWLFQNNGDTDAG 2124

Query: 2194 LILGYNRLFSTYEDNHGKLTLVDGFFSLANGSSGDTFYSSGDESSKFNRSYLPNIQILYW 2253
            LILGYNRLFS YE   GKLTLVD FFS++NG + DTFYS G+E  K+NRS+LPN+QI+YW
Sbjct: 2125 LILGYNRLFSAYEKGCGKLTLVDAFFSVSNGRTSDTFYSDGNEEDKYNRSFLPNLQIIYW 2184

Query: 2254 IKEIEKMKHLFIKFHGETLDVNFFENFVNIIESTVRSIDLFQTLKREKINPLVKAK---- 2309
            +K   +MK +FI+ HGETLDVNF  +FV IIE+T++SI +FQ LK+  +NPL +++    
Sbjct: 2185 LKAAAEMKDVFIRLHGETLDVNFLSSFVKIIEATLQSIQVFQELKKVLVNPLTQSEARSE 2244

Query: 2310 ---------------PERDEKSNSALTNIKGPIFGKLKQVNCEFIYDGGLFRLFSNASMT 2354
                           P +++K ++   +I  P    +++VNC+F YDGG+F+++S   + 
Sbjct: 2245 EEEEESEEHNRRETVPGKEKKEDAPRKDI-APFLSDIRKVNCQFKYDGGIFKVYSFEDIE 2303

Query: 2355 NKLEPTLMIKSPKVKIMLSYDYFEKELKKHWINCLIDIEPTQNVLKSGCVPFLSDFISQI 2414
            + L+P+  I+SP V I L Y     ++K H I  LI +  T NVL + C P L      I
Sbjct: 2304 SNLDPSFEIRSPGVTIDLDYKNNIGDVKPHLIRTLITVNSTHNVLFARCAPLLMALSQDI 2363

Query: 2415 KDIVELQDVNMEENMDNNVKDP---INITSLLENFDICFKLISGTQHVTLDCEPKAKINT 2471
            + +V+      +      V  P   I+   LL +FDI FK+IS  Q ++L CEPKAK+  
Sbjct: 2364 QHMVKKHSSKKKPEPKQRVSRPSQNIDYKRLLNSFDILFKIISSEQKLSLSCEPKAKVQA 2423

Query: 2472 DVGFGSFEFSILTPHLNPIDPLDISLKINDIKTSVKHQFSNEASASFEVSKLDVILIFTH 2531
            +VGF SF F+ILT  L+  +PL  +L + + +++++H FS E SASF +  +DV  +FTH
Sbjct: 2424 NVGFDSFMFAILTNDLDTSEPLSFALVVKNTRSAIRHIFSREPSASFGLDLIDVTFMFTH 2483

Query: 2532 PEV---FGTGLVDDVKLHFNLKQFQNISIFLDIWDVSKSTEKKLFKK--DSNTLVDAKSS 2586
            P +   FG  L+ DV+++FN+KQ QN+ +FLDIW +S     K  KK  D +  +DA   
Sbjct: 2484 PNIINMFGACLISDVEVYFNVKQLQNLYLFLDIWKLSNLLRPKPMKKPEDHHVAIDA--- 2540

Query: 2587 PIAQTIVNSSTLPWSFVFIATNINGDINMGSTLGNLALNLQRTWISTDHFHNKRQLLHLF 2646
            P +  +   + +PW F  I  NING +++G +LG L+L++++ W ++DH+ +KRQLLH +
Sbjct: 2541 PPSSPMDVGNIIPWCFTLIFANINGKVDLGPSLGLLSLSMRKAWFASDHYESKRQLLHAY 2600

Query: 2647 TDNVKISSEGRLGGFVEIDDITWKLDVN---YVDKYKFVVSPLVDLLFDVGKVSMKVAFD 2703
             D +K++++GRL G VE+D   W  +VN   Y D Y     PLV L F +  +S+KVAFD
Sbjct: 2601 IDQIKLTAKGRLSGIVELDGALWAAEVNWPKYDDPY-----PLVALSFVISNISLKVAFD 2655

Query: 2704 YHMFLISTVKDLKFHVLSEKDIDDILPDLLTVNLTCDEIKVCTTALVASNILDIYNTIMR 2763
            YHMFLI TV +  FH+ SE+D    +PDLL V LTC++I +C+TALVA+N+LD+YNTIMR
Sbjct: 2656 YHMFLIGTVLNTVFHLHSERDTSGFMPDLLKVMLTCEQIDMCSTALVAANLLDLYNTIMR 2715

Query: 2764 TRQDNKNSYIETLLESNNNVLKRKPLYEDILKSLNLLQTSLSANIHELNLQISPSSLYDA 2823
             RQD   SY+ETL ESN    K    Y+DILK LNL+QT +  +I+ LN+QISP SL+D 
Sbjct: 2716 MRQDTNVSYLETLRESNTTDTKETVDYKDILKVLNLIQTDVVVDINTLNVQISPISLFDV 2775

Query: 2824 EVIIIRVQDVFSSTETRTGEKIKTDLEMRVYNATLSLTSFGKELTEEDIAEMSAETYISY 2883
            EV+++ + +V ++ +T  GEK++T L +++YNA  SL+S   E+ E+ ++++S E Y+ Y
Sbjct: 2776 EVLVVNIANVCANVKTHAGEKLETYLHLQLYNAHGSLSSSKGEMDEDMVSKISVEDYMVY 2835

Query: 2884 ASTLTSGRIFEIPQLTINMTTFQNADNMILQYTYSCSFDGKVDVTWNLGPINFIKEVWAT 2943
            AS +  G IF+IP+L I+M TFQ +++ IL+Y Y  +F  K+ V WNLGP+NFIKE+W T
Sbjct: 2836 ASKIVGGTIFDIPKLEISMHTFQKSNSDILEYGYRSTFGDKIAVRWNLGPVNFIKEMWTT 2895

Query: 2944 HVRSLEVRTVQFMGNHDISLENEGDTDESVK---VLSNIEYIALEEPYIEMPQIKDLKDA 3000
            H+++L VR  Q +     + + EGD ++ ++    LS + YIA+EEP I+ PQIKDL DA
Sbjct: 2896 HIKALAVRRSQSLVG--TTGDEEGDVEKRMRDEETLSKLTYIAIEEPQIDTPQIKDLGDA 2953

Query: 3001 TPPLEWFGLNRKYFPSATHQSVIVPIQKLVNVAQKEYAKVLGSSK 3045
            TP LEWFGLNRK FP  THQ+VIVP+QKL++ A+KEYA ++G S+
Sbjct: 2954 TPSLEWFGLNRKKFPIFTHQTVIVPVQKLIHSAEKEYANIVGHSQ 2998

>NCAS0B05010 Chr2 complement(922165..931023) [8859 bp, 2952 aa] {ON}
            Anc_8.260 YLR087C
          Length = 2952

 Score = 2185 bits (5661), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1173/2896 (40%), Positives = 1748/2896 (60%), Gaps = 109/2896 (3%)

Query: 183  KLDSLFAINCTGFEIFLYNRKRAYETIIQNFSKEEKIQFIDFLRQHDLDDIFEEVSSEIK 242
            +L   F +N  G EIFLYN+  AY+ IIQ FSKEE+ QF  FL +  L D     S+ +K
Sbjct: 132  QLPCRFVVNLEGLEIFLYNKTVAYDNIIQMFSKEERFQFEKFLNEQILSD-----SATVK 186

Query: 243  NCNEYCNHKEGNNSAHFGSSCKSDKESASNISISGDSQEXXXXXXXXXXXXKISAHIMRK 302
            + ++        +++   S+ KS+  SA+N  +  + +                      
Sbjct: 187  SMDD-----SQFDTSESTSTDKSES-SATNDRVFQEEETDTSS----------------- 223

Query: 303  LHLDILPLDININKGAITIGNKFTRSLLVINFTEAHGLLDYALPDSKLDVFKNKVTFEIN 362
              L  LP+   + +G++ +GNKFT SLL+++   A  L+D+A P  KLD++K K++ E+ 
Sbjct: 224  -FLRFLPIQFLVTRGSLILGNKFTPSLLIVSADSADALMDFAQPKEKLDLYKFKLSAELI 282

Query: 363  DIDMSIKRNIGYNPELASRFNFRAGVLTRIWSYLQLVLNLIPTGRLKTWYESLRYKEDTT 422
            + + ++K+NIG++ +++ +F    G ++ +W++   +L ++      T     + + +  
Sbjct: 283  NTEATLKQNIGFDEDVSMKFKLDRGKVSEVWNHFTRMLGILYKPLRFTHMHRRKNEHEDK 342

Query: 423  FVKKWDGLVLYKDSVKSSTKLGADDVDFDFANHEYAKVSNFFKAPQIIFSIESDIPGIVP 482
            F  KW GL LYK +     +   DD++FDFANHEYAK S+  K+P++ F+ + D+PGIVP
Sbjct: 343  FQAKWRGLALYKGTGLGERRNDIDDIEFDFANHEYAKFSSILKSPKVTFTSQHDMPGIVP 402

Query: 483  HGSHPPLSKAHGPDIGNHESPPTFLIDLQLSHASIYFGSWVNRNIVDLRDLMFPVISKDQ 542
            HG+HP +S   GPD+GN  +PP + +D+Q+   S+ FG W  R    L  L+ PV+S+  
Sbjct: 403  HGAHPTISVLDGPDVGNSGAPPDYSLDIQIFGGSVCFGPWAQRQADHLWKLLSPVVSRTA 462

Query: 543  KPLNKLKPGLTRVHSMFNFSVSVLDDSSIRLPTREPSKDSDFLKQYLETKDDFRAFGWID 602
            KP+ +L PG  R+++     V+++DD++ R+PTRE SKD +FL+ Y ET  ++R FGWID
Sbjct: 463  KPVKRLTPGCRRIYTYGQVLVTIMDDATWRIPTRESSKDFEFLQHYRETNGEYRPFGWID 522

Query: 603  LSFKKGSEFMLNIPMIPTSGGFENTLFSKFSELEVTTSVNHNLLFKSNSLNIAANIGYPL 662
            L F K +       + PT  GF+N +    +E E  +SVNH++L K    +   +  +PL
Sbjct: 523  LKFSKETTVNTTFALCPTVDGFKNNIKIHLTENETRSSVNHDILLKCKYFDFDIDTSFPL 582

Query: 663  GWNDPVNWIFNINSKQLDIFLLREHITLLSDMIIDFSTQEPTPYELFRSFTYNLNLKIGG 722
            GWND   W  N+NS Q++ F+LREHITL++D + DFS+ EPTPYELFR F Y++N KI G
Sbjct: 583  GWNDEATWTINLNSSQMEAFILREHITLIADTLTDFSSGEPTPYELFRPFIYSINWKIDG 642

Query: 723  YSFYFNVNDRNIINNPLDFNENCYLSFHGDLFTSEITIPIISLAQQYVTISYEIFTPMFR 782
            YS Y NVND NI+NNPLDFNENCYLSFHGD  + +  IP  S+  ++  ISY I TPMFR
Sbjct: 643  YSLYLNVNDHNIVNNPLDFNENCYLSFHGDELSLDFLIPKTSITARHTDISYTIKTPMFR 702

Query: 783  LFLNTPSWNTLSEFMRNKEIGRSHDFRVSGTYLIYSELDIDNVDSLTIDFESNSTVLYCF 842
            L LNTP WNTL+EFM++KE+GRS+DF+V G+YLIYS+LDIDNVD++ +D  S  T L C+
Sbjct: 703  LLLNTPPWNTLNEFMKHKEVGRSYDFKVVGSYLIYSDLDIDNVDTIMMDCTSKGTTLQCY 762

Query: 843  GFVIKYMMNFQANYFGSFIKFITTEEYSELIRNNVNDNLGSINTNDLTSIEGLQKMDSIT 902
            GFV++Y++N + NYFG F  F+T+EEY+  IR N  D++   + +D              
Sbjct: 763  GFVVRYLINVKMNYFGDFFHFVTSEEYTGAIRAN-EDDMQYASESDDDRSSISSFDTMQG 821

Query: 903  NDVEDINQ--KTIKRSDLLRTENETDIWLNFKVNDGALILPEELYNGDSCVSLSFGELFI 960
            ND     +    ++RSDL RT NETD+W  F V +GAL+LPE +YN D CV L FGEL I
Sbjct: 822  NDAPGRRRLHTELQRSDLKRTTNETDLWFTFTVWEGALLLPETIYNCDPCVGLHFGELVI 881

Query: 961  NMRTCNYYMDVYITLYDNNLNRFEKIDPHELFEYIQTRNRSS-SVEGNISDITIHGHRMY 1019
            ++R+CNYYMD+   + D ++ R+    PHE+FE I   N       G++S +TIHGHRMY
Sbjct: 882  DLRSCNYYMDLLANMNDVSIKRYVSKHPHEIFEAIHKNNGEEYHTHGSLSSLTIHGHRMY 941

Query: 1020 GLPPKELTYFCQWSINIGTFLIDSDMIFLLSFIQSLNKIGFFLSNKENSLLYESDTVNDM 1079
            GLPP E TYFCQW  ++GT  I SD+ FL  F  S  +IGF   + EN LLYE +T +DM
Sbjct: 942  GLPPMEPTYFCQWDFDLGTLDIASDIEFLRGFFSSFTRIGFGYVDLENILLYEKETYDDM 1001

Query: 1080 TLLSVDVESLKVILSDPLLEARAEIGASSIIIRNIDFENEKYTKRLDVNASEFYFSLDSL 1139
            T ++V++E L V+L +P L   A    +++    IDFENEKY+ RLD+      FSL   
Sbjct: 1002 TSVTVNLEKLSVMLQEPKLNMYASFDLNNLYFTFIDFENEKYSTRLDLIIPTLEFSLFIK 1061

Query: 1140 KIDSGKKNILDVRTKLNITNFFKTDNHINHLDTQRKFIGLHDSPYHRCFFLLPEKFQESS 1199
            + D   K +  + TK+ ITNF ++ +   H  TQR++I LHD+PYHRC F+LP+++Q++ 
Sbjct: 1062 EEDGTTKKLFTLETKVKITNFVQSQDFDEHRKTQREYIKLHDAPYHRCSFILPQEYQDAE 1121

Query: 1200 SYKELYGSITPSFSLPMLPIPHIYSTTNFIVEGILDDYSEFL---------LSDHHNQMS 1250
             Y+EL+G+I PS SLP LP+P I STT+FI+E +L ++ + L          SD      
Sbjct: 1122 QYQELFGAIAPSSSLPPLPVPLIPSTTDFIIEDLLGEFQDLLETSSPFRMPFSDQDYATD 1181

Query: 1251 INAELNSVDTTPLKDSFDMQITNFQNILTTEDPYETDNFVVNVKYLTVTVNPDIVFTIEK 1310
            ++ +    D  PL+  F+      QN     D  E D+F+++V ++++ + PDI+ +I  
Sbjct: 1182 VSDDETEEDIDPLE--FNTPSEAIQN-----DKCERDSFIIDVSFISIEICPDILDSIGT 1234

Query: 1311 FSTEFNKKFSMNNQIDGIEMAIVNRLSDLKENISSKINVNLNVEKIDAAWGHRDVCFIGT 1370
            F   F+ + ++   ID IE+A VNRLS+L+E      NV +N+  +D  WG R    +G 
Sbjct: 1235 FLMLFSTE-NIVQIIDDIEIATVNRLSNLREGAFKLTNVKINILYLDLFWGSRTDTGVGI 1293

Query: 1371 YINMLKFELSQESTYNNNGGLQKDLTLLGKFRSVRIIIQNHSYNSFSDDRPPGLSLMLEG 1430
            Y++ + F + +++   N      +LT+L K RSVR  +   + NS +++RPP LSL++EG
Sbjct: 1294 YLDRIDFAMCEKTVEENKEKKLIELTVLNKIRSVRGTVNQTAANSKNEERPPALSLVIEG 1353

Query: 1431 FEAWXXXXXXXXXXXXXXXFDITVDEYQIHWLIPYVKSQILLFTKIQDSVK---LIYDEQ 1487
            +E W                DITVDE Q+ WL  Y  +Q L   +IQD +K    I   +
Sbjct: 1354 WEIWSSTVEDQVNSLNILSTDITVDEAQLEWLFGYFDNQGL---QIQDMIKTSDTIQKRK 1410

Query: 1488 ASYQKTFITSLIWAGEKYQIDHDPYVITKPATVLRLSAWHIRENRSWRIVTKLRHILTYX 1547
               +K  I+SL  A E YQI HDPYVITKPA + RLS  H+RENRSW+I+T+LRHILTY 
Sbjct: 1411 IESRKELISSLTAASEYYQISHDPYVITKPAFITRLSRGHVRENRSWKIITRLRHILTYL 1470

Query: 1548 XXX-XXXXXXXXXXIKRSGLEKEAASTFLNVFSNWRNWEVSDIEKSYIYRMIFVEEVSKR 1606
                           K +   ++A   F++VFSNWRNWE SDI +SYIYR +F+ + S +
Sbjct: 1471 PEDWHSTINRSLTQSKTAATTQDAKGIFISVFSNWRNWEFSDIARSYIYRKLFLNQHSNQ 1530

Query: 1607 IL---QNSIKVFLETFYFTIYSRNYSADQNFLITKANILINNEADQVNEVDLIRKQEEIV 1663
             +   + SI + + +F+ T+YS  Y  + NF+IT+ N+L+   +   ++  L R  E I 
Sbjct: 1531 EIHTTKKSITIKIASFFVTVYSAGYEVEHNFIITRTNLLLETNS-PTSDSSLSR--ETIF 1587

Query: 1664 DVVTKIGSIKFEFTEAILKLKRDIEQIIKTSVDSKSEGDKLSITKFFKVNLSFIFDHIDF 1723
            ++   +G+ K + ++ I+ +K  +  +  T  D     +     K FK+N   + +  + 
Sbjct: 1588 NITGTLGTAKGKLSDKIIMIKNLLPSLKIT--DGGKSKETFDFVKSFKLNTLILCERGEL 1645

Query: 1724 NGQFYNSSLKSRMSNVNILSYFENNIESSTPSGSFVYYADRTGIALKHLNNILIDCQVRN 1783
                 N+ L SR+    +   +E+  + ++ + S   Y  R  I LKH+N  L + Q+R+
Sbjct: 1646 QIDIGNTRLVSRVFGARLSMLWESPKDLTSQAVSLAVYTQRAEIHLKHINATLAEIQIRD 1705

Query: 1784 LFASTTAELHSAVNSLMINFRCSNLHFKSVPKTEIFVNAIKAIQRDVETLSAEISKAQGT 1843
                 T E  S   ++++N +CS+LH  ++  T+I V +IK I  ++  +  ++    GT
Sbjct: 1706 FSLIVTTESWSYKPTILVNSQCSDLHLMAMTATDILVASIKEIMENIHRIEQDL--LAGT 1763

Query: 1844 TDNINTEHTPSVHEKNKMQKAKPNSKNNITLSATFTNVSSEITLLHPIYLKHETNSVNIS 1903
                         +  K++   P  K N  L+  FTN+S E+  + P +++HE   ++I 
Sbjct: 1764 ----------RAEKITKVESHGPKPKVNTILTCFFTNISFELMPISPFFIRHEAKQLDIY 1813

Query: 1904 YNTINIDELLVQVLDTDLYLNSSHTKEQYARLSYDKLELTTFLPDLNEKLIDLEISSSIL 1963
            +N    +E+L+ V D D+YL S  TK+QY R S+  L+L   + + +   I+L +S+SIL
Sbjct: 1814 FNRFGSNEILLSVWDADIYLTSHLTKQQYFRFSFGDLQLKGNMVN-DPYHINLYLSASIL 1872

Query: 1964 KLTTSDPRRMLFSFLQDEKELKNSLTFLRSLE----SLNRKANSEDSETLFSSYEWIVNF 2019
            KLT SD ++++ SFLQDEK L  S+    +L+    S N+K+  E     FS   W ++ 
Sbjct: 1873 KLTVSDVQKLIPSFLQDEKILTESIEDFITLDLFGLSKNQKSKPEKDNNKFS---WSIDT 1929

Query: 2020 KSKYMGVLLPIQATYYVFELHDALSTVSNKEEPSSAVHKKFHGDLSFDHIIFLIKDQSIP 2079
               Y G+L PI + Y++FEL   L++++ K            G  S ++++F IK++++P
Sbjct: 1930 NINYFGLLAPIGSAYFLFELRMLLASLT-KMGSDIPNQSDISGQFSVENVLFFIKERALP 1988

Query: 2080 HKFSKILDFSIKLSTHRTVNNFDRSFEIESSFFRVCLTPFSLIQTMWGXXXXXXXXXXXX 2139
             + SK+LDFSIK+S  +   N   +++IESS FRVCL+P SL++ +W             
Sbjct: 1989 VRLSKLLDFSIKVSALQKKKNTSNTYQIESSHFRVCLSPESLVRLLWATNQVSTSIQYYK 2048

Query: 2140 DQSTXXX--XXXXXXXIDGATNSEKENVFSVRSFHILSYNFSIGWLYQDSDNTIPGLILG 2197
            D               I  A +       +V SFHILSYNF +GWL+     + PGLILG
Sbjct: 2049 DHHVDNKWDLRSKLNNIPKAPDLP----LNVPSFHILSYNFCVGWLFSVDSKSEPGLILG 2104

Query: 2198 YNRLFSTYEDNHGKLTLVDGFFSLANGSSGDTFYSSGDESSKFNRSYLPNIQILYWIKEI 2257
            YNRLFS YE N GKLTLVD FFS+ANG+S D F+S G E  K+NRSYLPN+QI YW K+ 
Sbjct: 2105 YNRLFSAYEKNLGKLTLVDVFFSIANGNSSDNFFSEGKEKDKYNRSYLPNMQISYWFKDA 2164

Query: 2258 EKMKHLFIKFHGETLDVNFFENFVNIIESTVRSIDLFQTLKREKINPLVKAKPERDEKSN 2317
              M+ LF++FHGE LDV F  +++++IES + S+  FQ LK++ I  L K +   D+K+ 
Sbjct: 2165 GTMRDLFVRFHGEALDVTFLSSYLDVIESALTSVQTFQELKKDLIPGLPKKQKVNDDKTL 2224

Query: 2318 SALTNIKGPIFGKLKQVNCEFIYDGGLFRLFSNASMTNKLEPTLMIKSPKVKIMLSYDYF 2377
                N   P    ++ ++C+F YDGG+F++FS      + EP+  + SP V I L+Y + 
Sbjct: 2225 EL--NTLSPFLANIRSISCQFKYDGGVFKIFSLEDAETQSEPSFEVNSPNVVIDLNYKHL 2282

Query: 2378 EKELKKHWINCLIDIEPTQNVLKSGCVPFLSDFISQIKDIVELQDVNMEENMDNNVKDPI 2437
            E   K+HWI  LI I  T N+L + C P LSDF  +I+ +V+    + E  +       +
Sbjct: 2283 ENRTKQHWIRSLIKINSTHNILYAKCAPLLSDFFERIQGMVKKHSSSEESTLSKPSSQNL 2342

Query: 2438 NITSLLENFDICFKLISGTQHVTLDCEPKAKINTDVGFGSFEFSILTPHLNPIDPLDISL 2497
            +   LL++FDI  K+ S  Q ++L CEPKAK+  D+GF SF F++ T  L+  +PL  SL
Sbjct: 2343 DYKRLLDSFDIALKITSAKQQLSLSCEPKAKVQADIGFQSFIFTVTTNDLDAAEPLSFSL 2402

Query: 2498 KINDIKTSVKHQFSNEASASFEVSKLDVILIFTHPEVF---GTGLVDDVKLHFNLKQFQN 2554
             +   + S+KH FS E S S  V  +DV L+FTHP+V    GT L+ ++ L FN+KQ QN
Sbjct: 2403 SVEKTEASIKHIFSRETSTSIGVDFVDVTLMFTHPDVINVHGTALISNINLFFNVKQLQN 2462

Query: 2555 ISIFLDIWDVSKSTEKKLFKKDSNTLVDAK---SSPIAQTIVNSSTLPWSFVFIATNING 2611
            + +FLDIW +S      L  K +N +V AK   S  IAQ     S +PW F  I TN+ G
Sbjct: 2463 LYLFLDIWRLS----DLLKSKPANDIVKAKTDSSLSIAQLSDPESIIPWCFTLIFTNVKG 2518

Query: 2612 DINMGSTLGNLALNLQRTWISTDHFHNKRQLLHLFTDNVKISSEGRLGGFVEIDDITWKL 2671
            D+++G +LG +++ L+RTW +TDH+ N R++LH FTD   +SS+GRL G  E+   +W  
Sbjct: 2519 DVDLGPSLGVISVQLKRTWFATDHYKNMRKVLHAFTDGTSLSSKGRLSGIFELKGASWIS 2578

Query: 2672 DVNYVDKYKFVVSPLVDLLFDVGKVSMKVAFDYHMFLISTVKDLKFHVLSEKDIDDILPD 2731
            +VN+         PLV +  ++ ++S K AFDYHMFLI  + + + H+ SEKD++ ++PD
Sbjct: 2579 EVNWPTDTTINAHPLVSITMNIDEISTKAAFDYHMFLIGAINNTRVHLHSEKDVNGVMPD 2638

Query: 2732 LLTVNLTCDEIKVCTTALVASNILDIYNTIMRTRQDNKNSYIETLLESNNNVLKRKPLYE 2791
            LL V   C+ I +C+TALVA+NILDIYNT MR RQDNK SYIETL ESN    K    Y 
Sbjct: 2639 LLKVTFLCESITLCSTALVAANILDIYNTAMRMRQDNKISYIETLRESNEAESKPPINYT 2698

Query: 2792 DILKSLNLLQTSLSANIHELNLQISPSSLYDAEVIIIRVQDVFSSTETRTGEKIKTDLEM 2851
            DIL+SLNLLQT +S +I+ LN+QISP +L+D EV++I ++ + + +ET +G+K+ T+LEM
Sbjct: 2699 DILRSLNLLQTDVSVDIYTLNIQISPITLFDVEVLVITIESISARSETHSGKKLMTELEM 2758

Query: 2852 RVYNATLSLTSFGKELTEEDIAEMSAETYISYASTLTSGRIFEIPQLTINMTTFQNADNM 2911
            +VY+A++SL++  +E+ E  ++++S + Y+ YAS +  G I EIP+L ++MTTFQ   + 
Sbjct: 2759 QVYDASVSLSTSKEEMDEATVSKISVKNYLQYASKIVGGTIIEIPKLLVSMTTFQEEKSD 2818

Query: 2912 ILQYTYSCSFDGKVDVTWNLGPINFIKEVWATHVRSLEVRTVQFMGNHDISLENEGDTDE 2971
            IL+Y Y+C FD K+ V WNLGPINFIKE+W TH+R++ VR  Q +G  D   ++E D ++
Sbjct: 2819 ILEYLYTCVFDDKLSVRWNLGPINFIKEMWTTHIRAIAVRRSQVVGVLD--GQSEEDVEK 2876

Query: 2972 SVKV---LSNIEYIALEEPYIEMPQIKDLKDATPPLEWFGLNRKYFPSATHQSVIVPIQK 3028
             +K     S  +Y+ALE P I+MPQI+DL DATPP+EWFG+NRK FP+ THQ+ +  +QK
Sbjct: 2877 RIKEEENFSRFKYVALEPPRIDMPQIRDLGDATPPMEWFGVNRKRFPAFTHQTAVFLVQK 2936

Query: 3029 LVNVAQKEYAKVLGSS 3044
            LV  A++EYA +LGSS
Sbjct: 2937 LVYSAEREYANILGSS 2952

 Score =  135 bits (341), Expect = 1e-30,   Method: Compositional matrix adjust.
 Identities = 61/121 (50%), Positives = 88/121 (72%), Gaps = 1/121 (0%)

Query: 6   TEFANVSLSQERYFSWVFLVYWILVVVATSTFVFYVAKLWGFGLTFACEWLLWKTMNIKV 65
           ++F  V L+++R FSW+FLV WIL V+ + +F+FY+ +   + +TF  EWLLWK   +KV
Sbjct: 5   SQFQGVPLTRQRNFSWIFLVTWILTVILSLSFIFYLGRTIAYIITFILEWLLWKHAKVKV 64

Query: 66  TIESIRLSFLTGTIFFKNVCLIDQDKTISILECSVTWRYWLLNTRKSEYELNAKADT-SK 124
            I+S+R+S L G IFFKNV +I +D TISILE ++TWRYWL NTRK E++  +  +T +K
Sbjct: 65  NIQSLRISLLGGRIFFKNVTIIHKDSTISILEGNITWRYWLFNTRKPEFQEASVDETQTK 124

Query: 125 P 125
           P
Sbjct: 125 P 125

>ZYRO0C01694g Chr3 (121250..130270) [9021 bp, 3006 aa] {ON} similar to
            uniprot|Q12150 Saccharomyces cerevisiae YLR087C CSF1
            Protein required for fermentation at low temperature
          Length = 3006

 Score = 2108 bits (5461), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1162/3091 (37%), Positives = 1804/3091 (58%), Gaps = 149/3091 (4%)

Query: 6    TEFANVSLSQERYFSWVFLVYWILVVVATSTFVFYVAKLWGFGLTFACEWLLWKTMNIKV 65
            + F  VSL + R FSWVFLV W+L  + T T +FY+ +++GF LTF  EW++WK   +K+
Sbjct: 5    SPFQKVSLDRTRNFSWVFLVDWVLTCIVTLTVIFYLGRIFGFLLTFILEWVVWKRCKVKI 64

Query: 66   TIESIRLSFLTGTIFFKNVCLIDQDKTISILECSVTWRYWLLNTRKSEYELNAKADTSK- 124
             IES+R++ L G I F+N+C+I +D TIS LE ++ WRYWL N+RKS+Y+ N   +  + 
Sbjct: 65   NIESLRIAPLGGNIMFRNLCIIHRDYTISCLEGTINWRYWLFNSRKSQYQENLDNEEERL 124

Query: 125  PNGDDMLDNNTIHDRSXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXKKL 184
             NG +   N+                                               +K 
Sbjct: 125  ENGQEPKSNSG----------------------------------------------RKH 138

Query: 185  DSLFAINCTGFEIFLYNRKRAYETIIQNFSKEEKIQFIDFLRQHDLDDIFEEVSSEIKNC 244
               F + C G EIF+YN+  +YE II  FSKEE+ QF  F+    + ++F E   E K  
Sbjct: 139  PCRFLLACEGLEIFVYNKTSSYENIIHMFSKEERAQFEKFVDDQTMTELFNESEQENKVL 198

Query: 245  NEYCNHKEGNNSAHFGSSCKSDKESASNISISGDSQEXXXXXXXXXXXXKISAHI--MRK 302
            +E         +   GS+ +++ E ++    +G +Q                      + 
Sbjct: 199  SESTPSSVTMETV--GSNDRNNNEDSNEEEDAGRNQNDGQAPNNLENDELFEQQCSNRKS 256

Query: 303  LHLDILPLDININKGAITIGNKFTRSLLVINFTEAHGLLDYALPDSKLDVFKNKVTFEIN 362
            +++  LP+ I+  + ++ +GN+FT S+LV++   + G++D   P  KLD+FK K+  E+ 
Sbjct: 257  MYMRFLPIQISTRRFSLVLGNRFTPSILVVSAKNSKGIIDLCPPKEKLDLFKIKLEKELY 316

Query: 363  DIDMSIKRNIGYNPELASRFNFRAGVLTRIWSYLQLVLNLIPTGRLKTWYESLRYKEDTT 422
            D+D S+K+NIG++ ++++ F +  G L+++W     +  L+PT   K     L+ +ED T
Sbjct: 317  DVDASVKQNIGFDDDISTSFKWTRGRLSKLWQKFARIF-LLPTLGPK----HLQTQEDIT 371

Query: 423  FVKKWDGLVLYKDSVKSSTKLGADDVDFDFANHEYAKVSNFFKAPQIIFSIESDIPGIVP 482
            F + W GL LY+ +++       ++VDFDFANHEYA+V +  K+ +I+F+ E DIPG+VP
Sbjct: 372  FRENWKGLSLYRQNMEEDE---LENVDFDFANHEYARVISILKSAKIVFTYEYDIPGLVP 428

Query: 483  HGSHPPLSKAHGPDIGNHESPPTFLIDLQLSHASIYFGSWVNRNIVDLRDLMFPVISKDQ 542
                 P     GP++GN  +PP F +D+QL  A+I +G W  R +  LR L+ PV+S+  
Sbjct: 429  K---EPEETLQGPEVGNSGAPPEFGVDIQLYGANICYGPWAERQLSYLRALLSPVVSRTP 485

Query: 543  KPLNKLKPGLTRVHSMFNFSVSVLDDSSIRLPTREPSKDSDFLKQYLETKDDFRAFGWID 602
            KP+  L PG  R++++F  S+S++++S+ R+PTRE SKD +FL+ Y+ETK++FR FGWID
Sbjct: 486  KPIKTLTPGSQRIYTIFKTSISIMEESTWRIPTREKSKDQEFLRHYVETKEEFRPFGWID 545

Query: 603  LSFKKGSEFMLNIPMIPTSGGFENTLFSKFSELEVTTSVNHNLLFKSNSLNIAANIGYPL 662
            L F K S  +L+  + PT  G  N +   FS +E+ TSVNH LL ++ S +  A++GYPL
Sbjct: 546  LKFMKDSYGILDTVICPTEEGSPNNVNFHFSNMEIRTSVNHELLLRAKSFDFEADMGYPL 605

Query: 663  GWNDPVNWIFNINSKQLDIFLLREHITLLSDMIIDFSTQEPTPYELFRSFTYNLNLKIGG 722
            GWND  NW  N++S QL+IF+LREHITL+SD+  DFS+ +PTPYELFR F Y +N  + G
Sbjct: 606  GWNDQANWNINLSSTQLEIFILREHITLISDVFADFSSGDPTPYELFRPFIYRINWNLDG 665

Query: 723  YSFYFNVNDRNIINNPLDFNENCYLSFHGDLFTSEITIPIISLAQQYVTISYEIFTPMFR 782
            YS Y NVND NI+NNPLDFNENCYLS HGD    ++ IP  ++A +   I+Y I TPMFR
Sbjct: 666  YSIYLNVNDHNIVNNPLDFNENCYLSLHGDHLIFDVKIPRQTVANRCTEITYHISTPMFR 725

Query: 783  LFLNTPSWNTLSEFMRNKEIGRSHDFRVSGTYLIYSELDIDNVDSLTIDFESNSTVLYCF 842
            L LNTP WNTL+EFM+NKE+GRS++F+V+G Y ++SELDIDNVD+++++  S  T L+C+
Sbjct: 726  LLLNTPPWNTLNEFMKNKEVGRSYNFQVNGLYTVFSELDIDNVDTISVECSSFGTTLHCY 785

Query: 843  GFVIKYMMNFQANYFGSFIKFITTEEYSEL--IRNNVNDNLGSINTN-DLTSIEGLQKMD 899
            GFV++Y+MN + NYFG F  F+T EEY+         N+NLG  ++  +++S E ++  D
Sbjct: 786  GFVVRYLMNVKMNYFGDFSHFVTAEEYTNANHTEEPKNENLGDEHSGFNISSTEDVE-TD 844

Query: 900  SITNDVEDINQ--KTIKRSDLLRTENETDIWLNFKVNDGALILPEELYNGDSCVSLSFGE 957
                +    N+     KRS+L RTENE DIW  F V +GALILPE +YN D C++L F E
Sbjct: 845  RTNPEGRPANKGIPMPKRSELKRTENEMDIWFVFSVWEGALILPETIYNSDPCIALHFNE 904

Query: 958  LFINMRTCNYYMDVYITLYDNNLNRFEKIDPHELFEYIQTRN-RSSSVEGNISDITIHGH 1016
            L +++R+ NYYMD+  T+ +  L R+    PH+LFE ++  N R     G +S +TIHGH
Sbjct: 905  LEVDLRSTNYYMDLLATMNNTELKRYVSRHPHDLFECVRKDNGRQEKSHGYLSSLTIHGH 964

Query: 1017 RMYGLPPKELTYFCQWSINIGTFLIDSDMIFLLSFIQSLNKIGFFLSNKENSLLYESDTV 1076
            RMYGLPP E TYFCQW ++I    I+SD+ F   F+   +KIGF   N EN LLYE++T+
Sbjct: 965  RMYGLPPTEPTYFCQWGVDIDRLEINSDLEFAKGFLTCFSKIGFGFKNLENILLYETNTL 1024

Query: 1077 NDMTLLSVDVESLKVILSDPLLEARAEIGASSIIIRNIDFENEKYTKRLDVNASEFYFSL 1136
             DMT ++V V+ LK +++D    +R+ + A  I    IDFENE Y++R+D    +  F +
Sbjct: 1025 FDMTSVTVRVKELKFMMNDADTSSRSVLHAKKITFTAIDFENEAYSQRVDFKFPDINFLI 1084

Query: 1137 DSLKIDSGKKN---ILDVRTKLNITNFFKTDNHINHLDTQRKFIGLHDSPYHRCFFLLPE 1193
               ++D  +K    +L ++T+LN T+F +     +H   QR++I LHDS Y+RC FLLP 
Sbjct: 1085 --FELDENQKEGRFLLHLKTQLNFTDFIQNQAFADHRYRQREYITLHDSAYYRCSFLLPC 1142

Query: 1194 KFQESSSYKELYGSITPSFSLPMLPIPHIYSTTNFIVEGILDDYSEFLLSDHHNQMSINA 1253
             FQES  YKEL GSI+PS +LP LP+P +  T ++I+E  L +Y+   +    +  S  +
Sbjct: 1143 FFQESVLYKELLGSISPSATLPPLPLPVLAETIDYIIEDCLGEYAP-TVKPDDSSSSDTS 1201

Query: 1254 ELNSVDTTPLKDSFDMQITNFQNILTTEDPYETD---NFVVNVKYLTVTVNPDIVFT--- 1307
            E      T     F      F   +    P   D   N+V++V+Y+ + V P +      
Sbjct: 1202 EGQRTPLTNEDTRFQANSGFFSPHMPHNPPNNRDRYNNYVLDVEYVNLEVKPSVTGVLLN 1261

Query: 1308 -IEKFSTEFNKKFSMNNQIDGIEMAIVNRLSDLKENISSKINVNLNVEKIDAAWGHRDVC 1366
             ++KF TE        + ID  E+AIV +L +L+   S      L+V+ +   +   +  
Sbjct: 1262 YLKKFYTE-----DTTDIIDKNEIAIVKKLGNLQYGASFVTTSRLHVKDLHFLYDFEEGS 1316

Query: 1367 FIGTYINMLKFELSQESTYNNNGGLQKDLTLLGKFRSVRIIIQNHSYNSFSDDRPPGLSL 1426
             +   +N   F+L +++  N +  +  + T+     ++RI +     +S S  +P  L L
Sbjct: 1317 GVELALNSFDFDLRRKTIENEDEKVILEKTMFSNIHTLRISLLEAHPSSIS-MKPAALQL 1375

Query: 1427 MLEGFEAWXXXXXXXXXXXXXXXFDITVDEYQIHWLIPYVKSQILLFTKIQDSVKLIYDE 1486
             +E  E W               F  T+DE Q+  +  Y+  QI +      S K + + 
Sbjct: 1376 SIEDLELWSSTVDENVNSVNVTSFGFTLDESQLERISGYLFGQIKVLRDTITSAKELENL 1435

Query: 1487 QASYQKTFITSLIWAGEKYQIDHDPYVITKPATVLRLSAWHIRENRSWRIVTKLRHILTY 1546
            +   QK  I  L  A E YQI HDPYVITKPA ++RLS  H+RENRSWRI+T+LRHILTY
Sbjct: 1436 RKKTQKDLICDLTSASEYYQISHDPYVITKPAFIMRLSEGHVRENRSWRIITRLRHILTY 1495

Query: 1547 XXX--XXXXXXXXXXXIKRSGLEKEAASTFLNVFSNWRNWEVSDIEKSYIYRMIFV---E 1601
                             +   + +     F++VFSNWRNW++SDI +SYIY+ IF+   E
Sbjct: 1496 LPNDWRTADHLVTVQDSENPNVPQRDEDIFVSVFSNWRNWDLSDITRSYIYKKIFLPQNE 1555

Query: 1602 EVSKRILQNSIKVFLETFYFTIYSRNYSADQNFLITKANILINNEADQVN-EVDLIRKQE 1660
            +  K+ L+  +K+  ++F+FT+    Y   ++ + T+ NI+++     VN   + + KQE
Sbjct: 1556 DSFKKELRTVLKINFQSFFFTVLISGYEVARSTIFTRTNIIVDVLPPSVNTSSENLFKQE 1615

Query: 1661 EIVDVVTKIGSIKFEFTEAILKLKRDIEQIIKTSVDS----------------KSEGDKL 1704
            +++ +   +G+IK E+ E + KLK    +  +  +D                  S+ D+L
Sbjct: 1616 KVITLTANMGAIKGEWGEEVFKLKELFSKFSENELDDLSNLGSISRSASISGFGSQMDRL 1675

Query: 1705 SITKF---------FKVNLSFIFDHIDFNGQFYNSSLKSRMSNVNILSYFENNIESSTPS 1755
              ++           K+  + IF+  D +    ++ L +R+ N       EN+ E++ P+
Sbjct: 1676 ESSRASGPGDRFRNLKIFATMIFERCDLHFVVGDTRLTNRIINGKNSMLLENSKENTPPA 1735

Query: 1756 GSFVYYADRTGIALKHLNNILIDCQVRNLFASTTAELHSAVNSLMINFRCSNLHFKSVPK 1815
             S V++A R  I LKH  N+L +  ++ L  + TA+L   +  + +N + +N   +++P 
Sbjct: 1736 LSAVFFAQRHEIWLKHSTNVLAEVLLKQLHVAATAQL-GVIPFVSLNCQATNSFIRAMPS 1794

Query: 1816 TEIFVNAIKAIQRDVETLSAEISKAQGTTDNINTEHTPSVHEKNKMQKAKPNSKNNITLS 1875
            T +  N+++ I+R VE L  +    +    +  T+ TP +  K               + 
Sbjct: 1795 TVVLRNSVEKIKRQVEVLIPQFKSHEVKNSSAVTKKTPRIPIK-------------FDIR 1841

Query: 1876 ATFTNVSSEITLLHPIYLKHETNSVNISYNTINIDELLVQVLDTDLYLNSSHTKEQYARL 1935
              FT++SSEI LL P YL  +   ++I  +     EL++  L+ D+YL S  + EQ+ + 
Sbjct: 1842 FNFTDMSSEIMLLSPFYLLQDVKQLHIYASGHENMELVLGFLEYDVYLKSQLSSEQFFKF 1901

Query: 1936 SYDKLELTTFLPDLNEKLIDLEISSSILKLTTSDPRRMLFSFLQDEKELKNSLTFLRSLE 1995
            S   L+    + D    +++++IS+S++KLT  +PRR L + LQDE+ L  S+  ++ L 
Sbjct: 1902 SSTDLQFKCEVADEVVPVVEVQISTSLMKLTLCEPRRALHNLLQDEQTLVESVDHIQKLW 1961

Query: 1996 SLNRKANSEDSETLFSSYEWIVNFKSKYMGVLLPIQATYYVFELHDALSTVSNKEEPSSA 2055
            +  R A+  +  +   +  W ++   KY G+L+P+ +  Y+FELH   ++++N  E    
Sbjct: 1962 NFLRSASGGNDRSPSRNTRWALDANLKYFGLLVPVSSICYIFELHSLFASLTNANEQYEE 2021

Query: 2056 VHKKFHGDLSFDHIIFLIKDQSIPHKFSKILDFSIKLSTHRTVNNFDRSFEIESSFFRVC 2115
              + F G +  +    L+K+ S+P   SK+LDFSI+  T + V N  +S++IESS+FR+C
Sbjct: 2022 YDRHFSGQIVVESCYLLVKELSLPANLSKVLDFSIRFLTSQKVPNSLQSYQIESSYFRLC 2081

Query: 2116 LTPFSLIQTMWGXXXXXXXXXXXXDQSTXXXXXXXXXXIDGATNSEKENVFSVRSFHILS 2175
            L P  L+  +W                T              T    E+    RS HILS
Sbjct: 2082 LFPELLVDILWSVHYLQSLLNHFKKHHTPWLPYS-----SNKTAKSGESTLDFRSIHILS 2136

Query: 2176 YNFSIGWLYQDSDNTIPGLILGYNRLFSTYEDNHGKLTLVDGFFSLANGSSGDTFYSSGD 2235
            YNF +GWL++  DN+ PGLILGY+RLFS YE + GKLTL+DG+ S+ANG++ DTFYS   
Sbjct: 2137 YNFCVGWLFEVGDNSEPGLILGYDRLFSAYEKHFGKLTLIDGYLSVANGNTSDTFYSQKS 2196

Query: 2236 ESSKFNRSYLPNIQILYWIKEIEKMKHLFIKFHGETLDVNFFENFVNIIESTVRSIDLFQ 2295
            E   + R+YL N+QI YW+K    +K LF++FHGE +DV F      ++E T+ SI  F 
Sbjct: 2197 EKDSYTRTYLSNMQIFYWLKGENLLKDLFVRFHGEVIDVRFLSTSFKLVEKTLHSIKRFN 2256

Query: 2296 TLKREKINPLVKAKPERDEKSNSALTNIKGPIFGKLKQVNCEFIYDGGLFRLFSNASMTN 2355
             +K+ KI         + + +  A +N   P    ++ +N +  + GG+F+++S   + +
Sbjct: 2257 EMKKAKIKQ--TGSSTKSKLNMEAASNTLAPFLAHIRTINSQLNFAGGVFKVYSPTELDS 2314

Query: 2356 KLEPTLMIKSPKVKIMLSYDYFEKELKKHWINCLIDIEPTQNVLKSGCVPFLSDFISQIK 2415
            K EP L IKSP V++ ++Y++ E   K H I     IEPT N+L + C P LSDF   IK
Sbjct: 2315 KAEPLLEIKSPGVQMAINYEFNETREKSHCIRFFTTIEPTHNMLFAKCAPLLSDFNHNIK 2374

Query: 2416 DIVELQDVNMEENMDNNVKDPINITSLLENFDICFKLISGTQHVTLDCEPKAKINTDVGF 2475
            +++       + +    V D I+  SLL  +DI F++ SG Q ++  CEPKAK+  D GF
Sbjct: 2375 NMIRNLSSEDKSHPSKPVTDSIDYKSLLNPYDIAFEIASGKQKLSFSCEPKAKVQLDAGF 2434

Query: 2476 GSFEFSILTPHLNPIDPLDISLKINDIKTSVKHQFSNEASASFEVSKLDVILIFTHPEVF 2535
             SF F + T  ++ ++P ++S  ++ I++SV+H FS ++SA+F +  +D++++FT+P V+
Sbjct: 2435 NSFLFRVTTDKVDSVEPFNVSFSMDKIESSVRHIFSRDSSAAFMLDYIDIVMMFTYPNVY 2494

Query: 2536 GTGLVDDVKLHFNLKQFQNISIFLDIWDVSKSTEKKLFKKDSNTLVDAKS----SPIAQT 2591
            G  LV D+ ++ N+KQ QN++IFLDIW +S     K  +  +    DAK          +
Sbjct: 2495 GVALVSDMNIYCNMKQRQNLNIFLDIWRLSNRGRTKPSENKAEDKSDAKKSLSPPFSPSS 2554

Query: 2592 IVNSSTLPWSFVFIATNINGDINMGSTLGNLALNLQRTWISTDHFHNKRQLLHLFTDNVK 2651
              +    PWSF  I TN+ G +++G +LG L L L++ WI+T H  ++++  H F   + 
Sbjct: 2555 NDSRKVFPWSFTIIFTNMGGVVDLGPSLGVLTLGLEQVWITTKHQGDQKRTWHTFAHGIT 2614

Query: 2652 ISSEGRLGGFVEIDDITWKLDVNYVDKYKFVVSPLVDLLFDVGKVSMKVAFDYHMFLIST 2711
            ++SEGRL G  E+D  +   ++++ ++    V PL+ +   + ++S+K AFDYHMFLI +
Sbjct: 2615 VNSEGRLSGMFELDQASSVSEISWPEEDLLRVGPLISVSMAINRMSIKSAFDYHMFLIGS 2674

Query: 2712 VKDLKFHVLSEKDIDDILPDLLTVNLTCDEIKVCTTALVASNILDIYNTIMRTRQDNKNS 2771
            +K +K H+ +E D   ILPDLL V+L  + I +C TAL A+N LDIYNTIMR +QDN+ S
Sbjct: 2675 MKSVKVHLHNESDTYAILPDLLQVSLEFESIVLCATALTAANALDIYNTIMRMQQDNRIS 2734

Query: 2772 YIETLLESNNNVLKRKPLYEDILKSLNLLQTSLSANIHELNLQISPSSLYDAEVIIIRVQ 2831
            YIETL ESN +       YE++L SLNLL+T +S  + EL + ISP SL+DAEV+++ V+
Sbjct: 2735 YIETLKESNISASSTSVAYEEVLNSLNLLRTDMSVIVKELKVHISPMSLFDAEVLVVSVR 2794

Query: 2832 DVFSSTETRTGEKIKTDLEMRVYNATLSLTSFGKELTEEDIAEMSAETYISYASTLTSGR 2891
            DV + +ET++GEK+KT+L++++ +   SL+S  +EL EE +++++ + Y+ YAS  + G 
Sbjct: 2795 DVNARSETQSGEKLKTELQLQISDVNASLSSSKEELDEETVSKIAVDDYMLYASKFSGGT 2854

Query: 2892 IFEIPQLTINMTTFQNADNMILQYTYSCSFDGKVDVTWNLGPINFIKEVWATHVRSLEVR 2951
            I ++PQL ++MTT+Q   + +L+Y ++C F  K+ + WNLGP+NFIKE+WATHVRSL VR
Sbjct: 2855 IIKLPQLLVSMTTWQQQSSPVLEYLFTCKFFDKISMKWNLGPVNFIKEMWATHVRSLAVR 2914

Query: 2952 TVQFMGNHDISLE--NEGDTDESVKVLSNIEYIALEEPYIEMPQIKDLKDATPPLEWFGL 3009
              Q +GN    LE  NE D +++VK  S   Y+ L+EPYIEMPQIKDL DATPPLEWFG+
Sbjct: 2915 RTQ-LGNSSPELEVANESDKEDTVK--SKFIYVPLDEPYIEMPQIKDLGDATPPLEWFGV 2971

Query: 3010 NRKYFPSATHQSVIVPIQKLVNVAQKEYAKV 3040
            +RK  P+ATHQ+ ++ IQKLV+ A+KEYAK+
Sbjct: 2972 HRKNLPAATHQTAVLLIQKLVHTAEKEYAKL 3002

>TBLA0E04420 Chr5 complement(1126342..1135788) [9447 bp, 3148 aa] {ON}
            Anc_8.260 YLR087C
          Length = 3148

 Score = 1891 bits (4899), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1021/2589 (39%), Positives = 1543/2589 (59%), Gaps = 71/2589 (2%)

Query: 499  NHESPPTFLIDLQLSHASIYFGSWVNRNIVDLRDLMFPVISKDQKPLNKLKPGLTRVHSM 558
            N  +PP   ++ QL  ASI +G W +RNI++++ +  P++S+  +     +PG  R ++M
Sbjct: 590  NISAPPESNMEFQLFDASINYGPWAHRNIMNIQRIFSPIVSRTPELQPDPEPGFLRRYTM 649

Query: 559  FNFSVSVLDDSSIRLPTREPSKDSDFLKQYLETKDDFRAFGWIDLSFKKGSEFMLNIPMI 618
               SVS+++DSS R+PTREPSKD DFLK+Y++T D  R+FGW DL+F + SE    I  I
Sbjct: 650  TKISVSIMEDSSWRVPTREPSKDQDFLKRYMKTNDSSRSFGWFDLNFSRNSEATFCISSI 709

Query: 619  PTSGGFENTLFSKFSELEVTTSVNHNLLFKSNSLNIAANIGYPLGWNDPVNWIFNINSKQ 678
            P   G+ N L   F +LEV +SVNH++ F+S S  + ++IGYPLGWND V W F  +S Q
Sbjct: 710  PDVNGYANKLNLDFKDLEVRSSVNHDIFFRSKSYRVDSDIGYPLGWNDEVTWSFVFDSYQ 769

Query: 679  LDIFLLREHITLLSDMIIDFSTQEPTPYELFRSFTYNLNLKIGGYSFYFNVNDRNIINNP 738
            L+ F LREH+ L++D   DFS+ EPTPYE FR   Y ++    GYS Y NVND NIINNP
Sbjct: 770  LETFFLREHLVLIADTFSDFSSGEPTPYEFFRPSIYKVDWNFHGYSAYLNVNDHNIINNP 829

Query: 739  LDFNENCYLSFHGDLFTSEITIPIISLAQQYVTISYEIFTPMFRLFLNTPSWNTLSEFMR 798
            LDFNENCY+S HGD     + IP + +   Y  I ++I TPMFRL LNTP WNTL+EFMR
Sbjct: 830  LDFNENCYISVHGDDAHIGVEIPRLGITATYTDIIFQISTPMFRLLLNTPPWNTLNEFMR 889

Query: 799  NKEIGRSHDFRVSGTYLIYSELDIDNVDSLTIDFESNSTVLYCFGFVIKYMMNFQANYFG 858
            NKEIGR +DF   G+Y+IYS+LDIDNVDSLTI+  +    L  +GFVI Y++N Q NYFG
Sbjct: 890  NKEIGRGYDFTAEGSYIIYSDLDIDNVDSLTIECSTRRMTLLTYGFVIGYLLNVQMNYFG 949

Query: 859  SFIKFITTEEYSELIRNNVNDNLGSI-------NTNDLTSIEGLQK---MDSITNDVEDI 908
             F  FIT EEY++++R N ND + ++        TN ++++   Q      S +N ++ +
Sbjct: 950  EFSHFITAEEYTDIVRGNDNDIVSTLADFSVMSETNSVSNVSNSQHNPDNSSKSNIIDPL 1009

Query: 909  NQKTIKRSDLLRTENETDIWLNFKVNDGALILPEELYNGDSCVSLSFGELFINMRTCNYY 968
                +++ D+ R  NETDIW  F V +GAL+LPE LYN D C++LSF EL I+ R C+YY
Sbjct: 1010 YNPPLRKDDIKRKVNETDIWFTFSVWEGALLLPEVLYNSDPCIALSFKELIIDFRNCDYY 1069

Query: 969  MDVYITLYDNNLNRFEKIDPHELFEYIQTRN-RSSSVEGNISDITIHGHRMYGLPPKELT 1027
            +D+  TL   +  R  + + +++FE +     ++    G++S+I+IHGHRMYG PP   +
Sbjct: 1070 LDLLATLNGTSFKRCIRKNQNDIFELVHNNAIKNLEEHGSVSNISIHGHRMYGAPPTSPS 1129

Query: 1028 YFCQWSINIGTFLIDSDMIFLLSFIQSLNKIGFFLSNKENSLLYESDTVNDMTLLSVDVE 1087
            YF  W++++    I+SD+ F+  FI  + K+GF  SN +N LLY+   +++MT ++V   
Sbjct: 1130 YFSDWAVDVNNLSINSDIYFIRGFISYITKVGFEFSNLQNILLYDESVLDNMTSVTVHGT 1189

Query: 1088 SLKVILSDPLLEARAEIGASSIIIRNIDFENEKYTKRLDVNASEFYFSLDSLKIDSGKKN 1147
             + ++++D    A+  +    I    I+F N++Y+ R+D+     +F+         K  
Sbjct: 1190 GIDILVADKSTSAQVLLNMDGITFNRINFANDRYSSRIDLQVPGLHFAFFDNGSSMDKTC 1249

Query: 1148 ILDVRTKLNITNFFKTDNHINHLDTQRKFIGLHDSPYHRCFFLLPEKFQESSSYKELYGS 1207
            + + +TK+N TNF +  +   H   Q++FI L+DS +HRC FLL    QES  Y ELYG 
Sbjct: 1250 LFEFKTKINFTNFTQMKDGELHSKKQQEFIALNDSAFHRCSFLLLPHIQESLLYHELYGG 1309

Query: 1208 ITPSFSLPMLPIPHIYSTTNFIVEGILDDY----SEFLLSDHHNQMSINAELNSVDTT-- 1261
            ITPS S+P LPIP    T  FI++  L  +    +E L S     +S +  ++S +    
Sbjct: 1310 ITPSSSVPPLPIPVQAETIAFIIDDFLGPFGINSTELLGS-----ISTSTPIHSSNKPLK 1364

Query: 1262 PLKDSFDMQITNFQNILTTEDPYETDNFVVNVKYLTVTVNPDIVFTIEKFSTEFNKKFSM 1321
            P   S    I + Q+ L         N+++++ Y+T+ +NP + FT   +++ F  +F  
Sbjct: 1365 PPSSSVIHPIESMQSHLVPSQSVTHGNYIIDISYITLDINP-LFFT---YASNFLDEFYS 1420

Query: 1322 NN---QIDGIEMAIVNRLSDLKENISSKINVNLNVEKIDAAWGHRDVCFIGTYINMLKFE 1378
             N    IDGIEMAIVNRL    E + S  N+ L ++ +D  +G R+   +  Y++ +  E
Sbjct: 1421 ENIIETIDGIEMAIVNRLGTKSEELDSVTNIKLQIKYLDFFFGQRNTEGLELYVDQIDLE 1480

Query: 1379 LSQESTYNNNGGLQKDLTLLGKFRSVRIIIQNHSYNSFSDDRPPGLSLMLEGFEAWXXXX 1438
            +SQ++    +  +  ++ +L +F S+R  I         D+RPP LSL LEG+E W    
Sbjct: 1481 VSQKTFQKKSTVVLDEIAILSRFLSLRASINEKKVLEDFDERPPALSLALEGWEGWSSTA 1540

Query: 1439 XXXXXXXXXXXFDITVDEYQIHWLIPYVKSQILLFTKIQDSVKLIYDEQASYQKTFITSL 1498
                        DITVDE QI WLI Y+   ++   ++ +S+  I  +    QK  ++ L
Sbjct: 1541 SSQVNSLNISSTDITVDESQIEWLIDYLNRLVVFVHELVNSLDSIQKKSNGIQKKLVSDL 1600

Query: 1499 IWAGEKYQIDHDPYVITKPATVLRLSAWHIRENRSWRIVTKLRHILTYXXXXXXXXXXXX 1558
              A E YQI HDPYVITKPA V+R+S  H+R+NRSWRIVT+LRHI TY            
Sbjct: 1601 TLASEYYQISHDPYVITKPAYVMRVSKGHVRQNRSWRIVTRLRHIYTYLPDDWEIHVQEE 1660

Query: 1559 XXIKRSGLEKEAASTFLNVFSNWRNWEVSDIEKSYIYRMIFV---EEVSKRILQNSIKVF 1615
               K      +++  FL VFSNWRNWEVSD+ +SYIY+ IF+   E  S++ LQ ++K+ 
Sbjct: 1661 MRGKDMNDVSDSSDIFLTVFSNWRNWEVSDVARSYIYKKIFLSNDETTSEKKLQTTVKLN 1720

Query: 1616 LETFYFTIYSRNYSADQNFLITKANILINNEADQVNEVDLIRKQEEIVDVVTKIGSIKFE 1675
            L + +FTIYS  Y+ D N ++TKA IL+    +      +   ++ I+++   +GSIK E
Sbjct: 1721 LNSIFFTIYSTGYAIDHNIILTKAVILLELTTETAVSPPI---EKSILNMTGSLGSIKGE 1777

Query: 1676 FTEAILKLKRDIEQIIKTSVDSKSEGDKLSI----TKFFKVNLSFIFDHIDFNGQFYNSS 1731
            F++  L+L   I    K   D KS  +  SI    + +F ++L  +F++        +++
Sbjct: 1778 FSDKFLRLLELIPDFSKEE-DIKSLTENSSIVSEKSPYFTIHLFLLFENGGLQLTMGDTT 1836

Query: 1732 LKSRMSNVNILSYFENNIESSTPSGSFVYYADRTGIALKHLNNILIDCQVRNLFASTTAE 1791
            L + +++  I +  E +  S   S S  YY  ++ + LKH  +I+ + Q+ +L   +T  
Sbjct: 1837 LSNNVTDGKISALLEKSSYSKEFSYSGAYYMKKSEMCLKHNKDIIAEFQLHHLGLISTGI 1896

Query: 1792 LHSAVNSLMINFRCSNLHFKSVPKTEIFVNAIKAIQRDVETLSAEISKAQGTTDNINTEH 1851
                   ++IN R ++LHFKS+  TE  V  I+ I      L       + TT     + 
Sbjct: 1897 YTPICPVILINLRSADLHFKSLASTEKIVKTIEDITEYSVHLYKHYDLRKYTTKPTKVDQ 1956

Query: 1852 TPSVHEKNKMQKAKPNSKNNITLSATFTNVSSEITLLHPIYLKHETNSVNISYNTINIDE 1911
             P   EK            ++ ++   + VS+E+TL+ P YL++ET  +++ +N     E
Sbjct: 1957 KP---EKINF---------DVRVACNLSKVSAELTLISPFYLRYETKQLDLYFNQNGDGE 2004

Query: 1912 LLVQVLDTDLYLNSSHTKEQYARLSYDKLELTTFLPDLNEKLIDLEISSSILKLTTSDPR 1971
            +L+ + DTD+++ S HTKEQY R SYD +++         K++ + +S+S++KLT S+PR
Sbjct: 2005 ILLSLWDTDIFVTSHHTKEQYFRFSYDDIQINCNPMSEKNKVLVVSLSASLVKLTFSEPR 2064

Query: 1972 RMLFSFLQDEKELKNSLTFLRSL-----------ESLNRKANSEDSETLFSSYEWIVNFK 2020
            R+  SFLQDE+    S   L+ L           + LN     ED+ T     +W +   
Sbjct: 2065 RIFASFLQDERITIESFQELKKLKKIFFSNAKNVKKLNNDVPKEDTPT-----KWALELN 2119

Query: 2021 SKYMGVLLPIQATYYVFELHDALSTVSNKEEPSSAVHKKFHGDLSFDHIIFLIKDQSIPH 2080
              Y G+LLPI +T++V ELH  L +++N  E    V+ +  G +S ++I+FLI D+S+P 
Sbjct: 2120 INYFGILLPIASTFFVLELHMLLGSLTNTTEEIQEVNNQISGQISLENILFLINDRSLPL 2179

Query: 2081 KFSKILDFSIKLSTHRTVNNFDRSFEIESSFFRVCLTPFSLIQTMWGXXXXXXXXXXXXD 2140
            + SK++DFSI++ST +   +   S +IESS FR+C +P SL+  +WG            D
Sbjct: 2180 RLSKLVDFSIRISTLQKTTSSYESLQIESSHFRMCFSPESLVFVLWGVKQLQNELEYYKD 2239

Query: 2141 QSTXXXXXXXXXXIDGATNSEKENVFSVRSFHILSYNFSIGWLYQDSDNTIPGLILGYNR 2200
              T              +++ +  +   RS HILSYNF IGW+  ++   IPG + GY+R
Sbjct: 2240 HKTKRQWNLSSHKTGTKSSTSESPLNYFRSIHILSYNFCIGWMLPENQKDIPGWMFGYDR 2299

Query: 2201 LFSTYEDNHGKLTLVDGFFSLANGSSGDTFYSSGDESSKFNRSYLPNIQILYWIKEIEKM 2260
            LFS YE N+GKLTL++G+ S+ N +S + F+S G+E ++ NRS+LP++QILYW+KE    
Sbjct: 2300 LFSAYEKNYGKLTLIEGYMSVTNSNSSNDFFSQGEEKNRHNRSFLPSMQILYWLKEFNSK 2359

Query: 2261 KHLFIKFHGETLDVNFFENFVNIIESTVRSIDLFQTLKREKINPLVKAKPERDEKSNSAL 2320
            K LFI+ HG+ LDV+   NFVNIIE   +S  +F+  ++ KI   ++ +   +   +   
Sbjct: 2360 KDLFIRLHGDALDVDILSNFVNIIELIFKSYQIFEDFRKSKIVQNIEKQKHHEHIKSENA 2419

Query: 2321 TNIKGPIFGKLKQVNCEFIYDGGLFRLFSNASMTNKLEPTLMIKSPKVKIMLSYDYFEKE 2380
            T         +  +NCEF Y+GG  R+FS   +     P+L + +PKV I L+Y +F+  
Sbjct: 2420 TEFVPTFLSDINSINCEFKYEGGTLRVFSVDDVEIDSTPSLELNAPKVSIYLNYKHFDDS 2479

Query: 2381 LKKHWINCLIDIEPTQNVLKSGCVPFLSDFISQIKDIVELQDVNMEENMDNNVKDPINIT 2440
             K HW+ C+IDI  + N+L S C PF+ +F+  I++I+E + V  ++++           
Sbjct: 2480 PKPHWLRCVIDIHSSHNILYSKCAPFVIEFVESIQEILENRPVEPKQSVSKIATPNRTYK 2539

Query: 2441 SLLENFDICFKLISGTQHVTLDCEPKAKINTDVGFGSFEFSILTPHLNPIDPLDISLKIN 2500
             +L  FDI F++ +  Q ++  CEP AK+  +VG  SF F I T   +  DPL ++L IN
Sbjct: 2540 RILAPFDIAFRIKAAKQMLSFSCEPSAKVQANVGLDSFLFGISTGGSSVEDPLSLTLCIN 2599

Query: 2501 DIKTSVKHQFSNEASASFEVSKLDVILIFTHPEVFGTGLVDDVKLHFNLKQFQNISIFLD 2560
             I TSV+H FS EASASF ++ +D+  IFT P ++  GL+ D+ + FN+KQ QN+ +FLD
Sbjct: 2600 KISTSVQHIFSKEASASFSLNFIDLTFIFTQPTLYCVGLISDIDIFFNMKQQQNLLLFLD 2659

Query: 2561 IWDVSKSTEKKLFKKDSNTLVDAKSSPIAQTIVNSSTLPWSFVFIATNINGDINMGSTLG 2620
            IW +S+S   +  +K          + I +T      +PW+F  I TN+N DI++G  LG
Sbjct: 2660 IWHLSESIGIRPNRKKRKHKKHKGHTQIPETPQPGKIIPWNFNIIFTNVNADIHLGPALG 2719

Query: 2621 NLALNLQRTWISTDHFHNKRQLLHLFTDNVKISSEGRLGGFVEIDDITWKLDVNYVDKYK 2680
             ++  L++TW  +D + +KRQ+L LFTD + + S GRL G ++I +  W+L+VNY D   
Sbjct: 2720 IVSAKLEKTWFISDRYLDKRQILQLFTDGMVLKSRGRLSGMLDISNAGWRLEVNYADNEL 2779

Query: 2681 FVVSPLVDLLFDVGKVSMKVAFDYHMFLISTVKDLKFHVLSEKDIDDILPDLLTVNLTCD 2740
               SP+V +  D+G V++K AFDYHMF+IS V ++ F + SE+D +  LPDLL   L C+
Sbjct: 2780 NYNSPIVAIGIDIGCVALKTAFDYHMFMISKVNNIHFRLHSERDPEGKLPDLLLTTLLCE 2839

Query: 2741 EIKVCTTALVASNILDIYNTIMRTRQDNKNSYIETLLESNNNVLKRKPLYEDILKSLNLL 2800
            EI +C+T LVASNILDIYNTI+RTRQD KNSY ETL+ESNN   +    Y DILKSLNLL
Sbjct: 2840 EISICSTTLVASNILDIYNTIIRTRQDTKNSYFETLMESNNQDTRTNIPYSDILKSLNLL 2899

Query: 2801 QTSLSANIHELNLQISPSSLYDAEVIIIRVQDVFSSTETRTGEKIKTDLEMRVYNATLSL 2860
            +T +  ++ +L LQISP SL+D EV++I + ++ + +ET + +K+KT LE++V NA+++L
Sbjct: 2900 RTDVQIDVSKLQLQISPISLFDFEVLVINIDNMSARSETTSTDKLKTRLELQVCNASVAL 2959

Query: 2861 TSFGKELTEEDIAEMSAETYISYASTLTSGRIFEIPQLTINMTTFQNADNMILQYTYSCS 2920
            ++  +EL EE + ++S   Y++YAS +  G I  IP+L + MTT+Q   +  ++YT++C 
Sbjct: 2960 STAKEELDEESVNKISVADYMTYASKIKGGTILIIPKLLVGMTTWQKVTSNTIEYTFTCK 3019

Query: 2921 FDGKVDVTWNLGPINFIKEVWATHVRSLEVRTVQFMGNHDISLENEGDTDESV---KVLS 2977
            FDGKV V WNLGP+NFIKE+WATHV+SL VR  +     + S E    + ES+       
Sbjct: 3020 FDGKVSVRWNLGPVNFIKEMWATHVKSLAVRQARIEEPVEYSSEELESSPESIYLEPAQP 3079

Query: 2978 NIEYIALEEPYIEMPQIKDLKDATPPLEWFGLNRKYFPSATHQSVIVPIQKLVNVAQKEY 3037
               Y+AL EP IEMPQIKDL+DATPP+EWFGLNRK FPS THQ+ ++ +QKLV+  +KEY
Sbjct: 3080 KFTYVALVEPSIEMPQIKDLEDATPPMEWFGLNRKKFPSFTHQTAVIVVQKLVHAVEKEY 3139

Query: 3038 AKVLGSSKE 3046
            AK++G S++
Sbjct: 3140 AKIIGHSEQ 3148

 Score =  133 bits (335), Expect = 6e-30,   Method: Compositional matrix adjust.
 Identities = 58/113 (51%), Positives = 81/113 (71%)

Query: 7   EFANVSLSQERYFSWVFLVYWILVVVATSTFVFYVAKLWGFGLTFACEWLLWKTMNIKVT 66
           +F +VSLS+E+YFSWVFLV WIL  +      FY+ +++ + LTF  +WLLW+   +K+ 
Sbjct: 6   KFVSVSLSREKYFSWVFLVTWILTCILCLLMFFYIDRVFAYSLTFILDWLLWRPYKVKIH 65

Query: 67  IESIRLSFLTGTIFFKNVCLIDQDKTISILECSVTWRYWLLNTRKSEYELNAK 119
            ESIRLS L+  I FKN+C+I ++ TISILE  + W+YWLLNTR S YEL+ +
Sbjct: 66  CESIRLSLLSARISFKNLCIITENSTISILEGKIIWQYWLLNTRVSAYELHQQ 118

 Score =  121 bits (303), Expect = 4e-26,   Method: Compositional matrix adjust.
 Identities = 65/197 (32%), Positives = 112/197 (56%), Gaps = 14/197 (7%)

Query: 299 IMRKLHLDILPLDININKGAITIGNKFTRSLLVINFTEAHGLLDYALP--DSKLDVFKNK 356
           +  +  L+  P  + + KG+I  GNKFT SLL+I++  A G++D  LP  + ++D++K K
Sbjct: 292 MYEEFQLNFYPFGLKLTKGSIIFGNKFTPSLLIISYKSAEGIVD-VLPATNPRVDLYKMK 350

Query: 357 VTFEINDIDMSIKRNIGYNPELASRFNFRAGVLTRIWSYLQLVLNLIPTGRLKTWYESLR 416
           +  +  + ++ +K NI Y  +   +  +   +L+R+W+    + +++P    +  + S  
Sbjct: 351 MKLDFQNFEIEVKPNISYEDDSKPKAFYCDSMLSRLWTKFSTLFDIMPNPLSRYIHFSRL 410

Query: 417 YK----------EDTTFVKKWDGLVLYKDSVKSSTKLGADDVDFDFANHEYAKVSNFFKA 466
           +K          ED  F KKW GL LYKD+  +      + ++FDF NHEYA+  +  KA
Sbjct: 411 HKNSLFLEDNIFEDEDFEKKWKGLSLYKDAALNRGN-PEEHIEFDFLNHEYARYCSIVKA 469

Query: 467 PQIIFSIESDIPGIVPH 483
           P++IF+ E DIPGIVP+
Sbjct: 470 PRLIFTNEYDIPGIVPY 486

 Score = 50.8 bits (120), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 22/46 (47%), Positives = 31/46 (67%)

Query: 183 KLDSLFAINCTGFEIFLYNRKRAYETIIQNFSKEEKIQFIDFLRQH 228
           +L   F   C G EIF+YN+  AYE II +FS +EKI++ +FL +H
Sbjct: 135 QLPCKFLFQCEGAEIFVYNKTSAYENIIDSFSPDEKIKYKEFLHKH 180

>SAKL0H17072g Chr8 (1498942..1507935) [8994 bp, 2997 aa] {ON} similar
            to uniprot|Q12150 Saccharomyces cerevisiae YLR087C CSF1
            Protein required for fermentation at low temperature
          Length = 2997

 Score = 1758 bits (4554), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1052/3121 (33%), Positives = 1681/3121 (53%), Gaps = 212/3121 (6%)

Query: 5    GTEFANVSLSQERYFSWVFLVYWILVVVATSTFVFYVAKLWGFGLTFACEWLLWKTMNIK 64
            G++F  + +S+E  FSWVFLV W+LVVV + + VFY  +   + +T   +W+LW+   +K
Sbjct: 4    GSQFKAIPISKENNFSWVFLVDWVLVVVLSLSVVFYFGRALAYCITILMKWVLWRRYKVK 63

Query: 65   VTIESIRLSFLTGTIFFKNVCLIDQDKTISILECSVTWRYWLLNTRKSEYELNAKADTSK 124
            + I+S+++SFL G +FFKN+ +I +D+TIS L+ S TWRYWLLN+RK+  E   K+   K
Sbjct: 64   INIQSLKISFLGGRVFFKNLTVITKDQTISFLQGSFTWRYWLLNSRKTLLEELEKSGEEK 123

Query: 125  PNGDDMLDNNTIHDRSXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXKKL 184
                 M                                                     L
Sbjct: 124  DQKSRM-----------------------------------------------------L 130

Query: 185  DSLFAINCTGFEIFLYNRKRAYETIIQNFSKEEKIQFIDFLRQHDLDDIFEEVSSEIKNC 244
               F +   GFE+F+YNR  AY+ I+++ +K++K  F  F                    
Sbjct: 131  QCRFFLESDGFELFIYNRTVAYDGILRSVAKDDKESFKKFF------------------- 171

Query: 245  NEYCNHKEGNNSAHFGSSCKSDKESASNISISGDSQEXXXXXXXXXXXXKISAHIMRKLH 304
                   EG   +   S  K + E+ ++ S                          R + 
Sbjct: 172  -------EGGEDSLHSSEEKLEDETLASDSSV--------SNVDSTNDRNFQEQDSRSML 216

Query: 305  LDILPLDININKGAITIGNKFTRSLLVINFTEAHGLLDYALPDSKLDVFKNKVTFEINDI 364
            L  LP+ + +N+GA+ +GN  T S+++I +  A G++D    + KLD++K +   + N++
Sbjct: 217  LQFLPIHLKVNRGAVLLGNTTTPSVMIIGYESAEGVVDVCQSNEKLDLYKIRYDLDFNNV 276

Query: 365  DMSIKRNIGYNPELASRFNFRAGVLTRIWS-YLQLVLNLIPTGRLKTWYESLRYKEDTTF 423
            D+ IK NI +  E   +       ++R+W  + ++    +      +  + + + +   F
Sbjct: 277  DLKIKPNISFGDENPIKSYIVHSRMSRVWKKFKKIFFERMSHYLAHSDNQKIMFVKHQQF 336

Query: 424  VKKWDGLVLYKD--------SVKSSTKLGADDVDFDFANHEYAKVSNFFKAPQIIFSIES 475
             +KW GL LY +        SV    +   +++  D  NHEYAK +   K+ ++  +   
Sbjct: 337  FEKWRGLALYSEYNVTTSDHSVGDEEEEEDENMMSDVGNHEYAKYTQILKSTKVAVTYAY 396

Query: 476  DIPGIVPHGSHPPLSKAHGPDIGNHESPPTFLIDLQLSHASIYFGSWVNRNIVDLRDLMF 535
            DIPG+VPHG+   + +  GPD+GN  +PP F +D +L  A+I +G W +R I  L+ ++ 
Sbjct: 397  DIPGMVPHGALHTMEQRDGPDVGNSGAPPEFSLDFKLYGATICYGPWAHRQIQYLQRMLC 456

Query: 536  PVISKDQKPLNKLKPGLTRVHSMFNFSVSVLDDSSIRLPTREPSKDSDFLKQYLETKDDF 595
            P++S+D  PL KL PG  R+++ FN SV +++D+  R+PTRE SKD DFLKQY E+K+  
Sbjct: 457  PIVSRDAIPLKKLTPGSRRIYTRFNLSVLMMEDALWRIPTRESSKDQDFLKQYRESKNKE 516

Query: 596  RAFGWIDLSFKKGSEFMLNIPMIPTSGGFENTLFSKFSELEVTTSVNHNLLFKSNSLNIA 655
            R FGW+D+   K ++  + + M PT  GFEN L     + E+ +SVNH++ FK+++  I+
Sbjct: 517  RPFGWLDIKLTKETDLFMTVGMCPTITGFENKLGFHLVKPEIRSSVNHDIFFKADAQTIS 576

Query: 656  ANIGYPLGWNDPVNWIFNINSKQLDIFLLREHITLLSDMIIDFSTQEPTPYELFRSFTYN 715
            A++GYPLGWN    W+F  NSKQ+  F LR+HI LLSD+ +DF +  PTPYELFR F Y 
Sbjct: 577  ADLGYPLGWNSEAQWVFQFNSKQVHTFFLRDHINLLSDIFMDFGSGIPTPYELFRPFVYR 636

Query: 716  LNLKIGGYSFYFNVNDRNIINNPLDFNENCYLSFHGDLFTSEITIPIISLAQQYVTISYE 775
                I  YS Y NVND NIINNPLDFNENCYLS HGD    + ++ + ++     T++Y 
Sbjct: 637  FEWSIDNYSIYLNVNDANIINNPLDFNENCYLSLHGDTLKIDFSVDLKTITGNSTTVNYS 696

Query: 776  IFTPMFRLFLNTPSWNTLSEFMRNKEIGRSHDFRVSGTYLIYSELDIDNVDSLTIDFESN 835
            I TP F L L+TPSW+TL EFM+NKE+GRS+DF ++G+Y  +S++D+ N+D++ I+ +S 
Sbjct: 697  IRTPEFHLQLDTPSWSTLHEFMKNKEVGRSYDFCMNGSYQFHSDVDVGNMDTILIECQSK 756

Query: 836  STVLYCFGFVIKYMMNFQANYFGSFIKFITTEEY------------SELIRNNVNDNLGS 883
             T L C GFVI+Y+MN   NYFG FI F TTEEY            +E+I +NV+D    
Sbjct: 757  YTTLQCCGFVIRYLMNINMNYFGDFIHFKTTEEYTRELQEKLETREAEVIADNVSDESSQ 816

Query: 884  INTNDLTSIEGLQKMDSITNDVEDINQ-KTIKRSDLLRTENETDIWLNFKVNDGALILPE 942
            +++    +       ++   D+ + N+   +KR+DL R ENE D+W  F V DG L+ PE
Sbjct: 817  MSSTSFVT----NDKETTEYDLHEFNEDPKVKRADLKRKENEKDVWFTFCVEDGCLVFPE 872

Query: 943  ELYNGDSCVSLSFGELFINMRTCNYYMDVYITLYDNNLNRFEKIDPHELFEYIQT-RNRS 1001
             +Y+  SC+ L F  L +++R  NYYMD+  +L    + R    +P  +F+ ++      
Sbjct: 873  NIYDCTSCIGLHFDSLDVDLRYLNYYMDLQASLSPTYIKRHSDFNPRNIFDVVRACEGLV 932

Query: 1002 SSVEGNISDITIHGHRMYGLPPKELTYFCQWSINIGTFLIDSDMIFLLSFIQSLNKIGFF 1061
               +G +S++ IH HRM+GLP  E TYFC+W   IG+  IDSD+ F    I + +KIGF 
Sbjct: 933  DGHQGFLSELNIHAHRMFGLPIIEETYFCKWDFQIGSLDIDSDIDFAKGLIGAFSKIGFG 992

Query: 1062 LSNKENSLLYESDTVNDMTLLSVDVESLKVILSDPLLEARAEIGASSIIIRNIDFENEKY 1121
              + EN L+YE     DMT L++  +S+   ++D        +    I    IDFENE+Y
Sbjct: 993  YKDYENMLIYEIIKPIDMTSLTLVTDSISFKVTDGNTNCVVALDLDKISASMIDFENERY 1052

Query: 1122 TKRLDVNASEFYFSLDSLKIDSGKKNILDV-RTKLNITNFFKTDNHINHLDTQRKFIGLH 1180
            + ++          +      S K  +  +  T L++  F +  +  NH + QR  I LH
Sbjct: 1053 SNKMSAKIPNIKLLVSE---KSSKNEVQGLFETSLDLAYFGQNRDFDNHRNLQRNHITLH 1109

Query: 1181 DSPYHRCFFLLPEKFQESSSYKELYGSITPSFSLPMLPIPHIYSTTNFIVEGIL----DD 1236
            DSPYHRC FLLP ++Q++  Y +L+G+ITP  S+P L  P I +T + I E +L     D
Sbjct: 1110 DSPYHRCAFLLPMQYQKTVLYNKLFGAITPGVSIPPLTQPVIPNTIDSIFESLLGKHYQD 1169

Query: 1237 YSEFLLSDHHNQMSINAE-----LNSVDTTPLKD--SFDMQITNFQNILTTEDPYETDNF 1289
            Y     +++  + +I  E       S  T+ LK+  S+     +++     E  +E D+F
Sbjct: 1170 YECCSDANYSKETAITEENSSFIQGSGSTSALKELSSYSQNCPSYK----LEPKFEYDSF 1225

Query: 1290 VVNVKYLTVTVNPDIVFTIEKFSTEFNKKFSMNNQIDGIEMAIVNRLSDLKENISSKINV 1349
            ++N+    + +NP     +     +F    S+++ ID  E+ IV + S      S+  N+
Sbjct: 1226 IINLGKTIIAINPSSEKCLLSIYLQFCVG-SIDDIIDANEIDIVEKFSKYFVEKSAVTNL 1284

Query: 1350 NLNVEKIDAAWGHRDVCF-IGTY------INMLKFELSQESTYN--NNGGLQ--KDLTLL 1398
             +   KI   +G     F +  Y      +N    +L Q+  +   N+  L+  +++T  
Sbjct: 1285 RVLAPKICFTFGSPKGKFEVSDYDHLYVEVNHPSLDLCQKKIFGQTNSSKLEYTEEVTSS 1344

Query: 1399 GKFRSVRIII--QNHSYNSFSDDRPPGLSLMLEGFEAWXXXXXXXXXXXXXXXFDITVDE 1456
             K  S+   I  Q     +    RP   S++ E  E W                D  V+ 
Sbjct: 1345 LKASSINFFINQQQLKPKTLLKARPV-FSIVFEELEFWSDSSESSKNSLNARAVDFFVNH 1403

Query: 1457 YQIHWLIPYVKSQILLFTKIQDSVKLIYDEQASYQKTFITSLIWAGEKYQIDHDPYVITK 1516
             Q+ WL  Y+++ IL  TK+  S         + QK  I     A  +Y I HD  VITK
Sbjct: 1404 SQLEWLSDYLRAVILCATKLFASFSKSKTLIQARQKELIFRTALASVEYNIIHDSPVITK 1463

Query: 1517 PATVLRLSAWHIRENRSWRIVTKLRHILTYXXXXXXXXXXXXXXIKRSGLEKEAASTFLN 1576
            PA + RLS  HIRENRSWRI+T+LRHIL Y               +   +  +A   FL 
Sbjct: 1464 PAYITRLSKNHIRENRSWRIITRLRHILNYLPKSWYKRTEESLKKEEFKIPDDARDQFLK 1523

Query: 1577 VFSNWRNWEVSDIEKSYIYRMIFVEEVSK--RILQNSIKVFLETFYFTIYSRNYSADQNF 1634
            +FSNWR+WE SD++K YIY+ +F+    K  RI     KV LE   F++ S  +  D++F
Sbjct: 1524 IFSNWRSWEFSDVQKCYIYKRVFLSRSMKKNRITGADFKVNLERISFSLSSSTHE-DEDF 1582

Query: 1635 LITK-ANILINNEADQVNEVDLIRKQE-----EIVDVVTKIGSIKFEFTEAILKLKRDIE 1688
            ++ K    +I+NE  + +     +  E     E + +   I SI+ +  + I+KL R  +
Sbjct: 1583 MVVKNLKSVISNELIESSLPPSAKNTEDSASTEKMIISCNIKSIRGDLGDNIVKLVRMYD 1642

Query: 1689 QIIKTS-VDSKSEGDKLSITKFFKVNLSFIFDHIDFNGQFYNSSLKSRMSNVNILSYFEN 1747
             +   S  + K+   K  +     +    + D  D N       L  R       ++ E 
Sbjct: 1643 GLSNLSDTNLKTTSVKHDVKPKL-IQGVLLVDRTDTNIHLDGKRLILRSFRNRFSTFMER 1701

Query: 1748 NIESSTPSGSFVYYADRTGIALKHLNNILIDCQVRNLFASTTAELHSAVNSLMINFRCSN 1807
                S    S       +   ++H + +L++  +++   + +  L        +  R   
Sbjct: 1702 VPSKSETKVSLAATCASSEAWVRHGSAVLLESSLKDGALNFSQSLFHEHLITKVVLRSGG 1761

Query: 1808 LHFKSVPKTEIFVNAIKAIQRDVETLSAEISKAQGTTDNINTEHTPSVHEKNKMQKAKPN 1867
            L   ++  TE +++ I +I+  V+ +  E++ A    +N     T          K + +
Sbjct: 1762 LSVSAMASTEQYIHFIWSIKASVDGIRKELASAIPKKNNTTISTT----------KPETS 1811

Query: 1868 SK-NNITLSATFTNVSSEITLLHPIYLKHETNSVNI---SYNTINIDELLVQVLDTDLYL 1923
            S+ N +TL AT +  S  I  L P  +   T+S+ +    ++ +N D   + + D D+ L
Sbjct: 1812 SRLNTVTLDATLSGFSLNIQPLTPFGIHQSTDSIEVHVEKHHQLNAD---ITIRDIDIEL 1868

Query: 1924 NSSHTKEQYARLSYDKLELT-TFLPDLNEKLIDLEISSSILKLTTSDPRRMLFSFLQDEK 1982
             S+ +K++Y + S   + L  +  P+ N   +++ ++S I KLT SDPR  ++S ++DE 
Sbjct: 1869 LSTRSKQRYLKFSQSTVNLVISNTPEQNAMFLNVGVASGISKLTVSDPREFIYSLVEDET 1928

Query: 1983 ELKNSLTFLRSL-ESLNRKANSEDSETLFSSYEWIVNFKSKYMGVLLPIQATYYVFELHD 2041
                +   L+SL E    K   +  +   ++  W+++   +Y+G+++ + +  YV EL++
Sbjct: 1929 LAIKNFAQLKSLAEKFPSKNQEKSKQRKQTNIIWLLHVNVEYIGIIVLLGSAGYVLELNN 1988

Query: 2042 ALSTVSNKEEPSSAVHKKFH---GDLSFDHIIFLIKDQSIPHKFSKILDFSIKLSTHRTV 2098
             L+++SN       + +  H   GD S ++++ LI    +  + SK++D ++ L   +  
Sbjct: 1989 VLTSLSNNISARKYLEQGLHGIVGDFSIENVLLLIHANRLKGELSKLVDLAVNLKVSQEE 2048

Query: 2099 NNFDRSFEIESSFFRVCLTPFSLIQTMWGXXXXXXXXXXXXDQSTXXXXXXXXXXIDGAT 2158
             +  ++ +IESS FRV L P SL + +W              +S+              T
Sbjct: 2049 GDDLQNIQIESSHFRVALCPMSLTKVLWAINEFTRVSEAYKTRSSLLQHKKT-----APT 2103

Query: 2159 N-SEKENVFSVRSFHILSYNFSIGWLYQDSDNTIPGLILGYNRLFSTYEDNHGKLTLVDG 2217
            + SE  N F  RS  ILSYNF IGW++     T PGLI GY RLF+ Y+  +GKLTL+D 
Sbjct: 2104 DISELSNKF--RSIQILSYNFCIGWIFDAGSETDPGLIWGYERLFAAYQKPYGKLTLLDA 2161

Query: 2218 FFSLANGSSGDTFYSSGDESSKFNRSYLPNIQILYWIKEIEKMKHLFIKFHGETLDVNFF 2277
            +FS+A+G+S DTF+S+G E  +FNRSYLP++QI YW  +     +LF++  GE LDVNF 
Sbjct: 2162 YFSIAHGASSDTFFSNGKEKDQFNRSYLPSMQIGYWFVKEGDTSNLFVRITGERLDVNFL 2221

Query: 2278 ENFVNIIESTVRSIDLFQTLKREKINPLVKAK-PERDEKSNSALTNIKGPIFGKLKQVNC 2336
             + + I    V+SI  FQ LK+  ++P    K  E+   S +A  +   PI  K++  NC
Sbjct: 2222 SSSIGIANGAVKSIQTFQELKKTMVDPFATNKTTEKPVNSEAAPLD---PILSKIRAFNC 2278

Query: 2337 EFIYDGGLFRLFSNASMTNKLEPTLMIKSPKVKIMLSYDYFEKELKKHWINCLIDIEPTQ 2396
               Y GG+F+LFS   + N  +P+  ++SP V++ + Y +    +K HWI  L+ ++P+ 
Sbjct: 2279 IVKYAGGVFKLFSEEDIQNNSKPSFEVESPSVEVAIDYKHLPDVIKSHWIRGLVTVDPSN 2338

Query: 2397 NVLKSGCVPFLSDFISQIKDIVELQDVNMEENMDNN---VKDPINITSLLENFDICFKLI 2453
            N L   CVP LS     ++++  L+  N +   D N       +N   LL  FDI F + 
Sbjct: 2339 NTLFPTCVPILSGMTKDVRNM--LKSFNSKPKPDRNSTISSSGMNYKKLLRAFDIAFLVN 2396

Query: 2454 SGTQHVTLDCEPKAKINTDVGFGSFEFSILTPHLNPIDPLDISLKINDIKTSVKHQFSNE 2513
             G Q ++L CEPKAK+  DVGF      + T +L+  +PL +S+ I  ++ + +H FS E
Sbjct: 2397 IGKQGISLSCEPKAKVQADVGFEKLAVKMFTNNLDNSEPLSLSIDIEHLRATSRHIFSRE 2456

Query: 2514 ASASFEVSKLDVILIFTHPEV---FGTGLVDDVKLHFNLKQFQNISIFLDIWDVSKSTEK 2570
             S SF++  +D + + THPE+   +GT LV DV+++FN+KQ Q++++FLDIW     ++ 
Sbjct: 2457 VSTSFQIDHIDAVFVLTHPEIIQTYGTTLVSDVQIYFNMKQLQDLNLFLDIW--KPDSQI 2514

Query: 2571 KLFKKDSNTLVDAKSS----PIA--QTIVNSSTLPWSFVFIATNINGDINMGSTLGNLAL 2624
                K  NT   + SS    P++  Q    ++  PW++  I +NI GDI++G +LG L++
Sbjct: 2515 LEMPKGGNTRTRSLSSHDKLPVSKFQKPAGTNAFPWNYTLIFSNIKGDIDLGPSLGVLSV 2574

Query: 2625 NLQRTWISTDHFHNKRQLLHLFTDNVKISSEGRLGGFVEIDDITWKLDVNYVDKYKFVVS 2684
               R+W  +DHF + RQ L +F +N+ +SS+GRLGGF+ I+ + W  ++++  K  F  +
Sbjct: 2575 RNNRSWAISDHFVDWRQRLSVFLENILLSSDGRLGGFLGIERVCWSSEISWPVKGGFYET 2634

Query: 2685 PLVDLLFDVGKVSMKVAFDYHMFLISTVKDLKFHVLSEKDIDDILPDLLTVNLTCDEIKV 2744
            PL+ L  ++G +++K +FDYHMFLI+ V+ L   + +E+D   IL DLL V++TC +I +
Sbjct: 2635 PLISLSLELGSLALKTSFDYHMFLIANVEHLLLKLYNERDEMGILKDLLAVSVTCGKIHL 2694

Query: 2745 CTTALVASNILDIYNTIMRTRQDNKNSYIETLLESNNNVLKRKPLYEDILKSLNLLQTSL 2804
              TAL ++N +DIYNTI+R RQDNKNSYIETL +SN    K K   +++L+SL+LL+T L
Sbjct: 2695 FLTALASANAIDIYNTIIRMRQDNKNSYIETLKDSNTQSTKSKRQNQNVLESLSLLRTDL 2754

Query: 2805 SANIHELNLQISPSSLYDAEVIIIRVQDVFSSTETRTGEKIKTDLEMRVYNATLSLTSFG 2864
            S  I    LQ+ PS+L+D EV++++ +D+ + T+T+   K+KT L  +++N  +SL++F 
Sbjct: 2755 SVGIDLFYLQVFPSTLFDMEVLVLKAEDMSAHTQTQGDHKVKTRLNWQLHNFKVSLSAFK 2814

Query: 2865 KELTEEDIAEMSAETYISYASTLTSGRIFEIPQLTINMTTFQNADNMILQYTYSCSFDGK 2924
             +  EE ++++  + YI +A+ +  G I   P + ++MTT+Q   + +++  Y+ SF GK
Sbjct: 2815 NQFNEEIVSQIEVKEYIKHATKVRGGTILAAPAILVDMTTWQEVSSNVIELLYTSSFGGK 2874

Query: 2925 VDVTWNLGPINFIKEVWATHVRSLEVRTVQFMGNHDISLENEGDTDESVK---VLSNIEY 2981
            VDV WNLGPINFI+E+WATHVR+L +R V  M + + S   +   +E +K   + +   Y
Sbjct: 2875 VDVKWNLGPINFIREMWATHVRALALRRVHDMRDKNKSFFEDEHIEEKIKDVDLGNKYVY 2934

Query: 2982 IALEEPYIEMPQIKDLKDATPPLEWFGLNRKYFPSATHQSVIVPIQKLVNVAQKEYAKVL 3041
            I LEEP IEMPQIKDL DATPP+EWFG+NR+ FP  THQSV+VP+QKL ++A++EYA+VL
Sbjct: 2935 IPLEEPRIEMPQIKDLGDATPPVEWFGVNRQRFPGLTHQSVVVPLQKLAHMAEEEYARVL 2994

Query: 3042 G 3042
            G
Sbjct: 2995 G 2995

>KLTH0G13728g Chr7 (1175228..1184128) [8901 bp, 2966 aa] {ON} similar
            to uniprot|Q12150 Saccharomyces cerevisiae YLR087C CSF1
            Protein required for fermentation at low temperature
          Length = 2966

 Score = 1507 bits (3902), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 933/2928 (31%), Positives = 1550/2928 (52%), Gaps = 149/2928 (5%)

Query: 182  KKLDSLFAINCTGFEIFLYNRKRAYETIIQNFSKEEKIQFIDFLRQHDLDDIFEEVSSEI 241
            +KL   F + C G E F+YN+ +A++ I+ +  +E+  +F DF         F++ S   
Sbjct: 123  EKLPCRFRVECQGLEHFIYNKTQAFDNILNSLPREDLERFKDF---------FQDNSD-- 171

Query: 242  KNCNEYCNHKEGNNSAHFGSSCKSDKESASNISISGDSQEXXXXXXXXXXXXKISAHIMR 301
            KN +E                C  D++SA   S    S                 +    
Sbjct: 172  KNTDE----------------CSVDEDSAGQRSHLETSTSSPSSKSKSLNDRSFQSPDST 215

Query: 302  KLHLDILPLDININKGAITIGNKFTRSLLVINFTEAHGLLDYALPDSKLDVFKNKVTFEI 361
               L +LPL+ ++ KGA+ IGNK + S++V+++ +  G+LD  LPDSK+D++K KV  E 
Sbjct: 216  PPFLKLLPLEYSVQKGAVVIGNKTSSSVMVLSYEKLDGVLDTCLPDSKIDLYKIKVRNEF 275

Query: 362  NDIDMSIKRNIGYNPELASRFNFRAGVLTRIW--SYLQLVLNLIPTGRLKTWYESLRYKE 419
                +S+K N+    E   +   +   L+++W  SY        P+ +           +
Sbjct: 276  RKFHISLKPNLSLESENPLKSFVKRSKLSKLWHRSYQLFFKTDSPSSK-----NPANSAK 330

Query: 420  DTTF--VKKWDGLVLYKDSVKSSTKLGADDVDFDFANHEYAKVSNFFKAPQIIFSIESDI 477
            D T   +K+W GL LY    K       D   FD + HEYA+ +   K   ++     D 
Sbjct: 331  DGTRNPLKRWRGLGLY---WKEEDAAWDDRFQFDLSKHEYARYTKVMKCDNMLLEYAFDA 387

Query: 478  PGIVPHGSHPPLSKAHGPDIGNHESPPTFLIDLQLSHASIYFGSWVNRNIVDLRDLMFPV 537
            PGIVPHG+ P      GPD+GN   PP + ID+Q+S AS+Y+G W +  I+ L+ L  PV
Sbjct: 388  PGIVPHGALPTFQTVDGPDVGNSGPPPDYSIDIQISGASLYYGPWSHHEIMPLQKLFSPV 447

Query: 538  ISKDQKPLNKLKPGLTRVHSMFNFSVSVLDDSSIRLPTREPSKDSDFLKQYLETKDDFRA 597
            +S+D +P+ +L PG  R+++    S+ ++ +S  R+PTRE SKD +FLK++ ET+D+ R 
Sbjct: 448  VSRDSQPVEQLTPGSKRIYTRLRLSILIVGESVWRIPTREASKDLEFLKRFRETEDETRP 507

Query: 598  FGWIDLSFKKGSEFMLNIPMIPTSGGFENTLFSKFSELEVTTSVNHNLLFKSNSLNIAAN 657
            FGW+++S  +GSE   NI M PT+ GF+NTL   F + E+ TSVNH++L  + + ++ A 
Sbjct: 508  FGWLEVSLSEGSEVRFNIAMCPTATGFDNTLDLHFVKPEIRTSVNHDILLSAQTHSMHAT 567

Query: 658  IGYPLGWNDPVNWIFNINSKQLDIFLLREHITLLSDMIIDFSTQEPTPYELFRSFTYNLN 717
            +GYPLGWN    W+F+  S Q  IF+L++HITLL D+I DF + EPTPYELFR F+Y  N
Sbjct: 568  MGYPLGWNKKAEWVFDSVSNQCQIFILKDHITLLGDIISDFGSGEPTPYELFRPFSYTFN 627

Query: 718  LKIGGYSFYFNVNDRNIINNPLDFNENCYLSFHGDLFTSEITIPIISLAQQYVTISYEIF 777
                GYS Y NVND NI+NNP++FNENCYLSFHGD       +P  ++A     I+YE+F
Sbjct: 628  WNFTGYSIYLNVNDANIVNNPVNFNENCYLSFHGDDLRLNFEVPQENIAGNSTKINYELF 687

Query: 778  TPMFRLFLNTPSWNTLSEFMRNKEIGRSHDFRVSGTYLIYSELDIDNVDSLTIDFESNST 837
            TP+FRL +NTPSWNTL EFM++KE+GRS +F +SG+YL +S+LD+DN+D++ I+  S ST
Sbjct: 688  TPLFRLNMNTPSWNTLHEFMKDKEVGRSANFSLSGSYLFHSKLDVDNIDTIIIECCSKST 747

Query: 838  VLYCFGFVIKYMMNFQANYFGSFIKFITTEEYSELIRNNVNDNLGSINTNDLTSIEGLQK 897
             L C+G+V++Y +  + NYFG F+ F TTEEY E +R   N    + + ++    E  ++
Sbjct: 748  TLKCYGYVLRYFLGVKMNYFGDFVHFKTTEEYMEELR-GTNAVTKTTHDSETEIQEAPKQ 806

Query: 898  MDSITNDVED--INQKTIKRSDLLRTENETDIWLNFKVNDGALILPEELYNGDSCVSLSF 955
            MD  ++  E    +  T K++ L R  NE D+W  F V DG  ILPE LY+ DSC +L F
Sbjct: 807  MDEDSSQREQHIKDPLTAKKTSLKRMVNEKDVWFTFVVEDGCFILPENLYDCDSCYALEF 866

Query: 956  GELFINMRTCNYYMDVYITLYDNNLNRFEKIDPHELFEYIQTRNRSSSVEGNISDITIHG 1015
              L I++R  NYYMD+   L    + R       E+FE          V G +S + IH 
Sbjct: 867  DSLDIDLRHINYYMDMQAALSPLRIRRLIDCGCEEVFEQKGRALCGELVAGRLSRLHIHT 926

Query: 1016 HRMYGLPPKELTYFCQWSINIGTFLIDSDMIFLLSFIQSLNKIGFFLSNKENSLLYESDT 1075
            HRM+GLPP E TYFC+W  ++GT  + SD+ F L FI +  K+GF   + EN + Y+   
Sbjct: 927  HRMFGLPPAEETYFCKWDFSLGTLDLSSDLPFTLGFINAWKKLGFGFRDYENIMNYKVAP 986

Query: 1076 VNDMTLLSVDVESLKVILSDPLLEARA-EIGASSIIIRNIDFENEKYTKRLDVNASEFYF 1134
            + DMT +++ ++++ V  +D + +  A ++ A  I  +  D EN  Y+ R+D++ +    
Sbjct: 987  ILDMTSVTLAIDAI-VFCTDKIKDETAIQLNAQDISAKFADLENSLYSSRVDLDVANLTA 1045

Query: 1135 SLDSLKIDSGKKN--ILDVRTKLNITNFFKTDNHINHLDTQRKFIGLHDSPYHRCFFLLP 1192
            S+    ID  K N  I    T + I+NF +  + + H   Q+  I  +D+P+HRC FL+P
Sbjct: 1046 SI----IDKNKSNKAIASFMTSIKISNFCQLQDLLAHSQQQKVHIASNDAPFHRCPFLIP 1101

Query: 1193 EKFQESSSYKELYGSITPSFSLPMLPIPHIYSTTNFIVEGILDDYSEFLLSDHHNQMSIN 1252
               Q SS YK L+G I P  S+P L +P        + +G L   +E    D  ++    
Sbjct: 1102 LTLQNSSDYKGLFGCIPPGVSIPSLAVPLQTENVKAVFQGYLK--AENASKDFVDRWFPV 1159

Query: 1253 AELNSVDTTPLKDSFDMQITNFQNILTT-----EDP-YETDNFVVNVKYLTVTVNPDIVF 1306
             E+ + +++ LKD F  Q+    +  T+      DP +E +  VVN++   ++++P+   
Sbjct: 1160 NEVKNKNSSSLKD-FKGQLQPILDDNTSLSSSFSDPTFEHNTLVVNLENSRLSISPECYE 1218

Query: 1307 TIEKFSTEFNKKFSMNNQIDGIEMAIVNRLSDLKENISSKINVNLNVEKIDAAWGHRDVC 1366
             I     + +KK  +   ID IE+ +V     +     +  N+ + +  +D  +   +  
Sbjct: 1219 VIGNAVEQCHKKL-IEQFIDNIELDVVLHFIKMASRQKNYKNIRVLMPTLDVLFETYNKE 1277

Query: 1367 FIGTYINMLKFELSQES-TYNNNGGLQ--------KDLTLLGKFRSVRIIIQNH--SYNS 1415
                    +K   +Q S  ++   GL+        +D T L K  S+ + + N       
Sbjct: 1278 NTYDVEGQVKVTANQVSLDWSLKKGLKLPGSDNDPEDTTSLLKIESLDLEVFNKLDKKTK 1337

Query: 1416 FSD-DRPPGLSLMLEGFEAWXXXXXXXXXXXXXXXFDITVDEYQIHWLIPYVKSQILLFT 1474
            F++ D        ++  EAW                + +V   + +WLI +++       
Sbjct: 1338 FAEMDENIAFGCSVKELEAWSYLNGIADSSLYLKSINASVALDKFNWLIDFMRKAFNDSK 1397

Query: 1475 KIQDSVKLIYDEQASYQKTFITSLIWAGEKYQIDHDPYVITKPATVLRLSAWHIRENRSW 1534
            ++ + +     +    ++ F   +  A ++YQI HDP VITKPA + RL + H+RE+RSW
Sbjct: 1398 QLINRLSYCTGQFRKAEQEFFYRISKASDEYQITHDPPVITKPAYITRLPSQHVRESRSW 1457

Query: 1535 RIVTKLRHILTYXXXXXXXXXXXXXXIKRSGLEKEAASTFLNVFSNWRNWEVSDIEKSYI 1594
            +IVT+LRHIL Y                       A  TFL +FSNW NW+ SD+EK Y+
Sbjct: 1458 KIVTRLRHILNYLPTTLISDIFNDLKNSEYPPRSTAEETFLEIFSNWGNWDYSDVEKCYM 1517

Query: 1595 YRMIFVEEVSKRIL-QNSIKVFLETFYFTIY-SRNYSADQNFLIT-KANILINNEADQVN 1651
            YR +F   +   +  ++S K+   TF    + S N  +D   L   KA   +    D+  
Sbjct: 1518 YRRVFTNTLDDTVAHESSTKIETGTFMLNFFDSINTGSDSVILKNLKAQRTLEACKDEAA 1577

Query: 1652 E--VDLIRKQEEIVDVVTK-IGSIKFEFTEAILKLKRDIEQIIKTSVDSKS--EGDKLSI 1706
            E   ++   ++++ + ++  I   +   ++  L     + ++     +  +  E +KL  
Sbjct: 1578 EKRSNMSNAEDDLEERLSCIINKAQISLSDGTLIKLLSVRELFTFEAEHAAVKENEKLPA 1637

Query: 1707 TKFFKVNLSFIFDHIDFN--GQFYNSSLKSRMSNVNILSYFENNIESSTP-SGSFVYYAD 1763
             + +      + D  D         ++LKS  + + I+   EN  E +   S +F +   
Sbjct: 1638 FQQYTA----LVDRCDIQLLCGANRANLKSFGNTLTIVR--ENKSEDADAFSTAFAWSWF 1691

Query: 1764 RTGIALKHLNNILIDCQVRNLFASTTAELHSAVNSLM-INFRCSNLHFKSVPKTEIFVNA 1822
              GI  +H N IL+D   R+  ++  A   S  NS   ++ R      K   +++ +   
Sbjct: 1692 EFGI--RHRNTILLDAFSRS--SAVGAHGFSGKNSRRKLDLRAKKFRLKLPSESKHYCTF 1747

Query: 1823 IKAIQRDVETLSAEISKAQGTTDNINTEHTPSVHEKNKMQKAKPNSKNNITLSATFTNVS 1882
            I +++     L   +    G  +  ++  T         +K  P    NI +S    +++
Sbjct: 1748 IDSLEESWNNLRLALGPNTGFLEKPHSAAT---------EKVAPQFALNIDIS----DLT 1794

Query: 1883 SEITLLHPIYLKHETNSVNISY--NTINIDELLVQVLDTDLYLNSSHTKEQYARLSYDKL 1940
            ++I+LL  + +      + ++Y  +  +  +L  + LD D++  S+ T +QY ++S   +
Sbjct: 1795 TDISLLSSLAITKNFKKLTLAYEQSASSALKLAFETLDIDVF--STRTTQQYLKISQSNI 1852

Query: 1941 ELTTFLPDL-NEKLIDLEISSSILKLTTSDPRRMLFSFLQDEKELKNSLTFLRS----LE 1995
              +   P   N     +++ S+I KL   DPR +     +D  + K  L  L+S    L 
Sbjct: 1853 SFSLHRPKKNNASPPTVKLDSNITKLKLYDPRDITLPLGKDIAQAKACLASLKSCFGKLN 1912

Query: 1996 SLNRKANSEDSETLFS-SYEWIVNFKSKYMGVLLPIQATYYVFELHDALSTVSNKE---E 2051
            + N K       T F+ S  WI   +  Y+G+L+P+ +T Y+ EL++  + ++  E   +
Sbjct: 1913 TKNDKDIMSQGNTKFNFSASWIFQVRLNYVGLLIPLGSTSYITELNEISAFITADEFTNK 1972

Query: 2052 PSSAVHKKFHGDLSFDHIIFLIKDQSIPHKFSKILDFSIKLSTHRTVNNFDRSFEIESSF 2111
             S        GDLS   I FLI D+ +P   S+++DF++ +   +      RS +IES +
Sbjct: 1973 ASENSQGALRGDLSAASIAFLINDRMLPEALSRVVDFAVSIKIAKESEEVIRSLQIESPY 2032

Query: 2112 FRVCLTPFSLIQTMWGXXXXXXXXXXXXDQSTXXXXXXXXXXIDGATNSEKENVF----S 2167
            FR+ L+PFSL++ ++              Q+                + E    F    +
Sbjct: 2033 FRIALSPFSLVRILFLVNELSRLSELQKRQTVGKL----------PESVEVRETFRFRRA 2082

Query: 2168 VRSFHILSYNFSIGWLYQDSDNTIPGLILGYNRLFSTYEDNHGKLTLVDGFFSLANGSSG 2227
             RS  +LSYNF +GW++  +D+  PGLI GY RLF+ +E  +GKLTL+D +FS+A GS+ 
Sbjct: 2083 FRSVQVLSYNFCLGWIFDVNDSPEPGLIWGYQRLFAAHEKPYGKLTLLDAYFSIAEGSTS 2142

Query: 2228 DTFYSSGDESSKFNRSYLPNIQILYWIKEIEKMKHLFIKFHGETLDVNFFENFVNIIEST 2287
            D FY+  +     NRS+LP++QI YWI+       LFI+ +GE LDV F    +++    
Sbjct: 2143 DDFYAHKNSFENPNRSFLPSMQIRYWIESKGLTDELFIRINGERLDVRFLSKSIDVAGGL 2202

Query: 2288 VRSIDLFQTLKREKINPLVK-AKPERDEKSNSALTNIKGPIFGKLKQVNCEFIYDGGLFR 2346
            ++S+++F  LK++ ++P    A P+R   ++   T  K P    +++V+C+  Y GG+FR
Sbjct: 2203 MKSLNMFDELKKQYVDPFKSVANPKRPSATS---TFSKFPGLSTIQRVDCKVQYAGGVFR 2259

Query: 2347 LFSNASMTNKLEPTLMIKSPKVKIMLSYDYFEKELKKHWINCLIDIEPTQNVLKSGCVPF 2406
            L+S   + N+  P+  ++SP V+I+  Y         H +   + +  + N +   CVP 
Sbjct: 2260 LYSLDDVQNEAGPSFQLESPSVEILFDYRRMVHGKHSHILRAWMIVYSSHNTIFPTCVPV 2319

Query: 2407 LSDFISQIKDIVELQDVNMEENMDNNV-KDPINITSLLENFDICFKLISGTQHVTLDCEP 2465
            L++    I+ +++  + + +E    +V ++ ++  S L   DI F +  G Q ++  CEP
Sbjct: 2320 LNEMARDIRQLLKGFNRSPQEASHKSVSQESLDYRSFLRGTDISFLIDIGKQQISFSCEP 2379

Query: 2466 KAKINTDVGFGSFEFSILTPHLNPIDPLDISLKINDIKTSVKHQFSNEASASFEVSKLDV 2525
            KAK+  D+GF      + T  L+  +PL +S+ I +I    +H FS E S S ++ +L  
Sbjct: 2380 KAKVQADLGFEKLAVKVFTNDLDMSEPLSLSIDIYEITAKSRHIFSREVSTSIKIDQLSW 2439

Query: 2526 ILIFTHPE---VFGTGLVDDVKLHFNLKQFQNISIFLDIW--DVSKSTEKKLFKKDSNTL 2580
            I I THP+    +G   + ++ ++FN+KQ Q+++IF++IW  D    T+ +L  + S  L
Sbjct: 2440 IFILTHPDTIHTYGIMHIPNIDVYFNIKQLQDLNIFVNIWKPDSYVFTQPELDSEHSRAL 2499

Query: 2581 VDAKSSPIA--QTIVNSSTLPWSFVFIATNINGDINMGSTLGNLALNLQRTWISTDHFHN 2638
               +   +A  + + ++++ PW+F+ I + I GDI++G +LG L+L   R W  TDH+ +
Sbjct: 2500 TSEEKPLVAKFKKVSSTTSFPWNFILIISKIKGDIDLGISLGVLSLTTDRIWAITDHYSD 2559

Query: 2639 KRQLLHLFTDNVKISSEGRLGGFVEIDDITWKLDVNYVDKYKFVVSPLVDLLFDVGKVSM 2698
              Q L L  + + +SS+GRLGG + + + +W   + +  +     SPLV L   + +  +
Sbjct: 2560 WTQKLSLQMEKILLSSDGRLGGTLLLRNFSWMSRIRWPVREGVFESPLVTLDVLLDEFDL 2619

Query: 2699 KVAFDYHMFLISTVKDLKFHVLSEKDIDDILPDLLTVNLTCDEIKVCTTALVASNILDIY 2758
            K++FDYH+ LI++V+ LK  + +++D   I  +LL+V ++ +  ++  TAL  +NILD+Y
Sbjct: 2620 KLSFDYHLILIASVEVLKLKLFNKRDPRGISRNLLSVAISSNSTQLFLTALAPANILDVY 2679

Query: 2759 NTIMRTRQDNKNSYIETLLESNNNVLKRKPLYEDILKSLNLLQTSLSANIHELNLQISPS 2818
            NTI+R R+DN+ SY ETL +SN    +     +DIL SL+ L+T L  ++  +++QI PS
Sbjct: 2680 NTILRMRKDNRKSYFETLGDSNTKDTRSASTSKDILNSLSFLRTELEVSLKFVHIQIYPS 2739

Query: 2819 SLYDAEVIIIRVQDVFSSTETRTGEKIKTDLEMRVYNATLSLTSFGKELTEEDIAEMSAE 2878
             L+D EV+  + +D  + ++    EK+KT L+ +++   ++L+ F  +L E+  +++  +
Sbjct: 2740 KLFDMEVLTFKAKDFLTQSQIEGDEKLKTHLKWQIHGVKIALSRFKNQLHEKAASQIGVK 2799

Query: 2879 TYISYASTLTSGRIFEIPQLTINMTTFQNADNMILQYTYSCSFDGKVDVTWNLGPINFIK 2938
             YI +A     G I  IP + I MTT+ +     ++  YS SF GK+ + WNLG INF++
Sbjct: 2800 EYIEHARKADGGTILVIPAILIGMTTWHDVATNTVELLYSNSFGGKIGIRWNLGSINFLR 2859

Query: 2939 EVWATHVRSLEVRTVQFMGNHDISLENEGDTDE--SVKVLSNIEYIALEEPYIEMPQIKD 2996
            E+WATHVR++ +R     G      E+E   ++   V +    EY+ LEEP+IE+PQ KD
Sbjct: 2860 EMWATHVRAMALRRSH-NGQPRGFFEDEHLEEKLRDVDLGDEYEYVPLEEPHIEIPQTKD 2918

Query: 2997 LKDATPPLEWFGLNRKYFPSATHQSVIVPIQKLVNVAQKEYAKVLGSS 3044
            L +ATPP+EWFG+NRK FP  THQ++IVP+QKL ++A+ E+A++LG +
Sbjct: 2919 LGEATPPVEWFGVNRKQFPGLTHQAMIVPLQKLAHIAETEWARILGRA 2966

 Score =  125 bits (314), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 55/117 (47%), Positives = 83/117 (70%), Gaps = 3/117 (2%)

Query: 4   LGTEFANVSLSQERYFSWVFLVYWILVVVATSTFVFYVAKLWGFGLTFACEWLLWKTMNI 63
           + ++F  VSLS    FSWVFLV W+L++  +    FY  +++G+ LTF  EWL WK   +
Sbjct: 1   MASQFKRVSLSTNEDFSWVFLVDWVLILSVSLLGAFYFGRVFGYTLTFLLEWLAWKRYKV 60

Query: 64  KVTIESIRLSFLTGTIFFKNVCLIDQDKTISILECSVTWRYWLLNTRKSEYELNAKA 120
           K++I+S+++SFL G IFFKN+ ++ Q++T S L+ S+TWRYWLLN+RK+ +   AKA
Sbjct: 61  KISIQSLKISFLGGRIFFKNLTVVTQNQTFSFLQGSITWRYWLLNSRKTAF---AKA 114

>Kwal_YGOB_56.23808 s56 (712095..712280,712384..721023) [8826 bp, 2941
            aa] {ON} ANNOTATED BY YGOB -
          Length = 2941

 Score = 1491 bits (3861), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 945/2938 (32%), Positives = 1535/2938 (52%), Gaps = 181/2938 (6%)

Query: 183  KLDSLFAINCTGFEIFLYNRKRAYETIIQNFSKEEKIQFIDFLRQHDLDDIFEEVSSEIK 242
            KL   F I C G E F+YNR +A++ I+ +  +E++     F       D     + E  
Sbjct: 109  KLPCRFRIECQGLEHFIYNRTQAFDNILSSLPREDQENVKKFF-----SDPSPRATEETS 163

Query: 243  NCNEYCNHKEGNNSAHFGSSCKSDKESASNISISGDSQEXXXXXXXXXXXXKISAHIMRK 302
              N+    K     +H  +S  S   SAS  S++  + +                     
Sbjct: 164  TENDSAAQK-----SHLETSMSS--PSASTESLNDRTYQLPNSMPS-------------- 202

Query: 303  LHLDILPLDININKGAITIGNKFTRSLLVINFTEAHGLLDYALPDSKLDVFKNKVTFEIN 362
              L +LPL+ ++ KGA+ IGNK T S++V +F +  G LD   PD+K+D++K K+  +I 
Sbjct: 203  -FLRLLPLEYSVQKGALIIGNKKTSSVMVSSFEKLKGHLDACAPDTKIDLYKIKLQSDIT 261

Query: 363  DIDMSIKRNIGYNPELASRFNFRAGVLTRIW-SYLQLVLNLIPTGRLKTWYESLRYKEDT 421
               MS++ N+ Y+ +   +   +A  L ++   Y +  L      R++  Y S   K ++
Sbjct: 262  KFQMSLRPNLCYDNDEPLKNLPKANRLPKLLHKYYETFL------RVRKRYLSRGSKTES 315

Query: 422  TF------VKKWDGLVLYKDSVKSSTKLGADDVDFDFANHEYAKVSNFFKAPQIIFSIES 475
            T       +++W GL LY    K +     D   F+   HEYA+ S   K   ++     
Sbjct: 316  TRKDLRNPLERWRGLGLY---WKENDPAWDDVFHFELPKHEYARYSKVMKCEHMLIEYSH 372

Query: 476  DIPGIVPHGSHPPLSKAHGPDIGNHESPPTFLIDLQLSHASIYFGSWVNRNIVDLRDLMF 535
            D PG+VPHG+ P L    GPD+GN  +PP F +D+Q+  A+I++G W +  I+ ++ +  
Sbjct: 373  DTPGVVPHGAFPTLEPLDGPDVGNGGAPPDFSLDIQVFGANIHYGPWAHHEIMPIQKVFS 432

Query: 536  PVISKDQKPLNKLKPGLTRVHSMFNFSVSVLDDSSIRLPTREPSKDSDFLKQYLETKDDF 595
            PV+S+D  P  +L  G TRV +    S+ ++ DS  R+PTREPSKD DFLK+Y ET+DD 
Sbjct: 433  PVVSRDSHPTERLSAGSTRVFTRLRISIMIMSDSIWRIPTREPSKDLDFLKRYKETEDDT 492

Query: 596  RAFGWIDLSFKKGSEFMLNIPMIPTSGGFENTLFSKFSELEVTTSVNHNLLFKSNSLNIA 655
            R FGW++LS  +GSE  LNI M PTS GF+N L   F + E+ TSVNH++L  + + +I 
Sbjct: 493  RPFGWLELSLAEGSEVRLNIAMCPTSTGFDNKLDLHFIKPEIRTSVNHDILLSAETHDIE 552

Query: 656  ANIGYPLGWNDPVNWIFNINSKQLDIFLLREHITLLSDMIIDFSTQEPTPYELFRSFTYN 715
            A IGYPLGWN    W F++ S Q  +F+L++HITLL D++ DF T +PTPY+LFR F Y 
Sbjct: 553  AQIGYPLGWNAKAKWNFDLKSHQARMFILKDHITLLGDILSDFGTGDPTPYDLFRPFIYE 612

Query: 716  LNLKIGGYSFYFNVNDRNIINNPLDFNENCYLSFHGDLFTSEITIPIISLAQQYVTISYE 775
             N ++ GYS Y NVND NI+NNP+DFNENCYLSFHGD       +P  S+A    TI Y 
Sbjct: 613  FNWELTGYSMYLNVNDANIVNNPVDFNENCYLSFHGDDLRISFRVPQDSIAGNSTTIDYN 672

Query: 776  IFTPMFRLFLNTPSWNTLSEFMRNKEIGRSHDFRVSGTYLIYSELDIDNVDSLTIDFESN 835
            ++TP+FRL +NTPSWNTL EFM++KE+GR+ DF ++G+YL +S+LD++N+D++ I+ +S 
Sbjct: 673  LYTPLFRLNMNTPSWNTLHEFMKDKEVGRACDFSLAGSYLFHSKLDVENIDTIIIECKSR 732

Query: 836  STVLYCFGFVIKYMMNFQANYFGSFIKFITTEEYSELIRN-----NVNDNLGSINTNDLT 890
             T L C+G+V+++++  + NYFG F+ F TTEEY E +R+       N    + +T   T
Sbjct: 733  MTTLKCYGYVVRFLVGVKMNYFGDFVHFKTTEEYMEELRDAYVEPKANSEQSANSTETTT 792

Query: 891  SIEGLQKMDSITNDVEDINQKTIKRSDLLRTENETDIWLNFKVNDGALILPEELYNGDSC 950
            + EG  K ++  N   D      K+  L R  NE D+W  F V DG LILP+ LY+ ++C
Sbjct: 793  AGEGEDKQNAPKNHTTD--PVMAKKLSLKRMVNEKDVWFTFIVEDGCLILPKNLYDCNAC 850

Query: 951  VSLSFGELFINMRTCNYYMDVYITLYDNNLNRFEKIDPHELFEYIQTRNRSSSVEGNISD 1010
             +  F  L I++R  NYYMD+   L    +      DP  LF   + R  S +  G+ISD
Sbjct: 851  FAFEFDSLDIDLRYINYYMDLQAALSPVIVRNLSDCDPAHLFSGSEGRCPSRANFGSISD 910

Query: 1011 ITIHGHRMYGLPPKELTYFCQWSINIGTFLIDSDMIFLLSFIQSLNKIGFFLSNKENSLL 1070
            + IH HRM+GLPP E TYFC+W  ++G   I SD+  +LSF  + +K+ F   + EN + 
Sbjct: 911  LHIHAHRMFGLPPDEETYFCKWDFSMGVLDISSDLSCILSFGDAWSKLAFSFKDYENIMN 970

Query: 1071 YESDTVNDMTLLSVDVESLKVILSDPLLEARAEIGASSIIIRNIDFENEKYTKRLDVNAS 1130
            Y+   + DMT +      ++V ++D  ++    +   ++  R +DFENE+Y+ R DV+  
Sbjct: 971  YKIVPILDMTSIIFHAGEIRVKINDVAVDYYIIVEVENVTARGVDFENERYSSRADVDIH 1030

Query: 1131 EFYFSLDSLKIDSGKKN---ILDVRTKLNITNFFKTDNHINHLDTQRKFIGLHDSPYHRC 1187
                   ++++  G K+   I D  + L IT F +  N + H   Q+  I  +D+P+HRC
Sbjct: 1031 SI-----TVQVKEGGKDGSLIGDFSSSLKITKFCQLKNFLVHSMQQKSHIATNDAPFHRC 1085

Query: 1188 FFLLPEKFQESSSYKELYGSITPSFSLPMLPIPHIYSTTNFIVEGILDDYSEFLLSDHHN 1247
             FLLP   Q S +Y++L GSI P  S+P +  P     T   V  ILD   EFL  + ++
Sbjct: 1086 SFLLPLAIQRSDNYRKLLGSIVPGVSIPGMVEP----ITPENVTMILD---EFLKGEKNS 1138

Query: 1248 QMSINAELNSVDTTPLKDSFDMQITNFQNIL--TTEDP--YETDNFVVNVKYLTVTVNPD 1303
                N    S      K   D    NF + L  +TE+    E+++ VV +     +++  
Sbjct: 1139 LQMGNEHFCS------KKEEDGYAFNFASGLMSSTENDSNVESESLVVKLIKPQASISAC 1192

Query: 1304 IVFTIEKFSTEFNKKFSMNNQIDGIEMAIVNRLSDLKENISSKINVNLNV-----EKIDA 1358
             +     FS +    F +   ID  E+ +V  L  ++  +  K   N+ V     E   +
Sbjct: 1193 CIKPFRSFSDQAYSNF-VEQLIDSNEIEVV--LHFIETTLKRKQCKNVKVFSPTFEMTLS 1249

Query: 1359 AWGHRDVCFIGTYINMLKFELS-------QESTYNNNGGLQKDLTLLGKFRSVRIIIQNH 1411
             +G  ++      ++++  E+S       + S  ++     +D+T L K  S+ + + N 
Sbjct: 1250 NFGSDNISQTSDTVDIVIKEISVDISMREEPSPNSSEKSTVQDITALVKVESLALCVSNT 1309

Query: 1412 SYNS----FSDDRPPGLSLMLEGFEAWXXXXXXXXXXXXXXXFDITVDEYQIHWLIPYVK 1467
            S N       +D+    S  ++  E W                D  V   +      ++K
Sbjct: 1310 SRNGPLENIHEDQL--CSTSIKDLEFWMTSEDIRKSSFNATSIDTWVHSDKTELCCIFLK 1367

Query: 1468 SQILLFTKIQDSVKLIYDEQASYQKTFITSLIWAGEKYQIDHDPYVITKPATVLRLSAWH 1527
            +       I + V +  +     Q+ F   +  A ++YQI HDP VITKPA + RL   H
Sbjct: 1368 NTAANIDTITEVVSVHKERLQKAQRDFFYRISTASDEYQIIHDPPVITKPAYITRLPNQH 1427

Query: 1528 IRENRSWRIVTKLRHILTYXXXXXXXXXXXXXXIKRSGLEKEAASTFLNVFSNWRNWEVS 1587
            +REN+SW+I+T+LRHIL Y                       A   FLN+FS WR+WE S
Sbjct: 1428 VRENKSWKIITRLRHILNYLPPSLLAEIYGALKSASFEAPTNAGEIFLNIFSKWRSWESS 1487

Query: 1588 DIEKSYIYRMIFVEEVSKRILQNSIKVFLETFYFTIYSRNYSADQNFLI--TKANILINN 1645
            D+E+ Y+YR  F  +   +    +++V +++   T+    +       +   K       
Sbjct: 1488 DVEQCYMYRKAFYSQYEGQAGPLNLRVEVDSCSATVSDSTHKEGDMIAVKGLKLLKKFIL 1547

Query: 1646 EADQVNEVDLI--RKQEEIVDVVTKIGSIKFEFTEAILKLKRDIEQIIKTSVDSKSEGDK 1703
            +++ V  +  I      +   +   + ++K   +E  +KL        +   +S++  D 
Sbjct: 1548 KSEMVGSILAIDDGTATDGNSLSCSLKAVKASISETAIKL-----LAFRELFESQNSQDI 1602

Query: 1704 LSITKFFK-------VNLSFIFDHIDFNGQFYNSSLKSRMSNV----NILSYFENNIESS 1752
            LS T+          + L+ + D  +        SL S+ +N+    N +S+   + ES+
Sbjct: 1603 LSNTQVLPSGKILKLMELALLIDRCEI-----KISLDSKTANLKSFGNSISFALVDTESA 1657

Query: 1753 TPSGSFVYYA-DRTGIALKHLNNILIDCQVRNLFASTTAELHSAVNSLMINFRCSNLHFK 1811
              +GS +  A       ++H N I++D   R     +      +     ++     L  K
Sbjct: 1658 RDTGSSMALAWSWFEFDVRHNNAIIVDAFARRGSLGSFISQSESTTLHRVHLGSQKLRLK 1717

Query: 1812 SVPKTEIFVNAIKAIQRDVETLSAEISKAQGTTDNINTEHTPSVHEKNKMQKAKPNSKN- 1870
                T+ + N I ++     +L+                  P +    + +   P  KN 
Sbjct: 1718 VPSSTKDYCNFINSLSESWSSLA------------------PKLKFNTRSKDLSPEMKNF 1759

Query: 1871 -NITLSATFTNVSSEITLLHPIYLKHETNSVNISYNTINIDELLVQVLDTDLYLNSSHTK 1929
              +   A   + +SEI+ L P+ +      + + +       L ++V + DL L S  T 
Sbjct: 1760 SKVAFEAHVDDFTSEISALSPLSISKRFKGLTVQFEKEANSSLRLKVENFDLDLLSEMTA 1819

Query: 1930 EQYARLSYDKLELTTFLPDLNEKLID-LEISSSILKLTTSDPRRMLFSFLQDEKELKNSL 1988
            +QY ++S  ++ELT  + D  EK+   +++ S++ K    DPR ++ +  QD    K +L
Sbjct: 1820 QQYLKVSQSQVELTAKIHDKIEKVASKMQLESALTKFKLCDPREIIETLTQDLVNAKQNL 1879

Query: 1989 TFLR-SLESLNR--KANSEDSETLFSSY---EWIVNFKSKYMGVLLPIQATYYVFELHDA 2042
              L+  L +L      +S D E    +    EW+     KY+G+L+P+  T Y+ E+++ 
Sbjct: 1880 EQLKIHLLALGALFGTDSTDEEVFAGALWPREWLWQLDMKYVGLLVPLGTTSYISEINEL 1939

Query: 2043 LSTVSNKEEPSSAVHKKFHGDLSFDHIIFLIKDQSIPHKFSKILDFSIKLSTHRTVNNFD 2102
             S++S  +E +       HG+LS   I FLI D+ +P   SK+L+F+ ++   +   N  
Sbjct: 1940 SSSLSC-DEAAEFSFPLVHGELSVAGISFLINDKELPEDLSKVLEFAFRIKLAKVAENSM 1998

Query: 2103 RSFEIESSFFRVCLTPFSLIQTMWGXXXXXXXXXXXXDQSTXXXXXXXXXXIDGATNSEK 2162
            +S +IES+ FR+ L PFSLI+ +               ++T            G  +S+ 
Sbjct: 1999 KSLQIESTHFRIALCPFSLIRIL-----------SLAYEATHLSGLQALKDNAGVKSSDD 2047

Query: 2163 ENVF-----SVRSFHILSYNFSIGWLYQDSDNTIPGLILGYNRLFSTYEDNHGKLTLVDG 2217
               F     +  S  ILSY+F +GW++ +   +  GL  GY RLF+ +E  +GKLTL+D 
Sbjct: 2048 AKDFFNISQTFHSIQILSYDFCLGWIFNNDGASNSGLTWGYQRLFAAHEKPYGKLTLLDA 2107

Query: 2218 FFSLANGSSGDTFYSSGDESSKFNRSYLPNIQILYWIKEIEKMKHLFIKFHGETLDVNFF 2277
            +F +A GS+ + FY   DE  + NRS LP++QI YW +       LF++ +GE LDV+F 
Sbjct: 2108 YFFIARGSTSNDFYIQPDEVDRPNRSSLPSMQICYWFETNGSEDELFVRINGERLDVSFL 2167

Query: 2278 ENFVNIIESTVRSIDLFQTLKREKINPLVKAKPERDEKSNSALTNIKGPIFGKLKQVNCE 2337
               + I     RS+ LFQ LKR+ ++P    +P +   + SA + +  PI   +  VNC+
Sbjct: 2168 SKSIGIAGGFARSLHLFQELKRQYLDPFKPEEPVKRVPAGSAFSKL--PILSSISHVNCK 2225

Query: 2338 FIYDGGLFRLFSNASMTNKLEPTLMIKSPKVKIMLSYDYFEKELKKHWINCLIDIEPTQN 2397
              Y GG+F+L+S   +  K  P+  ++SP V ++  Y       +KH +  L+ ++ + N
Sbjct: 2226 VRYAGGVFKLYSLDDIKRKTGPSFQLESPSVDVIFEYTKMLTGKRKHLLRALMSVDSSHN 2285

Query: 2398 VLKSGCVPFLSDFISQIKDIV-ELQDVNMEENMDNNVKDPINITSLLENFDICFKLISGT 2456
             L   CVP +S+    I+ ++ +L   ++E    +N+++ IN  SLL++ DI F +    
Sbjct: 2286 TLFPTCVPIISEMALDIRQLLKDLNKSSVETPRTSNMQEGINYRSLLQDVDISFMMNIDK 2345

Query: 2457 QHVTLDCEPKAKINTDVGFGSFEFSILTPHLNPIDPLDISLKINDIKTSVKHQFSNEASA 2516
            Q ++L CEPKAK+  DVGF  F   + T   + ++PL +SL I++I  + +H FS E S 
Sbjct: 2346 QQISLSCEPKAKVQADVGFEKFAMKLFTNDFDVLEPLSLSLDIHNITATSRHIFSREVST 2405

Query: 2517 SFEVSKLDVILIFTHPE---VFGTGLVDDVKLHFNLKQFQNISIFLDIWD-----VSKST 2568
            S  +  L  + + THP+    +G   +  + ++FN+KQ Q++++F++IW      +S+  
Sbjct: 2406 SLNIECLSFVFMLTHPDTIHTYGIANIPTIDVYFNIKQLQDLNVFINIWKLDSKILSQPE 2465

Query: 2569 EKKLFKKDSNTLVDAKSSPIAQTIVNSSTLPWSFVFIATNINGDINMGSTLGNLALNLQR 2628
                F      L    +S   + I NSS  PW+FV I + I G+I++G +LG L+L  ++
Sbjct: 2466 LDNKFVIGPTNLEKPLTSKYKKVISNSS-FPWNFVVILSRIRGEIDLGISLGVLSLTTEK 2524

Query: 2629 TWISTDHFHNKRQLLHLFTDNVKISSEGRLGGFVEIDDITWKLDVNYVDKYKFVVSPLVD 2688
             W  TDH+ +  Q L L  D + +SS+GRLGG   + +  W   + +        SPLV 
Sbjct: 2525 IWAVTDHYSDWTQTLSLQLDKLSLSSDGRLGGTFLLQNFRWMSQIKWPLNEGSFESPLVV 2584

Query: 2689 LLFDVGKVSMKVAFDYHMFLISTVKDLKFHVLSEKDIDDILPDLLTVNLTCDEIKVCTTA 2748
            L   + + ++K+ FDYH+ LI++V+ L   + +++D   ++ +LL+V+L+ D  +V  TA
Sbjct: 2585 LNIFLDETAVKLTFDYHLVLIASVEKLSLSLFNKRDPRGVIRNLLSVSLSSDSTQVFLTA 2644

Query: 2749 LVASNILDIYNTIMRTRQDNKNSYIETLLESNNNVLKRKPLYEDILKSLNLLQTSLSANI 2808
            L  +NI D+YNTI+R R+DN+ SY+ETL +SN    K      +IL SL+ L+T LS  +
Sbjct: 2645 LAPANIFDVYNTILRMRKDNRKSYLETLGDSNTRDTKGSSSSHEILSSLSFLRTELSVML 2704

Query: 2809 HELNLQISPSSLYDAEVIIIRVQDVFSSTETRTGEKIKTDLEMRVYNATLSLTSFGKELT 2868
              +++Q+ PS+L+D EV+  + +D  + ++T   +K+KT L+++V+N  L+L+++  +L 
Sbjct: 2705 KFVHIQVYPSTLFDMEVMTFKARDFSTFSQTEGSKKLKTQLKLKVHNVKLALSTYKSQLH 2764

Query: 2869 EEDIAEMSAETYISYASTLTSGRIFEIPQLTINMTTFQNADNMILQYTYSCSFDGKVDVT 2928
            E   +++  + YI +AS +  G I   P + I MTT+ +     ++  YS SF GK+ V 
Sbjct: 2765 ERVASQIGVKEYIEHASKVDGGTILSTPAILIGMTTWHDVATNKVELLYSNSFGGKIGVR 2824

Query: 2929 WNLGPINFIKEVWATHVRSLEVRTVQFMGNHDISLENE--GDTDESVKVLSNIEYIALEE 2986
            WNLG INF++E+WATH R++ +R     G      E+E  GD  + V +     YI LEE
Sbjct: 2825 WNLGSINFLREMWATHARAMALRRSH-NGQSKSFFEDEHLGDKLKDVDLGDEYTYIPLEE 2883

Query: 2987 PYIEMPQIKDLKDATPPLEWFGLNRKYFPSATHQSVIVPIQKLVNVAQKEYAKVLGSS 3044
            P+IE+PQ KDL +ATPP+EWFG+NRK FP  THQ VIVP+QKL ++A+ E+A++LG +
Sbjct: 2884 PHIEIPQTKDLGEATPPVEWFGVNRKQFPGLTHQGVIVPLQKLAHLAESEWARILGRA 2941

 Score = 96.7 bits (239), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 46/122 (37%), Positives = 70/122 (57%), Gaps = 11/122 (9%)

Query: 4   LGTEFANVSLSQERYFSWVFLVYWILVVVATSTFVFYVAKLWGFGLTFACEWLLWKTMNI 63
           + +EF  V +S  + FSWVFL  W+L++  +    FY  ++ G+ +T   E+L WK   +
Sbjct: 1   MSSEFRRVPISTAQDFSWVFLTDWVLILSVSLLSAFYFGRVLGYTITTILEYLAWKRYGV 60

Query: 64  KVTIESIRLSFLTGTIFFKNVCLIDQDKTISILECSVTWRYWLLNTRKSEYELNAKADTS 123
           KV           G +FFKN+ +I QD+T SIL  S+TWRYWLL++RK+  E  ++    
Sbjct: 61  KV-----------GRVFFKNLTVITQDQTYSILHGSITWRYWLLSSRKTSLESQSEKAAK 109

Query: 124 KP 125
            P
Sbjct: 110 LP 111

>Kwal_56.23810 s56 (712732..721023) [8292 bp, 2763 aa] {OFF} YLR087C
            (CSF1) -  [contig 172] PARTIAL
          Length = 2763

 Score = 1478 bits (3827), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 919/2816 (32%), Positives = 1492/2816 (52%), Gaps = 154/2816 (5%)

Query: 305  LDILPLDININKGAITIGNKFTRSLLVINFTEAHGLLDYALPDSKLDVFKNKVTFEINDI 364
            L +LPL+ ++ KGA+ IGNK T S++V +F +  G LD   PD+K+D++K K+  +I   
Sbjct: 26   LRLLPLEYSVQKGALIIGNKKTSSVMVSSFEKLKGHLDACAPDTKIDLYKIKLQSDITKF 85

Query: 365  DMSIKRNIGYNPELASRFNFRAGVLTRIW-SYLQLVLNLIPTGRLKTWYESLRYKEDTTF 423
             MS++ N+ Y+ +   +   +A  L ++   Y +  L      R++  Y S   K ++T 
Sbjct: 86   QMSLRPNLCYDNDEPLKNLPKANRLPKLLHKYYETFL------RVRKRYLSRGSKTESTR 139

Query: 424  ------VKKWDGLVLYKDSVKSSTKLGADDVDFDFANHEYAKVSNFFKAPQIIFSIESDI 477
                  +++W GL LY    K +     D   F+   HEYA+ S   K   ++     D 
Sbjct: 140  KDLRNPLERWRGLGLY---WKENDPAWDDVFHFELPKHEYARYSKVMKCEHMLIEYSHDT 196

Query: 478  PGIVPHGSHPPLSKAHGPDIGNHESPPTFLIDLQLSHASIYFGSWVNRNIVDLRDLMFPV 537
            PG+VPHG+ P L    GPD+GN  +PP F +D+Q+  A+I++G W +  I+ ++ +  PV
Sbjct: 197  PGVVPHGAFPTLEPLDGPDVGNGGAPPDFSLDIQVFGANIHYGPWAHHEIMPIQKVFSPV 256

Query: 538  ISKDQKPLNKLKPGLTRVHSMFNFSVSVLDDSSIRLPTREPSKDSDFLKQYLETKDDFRA 597
            +S+D  P  +L  G TRV +    S+ ++ DS  R+PTREPSKD DFLK+Y ET+DD R 
Sbjct: 257  VSRDSHPTERLSAGSTRVFTRLRISIMIMSDSIWRIPTREPSKDLDFLKRYKETEDDTRP 316

Query: 598  FGWIDLSFKKGSEFMLNIPMIPTSGGFENTLFSKFSELEVTTSVNHNLLFKSNSLNIAAN 657
            FGW++LS  +GSE  LNI M PTS GF+N L   F + E+ TSVNH++L  + + +I A 
Sbjct: 317  FGWLELSLAEGSEVRLNIAMCPTSTGFDNKLDLHFIKPEIRTSVNHDILLSAETHDIEAQ 376

Query: 658  IGYPLGWNDPVNWIFNINSKQLDIFLLREHITLLSDMIIDFSTQEPTPYELFRSFTYNLN 717
            IGYPLGWN    W F++ S Q  +F+L++HITLL D++ DF T +PTPY+LFR F Y  N
Sbjct: 377  IGYPLGWNAKAKWNFDLKSHQARMFILKDHITLLGDILSDFGTGDPTPYDLFRPFIYEFN 436

Query: 718  LKIGGYSFYFNVNDRNIINNPLDFNENCYLSFHGDLFTSEITIPIISLAQQYVTISYEIF 777
             ++ GYS Y NVND NI+NNP+DFNENCYLSFHGD       +P  S+A    TI Y ++
Sbjct: 437  WELTGYSMYLNVNDANIVNNPVDFNENCYLSFHGDDLRISFRVPQDSIAGNSTTIDYNLY 496

Query: 778  TPMFRLFLNTPSWNTLSEFMRNKEIGRSHDFRVSGTYLIYSELDIDNVDSLTIDFESNST 837
            TP+FRL +NTPSWNTL EFM++KE+GR+ DF ++G+YL +S+LD++N+D++ I+ +S  T
Sbjct: 497  TPLFRLNMNTPSWNTLHEFMKDKEVGRACDFSLAGSYLFHSKLDVENIDTIIIECKSRMT 556

Query: 838  VLYCFGFVIKYMMNFQANYFGSFIKFITTEEYSELIRN-----NVNDNLGSINTNDLTSI 892
             L C+G+V+++++  + NYFG F+ F TTEEY E +R+       N    + +T   T+ 
Sbjct: 557  TLKCYGYVVRFLVGVKMNYFGDFVHFKTTEEYMEELRDAYVEPKANSEQSANSTETTTAG 616

Query: 893  EGLQKMDSITNDVEDINQKTIKRSDLLRTENETDIWLNFKVNDGALILPEELYNGDSCVS 952
            EG  K ++  N   D      K+  L R  NE D+W  F V DG LILP+ LY+ ++C +
Sbjct: 617  EGEDKQNAPKNHTTD--PVMAKKLSLKRMVNEKDVWFTFIVEDGCLILPKNLYDCNACFA 674

Query: 953  LSFGELFINMRTCNYYMDVYITLYDNNLNRFEKIDPHELFEYIQTRNRSSSVEGNISDIT 1012
              F  L I++R  NYYMD+   L    +      DP  LF   + R  S +  G+ISD+ 
Sbjct: 675  FEFDSLDIDLRYINYYMDLQAALSPVIVRNLSDCDPAHLFSGSEGRCPSRANFGSISDLH 734

Query: 1013 IHGHRMYGLPPKELTYFCQWSINIGTFLIDSDMIFLLSFIQSLNKIGFFLSNKENSLLYE 1072
            IH HRM+GLPP E TYFC+W  ++G   I SD+  +LSF  + +K+ F   + EN + Y+
Sbjct: 735  IHAHRMFGLPPDEETYFCKWDFSMGVLDISSDLSCILSFGDAWSKLAFSFKDYENIMNYK 794

Query: 1073 SDTVNDMTLLSVDVESLKVILSDPLLEARAEIGASSIIIRNIDFENEKYTKRLDVNASEF 1132
               + DMT +      ++V ++D  ++    +   ++  R +DFENE+Y+ R DV+    
Sbjct: 795  IVPILDMTSIIFHAGEIRVKINDVAVDYYIIVEVENVTARGVDFENERYSSRADVDIHSI 854

Query: 1133 YFSLDSLKIDSGKKN---ILDVRTKLNITNFFKTDNHINHLDTQRKFIGLHDSPYHRCFF 1189
                 ++++  G K+   I D  + L IT F +  N + H   Q+  I  +D+P+HRC F
Sbjct: 855  -----TVQVKEGGKDGSLIGDFSSSLKITKFCQLKNFLVHSMQQKSHIATNDAPFHRCSF 909

Query: 1190 LLPEKFQESSSYKELYGSITPSFSLPMLPIPHIYSTTNFIVEGILDDYSEFLLSDHHNQM 1249
            LLP   Q S +Y++L GSI P  S+P +  P     T   V  ILD   EFL  + ++  
Sbjct: 910  LLPLAIQRSDNYRKLLGSIVPGVSIPGMVEP----ITPENVTMILD---EFLKGEKNSLQ 962

Query: 1250 SINAELNSVDTTPLKDSFDMQITNFQNIL--TTEDP--YETDNFVVNVKYLTVTVNPDIV 1305
              N    S      K   D    NF + L  +TE+    E+++ VV +     +++   +
Sbjct: 963  MGNEHFCS------KKEEDGYAFNFASGLMSSTENDSNVESESLVVKLIKPQASISACCI 1016

Query: 1306 FTIEKFSTEFNKKFSMNNQIDGIEMAIVNRLSDLKENISSKINVNLNV-----EKIDAAW 1360
                 FS +    F +   ID  E+ +V  L  ++  +  K   N+ V     E   + +
Sbjct: 1017 KPFRSFSDQAYSNF-VEQLIDSNEIEVV--LHFIETTLKRKQCKNVKVFSPTFEMTLSNF 1073

Query: 1361 GHRDVCFIGTYINMLKFELS-------QESTYNNNGGLQKDLTLLGKFRSVRIIIQNHSY 1413
            G  ++      ++++  E+S       + S  ++     +D+T L K  S+ + + N S 
Sbjct: 1074 GSDNISQTSDTVDIVIKEISVDISMREEPSPNSSEKSTVQDITALVKVESLALCVSNTSR 1133

Query: 1414 NS----FSDDRPPGLSLMLEGFEAWXXXXXXXXXXXXXXXFDITVDEYQIHWLIPYVKSQ 1469
            N       +D+    S  ++  E W                D  V   +      ++K+ 
Sbjct: 1134 NGPLENIHEDQL--CSTSIKDLEFWMTSEDIRKSSFNATSIDTWVHSDKTELCCIFLKNT 1191

Query: 1470 ILLFTKIQDSVKLIYDEQASYQKTFITSLIWAGEKYQIDHDPYVITKPATVLRLSAWHIR 1529
                  I + V +  +     Q+ F   +  A ++YQI HDP VITKPA + RL   H+R
Sbjct: 1192 AANIDTITEVVSVHKERLQKAQRDFFYRISTASDEYQIIHDPPVITKPAYITRLPNQHVR 1251

Query: 1530 ENRSWRIVTKLRHILTYXXXXXXXXXXXXXXIKRSGLEKEAASTFLNVFSNWRNWEVSDI 1589
            EN+SW+I+T+LRHIL Y                       A   FLN+FS WR+WE SD+
Sbjct: 1252 ENKSWKIITRLRHILNYLPPSLLAEIYGALKSASFEAPTNAGEIFLNIFSKWRSWESSDV 1311

Query: 1590 EKSYIYRMIFVEEVSKRILQNSIKVFLETFYFTIYSRNYSADQNFLI--TKANILINNEA 1647
            E+ Y+YR  F  +   +    +++V +++   T+    +       +   K       ++
Sbjct: 1312 EQCYMYRKAFYSQYEGQAGPLNLRVEVDSCSATVSDSTHKEGDMIAVKGLKLLKKFILKS 1371

Query: 1648 DQVNEVDLI--RKQEEIVDVVTKIGSIKFEFTEAILKLKRDIEQIIKTSVDSKSEGDKLS 1705
            + V  +  I      +   +   + ++K   +E  +KL        +   +S++  D LS
Sbjct: 1372 EMVGSILAIDDGTATDGNSLSCSLKAVKASISETAIKL-----LAFRELFESQNSQDILS 1426

Query: 1706 ITKFFK-------VNLSFIFDHIDFNGQFYNSSLKSRMSNV----NILSYFENNIESSTP 1754
             T+          + L+ + D  +        SL S+ +N+    N +S+   + ES+  
Sbjct: 1427 NTQVLPSGKILKLMELALLIDRCEI-----KISLDSKTANLKSFGNSISFALVDTESARD 1481

Query: 1755 SGSFVYYA-DRTGIALKHLNNILIDCQVRNLFASTTAELHSAVNSLMINFRCSNLHFKSV 1813
            +GS +  A       ++H N I++D   R     +      +     ++     L  K  
Sbjct: 1482 TGSSMALAWSWFEFDVRHNNAIIVDAFARRGSLGSFISQSESTTLHRVHLGSQKLRLKVP 1541

Query: 1814 PKTEIFVNAIKAIQRDVETLSAEISKAQGTTDNINTEHTPSVHEKNKMQKAKPNSKN--N 1871
              T+ + N I ++     +L+                  P +    + +   P  KN   
Sbjct: 1542 SSTKDYCNFINSLSESWSSLA------------------PKLKFNTRSKDLSPEMKNFSK 1583

Query: 1872 ITLSATFTNVSSEITLLHPIYLKHETNSVNISYNTINIDELLVQVLDTDLYLNSSHTKEQ 1931
            +   A   + +SEI+ L P+ +      + + +       L ++V + DL L S  T +Q
Sbjct: 1584 VAFEAHVDDFTSEISALSPLSISKRFKGLTVQFEKEANSSLRLKVENFDLDLLSEMTAQQ 1643

Query: 1932 YARLSYDKLELTTFLPDLNEKLID-LEISSSILKLTTSDPRRMLFSFLQDEKELKNSLTF 1990
            Y ++S  ++ELT  + D  EK+   +++ S++ K    DPR ++ +  QD    K +L  
Sbjct: 1644 YLKVSQSQVELTAKIHDKIEKVASKMQLESALTKFKLCDPREIIETLTQDLVNAKQNLEQ 1703

Query: 1991 LR-SLESLNR--KANSEDSETLFSSY---EWIVNFKSKYMGVLLPIQATYYVFELHDALS 2044
            L+  L +L      +S D E    +    EW+     KY+G+L+P+  T Y+ E+++  S
Sbjct: 1704 LKIHLLALGALFGTDSTDEEVFAGALWPREWLWQLDMKYVGLLVPLGTTSYISEINELSS 1763

Query: 2045 TVSNKEEPSSAVHKKFHGDLSFDHIIFLIKDQSIPHKFSKILDFSIKLSTHRTVNNFDRS 2104
            ++S  +E +       HG+LS   I FLI D+ +P   SK+L+F+ ++   +   N  +S
Sbjct: 1764 SLSC-DEAAEFSFPLVHGELSVAGISFLINDKELPEDLSKVLEFAFRIKLAKVAENSMKS 1822

Query: 2105 FEIESSFFRVCLTPFSLIQTMWGXXXXXXXXXXXXDQSTXXXXXXXXXXIDGATNSEKEN 2164
             +IES+ FR+ L PFSLI+ +               ++T            G  +S+   
Sbjct: 1823 LQIESTHFRIALCPFSLIRIL-----------SLAYEATHLSGLQALKDNAGVKSSDDAK 1871

Query: 2165 VF-----SVRSFHILSYNFSIGWLYQDSDNTIPGLILGYNRLFSTYEDNHGKLTLVDGFF 2219
             F     +  S  ILSY+F +GW++ +   +  GL  GY RLF+ +E  +GKLTL+D +F
Sbjct: 1872 DFFNISQTFHSIQILSYDFCLGWIFNNDGASNSGLTWGYQRLFAAHEKPYGKLTLLDAYF 1931

Query: 2220 SLANGSSGDTFYSSGDESSKFNRSYLPNIQILYWIKEIEKMKHLFIKFHGETLDVNFFEN 2279
             +A GS+ + FY   DE  + NRS LP++QI YW +       LF++ +GE LDV+F   
Sbjct: 1932 FIARGSTSNDFYIQPDEVDRPNRSSLPSMQICYWFETNGSEDELFVRINGERLDVSFLSK 1991

Query: 2280 FVNIIESTVRSIDLFQTLKREKINPLVKAKPERDEKSNSALTNIKGPIFGKLKQVNCEFI 2339
             + I     RS+ LFQ LKR+ ++P    +P +   + SA + +  PI   +  VNC+  
Sbjct: 1992 SIGIAGGFARSLHLFQELKRQYLDPFKPEEPVKRVPAGSAFSKL--PILSSISHVNCKVR 2049

Query: 2340 YDGGLFRLFSNASMTNKLEPTLMIKSPKVKIMLSYDYFEKELKKHWINCLIDIEPTQNVL 2399
            Y GG+F+L+S   +  K  P+  ++SP V ++  Y       +KH +  L+ ++ + N L
Sbjct: 2050 YAGGVFKLYSLDDIKRKTGPSFQLESPSVDVIFEYTKMLTGKRKHLLRALMSVDSSHNTL 2109

Query: 2400 KSGCVPFLSDFISQIKDIV-ELQDVNMEENMDNNVKDPINITSLLENFDICFKLISGTQH 2458
               CVP +S+    I+ ++ +L   ++E    +N+++ IN  SLL++ DI F +    Q 
Sbjct: 2110 FPTCVPIISEMALDIRQLLKDLNKSSVETPRTSNMQEGINYRSLLQDVDISFMMNIDKQQ 2169

Query: 2459 VTLDCEPKAKINTDVGFGSFEFSILTPHLNPIDPLDISLKINDIKTSVKHQFSNEASASF 2518
            ++L CEPKAK+  DVGF  F   + T   + ++PL +SL I++I  + +H FS E S S 
Sbjct: 2170 ISLSCEPKAKVQADVGFEKFAMKLFTNDFDVLEPLSLSLDIHNITATSRHIFSREVSTSL 2229

Query: 2519 EVSKLDVILIFTHPE---VFGTGLVDDVKLHFNLKQFQNISIFLDIWD-----VSKSTEK 2570
             +  L  + + THP+    +G   +  + ++FN+KQ Q++++F++IW      +S+    
Sbjct: 2230 NIECLSFVFMLTHPDTIHTYGIANIPTIDVYFNIKQLQDLNVFINIWKLDSKILSQPELD 2289

Query: 2571 KLFKKDSNTLVDAKSSPIAQTIVNSSTLPWSFVFIATNINGDINMGSTLGNLALNLQRTW 2630
              F      L    +S   + I NSS  PW+FV I + I G+I++G +LG L+L  ++ W
Sbjct: 2290 NKFVIGPTNLEKPLTSKYKKVISNSS-FPWNFVVILSRIRGEIDLGISLGVLSLTTEKIW 2348

Query: 2631 ISTDHFHNKRQLLHLFTDNVKISSEGRLGGFVEIDDITWKLDVNYVDKYKFVVSPLVDLL 2690
              TDH+ +  Q L L  D + +SS+GRLGG   + +  W   + +        SPLV L 
Sbjct: 2349 AVTDHYSDWTQTLSLQLDKLSLSSDGRLGGTFLLQNFRWMSQIKWPLNEGSFESPLVVLN 2408

Query: 2691 FDVGKVSMKVAFDYHMFLISTVKDLKFHVLSEKDIDDILPDLLTVNLTCDEIKVCTTALV 2750
              + + ++K+ FDYH+ LI++V+ L   + +++D   ++ +LL+V+L+ D  +V  TAL 
Sbjct: 2409 IFLDETAVKLTFDYHLVLIASVEKLSLSLFNKRDPRGVIRNLLSVSLSSDSTQVFLTALA 2468

Query: 2751 ASNILDIYNTIMRTRQDNKNSYIETLLESNNNVLKRKPLYEDILKSLNLLQTSLSANIHE 2810
             +NI D+YNTI+R R+DN+ SY+ETL +SN    K      +IL SL+ L+T LS  +  
Sbjct: 2469 PANIFDVYNTILRMRKDNRKSYLETLGDSNTRDTKGSSSSHEILSSLSFLRTELSVMLKF 2528

Query: 2811 LNLQISPSSLYDAEVIIIRVQDVFSSTETRTGEKIKTDLEMRVYNATLSLTSFGKELTEE 2870
            +++Q+ PS+L+D EV+  + +D  + ++T   +K+KT L+++V+N  L+L+++  +L E 
Sbjct: 2529 VHIQVYPSTLFDMEVMTFKARDFSTFSQTEGSKKLKTQLKLKVHNVKLALSTYKSQLHER 2588

Query: 2871 DIAEMSAETYISYASTLTSGRIFEIPQLTINMTTFQNADNMILQYTYSCSFDGKVDVTWN 2930
              +++  + YI +AS +  G I   P + I MTT+ +     ++  YS SF GK+ V WN
Sbjct: 2589 VASQIGVKEYIEHASKVDGGTILSTPAILIGMTTWHDVATNKVELLYSNSFGGKIGVRWN 2648

Query: 2931 LGPINFIKEVWATHVRSLEVRTVQFMGNHDISLENE--GDTDESVKVLSNIEYIALEEPY 2988
            LG INF++E+WATH R++ +R     G      E+E  GD  + V +     YI LEEP+
Sbjct: 2649 LGSINFLREMWATHARAMALRRSH-NGQSKSFFEDEHLGDKLKDVDLGDEYTYIPLEEPH 2707

Query: 2989 IEMPQIKDLKDATPPLEWFGLNRKYFPSATHQSVIVPIQKLVNVAQKEYAKVLGSS 3044
            IE+PQ KDL +ATPP+EWFG+NRK FP  THQ VIVP+QKL ++A+ E+A++LG +
Sbjct: 2708 IEIPQTKDLGEATPPVEWFGVNRKQFPGLTHQGVIVPLQKLAHLAESEWARILGRA 2763

>Ecym_4310 Chr4 (657929..666760) [8832 bp, 2943 aa] {ON} similar to
            Ashbya gossypii AGR088W
          Length = 2943

 Score = 1274 bits (3298), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 889/2928 (30%), Positives = 1489/2928 (50%), Gaps = 186/2928 (6%)

Query: 188  FAINCTGFEIFLYNRKRAYETIIQNFSKEEKIQFIDFLRQHDLDDIFEEVSSEIKNCNEY 247
            F + C G E+F+YN+   YE I+   +K +K    D  R+   DD  E +   +K     
Sbjct: 127  FKLECDGVELFIYNKIAVYEDILNELAKSDK----DSSRKFATDD--ESIFGRVKT---- 176

Query: 248  CNHKEGNNSAHFGSSCKSDKESASNISISGDSQEXXXXXXXXXXXXKISAHIMRKLHLDI 307
                  ++S  F    +S ++S    +I                   +S      L+LD 
Sbjct: 177  ------DSSVMFDPLDESSEQSKVGQTI----------------LNSVSNQSAVPLYLDF 214

Query: 308  LPLDININKGAITIGNKFTRSLLVINFTEAHGLLDYALPDSKLDVFKNKVTFEINDIDMS 367
            LP ++ ++ GA+ +GNK T S+ +I +    G++D A P S LD +K +  FE++   +S
Sbjct: 215  LPAEVILSSGAVVVGNKHTPSVAIIQYARIEGIIDVAGPTSNLDQYKLRSEFELSSTRVS 274

Query: 368  IKRNIGYNPELASRFNFRAGVLTRIWSYLQLVLNLIPTGRLKTWYESLRYKEDTTFVKKW 427
            +K NI +    +S+ +   G    +W  L+  L    +  L              F+  W
Sbjct: 275  VKPNISFGNGSSSKKHKIDGKPFNLWQKLKDCLLFTISHILAFTGNKKGLTGQEEFLTSW 334

Query: 428  DGLVLYKDSVKSSTKLGADDVDFDFANHEYAKVSNFFKAPQIIFSIESDIPGIVPHGSHP 487
             GL +Y D   S T   +D++ FD  NHEYAK +    A +I      D PG++      
Sbjct: 335  KGLAMY-DVATSDT--FSDEIPFDLQNHEYAKYTTILNADRIKLLYSYDTPGVITE---- 387

Query: 488  PLSKAHGPDIGNHESPPTFLIDLQLSHASIYFGSWVNRNIVDLRDLMFPVISKDQKPLNK 547
              +   G + G+    P + ID+QL  A+ Y+G W +R +     +  P +S+D     K
Sbjct: 388  --TLIKGYENGDIPPSPEYSIDVQLYDANFYYGPWAHRQLQYFIKMFSPAVSRDFSAHRK 445

Query: 548  LKPGLTRVHSMFNFSVSVLDDSSIRLPTREPSKDSDFLKQYLETKDDFRAFGWIDLSFKK 607
               G +R H+ F   + +++DS  R+PT+EPSKD+ FL +Y  T D+ RAFGWID+   K
Sbjct: 446  PVLGKSREHANFRCEIVIMEDSVWRIPTKEPSKDAAFLDKYKSTNDESRAFGWIDIKLNK 505

Query: 608  GSEFMLNIPMIPTSGGFENTLFSKFSELEVTTSVNHNLLFKSNSLNIAANIGYPLGWNDP 667
             +   + + +  +  GFENT  +      + TSVNH++LF + +  I A   YP  WN  
Sbjct: 506  DTNISIELGLQASECGFENTFHANLVNPVIITSVNHDVLFNAKAHQIIARQSYPHQWNSA 565

Query: 668  VNWIFNINSKQLDIFLLREHITLLSDMIIDFSTQEPTPYELFRSFTYNLNLKIGGYSFYF 727
            + W  +  S  L++F+LR+H  LL D+  DF++ +  PYELFR   Y  +  I  YS Y 
Sbjct: 566  ITWALHFISSDLELFILRDHFNLLVDLFTDFASGDAVPYELFRPVLYQFSWDISNYSLYL 625

Query: 728  NVNDRNIINNPLDFNENCYLSFHGDLFTSEITIPIISLAQQYVTISYEIFTPMFRLFLNT 787
            N ND NI+NNPLDFNENCY+S HG+     + +PI +++++ +TISYEI+TP F + L T
Sbjct: 626  NANDANIVNNPLDFNENCYISIHGNSARIGVKLPIETISEESITISYEIYTPKFDIQLKT 685

Query: 788  PSWNTLSEFMRNKEIGRSHDFRVSGTYLIYSELDIDNVDSLTIDFESNSTVLYCFGFVIK 847
            P W+TL EFM  + +GRSH+F  SG+YL Y+++DIDNVD++ ++ ++N      +GF+++
Sbjct: 686  PPWHTLHEFMAQRFVGRSHEFSASGSYLSYNDVDIDNVDTINLECKTNHATFLAYGFLLR 745

Query: 848  YMMNFQANYFGSFIKFITTEEYSELI--RNNVNDNLGSINTNDLTSIEGLQKMDSITNDV 905
            Y+MN + NYFG F +F TTEEYSE +  RN+V  ++ + N +D T+ E ++      +  
Sbjct: 746  YVMNLKLNYFGEFAQFRTTEEYSEELAQRNDVATDIFNNNDDDQTT-ELVEPNSYGESGF 804

Query: 906  EDINQKTIKRSDLLRTENETDIWLNFKVNDGALILPEELYNGDSCVSLSFGELFINMRTC 965
            + ++ K I ++ L RT NE DIW+ F   DG  +LPE  Y+  SC  L F  +  +MR  
Sbjct: 805  DILHGKKIDKASLKRTVNEKDIWVTFFFEDGCFVLPESFYDFKSCFGLHFDNITFDMRYL 864

Query: 966  NYYMDVYITLYDNNLNRFEKIDPHELFEYIQTRNR-SSSVEGNISDITIHGHRMYGLPPK 1024
            +YY D+  ++    + R+  +  + +F+   +    +S+ +G +S+  IH HRM+GLPP 
Sbjct: 865  SYYADLAFSMNSTYIKRYPDVSSNSVFDVCGSNPFITSNYDGYLSEFNIHIHRMFGLPPA 924

Query: 1025 ELTYFCQWSINIGTFLIDSDMIFLLSFIQSLNKIGFFLSNKENSLLYESDTVNDMTLLSV 1084
            E TY  +  +++G    +SD+  L  FIQ + K  F   N E+ L YE     D++ LS 
Sbjct: 925  EETYLFKIDVSLGYLSFESDIEALKGFIQFITKFSFGFDNFEDVLHYEMARSFDISCLSF 984

Query: 1085 DVESLKVILSDPLLEARAEIGASSIIIRNIDFENEKYTKRLDVNASEFYFSLDSLKIDSG 1144
              + + + L++        +   ++ ++ +DF   KY+ R +++   F F + S+  D  
Sbjct: 985  FADDISIRLNNIDTNKFISLSIPNVSLKLLDFGTSKYSLRANIDIPNFDFLVSSM--DDH 1042

Query: 1145 KKNILDVRTKLNITNF-----FKTDNHINHLDTQRKFIGLHDSPYHRCFFLLPEKFQESS 1199
               +  + T ++   F     FKT N++     Q + I L D+P+ RC FL P+++Q S 
Sbjct: 1043 NIVLGTISTSISFAIFSRNPDFKTTNNL-----QTQHILLSDAPFCRCSFLHPQEYQTSD 1097

Query: 1200 SYKELYGSITPSFSLPMLPIPHIYSTTNFIVEGILDDYSEFLLSDHHNQMSINAELN-SV 1258
             YK LY SI PS S+P+LP P   +  + I E +L D  +  +S+    +S + +L  ++
Sbjct: 1098 LYKLLYASIPPSSSIPLLPEPIGPNNFDTIFENLLGDIYQDYISEGTFDISNDTKLQLNI 1157

Query: 1259 D--TTPLKDSFDMQITNFQNILTTEDPYETDNFVVNVKYLTVTVNPDIVFTIEKFSTEFN 1316
            D      ++SF    T    I   ++ +E  +FV  + ++ + ++ D+   +E F+  + 
Sbjct: 1158 DEFKKHSENSFSKHKTKNLTIDIVDELHEVRSFVFELPHINIDIHIDV---LEVFADLYR 1214

Query: 1317 K--KFSMNNQIDGIEMAIVNRLSDLKENISSKINVNLNVEKID------AAWGHRDV-CF 1367
            +   F++++ IDG+ + IVN  S      SS     +   +ID        +   DV  +
Sbjct: 1215 QLTTFTISDTIDGLGVDIVNNFSKTFFGASSVTEAKVVCPRIDFRLRMYEYYALEDVKHY 1274

Query: 1368 IGTYINMLKFELSQESTYNN---NGGLQKDLTLLGKFRSVRIIIQNHSYNSF---SDDRP 1421
              + IN L   L     Y+    N  +     L   +++  I  +  S  +F   S+   
Sbjct: 1275 FVSDINKLDLNLRLRQEYDKESANSEMNSKNKLSVYYKTALINGKMLSKENFIYPSESSE 1334

Query: 1422 PGLSLMLEGFEAWXXXXXXXXXXXXXXXFDITVDEYQIHWLIPYVKSQILLFTKIQDSVK 1481
                   E  E +                 + +++     +  ++K+  L F     SV 
Sbjct: 1335 FSYKSTFEELEGYAFYDDDLVTDANLQRGCVFINQEHSDSISEFIKTLYLKFNTFIKSVT 1394

Query: 1482 LIYDEQASYQKTFITSLIWAGEKYQIDHDPYVITKPATVLRLSAWHIRENRSWRIVTKLR 1541
            +  +   S ++  +  +  AG+ Y I HDP VITKPA + RLS  H+RE+RSWRIVT+LR
Sbjct: 1395 ISKNFNKSMKRELLIRIAQAGQDYGIQHDPPVITKPAVITRLSRHHVRESRSWRIVTRLR 1454

Query: 1542 HILTYXXXXXXXXXXXXXXIKRSGLEKEAASTFLNVFSNWRNWEVSDIEKSYIYRMIFV- 1600
            H+L Y                +   E++A   FL++F+ WR+WE +D+E+ ++Y+  ++ 
Sbjct: 1455 HVLNYLPQYWYETTSLELQKGKFRSEEDAKLQFLDIFTRWRSWEFADVERCFLYKKTYIP 1514

Query: 1601 EEV--SKRIL------------QNSIKVFLETFYFTIYSRNY--SADQNFLITKANILIN 1644
             EV  +K I             ++   +F+ +F   I +  Y  SA    +  K+N +  
Sbjct: 1515 AEVTFAKTICFSSDLLTISFNERDKEHLFMNSFMIDIRNDCYVSSAVGESMAAKSNNVYK 1574

Query: 1645 NEADQVNEVDLIRKQEEIVDVVTKIGSIKFEFTEA-ILKLKRDIEQIIKTSVDSKSEGDK 1703
                 ++E+ +   ++ I+ +   I ++KFE+  +  + + +D     K   +   + +K
Sbjct: 1575 TVV-SLDELQINVDKKIILKLSKLIHTLKFEYVYSNPIVVAKDANGRCK---NISLQLNK 1630

Query: 1704 LSITKFF-KVNLSFIFDHIDFNGQFYNSSLKSRMSNVNILSYFENNIESSTPSGSFVYYA 1762
            ++   F   V+L FIF+ I      Y  SL      ++ L    N++       S + + 
Sbjct: 1631 ITTNCFLGNVSLGFIFERI------YVYSL------IDTLDSGNNSLL------SVLLFF 1672

Query: 1763 DRTGIALKHLNNILIDCQVRNLFASTTAELHSAVNSLMINFRCSNLH---FKSVPKTEIF 1819
            D   +  ++        + RNLF+    +LH  +  L         H   F ++  +   
Sbjct: 1673 DVAKLFFRY--------KTRNLFSLDFTDLHFNLTYLSKQKTYGFYHSAEFMNINSSIPS 1724

Query: 1820 VNAIKAIQRDVETLSAEISKAQGTTDNINTEHTPSVHEKNKMQKAKPNSKNNITLSATFT 1879
            +N I     ++     EI   Q    NI     P + +    Q  KP +   + ++A   
Sbjct: 1725 INDIIEANNEIRLHINEI--GQDFASNIQYTELPVLPDS---QVLKPIAMVKMNIAA--- 1776

Query: 1880 NVSSEITLLHPIYLKHETNSVNISYNTINIDELLVQVLDTDLYLNSSHTKEQYARLSYDK 1939
             ++ ++ LL P  L++      I+ +   I +  + + DT + L S   +E Y + S+  
Sbjct: 1777 -INIQLQLLLPFILRYSCKEFEINVDFGRILQSSLSLQDTSVELLSLEFQEPYMKYSHSY 1835

Query: 1940 LELTTFLPDLNEKLIDLEISSSILKLTTSDPRRMLFSFLQDEKELKNSLTFLRSLESLNR 1999
            L+L        + L  + + SS  KL+  +P++ +  FL D ++   ++  LRS   L  
Sbjct: 1836 LKLIGMDLGNTDNLGRISLDSSFSKLSIFEPKKNMRLFLSDIEQAVKNIEILRS-TMLET 1894

Query: 2000 KANSEDSETLFSSYEWI-VNFKSKYMGVLLPIQATYYVFELHDALSTVSNKEEPSSAVHK 2058
            K+++  +E  FS    I +N   +Y+G+LL    T YV E ++   + S  +  S+ V  
Sbjct: 1895 KSSTVQNEFPFSRLIPIQLNLNVEYIGLLLDFGTTLYVLEFNNLEFSFSKDKTSSNPVVP 1954

Query: 2059 KFHGDLSFDHIIFLIKDQSIPHKFSKILDFSIKLSTHRTVNNFDRSFEIESSFFRVCLTP 2118
             F  D S + I FLIKD+ +    SK+LDFS+++   R+     +S +IESS+    L+P
Sbjct: 1955 TFSSDYSSESICFLIKDRRVKETLSKVLDFSLRIKVIRSSLLAIQSLQIESSYLHAVLSP 2014

Query: 2119 FSLIQTMWGXXXXXXXXXXXXD---QSTXXXXXXXXXXIDGATNSEKENVFSVRSFHILS 2175
             SL++ +              D   +ST          I            S++S HILS
Sbjct: 2015 MSLVRLLSFVNEFSIMKSIYHDIKPRSTSSNSTLSILPI------------SIKSAHILS 2062

Query: 2176 YNFSIGWLYQDSDNTIPGLILGYNRLFSTYEDNHGKLTLVDGFFSLANGSSGDTFYSSGD 2235
            YN  IGWL+    N   GLI GY RLF+ Y+  +GKLTL+D +FS+A+G S  T+Y  G+
Sbjct: 2063 YNLCIGWLFDLGYNANEGLIWGYERLFAVYDKPYGKLTLLDAYFSVAHGFSSSTYYPDGN 2122

Query: 2236 ESSKFNRSYLPNIQILYWIKEIEKMKHLFIKFHGETLDVNFFENFVNIIESTVRSIDLFQ 2295
            E    NRSYLP++QI YW++E    K LFI+ +GE LDV+    +  I++   +S+  F+
Sbjct: 2123 EKGAMNRSYLPSMQINYWLEEENGTKDLFIRVNGEELDVSLLAWWFTIVDEATQSLHKFK 2182

Query: 2296 TLKREKINPLVKAKPERDEKSNSALTNIKGPIFGKLKQVNCEFIYDGGLFRLFSNASMTN 2355
             LK   ++PL   K   ++        +  P+   ++ +NC   Y G   +L+S   + +
Sbjct: 2183 KLKETILDPL---KVTSNDPILGEWNYLDNPLASSVRSINCIINYAGSSMKLYSRDDIQH 2239

Query: 2356 KLEPTLMIKSPKVKIMLSYDYFEKELKKHWINCLIDIEPTQNVLKSGCVPFLSD----FI 2411
                +  I+SP   + + Y Y+  + K HWI  L  +  T N L   CVP L++    F 
Sbjct: 2240 G-TCSFEIRSPAHTVTIDYKYYPSKKKSHWIRTLATVNTTHNTLFPVCVPLLNEMWLTFN 2298

Query: 2412 SQIKDIVELQDVNMEENMDNNVKDPINITSLLENFDICFKLISGTQHVTLDCEPKAKINT 2471
            + +K+    Q  N   N+  + K  IN   LLE FDI   +  G Q ++L CEP AKI  
Sbjct: 2299 TMLKNSCS-QFSNGAPNL-ASAKAEINYRDLLEAFDIAVIINVGKQEISLTCEPTAKIQA 2356

Query: 2472 DVGFGSFEFSILTPHLNPIDPLDISLKINDIKTSVKHQFSNEASASFEVSKLDVILIFTH 2531
             +GF  F+  I T  + P +PL +S+ ++++  S +H FS E S+S  + ++ ++   TH
Sbjct: 2357 TIGFEKFDIKIFTNSMVPDEPLCLSVDLHNLMASSRHVFSREISSSLSLQQISMVFSLTH 2416

Query: 2532 PE---VFGTGLVDDVKLHFNLKQFQNISIFLDIWDVSKSTEKK---LFKKDSNTLVDAKS 2585
             E    +G+ L+     +FN+KQ +++++FL+IW + K        L    +++     S
Sbjct: 2417 SEYIHTYGSTLISKPLFYFNVKQIEDLNLFLEIWSIEKQKSVNDIILAPVTASSFESVPS 2476

Query: 2586 SPIAQTIVNSSTLPWSFVFIATNINGDINMGSTLGNLALNLQRTWISTDHFHNKRQLLHL 2645
             P  Q +  ++T  W ++ I + I  +I++G +LG + +     W  + H  +  Q L +
Sbjct: 2477 MPKLQRVPINATFSWDYLLIISEIGAEIDLGPSLGLVKVKSDNLWGLSSHNIDWTQKLLI 2536

Query: 2646 FTDNVKISSEGRLGGFVEIDDITWKLDVNYVDKYKFVVSPLVDLLFDVGKVSMKVAFDYH 2705
                + +SS GRLGG+V I DI WK  + +     F   PLV+L   +G  + K++FDYH
Sbjct: 2537 SMKEICMSSSGRLGGYVFIKDIVWKSKITWPIINNFHGVPLVELSLALGAFNTKLSFDYH 2596

Query: 2706 MFLISTVKDLKFHVLSEKDIDDILPDLLTVNLTCDEIKVCTTALVASNILDIYNTIMRTR 2765
            MF IST+++    + +++D    L DLL+V+++ D I+V  T+L  +N+ DIY+TI R R
Sbjct: 2597 MFFISTIQNAAIELFNQQDERGFLADLLSVSVSVDNIQVFITSLAYANLFDIYSTIRRMR 2656

Query: 2766 QDNKNSYIETLLESNNNVLKRKPLYED--ILKSLNLLQTSLSANIHELNLQISPSSLYDA 2823
             D+  + ++ LLESN   LK+   +++  +L SL  L+T LS N   LNL I  ++L   
Sbjct: 2657 NDSGRTNLD-LLESNE--LKKISSFDNSKMLASLLSLRTELSVNAQLLNLHIFSTTLIGT 2713

Query: 2824 EVIIIRVQDVF------SSTETRTGEKIKTDLEMRVYNATLSLTSFGKELTEEDIAEMSA 2877
            EV+++R + V       +S++T +  K++T+L  ++ + +LSL+SF  +L E  + ++  
Sbjct: 2714 EVVVLRTRKVIANTKNEASSKTTSDAKVQTELTWQLQDMSLSLSSFKHQLDENQLDKIDV 2773

Query: 2878 ETYISYASTLTSGRIFEIPQLTINMTTFQNADNMILQYTYSCSFDGKVDVTWNLGPINFI 2937
              Y+  AS +  G I E P + + M T+Q+  + +++  YS SF   V +TWNL PINFI
Sbjct: 2774 IDYVKLASIIHGGIILEAPSIFVTMNTWQSQYSNVIELLYSSSFGNGVSITWNLRPINFI 2833

Query: 2938 KEVWATHVRSLEVRTVQFMGNHDISLENEGDTDESV-KVLSNIEYI--ALEEPYIEMPQI 2994
            K++W+ H+ ++++R +Q   + +I +  + D +  + KV    +YI   LEEP IEMP+I
Sbjct: 2834 KDMWSIHINAMKLRHMQKGNSSEIHIPKDEDIEAKLAKVDLGTKYIYKPLEEPNIEMPKI 2893

Query: 2995 KDLKDATPPLEWFGLNRKYFPSATHQSVIVPIQKLVNVAQKEYAKVLG 3042
            KDL DATPP+EWFGLNR  FP  THQ V+VP+QKL  VA+KEY ++LG
Sbjct: 2894 KDLGDATPPVEWFGLNRSRFPGLTHQIVVVPLQKLSAVAEKEYVRILG 2941

 Score = 99.8 bits (247), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 42/108 (38%), Positives = 68/108 (62%)

Query: 6   TEFANVSLSQERYFSWVFLVYWILVVVATSTFVFYVAKLWGFGLTFACEWLLWKTMNIKV 65
           TEF  + +  ER F WVFLV W  +++      FY+ +  G+ +T    W++WK   + +
Sbjct: 5   TEFEAIQVPYERRFGWVFLVNWAQLILINVFTTFYLWRAIGYIVTKILNWVIWKRYKVVI 64

Query: 66  TIESIRLSFLTGTIFFKNVCLIDQDKTISILECSVTWRYWLLNTRKSE 113
            I+S+  S + G ++FKN+ + D+D+TISIL+ + TWRYWLLN R ++
Sbjct: 65  NIQSLGFSIIGGKVYFKNISITDRDQTISILKGTFTWRYWLLNPRPTQ 112

>AGR088W Chr7 (892680..901343) [8664 bp, 2887 aa] {ON} Syntenic
            homolog of Saccharomyces cerevisiae YLR087C (CSF1)
          Length = 2887

 Score = 1139 bits (2946), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 820/2838 (28%), Positives = 1375/2838 (48%), Gaps = 202/2838 (7%)

Query: 308  LPLDININKGAITIGNKFTRSLLVINFTEAHGLLDYALPDSKLDVFKNKVTFEINDIDMS 367
            LP++   NKGAI +GNK T S+ ++N+ +  G +   +PD        +   +I++  ++
Sbjct: 150  LPVEFLHNKGAIVLGNKQTHSVAIMNYEKLAGTVSIEVPDDTRAPSSFRTEAKISNCTVA 209

Query: 368  IKRNIGYNPELASRFNFRAGVLTRIWSYLQLVLNLIPTGRLKTWYESLRYKEDTTFVK-- 425
            IK NI Y  +   +         R+W   + +L  +    L+    + R KE     K  
Sbjct: 210  IKPNISYEVDNPVKIYVEPKRTARLWKKYKTLLGTV----LEATLHAKRKKEQHQTPKWY 265

Query: 426  -KWDGLVLYKDSVKSSTKLGADDVDFDFANHEYAKVSNFFKAPQIIFSIESDIPGIVPHG 484
              W GL +Y  ++        ++V FD  +HEYAK +   KA Q+  +    +PG     
Sbjct: 266  DNWRGLSMYDVNLDEELD---EEVKFDIEHHEYAKCTTVLKADQMDVTYSYGMPGT---- 318

Query: 485  SHPPLSKAHGPDIGNHESP----PTF--LIDLQLSHASIYFGSWVNRNIVDLRDLMFPVI 538
                   A   D  N E+P    P     +D+ +  A+  +G W NR +     +  P +
Sbjct: 319  -------ARVTDSDNAENPLLERPELDHSVDILVYDANCTYGPWANRQVQQCLRVFSPTV 371

Query: 539  SKDQKPLNKLKPGLTRVHSMFNFSVSVLDDSSIRLPTREPSKDSDFLKQYLETKDDFRAF 598
             ++ K     +       + F  SV++++DS +R+P +E SKD+ FL++Y +T+D+ R F
Sbjct: 372  CRNFKLRTPEEIAQQTEPAAFKLSVTIMEDSVLRVPMKESSKDAAFLEKYKQTRDETRPF 431

Query: 599  GWIDLSFKKGSEFMLNIPMIPTSGGFENTLFSKFSELEVTTSVNHNLLFKSNSLNIAANI 658
            GWID+   K S   + +   PT  GFEN L +   +  ++TSVNH+ L K+ S +I  + 
Sbjct: 432  GWIDIRIAKESNITVRMAAYPTENGFENILHANLVDTTISTSVNHDTLLKAKSHDITVDF 491

Query: 659  GYPLGWNDPVNWIFNINSKQLDIFLLREHITLLSDMIIDFSTQEPTPYELFRSFTYNLNL 718
             YP GW D   W FN+ S Q ++F+LR+H+ L+SD++ DFS  E   YE FR F Y    
Sbjct: 492  SYPYGWQDKAEWNFNVCSTQAELFVLRDHVYLISDLVTDFSGGEEVLYEQFRPFDYRFRW 551

Query: 719  KIGGYSFYFNVNDRNIINNPLDFNENCYLSFHGDLFTSEITIPIISLAQQYVTISYEIFT 778
             I GYS Y NVND NIINNP+DF ENCYLS HGD      ++PI S+ Q+YVT+ + IFT
Sbjct: 552  DIRGYSAYLNVNDANIINNPIDFGENCYLSVHGDDAEITFSLPITSIIQKYVTVDFNIFT 611

Query: 779  PMFRLFLNTPSWNTLSEFMRNKEIGRSHDFRVSGTYLIYSELDIDNVDSLTIDFESNSTV 838
            P F LFLN P W+T SE +  KEIGRS +F + G+Y  YSE+D+DNVD+L I  E++  V
Sbjct: 612  PHFSLFLNAPPWHTFSELLHYKEIGRSKNFNIKGSYTSYSEVDVDNVDALNIACETDYIV 671

Query: 839  LYCFGFVIKYMMNFQANYFGSFIKFITTEEYSELI--RNNVNDNL-------GSINTNDL 889
            + C+G ++K M+N + NYFG  + F TTEEY E +  RN  N +        G+++ +D+
Sbjct: 672  VLCYGVILKCMLNVKVNYFGEMVHFRTTEEYVEELQRRNKQNPSTCRPFNSDGNVHDSDV 731

Query: 890  TSIEGLQKMDSITNDVEDINQKTIKRSDLLRTENETDIWLNFKVNDGALILPEELYNGDS 949
             + E  + +D+  +        TIK+S L R+ NE D+W  F    G    PE +Y  D+
Sbjct: 732  VATESNEIIDASFDAFG--GPPTIKKSALKRSINELDVWFTFISKGGCFFFPENIYKFDA 789

Query: 950  CVSLSFGELFINMRTCNYYMDVYITLYDNNLNRFEKIDPHELFEYIQTRNRS-SSVEGNI 1008
            C+   F  L  ++R  NYY+D  ++L      R   ID   LF+ I+       + +  +
Sbjct: 790  CLGFYFDNLEASLRFLNYYVDAAVSLDSIYFKRHTDIDARTLFKVIEDIGIPIDASDAYL 849

Query: 1009 SDITIHGHRMYGLPPKELTYFCQWSINIGTFLIDSDMIFLLSFIQSLNKIGFFLSNKENS 1068
            S  +   H+M G+ P E +Y C++ + + T  +  D+  L +F+ +L  + F   + ENS
Sbjct: 850  SQFSFRLHKMLGIMPSEESYACEFDVRVDTLDVHCDLAVLKAFVNTLRNLAFGFKDVENS 909

Query: 1069 LLYESDTVNDMTLLSVDVESLKVILS--DPLLEARAEIGASSIIIRNIDFENEKYTKRLD 1126
            L YE + V D+  +S  +E++ V L   D   +    +      + + D  NE+Y++R D
Sbjct: 910  LQYEREQVFDLNKISCVIENVTVKLQNVDKDEDIWLSLNLPVTTLTSFDLANERYSRRSD 969

Query: 1127 VNASEFYFSLDSLKIDSGKKNILDVRTKLNITNFFKTDNHINHLDTQRKFIGLHDSPYHR 1186
            ++  E  F +   + DS    +    T + +T F + +        QRK I ++D+P+HR
Sbjct: 970  LSIPELLFGI--YRGDSESTCLGAFSTGVTVTLFERFEQFARCRVLQRKHILVNDAPFHR 1027

Query: 1187 CFFLLPEKFQESSSYKELYGSITPSFSLPMLPIPHIYSTTNFIVEGILDD-YSEFLLS-- 1243
            C F+LP ++++   Y+ LYG I PS SLP+ P P        I E +L + Y E+     
Sbjct: 1028 CSFMLPPEYKKMPIYRSLYGCIPPSSSLPLFPEPISADNFEVIFEKLLGEIYQEYASDSS 1087

Query: 1244 -------------DHHNQMSINAELNSVDTTPLKDSFDMQITNFQNILTTEDPYETDNFV 1290
                         D+HNQ ++NA + +        S  ++  N Q  L++        F+
Sbjct: 1088 YQITDDSISSTEHDYHNQ-TVNAAIGT------SSSLFIRSQNHQQTLSS--------FI 1132

Query: 1291 VNV----KYLTVTVNPDIVFTIEKFSTEFNKKFSMNNQIDGIEMAIVNRLSDLKENISSK 1346
            V       YL ++   + +  I K+ TE     S++  ID +E+ I+N+        +  
Sbjct: 1133 VEFDPIDGYLDLSAT-EFMLEIYKYLTE----VSLDEAIDSLEIGIINQFIQTFGEDNGI 1187

Query: 1347 INVNLNVEKIDAAWGHRDVCF----IGTYINMLKFELSQESTYNNNGGLQKDLTLLGKFR 1402
              V +    I  +  ++   F    + + I  L      +S+  N     +  TL  K  
Sbjct: 1188 SEVRVLCPNISLSATNKQSKFSMFKLSSKIKNLDITSRIKSSDPNLKPDPEKTTLCYKID 1247

Query: 1403 SVRI-IIQNHSYNSFSDDRPPGL-SLMLEGFEAWXXXXXXXXXXXXXXXFDITVDEYQIH 1460
             +R  I+Q+         +P  L S  +E  E +                 +T+      
Sbjct: 1248 YIRANIVQDGIV--VPPKQPSQLFSCSIELLEGYLSYDKLSLLDNNVQSCSVTLSPGTDK 1305

Query: 1461 WLIPYVKSQILLFTKIQDSVKLIYDEQASYQKTFITSLIWAGEKYQIDHDPYVITKPATV 1520
             L  ++   I  F  +Q  +    D   + ++ F+ +++  G  Y+I HDP VITKPA +
Sbjct: 1306 LLFEFLNPFISTFDLLQRELSSFEDTLLASKREFLLNILRGGRDYEIQHDPPVITKPANI 1365

Query: 1521 LRLSAWHIRENRSWRIVTKLRHILTYXXXXXXXXXXXXXXIKRSGLEKEAASTFLNVFSN 1580
             R S  HIR   SWRI+ +LRHIL Y               +     +EA   FL++FS+
Sbjct: 1366 TRFSNRHIRSAESWRIIMRLRHILNYLPQEWHQSFTRHLGTQDFTSPEEAGKEFLSIFSD 1425

Query: 1581 WRNWEVSDIEKSYIYRMIFVEEVSKRILQNSIKVFLETFYFTIYSRNYSADQNFLITKAN 1640
            WR+WE +D++ S+++  +F +   KR                  SR ++A Q F  +  +
Sbjct: 1426 WRSWEPTDVQGSFVHEKVFTK---KR------------------SRPFAALQGFTFSSDD 1464

Query: 1641 ILINNEADQ-----VNEVDL-IRK---QEEIVDVVTKIGS------IKFEFT-EAILKLK 1684
            I +N + D      V  V L IR      E VD  T+ GS      I F  T E ++++ 
Sbjct: 1465 IRLNMKDDARVPITVKGVTLGIRNNGLAPEQVDGRTE-GSMPDPDYISFCTTDEVVMRVD 1523

Query: 1685 RDIEQIIKTSVDSKSE---GDKLSITKFFKV----NLSFIFDHIDFNGQFYNSSLKSRMS 1737
            R   + +K   D       G  +   K   V    N++F F  +    +     L+  + 
Sbjct: 1524 RSFVKTLKEFRDLIHRFKIGGPVGTAKHDNVSLFSNITFQFGKLYVVAKLAGVYLRICLD 1583

Query: 1738 NVNILSYF-ENNIESSTPSGSFVYYADRTGIALKHLNNILIDCQVRNLFASTTAELHSAV 1796
            N++ L    ++++ES   S S         ++  H+  IL     R  F +   ++ S +
Sbjct: 1584 NLSALMLTSQSSVESKVISSS--------TLSFDHMQAILGYRSFR--FMTIDIDMFSVL 1633

Query: 1797 NSLMINFRCSNLHFKSVPKTEIFVNAIKAIQRDVETLSAEISKAQGTTDNINTEHTPSVH 1856
               +    C ++ +K+    +  +++  A  +D   L+  +   +     +     P + 
Sbjct: 1634 LHYLPGQGCYSIDWKA---RKFHIDSSSATTKD---LTESLPYVRDEIKYLVEALVPELF 1687

Query: 1857 EKNKMQKAKPNSK-NNITLSATFTNVSSEITLLHPIYLKHETNSVNISYNTINIDELLVQ 1915
             +  +++    +K + +       N++ ++ +L P  + +   + N      + D ++  
Sbjct: 1688 AEPPIERESSGNKIHAVLFQGQVANITLKLQILSPFIILY--CAENFELQAESTDSVIFD 1745

Query: 1916 VLDTDLYLNSSHTKEQYARLSYDKLELTTFLPDLNEKLID-LEISSSILKLTTSDPRRML 1974
            +   + Y+  S  K++     Y    L       + +L + +     ILKL+  D +  +
Sbjct: 1746 LNSGESYMEISSAKQKLDYFKYTHTCLKLSGTSSSARLFEHISCDIGILKLSVFDLKTRI 1805

Query: 1975 FSFLQDEKELKNSLTFLRSLESLNRKANSEDSETLFSSYEWI----VNFKSKYMGVLLPI 2030
               LQD   +K +L  ++SL  +   + S  + + F S+  I    ++ ++ Y G+LL  
Sbjct: 1806 TDLLQD---IKAALFSMKSLSDILNISQSSPTASAFGSWFSILPDNLSLQATYAGLLLGF 1862

Query: 2031 QATYYVFELHDALSTVSNKEEPSSAVHKK-FHGDLSFDHIIFLIKDQSIPHKFSKILDFS 2089
              T Y+ E ++  +  +    P +   +  F  D S +   FLIKD+ I  + +K++DF+
Sbjct: 1863 GHTLYILEFNNFEAKHTRDGLPDAITPRPCFKVDHSIESASFLIKDRRIDDRLAKVVDFA 1922

Query: 2090 IKLSTHRTVNNFDRSFEIESSFFRVCLTPFSLIQTMWGXXXXXXXXXXXXDQSTXXXXXX 2149
            +  +     +   +S +IES+  ++ L P ++++ +              ++S       
Sbjct: 1923 VNFNMVHDTDLCIQSVQIESTHLKITLAPMTVVRLLSLINEFGIIRKQFTEESIYTPSSA 1982

Query: 2150 XXXXIDGATNSEKENVFS--VRSFHILSYNFSIGWLYQDSDNTIPGLILGYNRLFSTYED 2207
                   AT   + +V+   ++S HILS++FSI WL+   +++  GLI GY+RLFS YE 
Sbjct: 1983 HNNST--ATECLEPSVWRLIIKSGHILSHDFSIVWLFDIPNSSADGLICGYDRLFSVYEK 2040

Query: 2208 NHGKLTLVDGFFSLAN--GSSGDTFYSSGDESSKFNRSYLPNIQILYWIKEIEKMKHLFI 2265
             +GKLTL++ +FS A    S  D FYSS     + N SYL ++Q+ YW  E  +   LFI
Sbjct: 2041 PYGKLTLLNAYFSAAKILASEAD-FYSSVVRKQRINTSYLSDMQLRYWFTEDSENTDLFI 2099

Query: 2266 KFHGETLDVNFFENFVNIIESTVRSIDLFQTLKREKINPLVKAKPERDEKSNSALTNIKG 2325
            + HG  L V+     V ++E T++SI  F  LK+  ++P    K  +D   +    N   
Sbjct: 2100 RIHGAKLAVDISAEIVTLLEETIQSIQTFNNLKKALVDPFRTKK--QDSDISKEPYNWNN 2157

Query: 2326 PIFGKLKQVNCEFIYDGGLFRLFSNASMTNKLEPTLMIKSPKVKIMLSYDYFEKELKKHW 2385
             +   ++ +NC   Y G   +L S+    +     L + SP  K+ + Y YF    K H 
Sbjct: 2158 QLATGVRSLNCIINYAGVTLKLHSHDGRGDA--SPLELTSPSYKVAIDYKYFPNLEKTHR 2215

Query: 2386 INCLIDIEPTQNVLKSGCVPFLSDFISQIKDIVELQDVNMEENMDNNVKDPINI------ 2439
               LI   PT N   S     + D   +   +++    +  EN  ++     +I      
Sbjct: 2216 FRTLITATPTHNTFYSTSAFLIHDLCYRFSKLLK---TSSTENKSSSASTSSSIKVEGSD 2272

Query: 2440 -TSLLENFDICFKLISGTQHVTLDCEPKAKINTDVGFGSFEFSILTPHLNPIDPLDISLK 2498
             ++LL + D+   L  G Q VT  CEPKAK+   VGF  F+  I   ++N  + L ++++
Sbjct: 2273 NSTLLGSIDLVIILNVGKQEVTFSCEPKAKVQATVGFEKFDIKIFNNNINDEESLCLAIE 2332

Query: 2499 INDIKTSVKHQFSNEASASFEVSKLDVILIFTHPEV---FGTGLVDDVKLHFNLKQFQNI 2555
            I ++ T+ +H +S E  AS ++  + ++      +V   +G+ L+     +FN+KQ Q++
Sbjct: 2333 IENLMTNSRHIYSREVCASLKLRHISMVFDIMGSQVRRIYGSTLISSPLFYFNMKQLQDL 2392

Query: 2556 SIFLDIWDVSKSTEKKLFKKDSNTLVDAKSSPIAQTIV---NSSTLPWSFVFIATNINGD 2612
             +F+D W   + T           LVD  S  I        +SS+  W +  I      +
Sbjct: 2393 KLFIDQW-FPQKTPMNTGSYPEGVLVDDISRSIGSKFYKGSSSSSFTWGYSVIVAGSCAE 2451

Query: 2613 INMGSTLGNLALNLQRTWISTDHFHNKRQLLHLFTDNVKISSEGRLGGFVEIDDITWKLD 2672
            I +G +LG L +  +  W  +    +  Q L L    + ++S GRLGG   + +    L+
Sbjct: 2452 IELGPSLGVLNVTSEDVWAISKQQVDWSQQLDLNMGKLDVTSSGRLGGNFLVRNAHLSLE 2511

Query: 2673 VNYVDKYKFVVSPLVDLLFDVGKVSMKVAFDYHMFLISTVKDLKFHVLSEKDIDDILPDL 2732
            + + +   F   PLV +      V  K++FDYH F IS++K     + +E+D D  L DL
Sbjct: 2512 LKWPNPKDFFQVPLVCVKLGSDTVDTKLSFDYHTFFISSLKQGYASLFNERDEDGSLADL 2571

Query: 2733 LTVNLTCDEIKVCTTALVASNILDIYNTIMRTRQDNKNSYIETLLESNNNVLKRKPLYED 2792
            L+V ++ + + +  TAL A+NI DI N+I R ++DN+ SY+ + L S+    + +   ED
Sbjct: 2572 LSVTVSFESVNIFLTALAAANISDIKNSITRLKKDNELSYLSSFLASDQPSDEPE---ED 2628

Query: 2793 --ILKSLNLLQTSLSANIHELNLQISPSSLYDAEVIIIRVQDVFSSTETRTGEKIKTDLE 2850
              I  +L+LL+T LS N+    LQISP+SL+D++V+I+    + ++T  +   KIKTDL 
Sbjct: 2629 GGIFDTLSLLRTQLSLNLGVFRLQISPTSLFDSDVLILTATKMMANTGIQADIKIKTDLH 2688

Query: 2851 MRVYNATLSLTSFGKELTEEDIAEMSAETYISYASTLTSGRIFEIPQLTINMTTFQNADN 2910
             ++ + +L+L  F   L E  +A M    YI  +ST+  G IF  P + +NMTT+Q   +
Sbjct: 2689 WQLDDVSLALLPFNNSLDESYLATMEVGKYIELSSTIQGGAIFSAPSIVVNMTTWQEPQS 2748

Query: 2911 MILQYTYSCSFDGKVDVTWNLGPINFIKEVWATHVRSLEVRTVQFMGNHD----ISLENE 2966
             +++  YS SF G V + WNLGPI+FIK++W  H+ ++++R   + G  +    ++  N 
Sbjct: 2749 NVIELLYSTSFGGTVKIRWNLGPISFIKDMWQAHMNAMQLREGYYHGLAESGVAVTPLNS 2808

Query: 2967 GDTDESVKVLSNIEYIALEEPYIEMPQIKDLKDATPPLEWFGLNRKYFPSATHQSVIVPI 3026
                  + + S+ +Y+ L+EP IEMP+IKDL DATPP+EWFG+NR  FP  THQ VIVP+
Sbjct: 2809 KAVPLEMHLGSDYQYLPLQEPDIEMPRIKDLGDATPPIEWFGVNRTKFPGFTHQFVIVPL 2868

Query: 3027 QKLVNVAQKEYAKVLGSS 3044
            QKL   A+KEY K+LG +
Sbjct: 2869 QKLARTAEKEYEKILGRA 2886

 Score = 73.2 bits (178), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 32/87 (36%), Positives = 54/87 (62%), Gaps = 4/87 (4%)

Query: 38  VFYVAKLWGFGLTFACEWLLWKTMNIKVTIESIRLSFLTGTIFFKNVCLIDQDKTISILE 97
           +FYV ++ G+ ++ A   +LWK   + V+I+S+  S L G + FKNV +  QD+ IS+L+
Sbjct: 6   IFYVGRVLGYIVSKAANLVLWKQYRVTVSIQSLVFSPLAGKVHFKNVSVTSQDQLISVLK 65

Query: 98  CSVTWRYWLLNTRKSEYELNAKADTSK 124
            ++TWRYWL+      Y  +  AD ++
Sbjct: 66  GTITWRYWLIG----RYRRSGTADGAR 88

>KLLA0F19096g Chr6 complement(1762215..1770986) [8772 bp, 2923 aa]
            {ON} similar to uniprot|Q12150 Saccharomyces cerevisiae
            YLR087C CSF1 Protein required for fermentation at low
            temperature
          Length = 2923

 Score =  684 bits (1765), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 458/1507 (30%), Positives = 735/1507 (48%), Gaps = 135/1507 (8%)

Query: 183  KLDSLFAINCTGFEIFLYNRKRAYETIIQNFSKEEKIQFIDFLRQHDLDDIFEEVSSEIK 242
            KL   F + C G E+F+YN+   YE++               LR H     F  V+    
Sbjct: 127  KLPCRFLLQCDGLEVFVYNKIDVYESV---------------LRDH-----FTNVT---- 162

Query: 243  NCNEYCNHKEGNNSAHFGSSCKSDKESASNISISGDSQEXXXXXXXXXXXXKISAHIMRK 302
                    K+G  +        + +++A+N  +S  S+             K+SA     
Sbjct: 163  --------KDGQETESNDDITINTEKAAANSKLSNSSRYSYSGRSKSTDAPKLSAKT--- 211

Query: 303  LHLDILPLDININKGAITIGNKFTRSLLVINFTEAHGLLDYALPDSKLDVFKNKVTFEIN 362
                + P+ +  N+ AI +GN+ TR + V  F +A G+ D     S LD ++ K++ ++ 
Sbjct: 212  ---KLFPIQLEANRAAIVLGNRNTRHVGVFKFEQAKGVYDIFSSISDLDYYRTKISLDLY 268

Query: 363  DIDMSIKRNIGYNPELASRFNFRAGVLTRIWSYLQLVLNLIPTGRLKTWYESLRYKEDTT 422
            D    ++ N+GY  +   +       + +IW  ++     I   +L    +         
Sbjct: 269  DALFELRTNLGYQNDNPIKTFVVEKTMDKIWQTVKK--QCISISKLLLPNQGKTINNQQA 326

Query: 423  FVKKWDGLVLYKDSVKSSTKLGADDVDFD-FANHEYAKVSNFFKAPQIIFSIESDIPGIV 481
            ++  W GL LY      +  +  ++VD       EYA+ S   KA ++  +   DIPGIV
Sbjct: 327  YIDSWKGLDLYH----HTKAVQEENVDTTVLHEQEYARYSRVMKAERVSLTYYFDIPGIV 382

Query: 482  PHGSHPPLSKA---HGPDIGNHESPPTFLIDLQLSHASIYFGSWVNRNIVDLRDLMFPVI 538
            P  S    S++      +    +  P F  D+ +  A++Y+G W ++++ D+  L  P++
Sbjct: 383  PANSSSINSQSDRDESLNCNQDDDTPAFGTDIHIYTAAVYYGPWAHKHMQDIIRLFSPIV 442

Query: 539  SKDQKPLNKLKPGLTRVHSMFNFSVSVLDDSSIRLPTREPSKDSDFLKQYLETKDDFRAF 598
            S+DQ    K +PG  R++  F  SV   D S + +PTRE SKD +F+K+Y  T D  RAF
Sbjct: 443  SRDQMKATKPEPGSLRIYENFKLSVDFRDKSVLHIPTRESSKDEEFIKRYKTTGDTHRAF 502

Query: 599  GWIDLSFKKGSEFMLNIPMIPTSGGFENTLFSKFSELEVTTSVNHNLLFKSNSLNIAANI 658
            GW+++S  +G E + N+ +   +    N L+      E+ +SVNH +LF+ N+  I ANI
Sbjct: 503  GWLNVSLNEGGEILFNLALCSQADRLPNELYVLLLNPEIKSSVNHEVLFRCNTQTIKANI 562

Query: 659  GYPLGWNDPVNWIFNINSKQLDIFLLREHITLLSDMIIDFSTQEPTPYELFRSFTYNLNL 718
            GYP GWN   +W+F ++S+  ++FLLR+HI+L+SD+  DFS  +   YELFR FTY +  
Sbjct: 563  GYPTGWNKQADWLFELDSRTAELFLLRDHISLISDLFTDFSANDALRYELFRPFTYEIKW 622

Query: 719  KIGGYSFYFNVNDRNIINNPLDFNENCYLSFHGDLFTSEITIPIISLAQQYVTISYEIFT 778
                Y  + NVND NIINN LD NENC+LS  GD+  + I +P  S+ ++    ++ + +
Sbjct: 623  VFTEYKLFLNVNDANIINNLLDLNENCFLSLSGDILNTSINLPFTSIVKEPHETTFLLKS 682

Query: 779  PMFRLFLNTPSWNTLSEFMRNKEIGRSHDFRVSGTYLIYSELDIDNVDSLTIDFESNSTV 838
            P+ +L ++ P WNTL EF+     G   DF ++GTY+ +  +D+DN D++ IDF S+ST 
Sbjct: 683  PLVKLSIHPPCWNTLHEFLSETTFGECPDFSMTGTYISFPSVDVDNTDTILIDFRSSSTK 742

Query: 839  LYCFGFVIKYMMNFQANYFGSFIKFITTEEYSELIRNNVNDNLGSINTNDLTSIEGLQKM 898
               FGFV++Y+MN + NYFG F  F TTEEYS         N  S+  +  T  +  Q+ 
Sbjct: 743  FLSFGFVLRYLMNIKLNYFGDFNHFKTTEEYS---------NDLSMEEDTKTKTKNFQEQ 793

Query: 899  DSITNDVED---------------INQKTIKRSDLLRTENETDIWLNFKVNDGALILPEE 943
               TNDVE                IN+ TI +S LLRT+NETD+W+ F VNDG +I+PE 
Sbjct: 794  P--TNDVESLTSSSSDGSYQVADTINENTIHKSSLLRTKNETDVWITFFVNDGCIIIPEN 851

Query: 944  LYNGDSCVSLSFGELFINMRTCNYYMDV---YITLYDNNLNRFEKIDPHELFEYIQTRNR 1000
            LY+      LSF  L  +MR  NY+MD+   +  +Y N+ N F           +     
Sbjct: 852  LYDCQRSFLLSFRRLEFDMRYTNYFMDLTAFFSRIYLNHSNEF------SFNRVVAIEES 905

Query: 1001 SSSVEGNISDITIHGHRMYGLPPKELTYFCQWSINIGTFLIDSDMIFLLSFIQSLNKIGF 1060
             S   G + D+ +HGHRM+G+PP E TY C+W I+IG+   DSD  FL SF++++ K+GF
Sbjct: 906  HSENTGYLDDLNLHGHRMFGVPPVEETYLCKWDISIGSLSTDSDGQFLFSFLEAIQKVGF 965

Query: 1061 FLSNKENSLLYESDTVNDMTLLSVDVESLKVILSDPLLEARAEIGASSIIIRNIDFENEK 1120
               + EN L+Y      D+T L++ +  +  I+        A +  + I I + D  N +
Sbjct: 966  TYKDAENILIYSIHKPEDVTSLTISIGRVSSIVRTN-HGGSATLSLNDITINSWDLSNSR 1024

Query: 1121 YTKRLDVNASEFYFSLDSLKIDSGKKNILDVRTKLNITNFFKTDNHINHLDTQRKFIGLH 1180
            Y+KR+D+  +    ++    ID  K  +    T + +T F    N  NH  TQ+  + L+
Sbjct: 1025 YSKRVDLLVA----AISVCAIDEKKTVLFTCDTAVELTKFVVRSNMKNHRVTQQNCVLLN 1080

Query: 1181 DSPYHRCFFLLP-EKFQESSSYKELYGSITPSFSLPMLPIPHIYSTTNFIVEGILDDYSE 1239
            DSP+HRC FLL  ++   S+ Y +L GSITPS SLP L  P  + T + I E +L  Y  
Sbjct: 1081 DSPFHRCKFLLAFDQLNHSTLYDDLLGSITPSISLPTLSEPLTFQTFDNIYERLLGSYIN 1140

Query: 1240 FLLSDHHNQMSINAELNSVDTTPLKDSF--DMQITNFQNILTTE------DPYETDNFVV 1291
                       IN + + +DT  L D    D ++    N ++ +      + +E++N  V
Sbjct: 1141 L----------INFDTDIIDTKNLTDDRPDDKRLLPLSNTVSNDLSGQLAEEFESENTTV 1190

Query: 1292 NVKYLTVTVNPDIVFTIEKFSTEFNKKFSMNNQIDGIEMAIVN----------------- 1334
            N+  L+V V P   FT  + +  F    S  + +D  EM IVN                 
Sbjct: 1191 NISTLSVFVTPK-AFTFAENAAHFMLTMSTESIMDYFEMNIVNIFSVGHITNGKFFNSSV 1249

Query: 1335 RLSDLKENISSKINVN-LNVEKIDAAWGHRDVCFIGTYINMLKFELSQESTYNNNGGLQK 1393
             L ++K NIS +  ++   +E +D       V  I     +LK+  + E + N + G+  
Sbjct: 1250 MLKNVKVNISDETALDKTQLEALDRL--ELSVSNISVISKILKYPQNLEQS-NESTGITD 1306

Query: 1394 DLTLLGKFRSVRIIIQNHSYNSFSDDRPPGLSLMLEGFEAWXXXXXXXXXXXXXXXFDIT 1453
            D T+   F S++  I   S N  +   P     +L  F                      
Sbjct: 1307 DSTISCNFDSLQFNIFKSSKNRLTKVLPIAWFEIL-MFNTVLFSDVGKVSKLIFGSIKSA 1365

Query: 1454 VDEYQIHWLIPYVKSQILLFTKIQDSVKLIYDEQASYQKTFITSLIWAGEKYQIDHDPYV 1513
            + +  + W + Y+      F K   S   +   ++   K  I  +   G+   ID  PY+
Sbjct: 1366 ILDADVEWTVEYLLKLAKAFCKEGKSCIELGKLRSIDMKETIIRVAELGKISGIDSVPYI 1425

Query: 1514 ITKPATVLRLSAWHIRENRSWRIVTKLRHILTYXXXXXXXXXXXXXXIKRSGLEKEAAST 1573
            ITKPA + RLS +H+R+  SW+I+T+LRH+  +               +      +  S 
Sbjct: 1426 ITKPAYITRLSKFHVRDTASWKIITRLRHVSKHTSHVSETTSQCDDIPEEVRNICKDKSQ 1485

Query: 1574 FLNVFSNWRNWEVSDIEKSYIYRMIFVEE--VSKRILQNSIKVFLETFYFTIYSRNYSAD 1631
            FL++F +W+NW+V ++E+S ++ ++F  E  V +  L N + + LE  +  +    Y+  
Sbjct: 1486 FLDIFVDWKNWDVYEVEQSSLFTLLFSGESTVHEEDLFNELSLSLEMLHLEL---PYAPQ 1542

Query: 1632 QNFLITK 1638
            Q+ +I K
Sbjct: 1543 QSSIIAK 1549

 Score = 96.3 bits (238), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 46/106 (43%), Positives = 68/106 (64%)

Query: 5   GTEFANVSLSQERYFSWVFLVYWILVVVATSTFVFYVAKLWGFGLTFACEWLLWKTMNIK 64
            + F  +S+S E+  S  FLV WIL V+      FY+ ++  + LT   ++ +W+   IK
Sbjct: 4   SSTFRPISISDEKDLSVPFLVDWILAVILCILAPFYLGRILAWVLTKGLDFWVWRQYKIK 63

Query: 65  VTIESIRLSFLTGTIFFKNVCLIDQDKTISILECSVTWRYWLLNTR 110
           + ++SI++SFL G IFFKN+ ++  D TIS LE S TWRYWLL+TR
Sbjct: 64  INLQSIKVSFLGGRIFFKNLTVVSNDFTISFLEGSFTWRYWLLHTR 109

>Kwal_56.23808 s56 (712095..712280) [186 bp, 62 aa] {OFF} YLR087C
          (CSF1) -  [contig 173] PARTIAL
          Length = 62

 Score = 51.2 bits (121), Expect = 4e-07,   Method: Composition-based stats.
 Identities = 22/62 (35%), Positives = 36/62 (58%)

Query: 4  LGTEFANVSLSQERYFSWVFLVYWILVVVATSTFVFYVAKLWGFGLTFACEWLLWKTMNI 63
          + +EF  V +S  + FSWVFL  W+L++  +    FY  ++ G+ +T   E+L WK   +
Sbjct: 1  MSSEFRRVPISTAQDFSWVFLTDWVLILSVSLLSAFYFGRVLGYTITTILEYLAWKRYGV 60

Query: 64 KV 65
          KV
Sbjct: 61 KV 62

>KAFR0A02740 Chr1 (570430..573873) [3444 bp, 1147 aa] {ON} Anc_8.824
           YML104C
          Length = 1147

 Score = 45.1 bits (105), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 45/166 (27%), Positives = 79/166 (47%), Gaps = 15/166 (9%)

Query: 681 IFLLREHITLLSDMIIDFSTQEPTPYELFRSFTYNLNLKI-GGYSFYFNVNDRNIINNPL 739
           I L+ +HIT+ + M I  S QE     L  + TYN  LKI  G +   +  D++I N+  
Sbjct: 164 ISLITDHITVFNTMDIPSSYQENKKASLKYAITYNKILKIHQGITLKSDSLDKDIENHTK 223

Query: 740 DFNENCYLSFHGDLFTSEITIPIISLAQQYVTISYEIFTPMFRLFLNTPSWNT------- 792
           +  E    S  G+    E++ P +S+  + + +S  +F P+   + +  SWN        
Sbjct: 224 NIIEKALFSVLGE---EEMSSPFVSVLSKEI-LSMAVFCPLLTKYCDPYSWNMSLISICK 279

Query: 793 --LSEFMRNKEIGRSHDFRVSGTYLIYSELDIDNVDSLTIDFESNS 836
             L E  + +E+ +    ++  + LI  E +I N+ S  ++F  NS
Sbjct: 280 KILEERSQAQEVRKILTKQLHTSQLIDHE-NITNLKSCAMEFNINS 324

>TBLA0A10430 Chr1 (2564651..2567206) [2556 bp, 851 aa] {ON} Anc_5.272
            YHR028C
          Length = 851

 Score = 36.6 bits (83), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 31/129 (24%), Positives = 60/129 (46%), Gaps = 17/129 (13%)

Query: 1923 LNSSHTKEQYARLSYDKLELTTFLPDLNE----KLIDLEISSSILKLTTSDPRRMLFSFL 1978
            LNS HTK+   ++S++ +   TF P L      +++D E +   L +T S+   M+ S +
Sbjct: 85   LNSRHTKDGSLKISFENVRNNTFKPKLQSLQWLRVLDFETNDRGLFMTVSNDTYMVKS-V 143

Query: 1979 QDEKELK-----NSLTFLRSLESLNRKANSEDSETLFSSYEWIVNFKSKYMGVLLPIQAT 2033
             D++  +       +T   +   ++    S D + L      + N++  Y G       T
Sbjct: 144  HDKEYCQILYQGKDITIHGTAYKIDSLVASPDLKRLLIRTNSVANWRHSYFG-------T 196

Query: 2034 YYVFELHDA 2042
            YY++E+ D+
Sbjct: 197  YYIYEIEDS 205

>NDAI0E00810 Chr5 complement(163826..165307) [1482 bp, 493 aa] {ON}
            Anc_8.742
          Length = 493

 Score = 36.2 bits (82), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 30/112 (26%), Positives = 54/112 (48%), Gaps = 4/112 (3%)

Query: 2571 KLFKKDSNTLVDAKSSPIAQTIVNSSTLPWSFVF-IATNINGDINMGSTLGNLALNLQRT 2629
            ++FK + +     KS   A+ I+  S +   +++ +  +   +IN GST   L  +    
Sbjct: 9    QVFKNEKSREGVLKSCNAARFILKHSIMKQKYLYAMRCSTCKEINAGSTFMCLQCDFSGC 68

Query: 2630 WISTDHFHNKRQLLHLFTDNVKISSEGRLGGFVEIDDITWKLDVNYVDKYKF 2681
            W ++D  ++ +Q+ H+F+ N   SS G L  F  +D I     +NY    KF
Sbjct: 69   WNNSDFANHSKQMGHIFSIN---SSNGLLFCFKCVDYIGDVEQINYSMLNKF 117

>Skud_7.451 Chr7 (749618..751033) [1416 bp, 471 aa] {ON} YGR141W
            (REAL)
          Length = 471

 Score = 35.4 bits (80), Expect = 2.3,   Method: Composition-based stats.
 Identities = 29/125 (23%), Positives = 56/125 (44%), Gaps = 11/125 (8%)

Query: 1173 QRKFIGLHDSPY-----HRCFFLLPEKFQESSSYKELYGSITPSFSLPMLPIPHIYSTTN 1227
            +  F+ + D P+          L P +  E +   +  GS+ P + +   P+ H+YS   
Sbjct: 47   EEAFVEMKDGPWGTDIVSNMLPLHPSEVTEDNKSLKYKGSV-PQYVIDNSPLLHLYSEEK 105

Query: 1228 FIVEGILDDYSEFLLSDHHNQMSINAELNSVDTTPLKDSFDMQITNFQNI-LTTEDPYET 1286
            +    + D    F L DH  +  I   L   D + L++ + +++ N   + +++ED Y T
Sbjct: 106  YWPADVKDFVKRFQLRDHSGEHIIKESLR--DLSDLREHYLVELENSTWVRISSEDSYMT 163

Query: 1287 --DNF 1289
              D+F
Sbjct: 164  SLDDF 168

>Skud_8.269 Chr8 (471255..473060) [1806 bp, 601 aa] {ON} YHR202W
            (REAL)
          Length = 601

 Score = 35.4 bits (80), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 49/222 (22%), Positives = 87/222 (39%), Gaps = 45/222 (20%)

Query: 2771 SYIETLLESNNNVLKRKPLYEDILKSLNLLQTSLSANIHELNLQISPSSLYDAEVIIIRV 2830
            S++ +   +NN  +   PL E       +++     N+ E N +       D ++II+  
Sbjct: 193  SFLFSFQRANNRAIVTPPLEE-------IMEKGWFQNMTETNKE------EDIDLIIVFG 239

Query: 2831 QDVFSSTETRTGEKIKTDLEMRVYNATLSLTSFGKELTEEDIAEMSAETYISYASTLTSG 2890
                 +T+    E +K    +R Y     +  FG      D  ++ ++     +S L SG
Sbjct: 240  H--LPATDPAEREMLKIHALVRKYYPNTIIQYFGGHTHIRDFVQLDSK-----SSCLQSG 292

Query: 2891 RIFE-IPQLTINMTTFQNADNMILQYTYSCSFDGKVDVTWNLGPINFIKEVWATHVR--- 2946
            R  E +  L+INMT F + DN I    Y                I+F K+ +  H+R   
Sbjct: 293  RFAETVGFLSINMTNFADFDNPIFTRRY----------------IDFNKDAFTYHLRRIA 336

Query: 2947 -----SLEVRTVQFMGNHDISLENEGDTDESVKVLSNIEYIA 2983
                 SL  R   F+      L +E + D+ +  +    Y++
Sbjct: 337  NDADISLSTRRGGFISRLVNDLRHELNLDQKLGYIPRTYYVS 378

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.319    0.136    0.393 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 330,273,429
Number of extensions: 15701724
Number of successful extensions: 58197
Number of sequences better than 10.0: 142
Number of HSP's gapped: 59514
Number of HSP's successfully gapped: 185
Length of query: 3046
Length of database: 53,481,399
Length adjustment: 128
Effective length of query: 2918
Effective length of database: 38,804,151
Effective search space: 113230512618
Effective search space used: 113230512618
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 75 (33.5 bits)