Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
TPHA0J007208.259ON1393139364000.0
Kpol_392.88.259ON1427133034820.0
NCAS0B050008.259ON1409140933070.0
Suva_10.1708.259ON1416136732840.0
Skud_12.1548.259ON1417142432720.0
Smik_12.1458.259ON1418136732320.0
KAFR0B027108.259ON1416142532100.0
YLR086W (SMC4)8.259ON1418137031910.0
TDEL0F038608.259ON1399141031830.0
SAKL0H17094g8.259ON1422131031670.0
ZYRO0C01716g8.259ON1413133131540.0
Kwal_56.238258.259ON1396131131110.0
KLTH0G13750g8.259ON1399132630580.0
AGR089C8.259ON1370129830460.0
KNAG0G020208.259ON1444141230280.0
Ecym_43118.259ON1376130229800.0
TBLA0E044108.259ON1422132429450.0
NDAI0B019708.259ON1415130729380.0
KLLA0F19085g8.259ON1372128927350.0
CAGL0L12188g8.259ON139881619300.0
KAFR0C032008.68ON12236963842e-36
Suva_6.528.68ON12647373798e-36
NDAI0G033208.68ON12318003708e-35
KLLA0D07502g8.68ON12438773564e-33
Smik_6.718.68ON12286993555e-33
Kwal_23.50438.68ON12251713531e-32
Skud_6.648.68ON12308653512e-32
ZYRO0F03828g8.68ON12178043493e-32
TPHA0P003408.68ON12197143475e-32
KLTH0A02706g8.68ON12281703475e-32
SAKL0B02288g8.68ON12281883441e-31
YFL008W (SMC1)8.68ON12251583431e-31
NCAS0C040008.68ON12231633422e-31
TDEL0C009608.68ON12222153395e-31
Kpol_1011.58.68ON12211603369e-31
KNAG0G009108.68ON12261573351e-30
AGL023W8.68ON12221613288e-30
TBLA0G035308.68ON12321623271e-29
CAGL0F02079g8.68ON12231863172e-28
Ecym_73038.68ON12221663144e-28
KAFR0G029307.186ON11701852439e-20
CAGL0D05258g7.186ON11701822393e-19
NDAI0G020707.186ON11711862384e-19
TDEL0H026107.186ON11701932374e-19
SAKL0F07282g7.186ON11701822367e-19
Kwal_55.204217.186ON11701822322e-18
Suva_6.1047.186ON11701862322e-18
Smik_7.3467.186ON11701822322e-18
YFR031C (SMC2)7.186ON11701862322e-18
AGR236W7.186ON11701892303e-18
Skud_6.1197.186ON11701862303e-18
ZYRO0D15642g7.186ON11701852303e-18
Ecym_43907.186ON11701832303e-18
Kpol_1063.207.186ON11711832294e-18
KLTH0E04774g7.186ON11701842285e-18
NCAS0E019207.186ON11701792276e-18
KNAG0L011607.186ON11701812241e-17
TPHA0C044407.186ON11701892241e-17
TBLA0D046107.186ON11741822232e-17
KLLA0D16005g7.186ON11701852223e-17
Kwal_14.24351.295ON12477282179e-17
SAKL0D06116g1.295ON12297232134e-16
ZYRO0G21296g1.295ON12272192091e-15
KAFR0A016101.295ON12271032072e-15
Kpol_1018.21.295ON12111851972e-14
KNAG0B052301.295ON12251051972e-14
TBLA0C027401.295ON11191421972e-14
KLTH0H09966g1.295ON12241001972e-14
NCAS0A093301.295ON12271101963e-14
TDEL0D016201.295ON1223991954e-14
NDAI0G056301.295ON12291051938e-14
Smik_10.1671.295ON12291991938e-14
YJL074C (SMC3)1.295ON12302001892e-13
TPHA0I010901.295ON1216991882e-13
Ecym_63221.295ON12321071864e-13
Suva_6.1491.295ON12302001865e-13
CAGL0H02805g1.295ON12191901865e-13
AAL182W1.295ON12317241821e-12
Skud_10.1701.295ON1230991793e-12
KLLA0A00286g1.295ON1224781678e-11
KNAG0L006307.101ON11081571222e-05
Kwal_26.72047.101ON11171681222e-05
KLTH0D02816g7.101ON10942011202e-05
Skud_15.1217.101ON10931631122e-04
TDEL0E013404.237ON1106851104e-04
Suva_15.1337.101ON10923981060.001
KAFR0D013307.101ON10801961030.002
SAKL0B09526g7.101ON10991651030.003
ZYRO0B12122g4.237ON1109781020.003
TBLA0E021907.101ON10891931020.004
KLLA0F07997g7.101ON11191281020.004
YOL034W (SMC5)7.101ON10931631010.005
Kpol_1044.137.101ON11031751000.006
Ecym_26257.101ON10971421000.006
CAGL0H05071g4.237ON111076990.007
NCAS0J013904.237ON109668980.010
NCAS0I005707.101ON1095191970.013
NDAI0A084507.101ON111962970.014
TPHA0B008404.237ON111968970.015
Skud_12.4684.237ON112068960.016
YLR383W (SMC6)4.237ON111468960.017
ZYRO0G01584g7.101ON108864960.017
NDAI0J021804.237ON1108107960.018
Smik_12.4704.237ON111468960.018
Smik_15.1317.101ON109362960.019
Suva_10.5004.237ON111568960.019
KNAG0B060104.237ON111768950.023
TPHA0L006007.101ON111762950.025
TDEL0H034907.101ON110364940.034
CAGL0F01155g7.101ON1105151930.042
KLLA0E05303g4.237ON109870920.051
TBLA0I028904.237ON109871910.061
TBLA0A053001.67ON70767900.071
TDEL0G028102.351ON109471900.078
KAFR0A060404.237ON110275880.16
SAKL0H03322g4.237ON111185870.19
AEL337C7.101ON109764870.19
Kpol_483.104.237ON111847870.21
Kwal_26.93804.237ON110287860.26
KNAG0A031708.636ON471250840.32
TDEL0D051803.106ON837168850.35
Ecym_53444.237ON110258850.35
KLTH0D14080g4.237ON110278830.53
AER044W4.237ON110358830.60
NCAS0B087001.67ON71572820.74
Ecym_55145.414ON854207820.75
ZYRO0A07524g2.351ON109071801.4
Suva_16.2148.577ON493155781.8
ZYRO0F17050g1.67ON71472763.2
TPHA0E023205.267ON1915178763.6
TBLA0I010507.419ON371109745.8
Kwal_33.155611.527ON129773746.4
TDEL0D037403.251ON46096736.6
TBLA0F015007.436ON130758746.8
Kpol_1002.136.277ON1045134746.9
NDAI0A058403.251ON458102737.0
YDL058W (USO1)4.238ON1790116738.8
Kwal_55.198087.488ON82562739.1
TDEL0B022605.696ON66278729.8
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= TPHA0J00720
         (1393 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

TPHA0J00720 Chr10 (161017..165198) [4182 bp, 1393 aa] {ON} Anc_8...  2469   0.0  
Kpol_392.8 s392 complement(19392..23675) [4284 bp, 1427 aa] {ON}...  1345   0.0  
NCAS0B05000 Chr2 (917841..922070) [4230 bp, 1409 aa] {ON} Anc_8....  1278   0.0  
Suva_10.170 Chr10 (307316..311566) [4251 bp, 1416 aa] {ON} YLR08...  1269   0.0  
Skud_12.154 Chr12 (285613..289866) [4254 bp, 1417 aa] {ON} YLR08...  1264   0.0  
Smik_12.145 Chr12 (282081..286337) [4257 bp, 1418 aa] {ON} YLR08...  1249   0.0  
KAFR0B02710 Chr2 (545337..549587) [4251 bp, 1416 aa] {ON} Anc_8....  1241   0.0  
YLR086W Chr12 (302243..306499) [4257 bp, 1418 aa] {ON}  SMC4Subu...  1233   0.0  
TDEL0F03860 Chr6 (709579..713778) [4200 bp, 1399 aa] {ON} Anc_8....  1230   0.0  
SAKL0H17094g Chr8 complement(1508021..1512289) [4269 bp, 1422 aa...  1224   0.0  
ZYRO0C01716g Chr3 complement(130331..134572) [4242 bp, 1413 aa] ...  1219   0.0  
Kwal_56.23825 s56 complement(721498..725688) [4191 bp, 1396 aa] ...  1202   0.0  
KLTH0G13750g Chr7 complement(1184169..1188368) [4200 bp, 1399 aa...  1182   0.0  
AGR089C Chr7 complement(901437..905549) [4113 bp, 1370 aa] {ON} ...  1177   0.0  
KNAG0G02020 Chr7 (449115..453449) [4335 bp, 1444 aa] {ON} Anc_8....  1170   0.0  
Ecym_4311 Chr4 complement(666871..671001) [4131 bp, 1376 aa] {ON...  1152   0.0  
TBLA0E04410 Chr5 (1122005..1126273) [4269 bp, 1422 aa] {ON} Anc_...  1139   0.0  
NDAI0B01970 Chr2 (479208..483455) [4248 bp, 1415 aa] {ON} Anc_8....  1136   0.0  
KLLA0F19085g Chr6 (1758111..1762229) [4119 bp, 1372 aa] {ON} sim...  1058   0.0  
CAGL0L12188g Chr12 (1310968..1315164) [4197 bp, 1398 aa] {ON} si...   748   0.0  
KAFR0C03200 Chr3 (643231..646902) [3672 bp, 1223 aa] {ON} Anc_8....   152   2e-36
Suva_6.52 Chr6 (91156..94950) [3795 bp, 1264 aa] {ON} YFL008W (R...   150   8e-36
NDAI0G03320 Chr7 (781468..785163) [3696 bp, 1231 aa] {ON}             147   8e-35
KLLA0D07502g Chr4 complement(642751..646482) [3732 bp, 1243 aa] ...   141   4e-33
Smik_6.71 Chr6 (132627..136313) [3687 bp, 1228 aa] {ON} YFL008W ...   141   5e-33
Kwal_23.5043 s23 (978758..982435) [3678 bp, 1225 aa] {ON} YFL008...   140   1e-32
Skud_6.64 Chr6 (121616..125308) [3693 bp, 1230 aa] {ON} YFL008W ...   139   2e-32
ZYRO0F03828g Chr6 (318190..321843) [3654 bp, 1217 aa] {ON} simil...   139   3e-32
TPHA0P00340 Chr16 (65711..69370) [3660 bp, 1219 aa] {ON} Anc_8.6...   138   5e-32
KLTH0A02706g Chr1 complement(234723..238409) [3687 bp, 1228 aa] ...   138   5e-32
SAKL0B02288g Chr2 (215750..219436) [3687 bp, 1228 aa] {ON} simil...   137   1e-31
YFL008W Chr6 (119429..123106) [3678 bp, 1225 aa] {ON}  SMC1Subun...   136   1e-31
NCAS0C04000 Chr3 (807106..810777) [3672 bp, 1223 aa] {ON} Anc_8....   136   2e-31
TDEL0C00960 Chr3 (153572..157240) [3669 bp, 1222 aa] {ON} Anc_8....   135   5e-31
Kpol_1011.5 s1011 complement(13399..17064) [3666 bp, 1221 aa] {O...   134   9e-31
KNAG0G00910 Chr7 (172759..176439) [3681 bp, 1226 aa] {ON} Anc_8....   133   1e-30
AGL023W Chr7 (670877..674545) [3669 bp, 1222 aa] {ON} Syntenic h...   130   8e-30
TBLA0G03530 Chr7 complement(941941..945639) [3699 bp, 1232 aa] {...   130   1e-29
CAGL0F02079g Chr6 (201002..204673) [3672 bp, 1223 aa] {ON} simil...   126   2e-28
Ecym_7303 Chr7 (638719..642387) [3669 bp, 1222 aa] {ON} similar ...   125   4e-28
KAFR0G02930 Chr7 complement(609210..612722) [3513 bp, 1170 aa] {...    98   9e-20
CAGL0D05258g Chr4 (500858..504370) [3513 bp, 1170 aa] {ON} simil...    97   3e-19
NDAI0G02070 Chr7 (461697..465212) [3516 bp, 1171 aa] {ON} Anc_7....    96   4e-19
TDEL0H02610 Chr8 (434116..437628) [3513 bp, 1170 aa] {ON} Anc_7....    96   4e-19
SAKL0F07282g Chr6 complement(554459..557971) [3513 bp, 1170 aa] ...    96   7e-19
Kwal_55.20421 s55 (391382..394894) [3513 bp, 1170 aa] {ON} YFR03...    94   2e-18
Suva_6.104 Chr6 complement(183396..186908) [3513 bp, 1170 aa] {O...    94   2e-18
Smik_7.346 Chr7 complement(577634..581146) [3513 bp, 1170 aa] {O...    94   2e-18
YFR031C Chr6 complement(216594..220106) [3513 bp, 1170 aa] {ON} ...    94   2e-18
AGR236W Chr7 (1189845..1193357) [3513 bp, 1170 aa] {ON} Syntenic...    93   3e-18
Skud_6.119 Chr6 complement(211918..215430) [3513 bp, 1170 aa] {O...    93   3e-18
ZYRO0D15642g Chr4 complement(1307703..1311215) [3513 bp, 1170 aa...    93   3e-18
Ecym_4390 Chr4 (816076..819588) [3513 bp, 1170 aa] {ON} similar ...    93   3e-18
Kpol_1063.20 s1063 (46233..49748) [3516 bp, 1171 aa] {ON} (46233...    93   4e-18
KLTH0E04774g Chr5 (426535..430047) [3513 bp, 1170 aa] {ON} simil...    92   5e-18
NCAS0E01920 Chr5 (368382..371894) [3513 bp, 1170 aa] {ON} Anc_7....    92   6e-18
KNAG0L01160 Chr12 complement(206434..209946) [3513 bp, 1170 aa] ...    91   1e-17
TPHA0C04440 Chr3 complement(958279..961791) [3513 bp, 1170 aa] {...    91   1e-17
TBLA0D04610 Chr4 complement(1139885..1143409) [3525 bp, 1174 aa]...    91   2e-17
KLLA0D16005g Chr4 complement(1346492..1350004) [3513 bp, 1170 aa...    90   3e-17
Kwal_14.2435 s14 complement(756213..759956) [3744 bp, 1247 aa] {...    88   9e-17
SAKL0D06116g Chr4 complement(503196..506885) [3690 bp, 1229 aa] ...    87   4e-16
ZYRO0G21296g Chr7 (1747217..1750900) [3684 bp, 1227 aa] {ON} sim...    85   1e-15
KAFR0A01610 Chr1 complement(326620..330303) [3684 bp, 1227 aa] {...    84   2e-15
Kpol_1018.2 s1018 complement(5901..9536) [3636 bp, 1211 aa] {ON}...    80   2e-14
KNAG0B05230 Chr2 complement(1005244..1008921) [3678 bp, 1225 aa]...    80   2e-14
TBLA0C02740 Chr3 (656941..660300) [3360 bp, 1119 aa] {ON} Anc_1....    80   2e-14
KLTH0H09966g Chr8 complement(859362..863036) [3675 bp, 1224 aa] ...    80   2e-14
NCAS0A09330 Chr1 (1844122..1847805) [3684 bp, 1227 aa] {ON} Anc_...    80   3e-14
TDEL0D01620 Chr4 complement(321963..325634) [3672 bp, 1223 aa] {...    80   4e-14
NDAI0G05630 Chr7 complement(1393671..1397360) [3690 bp, 1229 aa]...    79   8e-14
Smik_10.167 Chr10 complement(290936..294625) [3690 bp, 1229 aa] ...    79   8e-14
YJL074C Chr10 complement(299157..302849) [3693 bp, 1230 aa] {ON}...    77   2e-13
TPHA0I01090 Chr9 complement(252902..256552) [3651 bp, 1216 aa] {...    77   2e-13
Ecym_6322 Chr6 (611978..615676) [3699 bp, 1232 aa] {ON} similar ...    76   4e-13
Suva_6.149 Chr6 (248275..251967) [3693 bp, 1230 aa] {ON} YJL074C...    76   5e-13
CAGL0H02805g Chr8 complement(256682..260341) [3660 bp, 1219 aa] ...    76   5e-13
AAL182W Chr1 (16155..19850) [3696 bp, 1231 aa] {ON} Syntenic hom...    75   1e-12
Skud_10.170 Chr10 (316063..319755) [3693 bp, 1230 aa] {ON} YJL07...    74   3e-12
KLLA0A00286g Chr1 complement(22024..25698) [3675 bp, 1224 aa] {O...    69   8e-11
KNAG0L00630 Chr12 complement(93928..97254) [3327 bp, 1108 aa] {O...    52   2e-05
Kwal_26.7204 s26 complement(263266..266619) [3354 bp, 1117 aa] {...    52   2e-05
KLTH0D02816g Chr4 complement(272310..275594) [3285 bp, 1094 aa] ...    51   2e-05
Skud_15.121 Chr15 (218825..222106) [3282 bp, 1093 aa] {ON} YOL03...    48   2e-04
TDEL0E01340 Chr5 complement(265681..269001) [3321 bp, 1106 aa] {...    47   4e-04
Suva_15.133 Chr15 (232441..235719) [3279 bp, 1092 aa] {ON} YOL03...    45   0.001
KAFR0D01330 Chr4 complement(263879..267121) [3243 bp, 1080 aa] {...    44   0.002
SAKL0B09526g Chr2 (805816..809115) [3300 bp, 1099 aa] {ON} simil...    44   0.003
ZYRO0B12122g Chr2 (972611..975940) [3330 bp, 1109 aa] {ON} simil...    44   0.003
TBLA0E02190 Chr5 complement(534078..537347) [3270 bp, 1089 aa] {...    44   0.004
KLLA0F07997g Chr6 complement(748561..751920) [3360 bp, 1119 aa] ...    44   0.004
YOL034W Chr15 (259923..263204) [3282 bp, 1093 aa] {ON}  SMC5Comp...    44   0.005
Kpol_1044.13 s1044 complement(23616..26927) [3312 bp, 1103 aa] {...    43   0.006
Ecym_2625 Chr2 (1208550..1211843) [3294 bp, 1097 aa] {ON} simila...    43   0.006
CAGL0H05071g Chr8 (486899..490231) [3333 bp, 1110 aa] {ON} simil...    43   0.007
NCAS0J01390 Chr10 (242118..245408) [3291 bp, 1096 aa] {ON} Anc_4...    42   0.010
NCAS0I00570 Chr9 complement(90806..94093) [3288 bp, 1095 aa] {ON...    42   0.013
NDAI0A08450 Chr1 (1947452..1950811) [3360 bp, 1119 aa] {ON} Anc_...    42   0.014
TPHA0B00840 Chr2 complement(194812..198171) [3360 bp, 1119 aa] {...    42   0.015
Skud_12.468 Chr12 (825378..828740) [3363 bp, 1120 aa] {ON} YLR38...    42   0.016
YLR383W Chr12 (885288..888632) [3345 bp, 1114 aa] {ON}  SMC6Comp...    42   0.017
ZYRO0G01584g Chr7 (120582..123848) [3267 bp, 1088 aa] {ON} simil...    42   0.017
NDAI0J02180 Chr10 (529566..532892) [3327 bp, 1108 aa] {ON} Anc_4...    42   0.018
Smik_12.470 Chr12 (824001..827345) [3345 bp, 1114 aa] {ON} YLR38...    42   0.018
Smik_15.131 Chr15 (226115..229396) [3282 bp, 1093 aa] {ON} YOL03...    42   0.019
Suva_10.500 Chr10 (850833..854180) [3348 bp, 1115 aa] {ON} YLR38...    42   0.019
KNAG0B06010 Chr2 (1178430..1181783) [3354 bp, 1117 aa] {ON} Anc_...    41   0.023
TPHA0L00600 Chr12 complement(102317..105670) [3354 bp, 1117 aa] ...    41   0.025
TDEL0H03490 Chr8 (578645..581956) [3312 bp, 1103 aa] {ON} Anc_7....    41   0.034
CAGL0F01155g Chr6 complement(116762..120079) [3318 bp, 1105 aa] ...    40   0.042
KLLA0E05303g Chr5 complement(472583..475879) [3297 bp, 1098 aa] ...    40   0.051
TBLA0I02890 Chr9 (683688..686984) [3297 bp, 1098 aa] {ON} Anc_4....    40   0.061
TBLA0A05300 Chr1 (1297764..1299887) [2124 bp, 707 aa] {ON} Anc_1...    39   0.071
TDEL0G02810 Chr7 (540540..543824) [3285 bp, 1094 aa] {ON} Anc_2....    39   0.078
KAFR0A06040 Chr1 complement(1222239..1225547) [3309 bp, 1102 aa]...    39   0.16 
SAKL0H03322g Chr8 complement(314365..317700) [3336 bp, 1111 aa] ...    38   0.19 
AEL337C Chr5 complement(14613..17906) [3294 bp, 1097 aa] {ON} Sy...    38   0.19 
Kpol_483.10 s483 (21646..25002) [3357 bp, 1118 aa] {ON} (21646.....    38   0.21 
Kwal_26.9380 s26 (1189521..1192829) [3309 bp, 1102 aa] {ON} YLR3...    38   0.26 
KNAG0A03170 Chr1 (394019..395434) [1416 bp, 471 aa] {ON} Anc_8.6...    37   0.32 
TDEL0D05180 Chr4 complement(940548..943061) [2514 bp, 837 aa] {O...    37   0.35 
Ecym_5344 Chr5 (696147..699455) [3309 bp, 1102 aa] {ON} similar ...    37   0.35 
KLTH0D14080g Chr4 (1149555..1152863) [3309 bp, 1102 aa] {ON} sim...    37   0.53 
AER044W Chr5 (714355..717666) [3312 bp, 1103 aa] {ON} Syntenic h...    37   0.60 
NCAS0B08700 Chr2 (1674262..1676409) [2148 bp, 715 aa] {ON} Anc_1...    36   0.74 
Ecym_5514 Chr5 (1043659..1046223) [2565 bp, 854 aa] {ON} similar...    36   0.75 
ZYRO0A07524g Chr1 (615902..619174) [3273 bp, 1090 aa] {ON} highl...    35   1.4  
Suva_16.214 Chr16 (374778..376259) [1482 bp, 493 aa] {ON} YPL097...    35   1.8  
ZYRO0F17050g Chr6 complement(1417445..1419589) [2145 bp, 714 aa]...    34   3.2  
TPHA0E02320 Chr5 complement(482429..488176) [5748 bp, 1915 aa] {...    34   3.6  
TBLA0I01050 Chr9 (210595..211710) [1116 bp, 371 aa] {ON} Anc_7.4...    33   5.8  
Kwal_33.15561 s33 (1157299..1161192) [3894 bp, 1297 aa] {ON} YKL...    33   6.4  
TDEL0D03740 Chr4 complement(686950..688332) [1383 bp, 460 aa] {O...    33   6.6  
TBLA0F01500 Chr6 (367909..371832) [3924 bp, 1307 aa] {ON} Anc_7....    33   6.8  
Kpol_1002.13 s1002 complement(35647..38784) [3138 bp, 1045 aa] {...    33   6.9  
NDAI0A05840 Chr1 complement(1328949..1330325) [1377 bp, 458 aa] ...    33   7.0  
YDL058W Chr4 (345665..351037) [5373 bp, 1790 aa] {ON}  USO1Essen...    33   8.8  
Kwal_55.19808 s55 (136074..138551) [2478 bp, 825 aa] {ON} YBL047...    33   9.1  
TDEL0B02260 Chr2 (408913..410901) [1989 bp, 662 aa] {ON} Anc_5.6...    32   9.8  

>TPHA0J00720 Chr10 (161017..165198) [4182 bp, 1393 aa] {ON} Anc_8.259
            YLR086W
          Length = 1393

 Score = 2469 bits (6400), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1252/1393 (89%), Positives = 1252/1393 (89%)

Query: 1    MSALPDAKKQKVKDIESNSPLNNDIPKIAQSRNDSPLQVANDPLKSYTPMKVXXXXXXXX 60
            MSALPDAKKQKVKDIESNSPLNNDIPKIAQSRNDSPLQVANDPLKSYTPMKV        
Sbjct: 1    MSALPDAKKQKVKDIESNSPLNNDIPKIAQSRNDSPLQVANDPLKSYTPMKVIISNNHSN 60

Query: 61   XXXPLPSQLMXXXXXXXXXXXXXXXXRGRAVKAYXXXXXXXXXXXXXXXXXXKLELIQLS 120
               PLPSQLM                RGRAVKAY                  KLELIQLS
Sbjct: 61   SISPLPSQLMSSSTQPPSLQHPSSSSRGRAVKAYSQSPPRSPDRSPVRSPTRKLELIQLS 120

Query: 121  PIKNSRSELQKIYSSKQEEKIERICLNKLVLHNFKSYAGTQTIGPFHSSFSAVVGPNGSG 180
            PIKNSRSELQKIYSSKQEEKIERICLNKLVLHNFKSYAGTQTIGPFHSSFSAVVGPNGSG
Sbjct: 121  PIKNSRSELQKIYSSKQEEKIERICLNKLVLHNFKSYAGTQTIGPFHSSFSAVVGPNGSG 180

Query: 181  KSNVIDSMLFVFGFRANKMRQGKLADLIHKSEEYPDLTSCAVDVHFEYLIDYPDDTTKIN 240
            KSNVIDSMLFVFGFRANKMRQGKLADLIHKSEEYPDLTSCAVDVHFEYLIDYPDDTTKIN
Sbjct: 181  KSNVIDSMLFVFGFRANKMRQGKLADLIHKSEEYPDLTSCAVDVHFEYLIDYPDDTTKIN 240

Query: 241  PSKQPLIITRRAFKNSTSKYYLNGKESNYKTITALLKEEGIDLDHNRFLILQGEVENIAQ 300
            PSKQPLIITRRAFKNSTSKYYLNGKESNYKTITALLKEEGIDLDHNRFLILQGEVENIAQ
Sbjct: 241  PSKQPLIITRRAFKNSTSKYYLNGKESNYKTITALLKEEGIDLDHNRFLILQGEVENIAQ 300

Query: 301  MKPKAEKEGDDGLLEYLEDIIGTTKYKELIDKKFIEIEALNDICIERENRFDIIDRXXXX 360
            MKPKAEKEGDDGLLEYLEDIIGTTKYKELIDKKFIEIEALNDICIERENRFDIIDR    
Sbjct: 301  MKPKAEKEGDDGLLEYLEDIIGTTKYKELIDKKFIEIEALNDICIERENRFDIIDREKES 360

Query: 361  XXXXXXXXXXXXXXXXXQVIVKSKLIQYKIWQNNIKLSNTLEKITKLEDEYNQEKNKNTE 420
                             QVIVKSKLIQYKIWQNNIKLSNTLEKITKLEDEYNQEKNKNTE
Sbjct: 361  LESEKESALEYLSKEKEQVIVKSKLIQYKIWQNNIKLSNTLEKITKLEDEYNQEKNKNTE 420

Query: 421  LKNKIDELRKLYTKNQDELQALLKDEKELVNAKRSLDSDNVSNTEQLKNIEKKLKKTAKE 480
            LKNKIDELRKLYTKNQDELQALLKDEKELVNAKRSLDSDNVSNTEQLKNIEKKLKKTAKE
Sbjct: 421  LKNKIDELRKLYTKNQDELQALLKDEKELVNAKRSLDSDNVSNTEQLKNIEKKLKKTAKE 480

Query: 481  IEEDLKTISSSNVRLKNFHDNKKLFETQLIELDNNLVTESQLLENIKLDLKDKTVGLSEE 540
            IEEDLKTISSSNVRLKNFHDNKKLFETQLIELDNNLVTESQLLENIKLDLKDKTVGLSEE
Sbjct: 481  IEEDLKTISSSNVRLKNFHDNKKLFETQLIELDNNLVTESQLLENIKLDLKDKTVGLSEE 540

Query: 541  ILKTEKDLEPWNIKLDELKSEIQIKESEKALFEESKNKLKANIEALEKDVNEKSKLTEDR 600
            ILKTEKDLEPWNIKLDELKSEIQIKESEKALFEESKNKLKANIEALEKDVNEKSKLTEDR
Sbjct: 541  ILKTEKDLEPWNIKLDELKSEIQIKESEKALFEESKNKLKANIEALEKDVNEKSKLTEDR 600

Query: 601  RKEVKNLMTKLENVSKEVIFGTNELKKANEKLCEMQKILIQDRQKANDARTSLSNVENRS 660
            RKEVKNLMTKLENVSKEVIFGTNELKKANEKLCEMQKILIQDRQKANDARTSLSNVENRS
Sbjct: 601  RKEVKNLMTKLENVSKEVIFGTNELKKANEKLCEMQKILIQDRQKANDARTSLSNVENRS 660

Query: 661  KVLRALLKLQKSGRINGFHGRLGNLGVIDEKYDVAISTACPRLNDIVVDSVECGQQCIEY 720
            KVLRALLKLQKSGRINGFHGRLGNLGVIDEKYDVAISTACPRLNDIVVDSVECGQQCIEY
Sbjct: 661  KVLRALLKLQKSGRINGFHGRLGNLGVIDEKYDVAISTACPRLNDIVVDSVECGQQCIEY 720

Query: 721  LRKNNLGHARFILLDKLNKFSMEKISTPRNVPRLFDLIKVNDEKFLPAFYSVLRNTLVAN 780
            LRKNNLGHARFILLDKLNKFSMEKISTPRNVPRLFDLIKVNDEKFLPAFYSVLRNTLVAN
Sbjct: 721  LRKNNLGHARFILLDKLNKFSMEKISTPRNVPRLFDLIKVNDEKFLPAFYSVLRNTLVAN 780

Query: 781  DLKEANAVAYGKTRYRVVTLKGNLIDISGTMSGGGNQASKGAMQLXXXXXXXXXXXXXXX 840
            DLKEANAVAYGKTRYRVVTLKGNLIDISGTMSGGGNQASKGAMQL               
Sbjct: 781  DLKEANAVAYGKTRYRVVTLKGNLIDISGTMSGGGNQASKGAMQLSNSTSKEKSTYSSEE 840

Query: 841  VMEIEKELSIREKNYQNAYNTVQEMEIELRNLKESEPKIELEISKLNFEIDSLENECSLK 900
            VMEIEKELSIREKNYQNAYNTVQEMEIELRNLKESEPKIELEISKLNFEIDSLENECSLK
Sbjct: 841  VMEIEKELSIREKNYQNAYNTVQEMEIELRNLKESEPKIELEISKLNFEIDSLENECSLK 900

Query: 901  RKQLNEPNASFSIEDNMSADITEMDNALYTLNEKQKLIESQMKSKKDRIKELQDKIMKIG 960
            RKQLNEPNASFSIEDNMSADITEMDNALYTLNEKQKLIESQMKSKKDRIKELQDKIMKIG
Sbjct: 901  RKQLNEPNASFSIEDNMSADITEMDNALYTLNEKQKLIESQMKSKKDRIKELQDKIMKIG 960

Query: 961  GIKLQMQNSKVDXXXXXXXXXXXXXXXXXAGIMKIESDVRXXXXXXXXXXXDNTKLNEKK 1020
            GIKLQMQNSKVD                 AGIMKIESDVR           DNTKLNEKK
Sbjct: 961  GIKLQMQNSKVDSLQEQKKILIKKQKSEKAGIMKIESDVRKLSKKLKESESDNTKLNEKK 1020

Query: 1021 XXXXXXXXXXXXXXXQNENNMNCIQDKKFTLREKSEITMNELTEMEGLLSEFKTLEVEYK 1080
                           QNENNMNCIQDKKFTLREKSEITMNELTEMEGLLSEFKTLEVEYK
Sbjct: 1021 IALENELKNIEELLAQNENNMNCIQDKKFTLREKSEITMNELTEMEGLLSEFKTLEVEYK 1080

Query: 1081 IKSEKLASLLNQIKKILKALEEDHSSLSIREVAYDLDLLNIKEQEAQKIKTELYADFEQN 1140
            IKSEKLASLLNQIKKILKALEEDHSSLSIREVAYDLDLLNIKEQEAQKIKTELYADFEQN
Sbjct: 1081 IKSEKLASLLNQIKKILKALEEDHSSLSIREVAYDLDLLNIKEQEAQKIKTELYADFEQN 1140

Query: 1141 QSXXXXXXXXXXXXXXXXXAKGIPSYMESDFKQFDISSLEAELVQLQDYFEIAKVDLDIL 1200
            QS                 AKGIPSYMESDFKQFDISSLEAELVQLQDYFEIAKVDLDIL
Sbjct: 1141 QSNDVINDEMIIEDNNNEIAKGIPSYMESDFKQFDISSLEAELVQLQDYFEIAKVDLDIL 1200

Query: 1201 EEYTRRMIEYRQRKYDLNQSVEQRDKVRKELEDLKKCRFNEFMESFNIISMTLKEMYQII 1260
            EEYTRRMIEYRQRKYDLNQSVEQRDKVRKELEDLKKCRFNEFMESFNIISMTLKEMYQII
Sbjct: 1201 EEYTRRMIEYRQRKYDLNQSVEQRDKVRKELEDLKKCRFNEFMESFNIISMTLKEMYQII 1260

Query: 1261 TMGGNAELELVDSLDPFSEGVTFSVMPPKKSWRNISNLSGGEKTLSSLALVFALHKYKPT 1320
            TMGGNAELELVDSLDPFSEGVTFSVMPPKKSWRNISNLSGGEKTLSSLALVFALHKYKPT
Sbjct: 1261 TMGGNAELELVDSLDPFSEGVTFSVMPPKKSWRNISNLSGGEKTLSSLALVFALHKYKPT 1320

Query: 1321 PLYVMDEIDAALDFRNVSIVANYIKERTKNAQFIVISLRNNMFELAEQLVGIYKNVNQTK 1380
            PLYVMDEIDAALDFRNVSIVANYIKERTKNAQFIVISLRNNMFELAEQLVGIYKNVNQTK
Sbjct: 1321 PLYVMDEIDAALDFRNVSIVANYIKERTKNAQFIVISLRNNMFELAEQLVGIYKNVNQTK 1380

Query: 1381 SATLKNNDILCRK 1393
            SATLKNNDILCRK
Sbjct: 1381 SATLKNNDILCRK 1393

>Kpol_392.8 s392 complement(19392..23675) [4284 bp, 1427 aa] {ON}
            complement(19392..23675) [4284 nt, 1428 aa]
          Length = 1427

 Score = 1345 bits (3482), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 730/1330 (54%), Positives = 934/1330 (70%), Gaps = 24/1330 (1%)

Query: 87   RGRAVKAYXXXXXXXXXXXXXXXXXXKLELIQLSPIKNSRSELQKIYSSKQEEKIERICL 146
            RGR  + Y                  KLELIQLSP+KNSR  LQKIY SK E++IER+C+
Sbjct: 97   RGRTARTYSQSPPRSPARSPARSPTRKLELIQLSPVKNSRIALQKIYESKNEKQIERLCI 156

Query: 147  NKLVLHNFKSYAGTQTIGPFHSSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQGKLAD 206
            +KLVLH+FKSYAGTQ +GPFHSSFSAVVGPNGSGKSNVIDSMLFVFGFRA+KMRQ +L+D
Sbjct: 157  DKLVLHDFKSYAGTQVVGPFHSSFSAVVGPNGSGKSNVIDSMLFVFGFRASKMRQDRLSD 216

Query: 207  LIHKSEEYPDLTSCAVDVHFEYLIDYPDDTTKINPSKQPLIITRRAFKNSTSKYYLNGKE 266
            LIHKSE +PDL SC+V+VHFEY+ID PD TT IN  K+ L+ITR+AFKN+TSKYY+NGKE
Sbjct: 217  LIHKSENFPDLKSCSVEVHFEYVIDKPDGTTIINTVKEKLVITRKAFKNNTSKYYINGKE 276

Query: 267  SNYKTITALLKEEGIDLDHNRFLILQGEVENIAQMKPKAEKEGDDGLLEYLEDIIGTTKY 326
            SNY ++T LLK+EGIDLDHNRFLILQGEVENIAQMKPKAE +GDDGLLEYLEDIIGT KY
Sbjct: 277  SNYTSVTKLLKDEGIDLDHNRFLILQGEVENIAQMKPKAENDGDDGLLEYLEDIIGTAKY 336

Query: 327  KELIDKKFIEIEALNDICIERENRFDIIDRXXXXXXXXXXXXXXXXXXXXXQVIVKSKLI 386
            K LI+KKF EIEALN+ICIE+ENRF+I+DR                       +VKSKL 
Sbjct: 337  KPLIEKKFEEIEALNEICIEKENRFEIVDREKASLESGKDEALEFLEKEKELTLVKSKLY 396

Query: 387  QYKIWQNNIKLSNTLEKITKLEDEYNQEKNKNTELKNKIDELRKLYTKNQDELQALLKDE 446
            QYK+WQ+N KLS TLEK++ +++E+ + K K++  + +++E+ K Y +    ++A  + E
Sbjct: 397  QYKLWQDNKKLSTTLEKLSNIKEEFEETKKKHSTTEIQMNEISKSYHEMLKNIKASQEQE 456

Query: 447  KELVNAKRSLDSDNVSNTEQLKNIEKKLKKTAKEIEEDLKTISSSNVRLKNFHDNKKLFE 506
            K+L   KR+ D++ VS  EQ KNI KK KK  KE+E+  KTIS++ +++++   N+  +E
Sbjct: 457  KKLNIQKRNYDTERVSLEEQRKNIMKKKKKMEKELEDCNKTISNTKIKIEDLGKNESEYE 516

Query: 507  TQLIELDNNLVTESQLLENIKLDLKDKTVGLSEEILKTEKDLEPWNIKLDELKSEIQIKE 566
            +QL EL+  L  E  LLE IK+ LKDKT+  S+EI + EK+LEPWN++L   KS+IQ+KE
Sbjct: 517  SQLDELNAQLQIERGLLEEIKISLKDKTIEFSDEISQHEKELEPWNLQLQGKKSQIQVKE 576

Query: 567  SEKALFEESKNKLKANIEALEKDVNEKSKLTEDRRKEVKNLMTKLENVSKEVIFGTNELK 626
            SE +L +E + KL+ +IE L   ++ K +    R KE+ +L  +L  ++KEV  G  E  
Sbjct: 577  SEISLIKEGRVKLENDIENLNSLISVKIEEKISREKEIGSLRNELNRITKEVSIGDTEYT 636

Query: 627  KANEKLCEMQKILIQDRQKANDARTSLSNVENRSKVLRALLKLQKSGRINGFHGRLGNLG 686
             A EKL EM+ +L Q RQKA DARTSLS  EN+++VL +L +LQKSGRI+GF+GRLG+LG
Sbjct: 637  NAKEKLREMKAVLNQHRQKAIDARTSLSAEENKNQVLASLFRLQKSGRISGFYGRLGDLG 696

Query: 687  VIDEKYDVAISTACPRLNDIVVDSVECGQQCIEYLRKNNLGHARFILLDKLNKFSMEKIS 746
             ID++YD+AISTACPRLND+VV++VECGQQCIEYLRKN LG+ARFILL+KL  F M KIS
Sbjct: 697  AIDDRYDIAISTACPRLNDLVVETVECGQQCIEYLRKNKLGYARFILLEKLRNFDMNKIS 756

Query: 747  TPRNVPRLFDLIKVNDEKFLPAFYSVLRNTLVANDLKEANAVAYGKTRYRVVTLKGNLID 806
            TP NVPRLFDL+  +D KFLPAFYSVLR+TLV N+LK+AN VAYG  R+RVVTL G LID
Sbjct: 757  TPNNVPRLFDLVISSDPKFLPAFYSVLRDTLVVNNLKDANRVAYGNKRFRVVTLSGELID 816

Query: 807  ISGTMSGGGNQASKGAMQLXXXXXXXXXXXXXXXVMEIEKELSIREKNYQNAYNTVQEME 866
            +SGTMSGGG Q S+G M+L               V +IEKEL+ REKN++ A  T  EME
Sbjct: 817  VSGTMSGGGTQTSRGLMKLTKSGNSGFKSYTIEDVEKIEKELAAREKNFEIANETFTEME 876

Query: 867  IELRNLKESEPKIELEISKLNFEIDSLENECSLKRKQLNEPNASFSIEDNMSADITEMDN 926
             ELR LK+ +P +ELEISK   EI S   E  L ++QLNE   S     + + +++ M++
Sbjct: 877  TELRRLKDRKPDVELEISKFELEITSWVTEHELMQQQLNEKQQSLDECMSNNEELSTMEH 936

Query: 927  ALYTLNEKQKLIESQMKSKKDRIKELQDKIMKIGGIKLQMQNSKVDXXXXXXXXXXXXXX 986
             L TL    K ++ + KSKKDRIK L+D+IMK+GGIKLQ+Q+SKVD              
Sbjct: 937  ELGTLQNDYKSLQLETKSKKDRIKFLKDEIMKVGGIKLQVQSSKVDSIIQKKDILNGKHK 996

Query: 987  XXXAGIMKIESDVRXXXXXXXXXXXDNTKLNEKKXXXXXXXXXXXXXXXQNENNMNCIQD 1046
                 + K E++++           D     +K                + E  ++ ++ 
Sbjct: 997  KDKNDLKKAETELKRLSKKQSECSTDLLTSTDKLENTDGQLSKISKSLSETETLLHELEF 1056

Query: 1047 KKFTLREKSEITMNELTEMEGLLSEFKTLEVEYKIKSEKLASLLNQIKKILKALEEDHSS 1106
             +    + SE   ++L E E  L+ FK  ++E++ K EKL +LLN IKK +++ + +  S
Sbjct: 1057 SREESLQNSENLKDQLKEFEENLNSFKVFQLEHQNKEEKLNNLLNFIKKDIRSTDSELQS 1116

Query: 1107 LSIREVAY---DLDLLNI-KEQEAQKIKTELYA----------------DFEQNQSXXXX 1146
            L IR++ +   +LD  NI +++E   +K    +                + E N+S    
Sbjct: 1117 LKIRDITHTLQELDNGNIDQDEEDVSMKDNAVSVSANNSLGNSENMEGVEIETNESDVSP 1176

Query: 1147 XX----XXXXXXXXXXXAKGIPSYMESDFKQFDISSLEAELVQLQDYFEIAKVDLDILEE 1202
                             +KGIP   E +FK  D+  LEA+ +QLQDY +   V++D+LEE
Sbjct: 1177 DANNDLEMEIDEDNNEISKGIPRISEDEFKNVDVEELEAQKLQLQDYIDTVNVNIDVLEE 1236

Query: 1203 YTRRMIEYRQRKYDLNQSVEQRDKVRKELEDLKKCRFNEFMESFNIISMTLKEMYQIITM 1262
            Y RR+ EY++RK DLN +V++R+KVR+ L+ LKK RF EFM+ F +IS+TLKEMYQ+ITM
Sbjct: 1237 YARRVAEYKRRKLDLNNAVDEREKVRELLDKLKKTRFEEFMQGFGVISITLKEMYQMITM 1296

Query: 1263 GGNAELELVDSLDPFSEGVTFSVMPPKKSWRNISNLSGGEKTLSSLALVFALHKYKPTPL 1322
            GGNAELELVDSLDPFSEGVTFSVMPPKKSWRNI+NLSGGEKTLSSLALVFALHKYKPTPL
Sbjct: 1297 GGNAELELVDSLDPFSEGVTFSVMPPKKSWRNITNLSGGEKTLSSLALVFALHKYKPTPL 1356

Query: 1323 YVMDEIDAALDFRNVSIVANYIKERTKNAQFIVISLRNNMFELAEQLVGIYKNVNQTKSA 1382
            YVMDEIDAALDFRNVSIVANYIKERTKNAQFIVISLRNNMFELAEQLVGIYK+ NQTKSA
Sbjct: 1357 YVMDEIDAALDFRNVSIVANYIKERTKNAQFIVISLRNNMFELAEQLVGIYKSNNQTKSA 1416

Query: 1383 TLKNNDILCR 1392
            TL+NNDI+ R
Sbjct: 1417 TLQNNDIINR 1426

>NCAS0B05000 Chr2 (917841..922070) [4230 bp, 1409 aa] {ON} Anc_8.259
            YLR086W
          Length = 1409

 Score = 1278 bits (3307), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 716/1409 (50%), Positives = 934/1409 (66%), Gaps = 29/1409 (2%)

Query: 3    ALPDAKKQKVKDIESNSPLNNDIPKIAQSRNDSPLQVAN-----DPL---KSYTPMKVXX 54
            +LP+ K+QKV + ES +P      + A +   SPLQ         P+   KS+TP K+  
Sbjct: 2    SLPNTKRQKVTEPESKTPEQGTEDQQANASLRSPLQRPEHQQSISPINNSKSHTPRKLIL 61

Query: 55   XXXXXXXXXPLPSQLMXXXXXXXXXXXXXXXXRGRA-VKAYXXXXXXXXXXXXXXXXXXK 113
                       PS                   RGR  +K+Y                  +
Sbjct: 62   GQNDNRYAFSQPSVSSSSFQVPTLQPPDSSSSRGRKDIKSYSQSPPRSPGRSPKR----R 117

Query: 114  LELIQLSPIKNSRSELQKIYSSK-QEEKIERICLNKLVLHNFKSYAGTQTIGPFHSSFSA 172
            LELIQLSP+KN+R +L+++Y +   + K ER+ +NKL L+NFKSYAG Q +GPFH+SFSA
Sbjct: 118  LELIQLSPVKNNRIKLRELYDAHNSQSKKERLFINKLTLNNFKSYAGQQVVGPFHTSFSA 177

Query: 173  VVGPNGSGKSNVIDSMLFVFGFRANKMRQGKLADLIHKSEEYPDLTSCAVDVHFEYLIDY 232
            VVGPNGSGKSNVIDSMLFVFGFRANKMRQ +L+DLIHKSE++PDLTSC+VDV F Y ID 
Sbjct: 178  VVGPNGSGKSNVIDSMLFVFGFRANKMRQDRLSDLIHKSEKFPDLTSCSVDVEFLYAIDE 237

Query: 233  PDDTTKINPSKQPLIITRRAFKNSTSKYYLNGKESNYKTITALLKEEGIDLDHNRFLILQ 292
             D  TKI+ +K  L+I+R+AFKN++SKYY+NGKESNY  +T LLKEEGIDLDH RFLILQ
Sbjct: 238  HDGDTKISETKPKLVISRKAFKNNSSKYYINGKESNYTDVTKLLKEEGIDLDHKRFLILQ 297

Query: 293  GEVENIAQMKPKAEKEGDDGLLEYLEDIIGTTKYKELIDKKFIEIEALNDICIERENRFD 352
            GEVENIAQMKPKAEKE DDGLLEYLEDIIGT+KYK+LI+K  IEIE+LN+ICIE+ENRF+
Sbjct: 298  GEVENIAQMKPKAEKESDDGLLEYLEDIIGTSKYKQLIEKDLIEIESLNEICIEKENRFE 357

Query: 353  IIDRXXXXXXXXXXXXXXXXXXXXXQVIVKSKLIQYKIWQNNIKLSNTLEKITKLEDEYN 412
            I+DR                       + KSKL+QY +WQNN KL+NTL+KI+ L +EYN
Sbjct: 358  IVDREKNSLESGKNLALEFLEKEKQLTLSKSKLLQYNLWQNNSKLTNTLQKISALNEEYN 417

Query: 413  QEKNKNTELKNKIDELRKLYTKNQDELQALLKDEKELVNAKRSLDSDNVSNTEQLKNIEK 472
             EK+KN  L+N+I+  ++L  ++Q +++ L  +EK+ + +KR L+ ++VS  E+LKN+ +
Sbjct: 418  VEKSKNQTLQNEINRTKQLLNESQSKIKVLEGEEKQQLKSKRILEGEHVSLDEKLKNLTQ 477

Query: 473  KLKKTAKEIEEDLKTISSSNVRLKNFHDNKKLFETQLIELDNNLVTESQLLENIKLDLKD 532
            K  KT K I    KTISS    ++    ++K +  +L  L+  L +E + LE +KL LK+
Sbjct: 478  KKAKTEKIIATTEKTISSLTSEIQELEKSQKEYSDELETLNQQLQSERESLEAMKLKLKE 537

Query: 533  KTVGLSEEILKTEKDLEPWNIKLDELKSEIQIKESEKALFEESKNKLKANIEALEKDVNE 592
            KT G+SEEIL  E DLEPWNIK+ E K+EIQ+ ES+ +L +E + KLK +I+ L ++V+ 
Sbjct: 538  KTSGISEEILIHEHDLEPWNIKVQEKKTEIQLVESQISLLQEGQVKLKNDIKVLSQEVSN 597

Query: 593  KSKLTEDRRKEVKNLMTKLENVSKEVIFGTNELKKANEKLCEMQKILIQDRQKANDARTS 652
            ++ L   R +++ NL  +  +++KE+  G  E      KL EM+ +L   RQ+A++AR +
Sbjct: 598  QTALKIKREEDLVNLKKQQSSITKEISNGETECNDGRSKLKEMKNVLNMQRQRASEARLA 657

Query: 653  LSNVENRSKVLRALLKLQKSGRINGFHGRLGNLGVIDEKYDVAISTACPRLNDIVVDSVE 712
            L+NV+NR KVL AL KLQKSGRI GFHGRLG+LG ID  YDVA+STACPRL+DIVV++VE
Sbjct: 658  LANVQNRGKVLTALYKLQKSGRIVGFHGRLGDLGTIDNTYDVAVSTACPRLDDIVVETVE 717

Query: 713  CGQQCIEYLRKNNLGHARFILLDKLNKFSMEKISTPRNVPRLFDLIKVNDEKFLPAFYSV 772
            CGQQCIEYLRKN LG+ARFILLDKL  F+   I TP+NVPRLFDLIK  D KF+PAFYSV
Sbjct: 718  CGQQCIEYLRKNKLGYARFILLDKLRSFNTNTIQTPKNVPRLFDLIKPKDSKFVPAFYSV 777

Query: 773  LRNTLVANDLKEANAVAYGKTRYRVVTLKGNLIDISGTMSGGGNQASKGAMQLXXXXXXX 832
            LR+TLVA DLK+AN VAYG+ RYRVVTL G LID+SGTMSGGGN  SKG M L       
Sbjct: 778  LRDTLVAKDLKQANRVAYGQRRYRVVTLDGKLIDVSGTMSGGGNHVSKGLMMLQRKGQNY 837

Query: 833  XXXXXXXXVMEIEKELSIREKNYQNAYNTVQEMEIELRNLKESEPKIELEISKLNFEIDS 892
                    V +IEK+LS +EKN++ A N   EME EL+ L   +P+IELEISK+  EID+
Sbjct: 838  FDDYNPEDVEQIEKDLSDKEKNFELANNAFYEMENELQKLNNRKPEIELEISKIIMEIDT 897

Query: 893  LENECSLKRKQLNEPNASFSIEDNMSADITEMDNA---LYTLNEKQKLIESQMKSKKDRI 949
               E   K +QL E     +I+++   D  E+  A   L  L E+   ++ + K+KK +I
Sbjct: 898  YSAEIKSKERQLQEKT---NIDNSELQDNEELKVAIENLQKLKEEHLALQDKTKAKKKKI 954

Query: 950  KELQDKIMKIGGIKLQMQNSKVDXXXXXXXXXXXXXXXXXAGIMKIESDVRXXXXXXXXX 1009
              L++KIMKIGGI+LQ+QNSKV                      K ++++          
Sbjct: 955  ASLKEKIMKIGGIELQVQNSKVTSIVQRIDILTAKQKKDRTSKKKSDTELEKAKKTLLTS 1014

Query: 1010 XXDNTKLNEKKXXXXXXXXXXXXXXXQNENNMNCIQDKKFTLREKSEITMNELTEMEGLL 1069
              D T + +                   + ++   Q  K TL+++ +   +++ ++E  +
Sbjct: 1015 KNDITLITDDIKEISERIDKISSSLNNIDKSIEEFQAHKETLKDECDELKDKVVDLEENI 1074

Query: 1070 SEFKTLEVEYKIKSEKLASLLNQIKKILKALEEDHSSLSIREVAYDLDLLNIKEQEAQKI 1129
            +EFK+ E+E   K EKL  LLN IK  +K LE+  S L++R++   L  L+ +E EA+  
Sbjct: 1075 NEFKSFEIEVNNKLEKLNGLLNHIKNQIKTLEDSLSKLTLRKMHQVLMALD-EESEAKAP 1133

Query: 1130 KTELYAD--------FEQNQSXXXXXXXXXXXXXXXXXAKGIPSYMESDFKQFDISSLEA 1181
                 +D         E   +                 + G+P   + +    DI+ +E 
Sbjct: 1134 NNGTLSDEQIHDQTGHELTNTAVQDDDSMDIDNGAEVISNGLPILSDDELSALDITLVET 1193

Query: 1182 ELVQLQDYFEIAKVDLDILEEYTRRMIEYRQRKYDLNQSVEQRDKVRKELEDLKKCRFNE 1241
            E+  L+ Y E    ++++LEEY +R+ E++ RK DLN +V++R+ VRK+LE+LKK R+ E
Sbjct: 1194 EVSDLEKYIESTDANIEVLEEYVKRLTEFKTRKLDLNDAVDKRETVRKQLEELKKTRYEE 1253

Query: 1242 FMESFNIISMTLKEMYQIITMGGNAELELVDSLDPFSEGVTFSVMPPKKSWRNISNLSGG 1301
            FM  F IISMTLKEMYQ+ITMGGNAELELVDSLDPFSEGVTFSVMPPKKSWRNISNLSGG
Sbjct: 1254 FMHGFGIISMTLKEMYQMITMGGNAELELVDSLDPFSEGVTFSVMPPKKSWRNISNLSGG 1313

Query: 1302 EKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKNAQFIVISLRNN 1361
            EKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKNAQFIVISLRNN
Sbjct: 1314 EKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKNAQFIVISLRNN 1373

Query: 1362 MFELAEQLVGIYKNVNQTKSATLKNNDIL 1390
            MFELA+QLVGIYK  N+T SAT+KN +IL
Sbjct: 1374 MFELAQQLVGIYKCENRTHSATIKNREIL 1402

>Suva_10.170 Chr10 (307316..311566) [4251 bp, 1416 aa] {ON} YLR086W
            (REAL)
          Length = 1416

 Score = 1269 bits (3284), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 694/1367 (50%), Positives = 909/1367 (66%), Gaps = 27/1367 (1%)

Query: 45   KSYTPMKVXXXXXXXXXXXPLPSQLMXXXXXXXXXXXXXXXXRGRAVKAYXXXXXXXXXX 104
            KS+TP K+             P+                   RGR  KAY          
Sbjct: 57   KSHTPRKLVLSSGENRYAFSQPTNSATSSLHVPNLQPPEAPSRGRDYKAYSQSPPRSPGR 116

Query: 105  XXXXXXXXKLELIQLSPIKNSRSELQKIYSSKQE--EKIERICLNKLVLHNFKSYAGTQT 162
                    +LEL+QLSP+KNSR ELQK+Y S Q   E+  R+ ++KLVL NFKSYAG Q 
Sbjct: 117  SPTR----RLELLQLSPVKNSRIELQKLYDSHQPSGEQQGRLFIDKLVLENFKSYAGKQV 172

Query: 163  IGPFHSSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQGKLADLIHKSEEYPDLTSCAV 222
            +GPFH+SFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQ +L+DLIHKSEE+P+L SC+V
Sbjct: 173  VGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDRLSDLIHKSEEFPNLQSCSV 232

Query: 223  DVHFEYLIDYPDDTTKINPSKQPLIITRRAFKNSTSKYYLNGKESNYKTITALLKEEGID 282
             VHFEY++D P  T++I+  K  L+ITR+AF+N++SKYY+NGKESNY  +T LLK EGID
Sbjct: 233  AVHFEYVVDEPSGTSRIDEEKPGLVITRKAFRNNSSKYYINGKESNYTQVTKLLKNEGID 292

Query: 283  LDHNRFLILQGEVENIAQMKPKAEKEGDDGLLEYLEDIIGTTKYKELIDKKFIEIEALND 342
            LDH RFLILQGEVENIAQMK KAEKE DDGLLEYLEDIIGT  YK LI+ +  +IE LN+
Sbjct: 293  LDHKRFLILQGEVENIAQMKSKAEKESDDGLLEYLEDIIGTANYKPLIEDRLSQIETLNE 352

Query: 343  ICIERENRFDIIDRXXXXXXXXXXXXXXXXXXXXXQVIVKSKLIQYKIWQNNIKLSNTLE 402
            IC+E+ENRF+I++R                       ++KSKL Q+K+ Q+N KL++TLE
Sbjct: 353  ICLEKENRFEIVNREKNSLESGKETALEFLEKEKQLTLLKSKLFQFKLLQSNSKLASTLE 412

Query: 403  KITKLEDEYNQEKNKNTELKNKIDELRKLYTKNQDELQALLKDEKELVNAKRSLDSDNVS 462
            K + L  ++  EK K  E   ++DE+     + +D + +    EK L   KR L+S  VS
Sbjct: 413  KTSSLNKDFESEKKKFQESLKEVDEVESQRKEIKDRMSSCASQEKTLALEKRELESTRVS 472

Query: 463  NTEQLKNIEKKLKKTAKEIEEDLKTISSSNVRLKNFHDNKKLFETQLIELDNNLVTESQL 522
              E+ KN+  K+ K  K ++    +IS +   L+  H  +   ET++ +L+ +L  E ++
Sbjct: 473  LEERTKNLVNKMGKAEKILKSTNHSISEAEHLLEELHGEQTEHETEVKDLNQSLEEERRI 532

Query: 523  LENIKLDLKDKTVGLSEEILKTEKDLEPWNIKLDELKSEIQIKESEKALFEESKNKLKAN 582
            L++IKL LKDKT  +S EI++ EKDLEPW+++L E KS+IQ+ ESE +L EE++ KLK N
Sbjct: 533  LDDIKLSLKDKTKDISAEIIQHEKDLEPWDLQLQEKKSQIQLAESELSLLEETQVKLKKN 592

Query: 583  IEALEKDVNEKSKLTEDRRKEVKNLMTKLENVSKEVIFGTNELKK----ANEKLCEMQKI 638
             EALE+++  K      R++E++  +  L+   K +I G ++ +K    A+ KL EMQ I
Sbjct: 593  AEALEENIAAKKA----RKQELQGFILDLKKNLKSLIDGRSQGEKDFSTAHLKLKEMQTI 648

Query: 639  LIQDRQKANDARTSLSNVENRSKVLRALLKLQKSGRINGFHGRLGNLGVIDEKYDVAIST 698
            L   RQ+A +AR+SLS  EN+SKVL AL +LQKSGRINGFHGRLG+LGVID+ +DVAIST
Sbjct: 649  LNAHRQRAMEARSSLSKAENKSKVLTALSRLQKSGRINGFHGRLGDLGVIDDNFDVAIST 708

Query: 699  ACPRLNDIVVDSVECGQQCIEYLRKNNLGHARFILLDKLNKFSMEKISTPRNVPRLFDLI 758
            ACPRL+D+VVD+VEC Q CI+YLRKN LG+ARFILLD+L +F+++ + TP NVPRLFDL+
Sbjct: 709  ACPRLDDVVVDTVECAQHCIDYLRKNKLGYARFILLDRLRQFNLQPVDTPENVPRLFDLV 768

Query: 759  KVNDEKFLPAFYSVLRNTLVANDLKEANAVAYGKTRYRVVTLKGNLIDISGTMSGGGNQA 818
            K  D KF  AFYSVLR+TLVA DLK+AN VAYGK R+RVVT+ G LIDISGTMSGGGN  
Sbjct: 769  KPKDPKFSNAFYSVLRDTLVARDLKQANNVAYGKRRFRVVTIDGKLIDISGTMSGGGNHV 828

Query: 819  SKGAMQLXXXXXXXXXXXXXXXVMEIEKELSIREKNYQNAYNTVQEMEIELRNLKESEPK 878
             KG M++               V +IE ELS REKN++ A +TV EME EL+ +++ EP 
Sbjct: 829  VKGLMRIGKNQSDRMDDYTPEEVNKIENELSEREKNFRVANDTVHEMEQELKKVRDQEPD 888

Query: 879  IELEISKLNFEIDSLENECSLKRKQLNEPNASFSIEDNMSADITEMDNALYTLNEKQKLI 938
            +E +I +   E DSL +E +L  +Q+ E   ++    N +A + ++   L  L  +   +
Sbjct: 889  MESQILRAEMEADSLASELALAEEQVKEAKMAYDKSVNDTAQLNKIMKILEHLRGEYDDL 948

Query: 939  ESQMKSKKDRIKELQDKIMKIGGIKLQMQNSKVDXXXXXXXXXXXXXXXXXAGIMKIESD 998
            +++ K+KK+RIK LQD+IMKIGG  LQ+QNSKV+                 +GI K   D
Sbjct: 949  QAETKTKKERIKALQDQIMKIGGTNLQIQNSKVESLSQRIDILVAKLKKVKSGIKKSVGD 1008

Query: 999  VRXXXXXXXXXXXDNTKLNEKKXXXXXXXXXXXXXXXQNENNMNCIQDKKFTLREKSEIT 1058
            V            D    + +                +N+ ++  I + K  L E+SE  
Sbjct: 1009 VTKFQKQLKNVERDIELSSNELKVIEEKSEQIKLDLIKNDTDVTGILNLKSDLEEQSEQL 1068

Query: 1059 MNELTEMEGLLSEFKTLEVEYKIKSEKLASLLNQIKKILKALEEDHSSLSIREVAYDL-- 1116
              ++ EMEG + EFK+LE+E K K EKL SLL  IK  +K  E++ + LSIR+V + L  
Sbjct: 1069 KEKVAEMEGKIDEFKSLEMEMKNKLEKLNSLLTYIKSDIKQQEKELNELSIRDVTHTLLI 1128

Query: 1117 ------DLLNIKEQEAQK-----IKTELYADFEQNQSXXXXXXXXXXXXXXXXXAKGIPS 1165
                  D+L+ + ++ Q+     I  E   + +  +                  ++GIP 
Sbjct: 1129 LDNNQMDILDKEGEDRQETNQEDISGEAKGETQGEEGDNDDRHCMNIDETSDEVSRGIPR 1188

Query: 1166 YMESDFKQFDISSLEAELVQLQDYFEIAKVDLDILEEYTRRMIEYRQRKYDLNQSVEQRD 1225
              E + K+ +I  LE ++ +L  Y +   VD+ +LEEY RR+ E+++RK DLNQ+V++RD
Sbjct: 1189 LSEDELKELNIELLEGDIGELTCYIDATNVDIGVLEEYARRLAEFKRRKLDLNQAVQKRD 1248

Query: 1226 KVRKELEDLKKCRFNEFMESFNIISMTLKEMYQIITMGGNAELELVDSLDPFSEGVTFSV 1285
            +V+++LE LKK RF+EFM  FNIISMTLKEMYQ+ITMGGNAELELVDSLDPFSEGVTFSV
Sbjct: 1249 EVKEQLEILKKKRFDEFMTGFNIISMTLKEMYQMITMGGNAELELVDSLDPFSEGVTFSV 1308

Query: 1286 MPPKKSWRNISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIK 1345
            MPPKKSWRNI+NLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIK
Sbjct: 1309 MPPKKSWRNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIK 1368

Query: 1346 ERTKNAQFIVISLRNNMFELAEQLVGIYKNVNQTKSATLKNNDILCR 1392
            ERTKNAQFIVISLRNNMFELA+QLVG+YK  N+TKS T+KN DIL R
Sbjct: 1369 ERTKNAQFIVISLRNNMFELAQQLVGVYKRDNRTKSTTVKNIDILNR 1415

>Skud_12.154 Chr12 (285613..289866) [4254 bp, 1417 aa] {ON} YLR086W
            (REAL)
          Length = 1417

 Score = 1264 bits (3272), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 706/1424 (49%), Positives = 923/1424 (64%), Gaps = 40/1424 (2%)

Query: 1    MSALPDAKKQKVK------------DIESNSPLNNDIPKIAQSRNDSPLQVANDPLKSYT 48
            M   P +KKQK K            D E  S + N + +  ++ + +   + +   +S+T
Sbjct: 1    MCDSPLSKKQKRKATEEPELSLNDTDAERESRVENRVNRTEKTPDPNSPSLESSYARSHT 60

Query: 49   PMKVXXXXXXXXXXXPLPSQLMXXXXXXXXXXXXXXXXRGRAVKAYXXXXXXXXXXXXXX 108
            P K+             P+                   RGR  KAY              
Sbjct: 61   PRKLVLSSGENRYAFSQPTNSATTSLHVPNLQPPKVSSRGRDYKAYSQSPPRSPGRSPAR 120

Query: 109  XXXXKLELIQLSPIKNSRSELQKIYSSKQEEKIE--RICLNKLVLHNFKSYAGTQTIGPF 166
                +LEL+QLSP+KNSR ELQK+Y S +    +  R+ +NKLVL NFKSYAG Q +GPF
Sbjct: 121  ----RLELLQLSPVKNSRIELQKLYDSHKSSGKQQGRLFINKLVLDNFKSYAGRQVVGPF 176

Query: 167  HSSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQGKLADLIHKSEEYPDLTSCAVDVHF 226
            H+SFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQ +L+DLIHKSE +PDL +C+V VHF
Sbjct: 177  HTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDRLSDLIHKSEAFPDLQACSVAVHF 236

Query: 227  EYLIDYPDDTTKINPSKQPLIITRRAFKNSTSKYYLNGKESNYKTITALLKEEGIDLDHN 286
            EY+ID P  T++I+  K  L+ITRRAFKN++SKYY+N KES+Y  +T LLK+EGIDLDH 
Sbjct: 237  EYIIDEPSGTSRIDEEKPGLVITRRAFKNNSSKYYINEKESSYTEVTKLLKKEGIDLDHK 296

Query: 287  RFLILQGEVENIAQMKPKAEKEGDDGLLEYLEDIIGTTKYKELIDKKFIEIEALNDICIE 346
            RFLILQGEVENIAQMKPKAEKE DDGLLEYLEDIIGT  YK LI+++  +IE+LN+IC+E
Sbjct: 297  RFLILQGEVENIAQMKPKAEKESDDGLLEYLEDIIGTANYKPLIEERLSQIESLNEICLE 356

Query: 347  RENRFDIIDRXXXXXXXXXXXXXXXXXXXXXQVIVKSKLIQYKIWQNNIKLSNTLEKITK 406
            + NRF+I+DR                       ++KSKL+Q+K+ Q+N KL++TLEKI+ 
Sbjct: 357  KANRFEIVDREKNSLESGKETALEFLKKEKQLTLLKSKLLQFKMLQSNSKLASTLEKISS 416

Query: 407  LEDEYNQEKNKNTELKNKIDELRKLYTKNQDELQALLKDEKELVNAKRSLDSDNVSNTEQ 466
            L  E+  EK K  E   ++DE++  +   +D + +    EK L   KR L+   VS  E+
Sbjct: 417  LNREFESEKKKFQESLREVDEVKAQHKDIKDRISSSTSREKTLSLEKRELEGSRVSLEER 476

Query: 467  LKNIEKKLKKTAKEIEEDLKTISSSNVRLKNFHDNKKLFETQLIELDNNLVTESQLLENI 526
             KN+  K+ K  K ++    +IS S    +     +   E ++ +L+ +L  E  +L++I
Sbjct: 477  TKNLVNKMGKAEKALKSTKHSISESEHMFQELQRQQTEHEKEIKDLNQSLEEERIILDDI 536

Query: 527  KLDLKDKTVGLSEEILKTEKDLEPWNIKLDELKSEIQIKESEKALFEESKNKLKANIEAL 586
            KL LKDKT  +S +I++ EK+ EPW+++L E KS+IQ+ ESE +L EE++ KLK N EAL
Sbjct: 537  KLSLKDKTKDISAKIIRHEKESEPWDLQLQEKKSQIQLAESELSLLEETRAKLKKNAEAL 596

Query: 587  EKDVNEKSKLTEDRRKEVKNLMTKLENVSKEVIFGTNE----LKKANEKLCEMQKILIQD 642
            E+ +  K +    R++E++ L+  L    K +I G ++     + A+ KL EMQ+IL   
Sbjct: 597  EEKIISKKQ----RKQELQGLVLDLSQRLKSLIDGRSQGERDFRSAHLKLKEMQRILNAH 652

Query: 643  RQKANDARTSLSNVENRSKVLRALLKLQKSGRINGFHGRLGNLGVIDEKYDVAISTACPR 702
            RQ+A +AR+SLS  +N++ VL AL KLQKSGRINGFHGRLG+LGVID  +DVAISTACPR
Sbjct: 653  RQRAMEARSSLSKAQNKNMVLTALSKLQKSGRINGFHGRLGDLGVIDNSFDVAISTACPR 712

Query: 703  LNDIVVDSVECGQQCIEYLRKNNLGHARFILLDKLNKFSMEKISTPRNVPRLFDLIKVND 762
            L+D+VVD+VEC Q CI+YLRKN LG+ARFILLD+L KF+++ ISTP NVPRLFD++K  D
Sbjct: 713  LDDVVVDTVECAQHCIDYLRKNKLGYARFILLDRLRKFNLQPISTPENVPRLFDVVKPKD 772

Query: 763  EKFLPAFYSVLRNTLVANDLKEANAVAYGKTRYRVVTLKGNLIDISGTMSGGGNQASKGA 822
             KF  AFYSVL++TLVA DLK+AN VAYGK R+RVVT+ G LIDISGTMSGGGN   KG 
Sbjct: 773  PKFSNAFYSVLKDTLVARDLKQANKVAYGKRRFRVVTVDGKLIDISGTMSGGGNHVMKGL 832

Query: 823  MQLXXXXXXXXXXXXXXXVMEIEKELSIREKNYQNAYNTVQEMEIELRNLKESEPKIELE 882
            M+L               V++IE EL+ REKN++ A +TV EME EL+ +++ EP +E +
Sbjct: 833  MRLGTNQSDEIEDYTPEEVIKIEHELAEREKNFRVANDTVHEMEEELKKVRDQEPDLESQ 892

Query: 883  ISKLNFEIDSLENECSLKRKQLNEPNASFSIEDNMSADITEMDNALYTLNEKQKLIESQM 942
            IS+   E DSL +E  L  +Q  E   ++    N    + E+   L  L  + + ++S+ 
Sbjct: 893  ISRAEMEADSLTSELMLAEQQAKEAKMAYDKAVNEKTQVNEVMKNLEHLRGEYEDLQSET 952

Query: 943  KSKKDRIKELQDKIMKIGGIKLQMQNSKVDXXXXXXXXXXXXXXXXXAGIMKIESDVRXX 1002
            ++KK++IK LQD+IMKIGG KL  QNSKV                  +GI K E DV   
Sbjct: 953  RTKKEQIKILQDQIMKIGGTKLHTQNSKVGSLCQRIDILVIKLKKVKSGIKKSEGDVLKY 1012

Query: 1003 XXXXXXXXXDNTKLNEKKXXXXXXXXXXXXXXXQNENNMNCIQDKKFTLREKSEITMNEL 1062
                     D    + +                +N+ NM  I + K  L+++ E     L
Sbjct: 1013 QKQLKNFEQDEELSSNELKVIEEKLKQTKLALTENDTNMTEISNLKSELKDQGEQLKERL 1072

Query: 1063 TEMEGLLSEFKTLEVEYKIKSEKLASLLNQIKKILKALEEDHSSLSIREVAYDLDLLN-- 1120
            TEME  + EFK+LE+E K K EKL SLL  IK  +K  +++ + LSIR+V + L +L+  
Sbjct: 1073 TEMEENIDEFKSLEIEMKNKLEKLNSLLIHIKNEIKQQDKELNDLSIRDVTHTLQMLDNN 1132

Query: 1121 --------IK-EQEAQKIKTELYADFEQNQSXXXXXXXXXXX---XXXXXXAKGIPSYME 1168
                    IK EQ+A + K     D E+ Q                     ++GIP   E
Sbjct: 1133 QMDVVEDGIKDEQDADQDKPSGIPDDEKIQEKDDADNNHHSMNIDEMSSEISRGIPKLCE 1192

Query: 1169 SDFKQFDISSLEAELVQLQDYFEIAKVDLDILEEYTRRMIEYRQRKYDLNQSVEQRDKVR 1228
             + K  DI  LE+++  L  Y     VD+ +LEEY RR+IE+++RK DLNQ+V++RD+V+
Sbjct: 1193 EELKDLDIELLESDISGLTCYINETSVDIGVLEEYVRRLIEFKRRKLDLNQAVQKRDEVK 1252

Query: 1229 KELEDLKKCRFNEFMESFNIISMTLKEMYQIITMGGNAELELVDSLDPFSEGVTFSVMPP 1288
            ++LE LKK RF+EFM  FNIISMTLKEMYQ+ITMGGNAELELVDSLDPFSEGVTFSVMPP
Sbjct: 1253 EQLEILKKNRFDEFMNGFNIISMTLKEMYQMITMGGNAELELVDSLDPFSEGVTFSVMPP 1312

Query: 1289 KKSWRNISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERT 1348
            KKSWRNI+NLSGGEKTLSSLALVFALHKY+PTPLYVMDEIDAALDFRNVSIVANYIKERT
Sbjct: 1313 KKSWRNITNLSGGEKTLSSLALVFALHKYRPTPLYVMDEIDAALDFRNVSIVANYIKERT 1372

Query: 1349 KNAQFIVISLRNNMFELAEQLVGIYKNVNQTKSATLKNNDILCR 1392
            KNAQFIVISLRNNMFELA+QL+GIYK  N+TKS T+KN DIL R
Sbjct: 1373 KNAQFIVISLRNNMFELAQQLIGIYKRDNRTKSTTVKNIDILKR 1416

>Smik_12.145 Chr12 (282081..286337) [4257 bp, 1418 aa] {ON} YLR086W
            (REAL)
          Length = 1418

 Score = 1249 bits (3232), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 690/1367 (50%), Positives = 904/1367 (66%), Gaps = 25/1367 (1%)

Query: 45   KSYTPMKVXXXXXXXXXXXPLPSQLMXXXXXXXXXXXXXXXXRGRAVKAYXXXXXXXXXX 104
            KS+TP K+             P+                   RGR  KAY          
Sbjct: 57   KSHTPRKLVLSSGENRYAFSQPTNSATTSLHVPNLQPPGTSSRGRDYKAYSQSPPRSPGR 116

Query: 105  XXXXXXXXKLELIQLSPIKNSRSELQKIYSSKQEEKIE--RICLNKLVLHNFKSYAGTQT 162
                    +LEL+QLSP+KNSR ELQK+Y+S Q    +  R+ +N+LVL NFKSYAG Q 
Sbjct: 117  SPTR----RLELLQLSPVKNSRVELQKLYNSHQSSTKQQGRLFINELVLENFKSYAGRQV 172

Query: 163  IGPFHSSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQGKLADLIHKSEEYPDLTSCAV 222
            +GPFH+SFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQ +L+DLIHKSE +P+L SC+V
Sbjct: 173  VGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDRLSDLIHKSEAFPNLQSCSV 232

Query: 223  DVHFEYLIDYPDDTTKINPSKQPLIITRRAFKNSTSKYYLNGKESNYKTITALLKEEGID 282
             VHFEY+ID    T++I+  K  L+ITR+AFKN++SKYY+NGKES+Y  +T LLK EGID
Sbjct: 233  AVHFEYVIDESSGTSRIDEEKPGLVITRKAFKNNSSKYYINGKESSYTEVTKLLKNEGID 292

Query: 283  LDHNRFLILQGEVENIAQMKPKAEKEGDDGLLEYLEDIIGTTKYKELIDKKFIEIEALND 342
            LDH RFLILQGEVENIAQMKPKAEKE DDGLLEYLEDIIGT  YK LI+++  +IEALN+
Sbjct: 293  LDHKRFLILQGEVENIAQMKPKAEKESDDGLLEYLEDIIGTANYKPLIEEQMNQIEALNE 352

Query: 343  ICIERENRFDIIDRXXXXXXXXXXXXXXXXXXXXXQVIVKSKLIQYKIWQNNIKLSNTLE 402
            +C+E+ENRF+I+DR                       ++KSKL Q+K+ Q+N KL++TLE
Sbjct: 353  VCLEKENRFEIVDREKNSLESGKETALEFLAKEKQLTLLKSKLFQFKVLQSNSKLASTLE 412

Query: 403  KITKLEDEYNQEKNKNTELKNKIDELRKLYTKNQDELQALLKDEKELVNAKRSLDSDNVS 462
            KI+ L  ++  EK K  E   K++E++    + +D + +    EK+LV  +R L+   VS
Sbjct: 413  KISSLNKDFETEKVKFQESLKKVEEVKTQRKEIKDRISSNDSREKDLVLERRELEGTRVS 472

Query: 463  NTEQLKNIEKKLKKTAKEIEEDLKTISSSNVRLKNFHDNKKLFETQLIELDNNLVTESQL 522
              E+ KN+  K++K+ +  +   ++IS +   LK  H  +   E+++ +L+  L  E  +
Sbjct: 473  LEERTKNLANKIEKSERTSKCTKRSISEAEHTLKELHTQQTEHESEIKDLNQLLEEERSV 532

Query: 523  LENIKLDLKDKTVGLSEEILKTEKDLEPWNIKLDELKSEIQIKESEKALFEESKNKLKAN 582
            L+ IKL LKDKT  +S EI++ EK+LEPW+++L E +S+IQ+ ESE +L EE+++KLK N
Sbjct: 533  LDEIKLSLKDKTKDISTEIIQHEKELEPWDLQLQEKESQIQLAESELSLLEETQSKLKKN 592

Query: 583  IEALEKDVNEKSKLTEDRRKEVKNLMTKLENVSKEVIFGTNELKKANEKLCEMQKILIQD 642
            +E +E+ +  +    ++ +  + NL  KL ++  E   G      A+ KL EMQK+L   
Sbjct: 593  VETMEEKILARKAHKQELQDLILNLKKKLSSLRDERSQGEENFSSAHLKLEEMQKVLNTH 652

Query: 643  RQKANDARTSLSNVENRSKVLRALLKLQKSGRINGFHGRLGNLGVIDEKYDVAISTACPR 702
            RQ+A +AR+SLS  +N+SKVL AL KLQKSGRINGFHGRLG+LG+ID  +DVAISTACPR
Sbjct: 653  RQRAMEARSSLSEAQNKSKVLTALSKLQKSGRINGFHGRLGDLGIIDNSFDVAISTACPR 712

Query: 703  LNDIVVDSVECGQQCIEYLRKNNLGHARFILLDKLNKFSMEKISTPRNVPRLFDLIKVND 762
            L+D+VVD+VEC QQCI+YLRKN LG+ARFILLD+L +F+++ ISTP NVPRLFDL+K  D
Sbjct: 713  LDDVVVDTVECAQQCIDYLRKNKLGYARFILLDRLRQFNLQPISTPENVPRLFDLVKPKD 772

Query: 763  EKFLPAFYSVLRNTLVANDLKEANAVAYGKTRYRVVTLKGNLIDISGTMSGGGNQASKGA 822
             KF  AFYSVLR+TLVA  LK+AN VAYG+ R+RVVT+ G LIDISGT+SGGGN  SKG 
Sbjct: 773  PKFSNAFYSVLRDTLVARSLKQANNVAYGRKRFRVVTIDGKLIDISGTISGGGNHVSKGL 832

Query: 823  MQLXXXXXXXXXXXXXXXVMEIEKELSIREKNYQNAYNTVQEMEIELRNLKESEPKIELE 882
            M+L               V +IE ELS RE N++ A +TV EME EL+NL++ EP IE +
Sbjct: 833  MRLGTNQSNKIDDYTPEEVNKIEHELSERENNFRVANDTVHEMEAELKNLRDQEPAIESK 892

Query: 883  ISKLNFEIDSLENECSLKRKQLNEPNASFSIEDNMSADITEMDNALYTLNEKQKLIESQM 942
            ISK   E DS+ +E +L  +Q+ E   ++    +  A +  +   L  L  +   ++S+ 
Sbjct: 893  ISKTEMEADSITSELTLAEQQVKEARIAYHNALSDKAQVNMIMKNLERLKGEHDDLQSET 952

Query: 943  KSKKDRIKELQDKIMKIGGIKLQMQNSKVDXXXXXXXXXXXXXXXXXAGIMKIESDVRXX 1002
            K+KK++IK LQ +IMKIGG KLQMQNSKV                  +GI K E DV   
Sbjct: 953  KTKKEKIKVLQGEIMKIGGTKLQMQNSKVGSLCQRLDILVAKLKKVKSGIKKSEGDVLKF 1012

Query: 1003 XXXXXXXXXDNTKLNEKKXXXXXXXXXXXXXXXQNENNMNCIQDKKFTLREKSEITMNEL 1062
                     D    + +                +N+  M    + +  L+E+SE     +
Sbjct: 1013 QKQLKNSERDVELSSNELKAIEEKLKHTKLDLSENDIKMTETFNLRSELKEESEQLKEMV 1072

Query: 1063 TEMEGLLSEFKTLEVEYKIKSEKLASLLNQIKKILKALEEDHSSLSIREVAYDLDLLN-- 1120
             E E  + EFK+LE+E K K EKL SLL  IKK +   E+  S LSIR+V + L++L+  
Sbjct: 1073 AETEENIDEFKSLEIEMKNKLEKLNSLLMHIKKEINQQEKGLSELSIRDVTHTLEILDNN 1132

Query: 1121 ---------------IKEQEAQKIKTELYADFEQNQSXXXXXXXXXXXXXXXXXAKGIPS 1165
                           +KE+ + + + E   + ++ +                   +GIP 
Sbjct: 1133 TMDIVKTDNKIEQAVVKEKRSSETQDE--KNIQEEERTCDDHHSMDIDETSNEVIRGIPR 1190

Query: 1166 YMESDFKQFDISSLEAELVQLQDYFEIAKVDLDILEEYTRRMIEYRQRKYDLNQSVEQRD 1225
            + E + K+ DI  LE E+ +L  Y +   VD+ +LEEY RR+ E+++RK DLNQ+V++RD
Sbjct: 1191 FSEEELKELDIELLEKEISELSYYIDETNVDIGVLEEYARRLAEFKRRKLDLNQAVQKRD 1250

Query: 1226 KVRKELEDLKKCRFNEFMESFNIISMTLKEMYQIITMGGNAELELVDSLDPFSEGVTFSV 1285
            +V+ ++E LKK RF+EFM  FNIISMTLKEMYQ+ITMGGNAELELVDSLDPFSEGVTFSV
Sbjct: 1251 EVKGQVEVLKKKRFDEFMTGFNIISMTLKEMYQMITMGGNAELELVDSLDPFSEGVTFSV 1310

Query: 1286 MPPKKSWRNISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIK 1345
            MPPKKSWRNI+NLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIK
Sbjct: 1311 MPPKKSWRNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIK 1370

Query: 1346 ERTKNAQFIVISLRNNMFELAEQLVGIYKNVNQTKSATLKNNDILCR 1392
            ERTKNAQFIVISLRNNMFELA+QLVGIYK  N+T+S T+KN DIL R
Sbjct: 1371 ERTKNAQFIVISLRNNMFELAQQLVGIYKRDNRTRSTTVKNIDILNR 1417

>KAFR0B02710 Chr2 (545337..549587) [4251 bp, 1416 aa] {ON} Anc_8.259
            YLR086W
          Length = 1416

 Score = 1241 bits (3210), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 698/1425 (48%), Positives = 925/1425 (64%), Gaps = 46/1425 (3%)

Query: 1    MSALPDAKKQKV-KDIESNSPLNNDIPKIAQSRND--SPLQVANDPLKSYTPMKVXXXXX 57
            MS  P +KKQKV  D E  +P  N      +  ND   P   A+  LKS+TP K+     
Sbjct: 1    MSHTPLSKKQKVVSDEERITPNQN------EQDNDKTHPEVTASSFLKSHTPRKLLLGSA 54

Query: 58   XXXXXXPLP-----SQLMXXXXXXXXXXXXXXXXRGRAVKAYXXXXXXXXXXXXXXXXXX 112
                    P     S                   RGR  KAY                  
Sbjct: 55   DNKYVLSQPIISSSSHGSSSLQVPNLQPPLSQPSRGRDKKAYSQSPPRSPGRSPVR---- 110

Query: 113  KLELIQLSPIKNSRSELQKIYSSKQEEKIERICLNKLVLHNFKSYAGTQTIGPFHSSFSA 172
            KLELIQLSPIKN+R ELQK+Y+SK + K+ R+ ++KLVL +FKSYAGTQ +GPF++SFSA
Sbjct: 111  KLELIQLSPIKNNRIELQKLYNSKNQNKV-RLYIDKLVLQDFKSYAGTQIVGPFNTSFSA 169

Query: 173  VVGPNGSGKSNVIDSMLFVFGFRANKMRQGKLADLIHKSEEYPDLTSCAVDVHFEYLIDY 232
            +VGPNGSGKSNVIDSMLFVFGFRANKMRQ +L DLIHKSE +P++ SC+V+VHF+Y+ID 
Sbjct: 170  IVGPNGSGKSNVIDSMLFVFGFRANKMRQDRLGDLIHKSEAFPNIQSCSVEVHFQYVIDE 229

Query: 233  PDDTTKINPSKQPLIITRRAFKNSTSKYYLNGKESNYKTITALLKEEGIDLDHNRFLILQ 292
             D T+KI   ++PL++ R+AFKN++SKYY+NGKESNY  +T LLKEEGIDLDH RFLILQ
Sbjct: 230  NDGTSKIIEDRKPLVVMRKAFKNNSSKYYINGKESNYTEVTRLLKEEGIDLDHKRFLILQ 289

Query: 293  GEVENIAQMKPKAEKEGDDGLLEYLEDIIGTTKYKELIDKKFIEIEALNDICIERENRFD 352
            GEVENIAQMK KAEKEGDDGLLEYLEDIIGT+KYK LI+ K +EIEALN+IC+E+E RF+
Sbjct: 290  GEVENIAQMKAKAEKEGDDGLLEYLEDIIGTSKYKTLIEDKMVEIEALNEICVEKEKRFE 349

Query: 353  IIDRXXXXXXXXXXXXXXXXXXXXXQVIVKSKLIQYKIWQNNIKLSNTLEKITKLEDEYN 412
            I++                        +++SKL QYK++Q N KL+ TL+KI+  ++   
Sbjct: 350  IVETEKNSLESDKDAALEFIAKEKQLTLLRSKLTQYKLYQTNTKLATTLDKISNFKNALQ 409

Query: 413  QEKNKNTELKNKIDELRKLYTKNQDELQALLKDEKELVNAKRSLDSDNVSNTEQLKNIEK 472
            +E++K  +++++ID+  +   +  +++ A +  E+ELV  KR  D   VS  E++KN+ +
Sbjct: 410  EERSKYEKIQSEIDQSTRELREANEKINASVAQERELVQKKREYDGQCVSMEERIKNLTQ 469

Query: 473  KLKKTAKEIEEDLKTISSSNVRLKNFHDNKKLFETQLIELDNNLVTESQLLENIKLDLKD 532
            K  K  K + +    I  +   LK+  D +  ++++   L   L  E   L++IKL LKD
Sbjct: 470  KKTKAEKTLHDKRIEIQKNESILKDLQDYQMNYDSEFSNLQKELDKERSKLDDIKLSLKD 529

Query: 533  KTVGLSEEILKTEKDLEPWNIKLDELKSEIQIKESEKALFEESKNKLKANIEALEKDVNE 592
            KT  +S +I   EKD+EPW  K+ E + +IQ+ ESE +L +ES+ KLK  + +L+ ++++
Sbjct: 530  KTKDISSQISLYEKDIEPWVSKIQEKQVQIQLAESEISLLKESQAKLKEGLGSLKVEIDD 589

Query: 593  KSKLTEDRRKEVKNLMTKLENVSKEVIFGTNELKKANEKLCEMQKILIQDRQKANDARTS 652
              K  +++   ++NL  +  ++ KEV  G +E  +A EK  EM+ IL   RQ+A DAR++
Sbjct: 590  VRKEIDNKNSIIENLKKEQVSLKKEVSLGESECSRAKEKEKEMRVILNSHRQRAIDARSA 649

Query: 653  LSNVENRSKVLRALLKLQKSGRINGFHGRLGNLGVIDEKYDVAISTACPRLNDIVVDSVE 712
            L   EN+S VL AL +LQKSGRINGFHGRLG+LGVI +KYD+AISTAC RL+DIVVDSVE
Sbjct: 650  LHMAENKSTVLSALTRLQKSGRINGFHGRLGDLGVIADKYDIAISTACSRLDDIVVDSVE 709

Query: 713  CGQQCIEYLRKNNLGHARFILLDKLNKFSMEKISTPRNVPRLFDLIKVNDEKFLPAFYSV 772
            CGQQCIEYLRKN LG+ARFILLDKL  F + ++ TP NV RLFDL++  D KF  AFYSV
Sbjct: 710  CGQQCIEYLRKNKLGYARFILLDKLRNFQLGQLQTPENVLRLFDLVQPIDLKFSNAFYSV 769

Query: 773  LRNTLVANDLKEANAVAYGKTRYRVVTLKGNLIDISGTMSGGGNQASKGAMQLXXXXXXX 832
            LR+TLVA D+++AN VAYGK RYRVVTL G LIDISGTM+GGG+  SKG M+L       
Sbjct: 770  LRDTLVATDIRQANRVAYGKRRYRVVTLDGKLIDISGTMTGGGSHVSKGLMKLKNSNMEH 829

Query: 833  XXXXXXXXVMEIEKELSIREKNYQNAYNTVQEMEIELRNLKESEPKIELEISKLNFEIDS 892
                    V +IE++L+ RE N++ A++T+QEM  EL+ L++ EP+IELEI+KL  ++DS
Sbjct: 830  LEVYEAGDVEKIERDLAERENNFKIAHDTLQEMNNELKRLQDKEPEIELEIAKLLMDVDS 889

Query: 893  LENECSLKRKQLNEPNASFSIEDNMSADITEMDNALYTLNEKQKLIESQMKSKKDRIKEL 952
            L ++ +LK +QL E   +++   N    +   +  L TL  + + +E Q +SKK++I  L
Sbjct: 890  LNDQLNLKEQQLKELEKNYTDVINKKDPLDRAEAFLQTLRNEHRALEDQSQSKKEKINTL 949

Query: 953  QDKIMKIGGIKLQMQNSKVDXXXXXXXXXXXXXXXXXAGIMKIESDVRXXXXXXXXXXXD 1012
            +++IMKIGG +LQ+QNSKV                  A I + E +++           D
Sbjct: 950  KEEIMKIGGKELQIQNSKVSSLTERIGIVNAKHKKDKATIKRTEKELQKVQRLFKQAELD 1009

Query: 1013 NTKLNEKKXXXXXXXXXXXXXXXQNENNMNCIQDKKFTLREKSEITMNELTEMEGLLSEF 1072
            NT                     + E   + I ++K  L  + E    ++ +ME  ++E+
Sbjct: 1010 NTACVNDLETLQTNVIAIRTRLQETEAEFDIILNEKDDLTGQCESLKEKIKDMEESMNEY 1069

Query: 1073 KTLEVEYKIKSEKLASLLNQIKKILKALEEDHSSLSIREV-------------------- 1112
            K+ E+E K K EKL SLL+  KK +++L ++  S  +R+V                    
Sbjct: 1070 KSFEIEIKNKLEKLNSLLDYCKKDIRSLNQELQSYHVRDVTQSLEKIQNENANNSVGVKQ 1129

Query: 1113 -AYDLDLLNIKEQEAQKIKTELYADFEQNQSXXXXXXXXXXXX------XXXXXAKGIPS 1165
             + +LD+ +       K   E+  +   N S                       +KGIP 
Sbjct: 1130 SSNNLDVSSSHTPNVDKHDDEISMEDADNDSQNEIEEKEQDADIMDLDNVTEEVSKGIPK 1189

Query: 1166 YMESDFKQFDISSLEAELVQLQDYFEIAKVDLDILEEYTRRMIEYRQRKYDLNQSVEQRD 1225
              + D K  D+ SLE+E+ QLQDY E +  D+++LEEY RR+ E+++RK DLN +V +RD
Sbjct: 1190 LTDDDLKSIDLDSLESEINQLQDYVENSNADIELLEEYIRRLEEFKKRKLDLNTTVARRD 1249

Query: 1226 KVRKELEDLKKCRFNEFMESFNIISMTLKEMYQIITMGGNAELELVDSLDPFSEGVTFSV 1285
            +VR ELE LKK R +EFME F+IIS+TLKEMYQ+ITMGGNAELELVDSLDPFSEGVTFSV
Sbjct: 1250 EVRDELEKLKKTRHDEFMEGFSIISLTLKEMYQMITMGGNAELELVDSLDPFSEGVTFSV 1309

Query: 1286 MPPKKSWRNISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIK 1345
            MPPKKSWRNI+NLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIK
Sbjct: 1310 MPPKKSWRNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIK 1369

Query: 1346 ERTKNAQFIVISLRNNMFELAEQLVGIYKNVNQTKSATLKNNDIL 1390
            ERTKNAQFIVISLRNNMFELA+QLVGIYK  N T+SATLKN DIL
Sbjct: 1370 ERTKNAQFIVISLRNNMFELAQQLVGIYKRSNMTQSATLKNKDIL 1414

>YLR086W Chr12 (302243..306499) [4257 bp, 1418 aa] {ON}  SMC4Subunit
            of the condensin complex; reorganizes chromosomes during
            cell division; forms a complex with Smc2p that has
            ATP-hydrolyzing and DNA-binding activity; required for
            tRNA gene clustering at the nucleolus; potential Cdc28p
            substrate
          Length = 1418

 Score = 1233 bits (3191), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 688/1370 (50%), Positives = 906/1370 (66%), Gaps = 31/1370 (2%)

Query: 45   KSYTPMKVXXXXXXXXXXXPLPSQLMXXXXXXXXXXXXXXXXRGRAVKAYXXXXXXXXXX 104
            KSYTP K+             P+                   RGR  K+Y          
Sbjct: 57   KSYTPRKLVLSSGENRYAFSQPTNSTTTSLHVPNLQPPKTSSRGRDHKSYSQSPPRSPGR 116

Query: 105  XXXXXXXXKLELIQLSPIKNSRSELQKIY-----SSKQEEKIERICLNKLVLHNFKSYAG 159
                    +LEL+QLSP+KNSR ELQKIY     SSKQ+    R+ +N+LVL NFKSYAG
Sbjct: 117  SPTR----RLELLQLSPVKNSRVELQKIYDRHQSSSKQQS---RLFINELVLENFKSYAG 169

Query: 160  TQTIGPFHSSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQGKLADLIHKSEEYPDLTS 219
             Q +GPFH+SFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQ +L+DLIHKSE +P L S
Sbjct: 170  KQVVGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDRLSDLIHKSEAFPSLQS 229

Query: 220  CAVDVHFEYLIDYPDDTTKINPSKQPLIITRRAFKNSTSKYYLNGKESNYKTITALLKEE 279
            C+V VHF+Y+ID    T++I+  K  LIITR+AFKN++SKYY+N KES+Y  +T LLK E
Sbjct: 230  CSVAVHFQYVIDESSGTSRIDEEKPGLIITRKAFKNNSSKYYINEKESSYTEVTKLLKNE 289

Query: 280  GIDLDHNRFLILQGEVENIAQMKPKAEKEGDDGLLEYLEDIIGTTKYKELIDKKFIEIEA 339
            GIDLDH RFLILQGEVENIAQMKPKAEKE DDGLLEYLEDIIGT  YK LI+++  +IE 
Sbjct: 290  GIDLDHKRFLILQGEVENIAQMKPKAEKESDDGLLEYLEDIIGTANYKPLIEERMGQIEN 349

Query: 340  LNDICIERENRFDIIDRXXXXXXXXXXXXXXXXXXXXXQVIVKSKLIQYKIWQNNIKLSN 399
            LN++C+E+ENRF+I+DR                       +++SKL Q+K+ Q+N KL++
Sbjct: 350  LNEVCLEKENRFEIVDREKNSLESGKETALEFLEKEKQLTLLRSKLFQFKLLQSNSKLAS 409

Query: 400  TLEKITKLEDEYNQEKNKNTELKNKIDELRKLYTKNQDELQALLKDEKELVNAKRSLDSD 459
            TLEKI+    +   EK K  E   K+DE++    + +D + +    EK LV  +R L+  
Sbjct: 410  TLEKISSSNKDLEDEKMKFQESLKKVDEIKAQRKEIKDRISSCSSKEKTLVLERRELEGT 469

Query: 460  NVSNTEQLKNIEKKLKKTAKEIEEDLKTISSSNVRLKNFHDNKKLFETQLIELDNNLVTE 519
             VS  E+ KN+  K++K  K ++    +IS +   L+     +   ET++ +L   L  E
Sbjct: 470  RVSLEERTKNLVSKMEKAEKTLKSTKHSISEAENMLEELRGQQTEHETEIKDLTQLLEKE 529

Query: 520  SQLLENIKLDLKDKTVGLSEEILKTEKDLEPWNIKLDELKSEIQIKESEKALFEESKNKL 579
              +L++IKL LKDKT  +S EI++ EK+LEPW+++L E +S+IQ+ ESE +L EE++ KL
Sbjct: 530  RSILDDIKLSLKDKTKNISAEIIRHEKELEPWDLQLQEKESQIQLAESELSLLEETQAKL 589

Query: 580  KANIEALEKDVNEKSKLTEDRRKEVKNLMTKLENVSKEVIFGTNELKKANEKLCEMQKIL 639
            K N+E LE+ +  K    ++ +  + +L  KL ++  E   G      A+ KL EMQK+L
Sbjct: 590  KKNVETLEEKILAKKTHKQELQDLILDLKKKLNSLKDERSQGEKNFTSAHLKLKEMQKVL 649

Query: 640  IQDRQKANDARTSLSNVENRSKVLRALLKLQKSGRINGFHGRLGNLGVIDEKYDVAISTA 699
               RQ+A +AR+SLS  +N+SKVL AL +LQKSGRINGFHGRLG+LGVID+ +DVAISTA
Sbjct: 650  NAHRQRAMEARSSLSKAQNKSKVLTALSRLQKSGRINGFHGRLGDLGVIDDSFDVAISTA 709

Query: 700  CPRLNDIVVDSVECGQQCIEYLRKNNLGHARFILLDKLNKFSMEKISTPRNVPRLFDLIK 759
            CPRL+D+VVD+VEC Q CI+YLRKN LG+ARFILLD+L +F+++ ISTP NVPRLFDL+K
Sbjct: 710  CPRLDDVVVDTVECAQHCIDYLRKNKLGYARFILLDRLRQFNLQPISTPENVPRLFDLVK 769

Query: 760  VNDEKFLPAFYSVLRNTLVANDLKEANAVAYGKTRYRVVTLKGNLIDISGTMSGGGNQAS 819
              + KF  AFYSVLR+TLVA +LK+AN VAYGK R+RVVT+ G LIDISGTMSGGGN  +
Sbjct: 770  PKNPKFSNAFYSVLRDTLVAQNLKQANNVAYGKKRFRVVTVDGKLIDISGTMSGGGNHVA 829

Query: 820  KGAMQLXXXXXXXXXXXXXXXVMEIEKELSIREKNYQNAYNTVQEMEIELRNLKESEPKI 879
            KG M+L               V +IE+ELS RE N++ A +TV EME EL+ L++ EP +
Sbjct: 830  KGLMKLGTNQSDKVDDYTPEEVDKIERELSERENNFRVASDTVHEMEEELKKLRDHEPDL 889

Query: 880  ELEISKLNFEIDSLENECSLKRKQLNEPNASF--SIEDNMSADITEMDNALYTLNEKQKL 937
            E +ISK   E DSL +E +L  +Q+ E   ++  ++ D    ++  M N L  L  +   
Sbjct: 890  ESQISKAEMEADSLASELTLAEQQVKEAEMAYVKAVSDKAQLNVV-MKN-LERLRGEYND 947

Query: 938  IESQMKSKKDRIKELQDKIMKIGGIKLQMQNSKVDXXXXXXXXXXXXXXXXXAGIMKIES 997
            ++S+ K+KK++IK LQD+IMKIGGIKLQMQNSKV+                 +   K   
Sbjct: 948  LQSETKTKKEKIKGLQDEIMKIGGIKLQMQNSKVESVCQKLDILVAKLKKVKSASKKSGG 1007

Query: 998  DVRXXXXXXXXXXXDNTKLNEKKXXXXXXXXXXXXXXXQNENNMNCIQDKKFTLREKSEI 1057
            DV            D    +++                +N+ NMN   + K  L+E+SE 
Sbjct: 1008 DVVKFQKLLQNSERDVELSSDELKVIEEQLKHTKLALAENDTNMNETLNLKVELKEQSEQ 1067

Query: 1058 TMNELTEMEGLLSEFKTLEVEYKIKSEKLASLLNQIKKILKALEEDHSSLSIREVAYDLD 1117
               ++ +ME  ++EFK++E+E K K EKL SLL  IK  +   E+  + LSIR+V + L 
Sbjct: 1068 LKEQMEDMEESINEFKSIEIEMKNKLEKLNSLLTYIKSEITQQEKGLNELSIRDVTHTLG 1127

Query: 1118 LLN------IKE---------QEAQKIKTELYADFEQNQSXXXXXXXXXXXXXXXXXAKG 1162
            +L+      +KE         QE +  +T+  ++ +  ++                 ++G
Sbjct: 1128 MLDDNKMDSVKEDVKNNQELDQEYRSCETQDESEIKDAETSCDNYHPMNIDETSDEVSRG 1187

Query: 1163 IPSYMESDFKQFDISSLEAELVQLQDYFEIAKVDLDILEEYTRRMIEYRQRKYDLNQSVE 1222
            IP   E + ++ D+  +E+++ +L  Y E   VD+ +LEEY RR+ E+++RK DLN +V+
Sbjct: 1188 IPRLSEDELRELDVELIESKINELSYYVEETNVDIGVLEEYARRLAEFKRRKLDLNNAVQ 1247

Query: 1223 QRDKVRKELEDLKKCRFNEFMESFNIISMTLKEMYQIITMGGNAELELVDSLDPFSEGVT 1282
            +RD+V+++L  LKK RF+EFM  FNIISMTLKEMYQ+ITMGGNAELELVDSLDPFSEGVT
Sbjct: 1248 KRDEVKEQLGILKKKRFDEFMAGFNIISMTLKEMYQMITMGGNAELELVDSLDPFSEGVT 1307

Query: 1283 FSVMPPKKSWRNISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVAN 1342
            FSVMPPKKSWRNI+NLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVAN
Sbjct: 1308 FSVMPPKKSWRNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVAN 1367

Query: 1343 YIKERTKNAQFIVISLRNNMFELAEQLVGIYKNVNQTKSATLKNNDILCR 1392
            YIKERTKNAQFIVISLRNNMFELA+QLVG+YK  N+TKS T+KN DIL R
Sbjct: 1368 YIKERTKNAQFIVISLRNNMFELAQQLVGVYKRDNRTKSTTIKNIDILNR 1417

>TDEL0F03860 Chr6 (709579..713778) [4200 bp, 1399 aa] {ON} Anc_8.259
            YLR086W
          Length = 1399

 Score = 1230 bits (3183), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 678/1410 (48%), Positives = 910/1410 (64%), Gaps = 30/1410 (2%)

Query: 1    MSALPDAKKQKVKDIESNSPLNNDIPKIAQSRNDSPLQVANDPLKSYTPMKVXXXXXXXX 60
            M   P  K+Q+V D ES         +       SPL   ++   S+TP K+        
Sbjct: 1    MPDTPLTKRQRVNDNESREF------EAVNGSTKSPLTSNSNSTISHTPKKLVIGTNDDT 54

Query: 61   XXXPLPSQLMXXXXXXXXXXXXXXXXRGRAVKAYXXXXXXXXXXXXXXXXXXKLELIQLS 120
                 P  +                 RGR  + Y                  KLELI++S
Sbjct: 55   TSQSQPI-VSSSSLQAPSLQHPNSSSRGREQRTYSQSPPRSPGRSPTR----KLELIKIS 109

Query: 121  PIKNSRSELQKIYSSKQEEK-IERICLNKLVLHNFKSYAGTQTIGPFHSSFSAVVGPNGS 179
            P+K +R ELQ++Y ++Q ++   R+C+NKLVL +FKSYAG Q +GPFHSSFSAVVGPNGS
Sbjct: 110  PVKKNRLELQRLYDAEQSQRNAARLCINKLVLQDFKSYAGRQVVGPFHSSFSAVVGPNGS 169

Query: 180  GKSNVIDSMLFVFGFRANKMRQGKLADLIHKSEEYPDLTSCAVDVHFEYLIDYPDDTTKI 239
            GKSNVIDSMLFVFGFRANKMRQ +L+DLIH SE +P+L SC+V+VHF+Y++D PD TT+I
Sbjct: 170  GKSNVIDSMLFVFGFRANKMRQDRLSDLIHNSEVHPNLKSCSVEVHFQYVVDEPDGTTRI 229

Query: 240  NPSKQPLIITRRAFKNSTSKYYLNGKESNYKTITALLKEEGIDLDHNRFLILQGEVENIA 299
            +  K  L++TR+AFKN++SKYY+N KESNY  +T LLK+EGIDLDH RFLILQGEVENIA
Sbjct: 230  DEEKPTLVVTRKAFKNNSSKYYVNDKESNYTEVTQLLKKEGIDLDHKRFLILQGEVENIA 289

Query: 300  QMKPKAEKEGDDGLLEYLEDIIGTTKYKELIDKKFIEIEALNDICIERENRFDIIDRXXX 359
            QM+PKAEKEG+DGLLEYLEDI GT KYK  I+    EIE LN+ CIE+ENRF I+D+   
Sbjct: 290  QMRPKAEKEGEDGLLEYLEDITGTAKYKPQIETILQEIEVLNESCIEKENRFHIVDQEKS 349

Query: 360  XXXXXXXXXXXXXXXXXXQVIVKSKLIQYKIWQNNIKLSNTLEKITKLEDEYNQEKNKNT 419
                                +++SK+IQYKIWQN+IKL++TL+K +KL+ + +QE  K +
Sbjct: 350  SLETGKDEALEFLEKEKTLTLLRSKMIQYKIWQNDIKLTSTLDKSSKLKGQLDQENEKYS 409

Query: 420  ELKNKIDELRKLYTKNQDELQALLKDEKELVNAKRSLDSDNVSNTEQLKNIEKKLKKTAK 479
            E   ++D L+    +    ++ L  +EK L+  KR LD   V+  E++K++ +K  K  K
Sbjct: 410  ETLKEVDSLKDESKQVAKRIETLAIEEKALLAQKRGLDQQRVAIEEKIKSVNQKTNKAEK 469

Query: 480  EIEEDLKTISSSNVRLKNFHDNKKLFETQLIELDNNLVTESQLLENIKLDLKDKTVGLSE 539
             ++ +  +++++   L+    ++  +E +L +L+  L+TE   LE++K+ LK+KTV +S 
Sbjct: 470  LLKSNQHSLNATEANLRELRQSQLDYEKELQDLNQELITERAKLEDVKISLKEKTVNISA 529

Query: 540  EILKTEKDLEPWNIKLDELKSEIQIKESEKALFEESKNKLKANIEALEKDVNEKSKLTED 599
             I + EKDLEPW+ +L + ++EIQ+ ESE +L +++  ++  +IE L+ ++    +    
Sbjct: 530  GIAQYEKDLEPWDGQLQQKRAEIQLAESELSLLKDTNARINKDIEQLKNEIARGGEEKLA 589

Query: 600  RRKEVKNLMTKLENVSKEVIFGTNELKKANEKLCEMQKILIQDRQKANDARTSLSNVENR 659
            + K ++ L  +  +V+ EV     E   A+ +L +M +ILI  RQ+  DAR + S+ +N+
Sbjct: 590  KEKVIRELKQEESDVTAEVHTAGAECSSASARLKKMHEILIAQRQRTLDARAAFSSAQNK 649

Query: 660  SKVLRALLKLQKSGRINGFHGRLGNLGVIDEKYDVAISTACPRLNDIVVDSVECGQQCIE 719
            S VL AL KLQKSGRI+GFHGRLG+LGVIDEKYDVAISTACPRL DIVV+SVECGQQCIE
Sbjct: 650  STVLTALTKLQKSGRISGFHGRLGDLGVIDEKYDVAISTACPRLEDIVVESVECGQQCIE 709

Query: 720  YLRKNNLGHARFILLDKLNKFSMEKISTPRNVPRLFDLIKVNDEKFLPAFYSVLRNTLVA 779
            YLRKN LG+ARFILLDKL KF   KI TP NVPRLFDL+K  D+KF+PAFYSVLR+TL A
Sbjct: 710  YLRKNKLGYARFILLDKLRKFHTGKIQTPENVPRLFDLVKPKDDKFIPAFYSVLRDTLAA 769

Query: 780  NDLKEANAVAYGKTRYRVVTLKGNLIDISGTMSGGGNQASKGAMQLXXXXXXXXXXXXXX 839
              L +AN VAYGK R+RVV+L G LIDISGTMSGGG+   +G M+L              
Sbjct: 770  QSLAQANRVAYGKKRFRVVSLDGKLIDISGTMSGGGSHVVRGLMRLSQNNSYSPDIFSPE 829

Query: 840  XVMEIEKELSIREKNYQNAYNTVQEMEIELRNLKESEPKIELEISKLNFEIDSLENECSL 899
             V ++E EL+ +EK++Q A +T +EME +L+ LK+  P+I+L++SKL  E +S  +E  L
Sbjct: 830  EVAQLENELTEKEKSFQIASDTFREMEDQLKKLKDRVPEIQLKVSKLVMETESWMSELKL 889

Query: 900  KRKQLNEPNASFSIEDNMSADITEMDNALYTLNEKQKLIESQMKSKKDRIKELQDKIMKI 959
            K K L E   +       + +    +  + TL ++Q+ +  Q  + + +I  L+DKIM+I
Sbjct: 890  KEKLLLERLEAQKKATGKNEEYQLAEARVKTLKDEQRALSDQTTTTRQKIAVLKDKIMEI 949

Query: 960  GGIKLQMQNSKVDXXXXXXXXXXXXXXXXXAGIMKIESDVRXXXXXXXXXXXDNTKLNEK 1019
            GG +LQ+QNSKV                  A I K E++++           D    +++
Sbjct: 950  GGSELQIQNSKVTSTIQRMEILTSKQKKGKASIKKAENELKKSAKIVGNTQKDLDLYSQE 1009

Query: 1020 KXXXXXXXXXXXXXXXQNENNMNCIQDKKFTLREKSEITMNELTEMEGLLSEFKTLEVEY 1079
                              E +++  QD    + EK +     L +ME   +EFK+L++E 
Sbjct: 1010 IASLKENADNVQQTLESVEKSVDEQQDLSHEMNEKLDQLKQRLAQMEAGFTEFKSLKIEI 1069

Query: 1080 KIKSEKLASLLNQIKKILKALEEDHSSLSIREVAYDLDLLNIKEQ--------EAQKIKT 1131
              K EKL +LL  I K ++ LE D ++L IR+V   L LL+  E         E Q+ +T
Sbjct: 1070 NDKLEKLNALLGHITKEVRQLESDLNNLKIRDVTRTLQLLDEGESTNNSKMPNELQEKRT 1129

Query: 1132 ELYADF---EQNQSXXXXXXXXXXXXXXXXXAK------GIPSYMESDFKQFDISSLEAE 1182
            E  AD    E  +S                  K      G+P   E++ K  D+  L A+
Sbjct: 1130 E-GADATRQEGEESDVSMEEEKSNDEVMEVDEKPHELENGLPRVSEAELKSLDVEDLGAQ 1188

Query: 1183 LVQLQDYFEIAKVDLDILEEYTRRMIEYRQRKYDLNQSVEQRDKVRKELEDLKKCRFNEF 1242
            +  LQ+Y +   VD++ILEEY +R+ E+++RK DLN++V +RD +R++L +LKK RF+EF
Sbjct: 1189 IEDLQNYVDSVNVDVEILEEYAKRLAEHKRRKVDLNEAVGERDAMREKLGELKKRRFDEF 1248

Query: 1243 MESFNIISMTLKEMYQIITMGGNAELELVDSLDPFSEGVTFSVMPPKKSWRNISNLSGGE 1302
            M+ F IISMTLKEMYQ+ITMGGNAELELVDSLDPFSEGVTFSVMPPKKSWRNI+NLSGGE
Sbjct: 1249 MQGFGIISMTLKEMYQMITMGGNAELELVDSLDPFSEGVTFSVMPPKKSWRNITNLSGGE 1308

Query: 1303 KTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKNAQFIVISLRNNM 1362
            KTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKNAQFIVISLRNNM
Sbjct: 1309 KTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKNAQFIVISLRNNM 1368

Query: 1363 FELAEQLVGIYKNVNQTKSATLKNNDILCR 1392
            FELA+QLVGIYK  N TKSA+LKNNDIL R
Sbjct: 1369 FELAQQLVGIYKTQNMTKSASLKNNDILNR 1398

>SAKL0H17094g Chr8 complement(1508021..1512289) [4269 bp, 1422 aa]
            {ON} similar to uniprot|Q12267 Saccharomyces cerevisiae
            YLR086W SMC4 Subunit of the condensin complex which
            reorganizes chromosomes during cell division forms a
            stable complex with Smc2p that has ATP-hydrolyzing and
            DNA- binding activity and promotes knotting of circular
            DNA potential Cdc28p substrate
          Length = 1422

 Score = 1224 bits (3167), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 656/1310 (50%), Positives = 881/1310 (67%), Gaps = 38/1310 (2%)

Query: 113  KLELIQLSPIKNSRSELQKIYSSKQEEK---IERICLNKLVLHNFKSYAGTQTIGPFHSS 169
            +LELIQLSP+KN+R+ELQKIY  K ++    + R+C++KL LHNFKSYAGTQ IGPFH+S
Sbjct: 116  RLELIQLSPVKNNRAELQKIYDEKNKDGNQCVHRLCIDKLSLHNFKSYAGTQIIGPFHTS 175

Query: 170  FSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQGKLADLIHKSEEYPDLTSCAVDVHFEYL 229
            FSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQGKL+DLIHKSE YP+L SC+VD+HF Y+
Sbjct: 176  FSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQGKLSDLIHKSEAYPNLESCSVDIHFRYV 235

Query: 230  IDYPDDTTKINPSKQPLIITRRAFKNSTSKYYLNGKESNYKTITALLKEEGIDLDHNRFL 289
            +D  D TT+ +  K P++ITR+AF+N++SKYY++GKESNY  +T LL+++GIDLDH RFL
Sbjct: 236  VDESDGTTRSDDEKPPMVITRKAFRNNSSKYYIDGKESNYTEVTQLLRDQGIDLDHKRFL 295

Query: 290  ILQGEVENIAQMKPKAEKEGDDGLLEYLEDIIGTTKYKELIDKKFIEIEALNDICIEREN 349
            ILQGEVE+I+QMKPKAE+E DDGLLEYLEDIIGT KYK  I+   +EI+ LND+C+E+EN
Sbjct: 296  ILQGEVESISQMKPKAERESDDGLLEYLEDIIGTAKYKAGIEAGLVEIDTLNDVCVEKEN 355

Query: 350  RFDIIDRXXXXXXXXXXXXXXXXXXXXXQVIVKSKLIQYKIWQNNIKLSNTLEKITKLED 409
            RF+++++                       ++KSKL QY IWQ+  KLS TL KI++L +
Sbjct: 356  RFELVEKEKNSLESGKDEALEFLEKEKSLTLLKSKLAQYHIWQDQRKLSETLGKISELNE 415

Query: 410  EYNQEKNKNTELKNKIDELRKLYTKNQDELQALLKDEKELVNAKRSLDSDNVSNTEQLKN 469
               QEK K  + + ++ +LR+     + ++  L K+ K+L + +R +D +  S  E+ +N
Sbjct: 416  HLGQEKAKYDQFQREVAQLRERCNDFKKQMVKLDKEHKDLTSKRRLMDREKTSMEEKQRN 475

Query: 470  IEKKLKKTAKEIEEDLKTISSSNVRLKNFHDNKKLFETQLIELDNNLVTESQLLENIKLD 529
            ++KK  K  K ++    +++ S  +L+  ++++K ++ +L++L+ +L+ E   L+ IKL 
Sbjct: 476  LDKKRLKAEKLLKSTENSMADSKHKLEELNNSQKQYKEKLLQLNESLLEERSKLDEIKLS 535

Query: 530  LKDKTVGLSEEILKTEKDLEPWNIKLDELKSEIQIKESEKALFEESKNKLKANIEALEKD 589
            L+DKT  +S EI   E+DLEPWN +L E KS++++ ES+ A+ +ESK K   NI  L+ +
Sbjct: 536  LRDKTSEISAEIANHERDLEPWNAQLQEKKSQMKLTESQIAILKESKEKKVQNIIQLKTE 595

Query: 590  VNEKSKLTEDRRKEVKNLMTKLENVSKEVIFGTNELKKANEKLCEMQKILIQDRQKANDA 649
            +   ++    +   +  L  +  N+ K +  G  E   A+ KL EM+ +LI  RQ+A +A
Sbjct: 596  IEAFAEKNNVQEIAIHKLQCEQANILKRIDIGEKECGSASSKLGEMKNVLISHRQRAMEA 655

Query: 650  RTSLSNVENRSKVLRALLKLQKSGRINGFHGRLGNLGVIDEKYDVAISTACPRLNDIVVD 709
            R++LSNVEN++KVL AL++LQ+SGRI GFHGRLG+LG ID+ YDVAISTACPRL+DIVVD
Sbjct: 656  RSTLSNVENKNKVLSALIRLQRSGRIAGFHGRLGDLGTIDDMYDVAISTACPRLDDIVVD 715

Query: 710  SVECGQQCIEYLRKNNLGHARFILLDKLNKFSMEKISTPRNVPRLFDLIKVNDEKFLPAF 769
            +VECGQQCIE+LRKN LG+ARFI+LDKL KF++  I TP  VPRLFDL++  + KFLPAF
Sbjct: 716  NVECGQQCIEHLRKNKLGYARFIILDKLRKFNLSPIQTPETVPRLFDLVRSKNGKFLPAF 775

Query: 770  YSVLRNTLVANDLKEANAVAYGKTRYRVVTLKGNLIDISGTMSGGGNQASKGAMQLXXXX 829
            YSVLR+TLV +DLK+AN VAYGK R+RVVTL G LID SGT+SGGG    KG M+     
Sbjct: 776  YSVLRDTLVVSDLKQANRVAYGKRRFRVVTLDGKLIDTSGTLSGGGTHVMKGLMK---SK 832

Query: 830  XXXXXXXXXXXVMEIEKELSIREKNYQNAYNTVQEMEIELRNLKESEPKIELEISKLNFE 889
                       V  IEKEL+ REKN+  A  T  +ME  L+  K+ EP+IE+EI+K   +
Sbjct: 833  QQPGAGYTPEEVQNIEKELNEREKNFHIAIETFHDMEEALKKFKDREPEIEVEIAKRRLD 892

Query: 890  IDSLENECSLKRKQLNEPNA---SFSIEDNMSADITEMDNALYTLNEKQKLIESQMKSKK 946
            I+S   E  LK++QL E        S+ED   AD    ++ L  L+E+   IE++ K+K+
Sbjct: 893  IESSSTELKLKQEQLKELETDRDGGSVEDRELAD---AESKLQVLSEEYDEIENETKNKQ 949

Query: 947  DRIKELQDKIMKIGGIKLQMQNSKVDXXXXXXXXXXXXXXXXXAGIMKIESDVRXXXXXX 1006
              I  L++KIMKIGG KLQ+QNSKV+                     K E+D++      
Sbjct: 950  QLINSLKEKIMKIGGTKLQLQNSKVNSINEQINIISSKQKKDRTATKKAENDLKRLENQC 1009

Query: 1007 XXXXXDNTKLNEKKXXXXXXXXXXXXXXXQNENNMNCIQDKKFTLREKSEITMNELTEME 1066
                 D    N +                + + ++N  +  K  + E+ E     L E  
Sbjct: 1010 REASNDIESCNLEISKISVLNTELEAKIYKLDTSLNETESLKEEVEEEFERVKTNLEEKT 1069

Query: 1067 GLLSEFKTLEVEYKIKSEKLASLLNQIKKILKALEEDHSSLSIREVAYDLDLLN------ 1120
               S+FK++E+E   + EKL  L + IKK +K  +++ +SL IR++   L  LN      
Sbjct: 1070 NNTSDFKSVEIEINNRLEKLNGLTSHIKKEIKYNKDELNSLKIRDITQTLQALNEGKLPE 1129

Query: 1121 -------IKEQEAQKIKTELYADFE-------------QNQSXXXXXXXXXXXXXXXXXA 1160
                   ++++E Q+ + E+ +D               Q Q                  +
Sbjct: 1130 ENEDDFEVQDEEVQREQREMSSDPNAMDIDEEQAAEQFQVQQTDGEIDSMDIDEYENETS 1189

Query: 1161 KGIPSYMESDFKQFDISSLEAELVQLQDYFEIAKVDLDILEEYTRRMIEYRQRKYDLNQS 1220
             G+P + E+  +   I  +E ++ +L  Y + A VD+D+LEEY RR+ EY++RK DLNQ+
Sbjct: 1190 NGLPKFSEAQLQSIQIEDVELQIDELNHYVDNAHVDIDVLEEYARRLAEYKKRKLDLNQA 1249

Query: 1221 VEQRDKVRKELEDLKKCRFNEFMESFNIISMTLKEMYQIITMGGNAELELVDSLDPFSEG 1280
            V +RD+VRK  E+LKK R ++FME F+IISMTLKEMYQ+ITMGGNAELELVDSLDPFSEG
Sbjct: 1250 VLKRDEVRKNCEELKKKRLDKFMEGFSIISMTLKEMYQMITMGGNAELELVDSLDPFSEG 1309

Query: 1281 VTFSVMPPKKSWRNISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIV 1340
            V FSVMPPKKSWRNISNLSGGEKTLSSLALVFALHKY+PTPLYVMDEIDAALDFRNVSIV
Sbjct: 1310 VLFSVMPPKKSWRNISNLSGGEKTLSSLALVFALHKYRPTPLYVMDEIDAALDFRNVSIV 1369

Query: 1341 ANYIKERTKNAQFIVISLRNNMFELAEQLVGIYKNVNQTKSATLKNNDIL 1390
            ANYIKERTKNAQFIVISLRNNMFELA+QLVGIYKN N T+S TL+N DIL
Sbjct: 1370 ANYIKERTKNAQFIVISLRNNMFELAQQLVGIYKNNNMTRSTTLQNIDIL 1419

>ZYRO0C01716g Chr3 complement(130331..134572) [4242 bp, 1413 aa] {ON}
            similar to uniprot|Q12267 Saccharomyces cerevisiae
            YLR086W SMC4 Subunit of the condensin complex which
            reorganizes chromosomes during cell division forms a
            stable complex with Smc2p that has ATP-hydrolyzing and
            DNA- binding activity and promotes knotting of circular
            DNA potential Cdc28p substrate
          Length = 1413

 Score = 1219 bits (3154), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 681/1331 (51%), Positives = 893/1331 (67%), Gaps = 34/1331 (2%)

Query: 87   RGRAVKAYXXXXXXXXXXXXXXXXXXKLELIQLSPIKNSRSELQKIYSSKQ-EEKIERIC 145
            RGR  K Y                  KLELIQ+SP+KNSR ELQKIY ++Q + +  R+C
Sbjct: 89   RGRGSKTYSQSPPRSPGRSPTR----KLELIQISPLKNSRLELQKIYDAQQNQARHTRLC 144

Query: 146  LNKLVLHNFKSYAGTQTIGPFHSSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQGKLA 205
            +++L+L +FKSYAG Q +GPF++SFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQ +L+
Sbjct: 145  IDQLILQDFKSYAGRQVVGPFNTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDRLS 204

Query: 206  DLIHKSEEYPDLTSCAVDVHFEYLIDYPDDTTKINPSKQPLIITRRAFKNSTSKYYLNGK 265
            DLIHKSEEYP L SC+V+VHF+Y+ID P   T+I+  K  L++TR+AF+N+TSKYY+N +
Sbjct: 205  DLIHKSEEYPSLPSCSVEVHFKYVIDEPSGETRIDEEKPNLVVTRKAFRNNTSKYYVNDQ 264

Query: 266  ESNYKTITALLKEEGIDLDHNRFLILQGEVENIAQMKPKAEKEGDDGLLEYLEDIIGTTK 325
            E+NY  +T LLK+EG+DLDH RFLILQGEVENIAQMK KAE+EG+DGLLEYLEDIIGT K
Sbjct: 265  ETNYGEVTKLLKKEGVDLDHKRFLILQGEVENIAQMKSKAEREGEDGLLEYLEDIIGTAK 324

Query: 326  YKELIDKKFIEIEALNDICIERENRFDIIDRXXXXXXXXXXXXXXXXXXXXXQVIVKSKL 385
            YK LI+K   ++E+LNDICIE+ENRF I+DR                       + KSKL
Sbjct: 325  YKPLIEKNLADMESLNDICIEKENRFQIVDREKNSLENGKEEALLFLENERKLTVSKSKL 384

Query: 386  IQYKIWQNNIKLSNTLEKITKLEDEYNQEKNKNTELKNKIDELRKLYTKNQDELQALLK- 444
             QY I  +N+KL NTL+KIT L  +  +E +KN  +K ++D+LR       DEL++ LK 
Sbjct: 385  YQYHILNSNMKLKNTLDKITNLNQKLEKESDKNASVKKELDKLRAF----GDELESKLKN 440

Query: 445  ---DEKELVNAKRSLDSDNVSNTEQLKNIEKKLKKTAKEIEEDLKTISSSNVRLKNFHDN 501
               +EK+L+  KR LD  NV N E++KN EKK  K  K +    ++ISSS  RL      
Sbjct: 441  CNNEEKQLLGKKRELDGKNVLNEEKIKNFEKKRDKAEKTLSSMDRSISSSEARLSELKQL 500

Query: 502  KKLFETQLIELDNNLVTESQLLENIKLDLKDKTVGLSEEILKTEKDLEPWNIKLDELKSE 561
            +  +E  L EL+     E   LE IK  LKDKT G+S EI + EK+LEPWN +L E K++
Sbjct: 501  QVDYENSLKELNEQTEVEKMKLEKIKFSLKDKTNGISLEIAQLEKELEPWNAQLQEKKTQ 560

Query: 562  IQIKESEKALFEESKNKLKANIEALEKDVNEKSKLTEDRRKEVKNLMTKLENVSKEVIFG 621
            IQ+ ES+ +L +E++ KL   I+  ++++  + +      KE+ +L ++ ++V +E+  G
Sbjct: 561  IQLAESQISLIKEAEAKLAQEIDQFKQEIETRKQQILQGSKELDSLHSQHKSVKEEISTG 620

Query: 622  TNELKKANEKLCEMQKILIQDRQKANDARTSLSNVENRSKVLRALLKLQKSGRINGFHGR 681
              E   A  +L EMQ IL   RQKA DAR++LSN EN+SKVL AL +LQKSGRI+GFHGR
Sbjct: 621  EKECLNARIRLKEMQNILNTQRQKALDARSALSNAENKSKVLTALSRLQKSGRISGFHGR 680

Query: 682  LGNLGVIDEKYDVAISTACPRLNDIVVDSVECGQQCIEYLRKNNLGHARFILLDKLNKFS 741
            LG+LGVIDEKYDVAISTACPRL DIVV++VECGQQCIEYLRKN LG+ARFILLDKL KF+
Sbjct: 681  LGDLGVIDEKYDVAISTACPRLEDIVVETVECGQQCIEYLRKNKLGYARFILLDKLRKFN 740

Query: 742  MEKISTPRNVPRLFDLIKVNDEKFLPAFYSVLRNTLVANDLKEANAVAYGKTRYRVVTLK 801
            ++ I+TP +VPRLFDLI   D KF  AF+SVL NTLVANDLK+AN VAYGK R+RVVTL 
Sbjct: 741  LDSINTPESVPRLFDLIHPKDPKFSSAFFSVLGNTLVANDLKQANRVAYGKKRFRVVTLD 800

Query: 802  GNLIDISGTMSGGGNQASKGAMQLXXXXXXXXXXXXXXXVMEIEKELSIREKNYQNAYNT 861
            GNLIDISGTMSGGG++ S+G MQ+               V ++E  L  REKN+Q A +T
Sbjct: 801  GNLIDISGTMSGGGSRVSRGLMQINRNKTEDIEIYSSEEVAQLEVNLVEREKNFQVASDT 860

Query: 862  VQEMEIELRNLKESEPKIELEISKLNFEIDSLENECSLKRKQLNEPNASFSIEDNMSADI 921
            + +ME +L++LKE EP IE  IS+L  EI+S  +E  +K  Q+ E   ++S   + + ++
Sbjct: 861  IYQMEEQLKDLKEKEPAIENNISQLTMEIESWNSEIKIKEIQMLESERAYSATQDNNVEL 920

Query: 922  TEMDNALYTLNEKQKLIESQMKSKKDRIKELQDKIMKIGGIKLQMQNSKVDXXXXXXXXX 981
             E    + +L ++ K I++Q KSKK RI+ L+++IM+IGG +L++Q+SKVD         
Sbjct: 921  RETIQHVQSLKDEFKSIQNQTKSKKHRIETLKNEIMEIGGAELKIQSSKVDSVIQRIDIV 980

Query: 982  XXXXXXXXAGIMKIESDVRXXXXXXXXXXXDNTKLNEKKXXXXXXXXXXXXXXXQNENNM 1041
                    + I K E+++            D    N++                +   ++
Sbjct: 981  VSKQKKERSVIKKTENEINKSHKMKLETSRDLENFNQEIQTLKTTIEGLQDSLNKVHESV 1040

Query: 1042 NCIQDKKFTLREKSEITMNELTEMEGLLSEFKTLEVEYKIKSEKLASLLNQIKKILKALE 1101
              +Q  K  L E+S    ++L ++   ++ FK+ E+E K + EKL SL   +KK +K  E
Sbjct: 1041 TSVQHTKEGLIEESRTLEDKLNDINEDIAIFKSFEMEMKNELEKLNSLSFHLKKEIKHYE 1100

Query: 1102 EDHSSLSIREVAYDLDLLNIKEQEAQKIKTELYADFEQNQSXXXXXXXXXXXXXXXXXA- 1160
            E    L IR+V   L  L  +   A        +D E+++S                   
Sbjct: 1101 EKLGDLKIRDVTQILHDLKDESNNASDPSENPVSDVEESESSVGEGKDENKDLDAQDQVQ 1160

Query: 1161 --------------------KGIPSYMESDFKQFDISSLEAELVQLQDYFEIAKVDLDIL 1200
                                +G+  + E +  + +I  LE E+  LQ++ + +  D+D+L
Sbjct: 1161 DAEKQGDNQMDVEDGGEYSDRGLTQFSEDELHEIEIEELEKEIEDLQNFLDASNADIDVL 1220

Query: 1201 EEYTRRMIEYRQRKYDLNQSVEQRDKVRKELEDLKKCRFNEFMESFNIISMTLKEMYQII 1260
            EEY RR+IE++ R+ DLNQ+VE+R+KV+++L++LKK RF+EFM+ F IISMTLKEMYQ+I
Sbjct: 1221 EEYARRLIEFKSRRLDLNQAVEERNKVKEKLDELKKKRFDEFMQGFGIISMTLKEMYQMI 1280

Query: 1261 TMGGNAELELVDSLDPFSEGVTFSVMPPKKSWRNISNLSGGEKTLSSLALVFALHKYKPT 1320
            TMGGNAELELVD+LDPFSEGVTFSVMPPKKSWRNI+NLSGGEKTLSSLALVFALHKYKPT
Sbjct: 1281 TMGGNAELELVDTLDPFSEGVTFSVMPPKKSWRNITNLSGGEKTLSSLALVFALHKYKPT 1340

Query: 1321 PLYVMDEIDAALDFRNVSIVANYIKERTKNAQFIVISLRNNMFELAEQLVGIYKNVNQTK 1380
            PLYVMDEIDAALDFRNVSIVANYIKERTKNAQFIVISLRNNMFELA+QLVGIYK  N+TK
Sbjct: 1341 PLYVMDEIDAALDFRNVSIVANYIKERTKNAQFIVISLRNNMFELAQQLVGIYKRDNKTK 1400

Query: 1381 SATLKNNDILC 1391
            SAT+KN D + 
Sbjct: 1401 SATIKNIDFVS 1411

>Kwal_56.23825 s56 complement(721498..725688) [4191 bp, 1396 aa] {ON}
            YLR086W (SMC4) - SMC chromosomal ATPase family member
            [contig 172] FULL
          Length = 1396

 Score = 1202 bits (3111), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 656/1311 (50%), Positives = 882/1311 (67%), Gaps = 41/1311 (3%)

Query: 113  KLELIQLSPIKNSRSELQKIYSSKQE-EKIERICLNKLVLHNFKSYAGTQTIGPFHSSFS 171
            KLELIQLSP+K SR E QK   S+     I+R+C+++LVLHNFKSYAGTQ +GPFH+SFS
Sbjct: 95   KLELIQLSPMKKSRLESQKFQESRAMMGSIQRLCIDRLVLHNFKSYAGTQVVGPFHNSFS 154

Query: 172  AVVGPNGSGKSNVIDSMLFVFGFRANKMRQGKLADLIHKSEEYPDLTSCAVDVHFEYLID 231
            AVVGPNGSGKSNVIDS+LFVFGFRANKMRQGKL++LIHKSE +PDL SC VD+ F+Y+ D
Sbjct: 155  AVVGPNGSGKSNVIDSLLFVFGFRANKMRQGKLSELIHKSELHPDLDSCHVDIFFQYVQD 214

Query: 232  YPDDTTKINPSKQPLIITRRAFKNSTSKYYLNGKESNYKTITALLKEEGIDLDHNRFLIL 291
             PD TT I   K  ++I R+AF+N+TSKYYLNGKES+Y  IT LL++EGIDLDH RFLIL
Sbjct: 215  EPDGTTSIIQQKPSMVIRRKAFRNNTSKYYLNGKESSYTIITQLLRDEGIDLDHKRFLIL 274

Query: 292  QGEVENIAQMKPKAEKEGDDGLLEYLEDIIGTTKYKELIDKKFIEIEALNDICIERENRF 351
            QGEVE+IAQMKPKAEKE DDGLLEYLEDIIGT +YK LI+    EI  LNDIC E+ENRF
Sbjct: 275  QGEVESIAQMKPKAEKESDDGLLEYLEDIIGTAQYKPLIENTLSEIAKLNDICEEKENRF 334

Query: 352  DIIDRXXXXXXXXXXXXXXXXXXXXXQVIVKSKLIQYKIWQNNIKLSNTLEKITKLEDEY 411
            +I++R                       I++SKL+QY +W+N  KL++T EKI K +++ 
Sbjct: 335  EIVEREKSSLEQGKNEALEYLEKEKTLTILRSKLLQYHLWKNEQKLNSTKEKIAKAQEKL 394

Query: 412  NQEKNKNTELKNKIDELRKLYTKNQDELQALLKDEKELVNAKRSLDSDNVSNTEQLKNIE 471
            + EK K T+   ++  ++      +  L  L + EK+L   KR+ D D VS  E+LKN+ 
Sbjct: 395  SAEKAKRTKHSEEMAAMKADLQSLKLILGDLGESEKKLTLEKRACDRDRVSLEEKLKNLT 454

Query: 472  KKLKKTAKEIEEDLKTISSSNVRLKNFHDNKKLFETQLIELDNNLVTESQLLENIKLDLK 531
            +K  K+++ ++    +IS++  +++   ++++  E  L+EL+  +  E + L+ IK  LK
Sbjct: 455  QKEVKSSRSLQSITSSISTTQAKMEELANDQEQHEKDLLELNGTMKEEKEKLDEIKSSLK 514

Query: 532  DKTVGLSEEILKTEKDLEPWNIKLDELKSEIQIKESEKALFEESKNKLKANIEALEKDVN 591
            DK   +SE+I + EK+LEPWN+KL E K++++++E+  ++F+ES  K++ +I  + K ++
Sbjct: 515  DKISLISEQIREIEKELEPWNVKLQEKKAQVKLEETTISVFKESHAKIEQDIILVNKGID 574

Query: 592  EKSKLTEDRRKEVKNLMTKLENVSKEVIFGTNELKKANEKLCEMQKILIQDRQKANDART 651
            E      ++R  V +L  +  ++ +++  G +E   A +K+ EM+ IL   RQ++ DAR+
Sbjct: 575  ELRNKMNEQRGSVFSLEKEQVDIGRQLTVGQSECDNAVKKIKEMKGILTAHRQRSIDARS 634

Query: 652  SLSNVENRSKVLRALLKLQKSGRINGFHGRLGNLGVIDEKYDVAISTACPRLNDIVVDSV 711
            SLS  EN++KVL ALL+LQ+SGRI+GFHGRLG+LG ID+KYDVAISTACPRL+DIVV++V
Sbjct: 635  SLSTFENKNKVLAALLRLQRSGRISGFHGRLGDLGTIDDKYDVAISTACPRLDDIVVETV 694

Query: 712  ECGQQCIEYLRKNNLGHARFILLDKLNKFSMEKISTPRNVPRLFDLIKVNDEKFLPAFYS 771
            ECGQQCIEYLRKN LG+ARFILLDKL  F++  I TP NVPRL+DL++ N+ KF  AFYS
Sbjct: 695  ECGQQCIEYLRKNKLGYARFILLDKLRNFNLSPIKTPENVPRLYDLVRPNNPKFRNAFYS 754

Query: 772  VLRNTLVANDLKEANAVAYGKTRYRVVTLKGNLIDISGTMSGGGNQASKGAMQLXXXXXX 831
            VLR+TLVA DLKEAN VAYGK RYRVVTL G LID+SGTMSGGGN  ++G M+       
Sbjct: 755  VLRDTLVAKDLKEANKVAYGKQRYRVVTLDGKLIDLSGTMSGGGNFKARGMMK---SEQQ 811

Query: 832  XXXXXXXXXVMEIEKELSIREKNYQNAYNTVQEMEIELRNLKESEPKIELEISKLNFEID 891
                     V +I+KELS RE N+Q A +T+ EME  L+ LK+ EP+IEL+ISK   +ID
Sbjct: 812  SNSAFTAEEVQQIDKELSEREHNFQIAADTLHEMEEALQKLKDREPEIELDISKRKLDID 871

Query: 892  SLENECSLKRKQLNEPNASFSIEDNMSADITEMDNALYTLNEKQKLIESQMKSKKDRIKE 951
            SL +E      +L       + +++ + +++  +  L +L  + + +E++M+SKK  +K 
Sbjct: 872  SLSSEMKASEGRLEYLLQEKAQKESSNEELSTAEVKLKSLKSEYRELENEMQSKKKEMKV 931

Query: 952  LQDKIMKIGGIKLQMQNSKVDXXXXXXXXXXXXXXXXXAGIMKIESDVRXXXXXXXXXXX 1011
            LQ++IMK+GG KLQMQ+S VD                   + K ++D++           
Sbjct: 932  LQEQIMKVGGTKLQMQSSMVDSVNQRITIVLAKSKKTKTDLKKAQNDIKRYQKQAEQLAE 991

Query: 1012 DNTKLNEKKXXXXXXXXXXXXXXXQNENNMNCIQDKKFTLRE---KSEITMNELTEMEGL 1068
            +    +++K               +   ++N ++D+     E   K+E +++E T +EG 
Sbjct: 992  ELKSCSQEKSLIENNLDSSSKKVDELSESINKLKDELELTEERVRKAEESIDEKT-VEG- 1049

Query: 1069 LSEFKTLEVEYKIKSEKLASLLNQIKKILKALEEDHS--SLSIREVAYDLDLLNIKEQEA 1126
              +F+ LE++   + +KL  L   + K  +A E  HS  SL IR+V   L  L+  E   
Sbjct: 1050 -RDFEALEIQCVAQLDKLKELFAILNK--EAAEFLHSLNSLKIRDVTATLQALD--ESLE 1104

Query: 1127 QKIKTELYA------------------DFEQNQSXXXXXXXXXXXXXXXXX-------AK 1161
             + K E+ A                  D ++NQ                           
Sbjct: 1105 NESKNEVAAETPGEEDGEHSSSLHDPMDVDENQGESTSTTEAQLQAGEAERRNTEESLPN 1164

Query: 1162 GIPSYMESDFKQFDISSLEAELVQLQDYFEIAKVDLDILEEYTRRMIEYRQRKYDLNQSV 1221
            G+P  +E + + F++ ++E E+ QLQDY E A  D++ILEEY RR+IEY+ RK DLN +V
Sbjct: 1165 GLPKLLEDELENFEVETVELEIHQLQDYVENAYADIEILEEYARRLIEYKARKVDLNHAV 1224

Query: 1222 EQRDKVRKELEDLKKCRFNEFMESFNIISMTLKEMYQIITMGGNAELELVDSLDPFSEGV 1281
            ++RDKVR+  E+LKK R +EFME FN I M LKEMYQ+ITMGGNAELELVDSLDPFSEGV
Sbjct: 1225 QERDKVRQSNENLKKKRLDEFMEGFNAICMILKEMYQMITMGGNAELELVDSLDPFSEGV 1284

Query: 1282 TFSVMPPKKSWRNISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVA 1341
             FSVMPPKKSWRNI+NLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVA
Sbjct: 1285 LFSVMPPKKSWRNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVA 1344

Query: 1342 NYIKERTKNAQFIVISLRNNMFELAEQLVGIYKNVNQTKSATLKNNDILCR 1392
            NYIKERTKNAQFIVISLRNNMFELA+QLVG+YKN N TKS  L+N D++ R
Sbjct: 1345 NYIKERTKNAQFIVISLRNNMFELAKQLVGVYKNKNMTKSVALQNTDLIDR 1395

>KLTH0G13750g Chr7 complement(1184169..1188368) [4200 bp, 1399 aa]
            {ON} similar to uniprot|Q12267 Saccharomyces cerevisiae
            YLR086W SMC4 Subunit of the condensin complex which
            reorganizes chromosomes during cell division forms a
            stable complex with Smc2p that has ATP-hydrolyzing and
            DNA- binding activity and promotes knotting of circular
            DNA potential Cdc28p substrate
          Length = 1399

 Score = 1182 bits (3058), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 654/1326 (49%), Positives = 865/1326 (65%), Gaps = 68/1326 (5%)

Query: 113  KLELIQLSPIKNSRSELQKIYSSKQ-EEKIERICLNKLVLHNFKSYAGTQTIGPFHSSFS 171
            KLELIQLSP K +R E QK    +   + IER+C+N+L LHNFKSYAGTQ +GPFHSSFS
Sbjct: 95   KLELIQLSPTKKTRLESQKTEQVRGLAQPIERLCINRLSLHNFKSYAGTQVVGPFHSSFS 154

Query: 172  AVVGPNGSGKSNVIDSMLFVFGFRANKMRQGKLADLIHKSEEYPDLTSCAVDVHFEYLID 231
            AVVGPNGSGKSNVIDS+LFVFGFRANKMRQGKL+DLIHKSE +P+L SC V+V F+Y+ D
Sbjct: 155  AVVGPNGSGKSNVIDSLLFVFGFRANKMRQGKLSDLIHKSEAHPNLDSCHVEVFFQYVQD 214

Query: 232  YPDDTTKINPSKQPLIITRRAFKNSTSKYYLNGKESNYKTITALLKEEGIDLDHNRFLIL 291
              D  T +   +  L++TR+AFKN+TSKYY+NGKES+Y  +T LL++EGIDLDH RFLIL
Sbjct: 215  ELDGRTTVRQDRPGLVVTRKAFKNNTSKYYVNGKESSYTQVTELLRKEGIDLDHKRFLIL 274

Query: 292  QGEVENIAQMKPKAEKEGDDGLLEYLEDIIGTTKYKELIDKKFIEIEALNDICIERENRF 351
            QGEVE+IAQMKPKAEKEGDDGLLEYLEDIIGT KYK LI++  ++I+ LND+C E+ENR+
Sbjct: 275  QGEVESIAQMKPKAEKEGDDGLLEYLEDIIGTAKYKPLIEQTLVQIDQLNDVCQEKENRY 334

Query: 352  DIIDRXXXXXXXXXXXXXXXXXXXXXQVIVKSKLIQYKIWQNNIKLSNTLEKITKLEDEY 411
            +I++R                        ++SKL+Q+K+W+N+ K +NT EKI  LE++ 
Sbjct: 335  EIVEREKSSLESGKDEALEFLEKEKKLTFLRSKLLQHKLWKNSFKSTNTQEKIKTLEEKL 394

Query: 412  NQEKNKNTELKNKIDELRKLYTKNQDELQALLKDEKELVNAKRSLDSDNVSNTEQLKNIE 471
            + E+ K TE K +I +L          ++ +   E  L + KR+ D D VS  E+LKNI 
Sbjct: 395  SAERAKYTEHKREIKQLESESKSLNVTIRGIKDSESSLTSEKRTCDRDRVSLEEKLKNIS 454

Query: 472  KKLKKTAKEIEEDLKTISSSNVRLKNFHDNKKLFETQLIELDNNLVTESQLLENIKLDLK 531
            +K  K  K     + +I+++  +L+    ++  +E +L EL+ +L+ E   L+ IK+ LK
Sbjct: 455  QKKVKAEKTHHATVNSINATQAKLEELFKDQVQYEKELDELNKSLLVEKTKLDEIKISLK 514

Query: 532  DKTVGLSEEILKTEKDLEPWNIKLDELKSEIQIKESEKALFEESKNKLKANIEALEKDVN 591
             KT  +S +I + E++LEPWN+KL E +S+I+++E++ ++ +ES  K+   I   E D++
Sbjct: 515  GKTGAISVQIGEIEQELEPWNVKLQEKRSQIKLEETKISVLKESLAKIAEEISKSENDIS 574

Query: 592  EKSKLTEDRRKEVKNLMTKLENVSKEVIFGTNELKKANEKLCEMQKILIQDRQKANDART 651
               K   ++ + ++ L  +  ++ +++I G  E   A+ K+ EM+ +L   RQ++ DA++
Sbjct: 575  NNRKKVAEQHQAIEGLEKEHTDIQRQIIIGQTECDNASNKMKEMKAVLTTHRQRSLDAKS 634

Query: 652  SLSNVENRSKVLRALLKLQKSGRINGFHGRLGNLGVIDEKYDVAISTACPRLNDIVVDSV 711
            SLS  EN++KVL AL +LQ+SGRI+GFHGRLG+LG ID+KYDVAISTACPRL+D+VV++V
Sbjct: 635  SLSTFENKNKVLSALQRLQRSGRISGFHGRLGDLGTIDDKYDVAISTACPRLDDVVVETV 694

Query: 712  ECGQQCIEYLRKNNLGHARFILLDKLNKFSMEKISTPRNVPRLFDLIKVNDEKFLPAFYS 771
            ECGQQCIE+LRKN LG+ARFILLDKL  F+M  I TP NV RLFDL+   D KF  AFYS
Sbjct: 695  ECGQQCIEHLRKNKLGYARFILLDKLRSFNMNTIQTPNNVSRLFDLVHPIDNKFRNAFYS 754

Query: 772  VLRNTLVANDLKEANAVAYGKTRYRVVTLKGNLIDISGTMSGGGNQASKGAMQLXXXXXX 831
            VLR+TLVA DLKEAN VAYGK R+RVVTL G LID+SGTMSGGGN  + G M+       
Sbjct: 755  VLRDTLVAKDLKEANRVAYGKQRFRVVTLDGKLIDLSGTMSGGGNHRASGMMK--SERLN 812

Query: 832  XXXXXXXXXVMEIEKELSIREKNYQNAYNTVQEMEIELRNLKESEPKIELEISKLNFEID 891
                     V +I++EL+ RE+N++ A +T+ EME  L++LK+ EP+IE +ISK   EID
Sbjct: 813  TGASFTAEEVRQIDEELTERERNFKIATDTLHEMEDALQSLKDREPEIETDISKRRMEID 872

Query: 892  SLENE--------CSLKRKQ-LNEPNASFSIEDNMSADITEMDNALYTLNEKQKLIESQM 942
            SL +E         SLK++Q LNE +    IE N   D         +L  + KL+E +M
Sbjct: 873  SLLSEIKLCEDRAASLKKEQKLNESSDDTLIEANSRLD---------SLKAECKLLEGEM 923

Query: 943  KSKKDRIKELQDKIMKIGGIKLQMQNSKVDXXXXXXXXXXXXXXXXXAGIMKIESDVRXX 1002
            KSKK++IKELQ++IMKIGG KLQ+Q S VD                   + K E+D++  
Sbjct: 924  KSKKNKIKELQEQIMKIGGTKLQLQGSLVDSIGQRISITLGKQKRDKTAVKKAENDLKRY 983

Query: 1003 XXXXXXXXXDNTKLNEKKXXXXXXXXXXXXXXXQNENNMNCIQDKKFTLREKSEITMNEL 1062
                     D  +   +                + E +++ +Q +   + EK       +
Sbjct: 984  EKQAGQLSVDIDQCTNELESIKELISSSDNKILELEASIDKLQKEGEEIEEK-------V 1036

Query: 1063 TEMEGLLSE-------FKTLEVEYKIKSEKLASLLNQIKK----ILKALEEDHSSLSIRE 1111
             E+E L+ E       F   EV+   + EKL  LLN I K    +LK LE    SL IR+
Sbjct: 1037 REIERLIEEKSSEGQDFAVFEVDINNQLEKLNDLLNHIGKDGHDLLKQLE----SLKIRD 1092

Query: 1112 VAYDLDLLNIKEQEAQKIKTELYADF-------------------------EQNQSXXXX 1146
            V   L  LN       +   EL+                            E   S    
Sbjct: 1093 VTATLQTLNKLLLSESRSGDELHGQSSEARSQEPSNGDLMEVDTVEGCMGNEPTASQPED 1152

Query: 1147 XXXXXXXXXXXXXAKGIPSYMESDFKQFDISSLEAELVQLQDYFEIAKVDLDILEEYTRR 1206
                            +P   E+  K+ ++  +E E+ QL D+ E A  D+++LEEYT+R
Sbjct: 1153 QMDVDEPEEMETSPSDLPKLTEAQLKELNVEEVELEIGQLNDFVENAYADIEVLEEYTKR 1212

Query: 1207 MIEYRQRKYDLNQSVEQRDKVRKELEDLKKCRFNEFMESFNIISMTLKEMYQIITMGGNA 1266
            +++++ RK +LN++VEQRD VR+  ++L+K R +EFM  FN ISMTLKEMYQ+ITMGGNA
Sbjct: 1213 LVDFQARKLELNKAVEQRDSVRQNCDNLRKKRLDEFMNGFNTISMTLKEMYQMITMGGNA 1272

Query: 1267 ELELVDSLDPFSEGVTFSVMPPKKSWRNISNLSGGEKTLSSLALVFALHKYKPTPLYVMD 1326
            ELELVDSLDPFSEGV FSVMPPKKSWRNISNLSGGEKTLSSLALVFALHKYKPTPLYVMD
Sbjct: 1273 ELELVDSLDPFSEGVLFSVMPPKKSWRNISNLSGGEKTLSSLALVFALHKYKPTPLYVMD 1332

Query: 1327 EIDAALDFRNVSIVANYIKERTKNAQFIVISLRNNMFELAEQLVGIYKNVNQTKSATLKN 1386
            EIDAALDFRNVSIVANYIKERTKNAQFIVISLRNNMFELA+QLVGIYKN N TKS  L+N
Sbjct: 1333 EIDAALDFRNVSIVANYIKERTKNAQFIVISLRNNMFELAQQLVGIYKNRNMTKSVALEN 1392

Query: 1387 NDILCR 1392
             D++ R
Sbjct: 1393 KDLINR 1398

>AGR089C Chr7 complement(901437..905549) [4113 bp, 1370 aa] {ON}
            Syntenic homolog of Saccharomyces cerevisiae YLR086W
            (SMC4)
          Length = 1370

 Score = 1177 bits (3046), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 636/1298 (48%), Positives = 859/1298 (66%), Gaps = 28/1298 (2%)

Query: 114  LELIQLSPIKNSRSELQKIYSSKQEEKIERICLNKLVLHNFKSYAGTQTIGPFHSSFSAV 173
            +ELIQLSPIKNSR ELQ++Y +KQ+ K+ER+C+  LVL NFKSYAG Q +GPFHSSFSAV
Sbjct: 77   VELIQLSPIKNSRLELQRLYDTKQK-KVERLCIRTLVLENFKSYAGRQVVGPFHSSFSAV 135

Query: 174  VGPNGSGKSNVIDSMLFVFGFRANKMRQGKLADLIHKSEEYPDLTSCAVDVHFEYLIDYP 233
            VGPNGSGKSNVIDSMLF FGFRANKMRQGKL+ LIHKSE+YPDL  C+V++ F+Y++D P
Sbjct: 136  VGPNGSGKSNVIDSMLFAFGFRANKMRQGKLSHLIHKSEKYPDLDFCSVEIQFQYVVDEP 195

Query: 234  DDTTKINPSKQPLIITRRAFKNSTSKYYLNGKESNYKTITALLKEEGIDLDHNRFLILQG 293
            D TT++   K  L + R+AFKN+TSKYYLNGKES Y  +T LL++EGIDLDH RFLILQG
Sbjct: 196  DGTTRVLSGKPELSVMRKAFKNNTSKYYLNGKESTYTEVTRLLRDEGIDLDHKRFLILQG 255

Query: 294  EVENIAQMKPKAEKEGDDGLLEYLEDIIGTTKYKELIDKKFIEIEALNDICIERENRFDI 353
            EVE+IAQMKPKAE EGDDGLLEYLEDIIGTTKYK  I++  +E+++LNDIC+E+ENRFD+
Sbjct: 256  EVESIAQMKPKAEHEGDDGLLEYLEDIIGTTKYKAQIEQALVEVDSLNDICMEKENRFDL 315

Query: 354  IDRXXXXXXXXXXXXXXXXXXXXXQVIVKSKLIQYKIWQNNIKLSNTLEKITKLEDEYNQ 413
            +++                       ++ SK  QY ++ N  KL+ TL  ++   ++  Q
Sbjct: 316  VEKEKLSLEPGKDEALAFLKKEKDLTLLMSKKYQYHLFHNGSKLAKTLSNVSNTMNKLEQ 375

Query: 414  EKNKNTELKNKIDELRKLYTKNQDELQALLKDEKELVNAKRSLDSDNVSNTEQLKNIEKK 473
            EK K  E + +I EL     +  + L ++    KE +   R L+ + VSN E+ K++ +K
Sbjct: 376  EKAKKVEAQKEIVELTDASEQLANRLVSMNNTNKESLAKMRQLERELVSNEEKQKSLLQK 435

Query: 474  LKKTAKEIEEDLKTISSSNVRLKNFHDNKKLFETQLIELDNNLVTESQLLENIKLDLKDK 533
              K  K +    K+I     +++ +    + +ET L  L++ +V     LE +KL L DK
Sbjct: 436  RSKAEKTLNTVEKSIKQCENKIEEYISQNQEYETSLTTLNHTIVDAQAELEKMKLALSDK 495

Query: 534  TVGLSEEILKTEKDLEPWNIKLDELKSEIQIKESEKALFEESKNKLKANIEALEKDVNEK 593
            T  +++E+   EK+LEPW  K++E KSEI++ ESE ++ +E+  KL++ I  L +++ + 
Sbjct: 496  TGDITKEVAVLEKELEPWTNKVEEKKSEIKLVESEISIIKEADLKLESEIANLSQEIEQL 555

Query: 594  SKLTEDRRKEVKNLMTKLENVSKEVIFGTNELKKANEKLCEMQKILIQDRQKANDARTSL 653
                  R + ++ L  +  ++   ++ G  E   A  KL EM+K+L+  RQ+ NDAR+++
Sbjct: 556  RGNISHREESIETLNVESSSIRDYILVGERECTSARSKLEEMKKVLVTHRQRVNDARSAV 615

Query: 654  SNVENRSKVLRALLKLQKSGRINGFHGRLGNLGVIDEKYDVAISTACPRLNDIVVDSVEC 713
            S+ EN++KVL AL +LQKSGRI+G+HGRLG+LG ID+KYD+AISTACPRL+DIVVD+VEC
Sbjct: 616  SSAENKNKVLTALSRLQKSGRIDGYHGRLGDLGTIDDKYDIAISTACPRLDDIVVDTVEC 675

Query: 714  GQQCIEYLRKNNLGHARFILLDKLNKFSMEKISTPRNVPRLFDLIKVNDEKFLPAFYSVL 773
            GQQCIE+LRKN LG+ARFILLDKL KF+++   TP NVPRLFDL+K  + KF PAFYSVL
Sbjct: 676  GQQCIEHLRKNKLGYARFILLDKLRKFNLQPAHTPENVPRLFDLVKPKEPKFAPAFYSVL 735

Query: 774  RNTLVANDLKEANAVAYGKTRYRVVTLKGNLIDISGTMSGGGNQASKGAMQLXXXXXXXX 833
            R+TLV  DL +AN VAYGK RYRVVTL G LIDISGTM+GGG++A+ G M+         
Sbjct: 736  RDTLVTTDLSQANRVAYGKKRYRVVTLDGKLIDISGTMTGGGDRAASGLMK----STQQS 791

Query: 834  XXXXXXXVMEIEKELSIREKNYQNAYNTVQEMEIELRNLKESEPKIELEIS--KLNFEID 891
                   V  +E+EL+ REKN++ A+ T QEME  L+N  + +P+IE+E+S  K++ E  
Sbjct: 792  SLYTPEEVQRMEEELNEREKNFKVAFETFQEMESALQNYLDRQPEIEVELSKQKMDIETI 851

Query: 892  SLENECSLKRKQLNEPNASFSIEDNMSADITEMDNALYTLNEKQKLIESQMKSKKDRIKE 951
            S E E  ++RK   E +   SIED  S+++   +  L  LN       S  +SK  RIKE
Sbjct: 852  SAELESKIERKLELERSNKTSIED--SSELRTAEEKLAALNADLNSFMSASESKNQRIKE 909

Query: 952  LQDKIMKIGGIKLQMQNSKVDXXXXXXXXXXXXXXXXXAGIMKIESDVRXXXXXXXXXXX 1011
            L+ KIM+IGG++LQ  NSKVD                     K E +++           
Sbjct: 910  LRAKIMEIGGLELQTLNSKVDSLNQQIKIVAAKQKKDKTAQKKAELELKRARKQQITAKD 969

Query: 1012 DNTKLNEKKXXXXXXXXXXXXXXXQNENNMNCIQDKKFTLREKSEITMNELTEMEGLLSE 1071
            D    + +                + +  ++ +Q++  TL ++  +T +EL +    +  
Sbjct: 970  DIEHCDIEIQKMKSSYDTISTGMQELQKQLSDLQEEIGTLTDEHAVTKHELDQKNEKIDS 1029

Query: 1072 FKTLEVEYKIKSEKLASLLNQIKKILKALEEDHSSLSIR---EVAYDLD----------- 1117
            + ++E+E   + +KL +L N +KK +   +   S L +R   +V  DL+           
Sbjct: 1030 YSSIEIELTEQLQKLQNLANYLKKEMNEYDSKLSHLKLRDLGQVMLDLEENKSLQSFSHS 1089

Query: 1118 -LLNIKEQEAQK--IKTELYADF--EQNQSXXXXXXXXXXXXXXXXXAKGIPSYMESDFK 1172
               + K +  Q   ++T L +    E+  S                   G+P   +S+  
Sbjct: 1090 PTPDTKRENIQSSMLETHLASPSPNERKISIAENNLSMEVDEQASVLENGLPKLPDSELA 1149

Query: 1173 QFDISSLEAELVQLQDYFEIAKVDLDILEEYTRRMIEYRQRKYDLNQSVEQRDKVRKELE 1232
            + D+  LE ++VQLQDY + + VD++IL+EY +R+ EYR+R+ DLN+++ +RD+ R   E
Sbjct: 1150 RVDLEDLERDIVQLQDYIDNSTVDIEILDEYAKRLAEYRRRRIDLNEAIMKRDETRMHCE 1209

Query: 1233 DLKKCRFNEFMESFNIISMTLKEMYQIITMGGNAELELVDSLDPFSEGVTFSVMPPKKSW 1292
             LKK R +EFME F IIS+TLKEMYQ+ITMGGNAELELVDSLDPFSEGV FSVMPPKKSW
Sbjct: 1210 VLKKRRLDEFMEGFGIISITLKEMYQMITMGGNAELELVDSLDPFSEGVLFSVMPPKKSW 1269

Query: 1293 RNISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKNAQ 1352
            RNISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKNAQ
Sbjct: 1270 RNISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKNAQ 1329

Query: 1353 FIVISLRNNMFELAEQLVGIYKNVNQTKSATLKNNDIL 1390
            FIVISLRNNMFELA++LVGIYKN N T+S TL+N DI+
Sbjct: 1330 FIVISLRNNMFELAQRLVGIYKNSNMTRSTTLQNRDII 1367

>KNAG0G02020 Chr7 (449115..453449) [4335 bp, 1444 aa] {ON} Anc_8.259
            YLR086W
          Length = 1444

 Score = 1170 bits (3028), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 656/1412 (46%), Positives = 896/1412 (63%), Gaps = 45/1412 (3%)

Query: 17   SNSPLNNDIPKIAQSRNDSPLQVANDPLKSYTPMKVXXXXXXXXXXXPLP----SQLMXX 72
            + S L++ +PK+  S   SPL    D  K+ TP K+             P    S  +  
Sbjct: 42   TKSSLHDSLPKLQSSV--SPL----DFKKTVTPRKLIIGPSENKYALSQPTTSASSSLQV 95

Query: 73   XXXXXXXXXXXXXXRGRAVKAYXXXXXXXXXXXXXXXXXXKLELIQLSPIKNSRSELQKI 132
                          RGR +K Y                  KLELIQLSPIKNSR ELQK+
Sbjct: 96   PALQQKLVPLSQDSRGRRIKMYSQSPPRSPGRSPNRSPVRKLELIQLSPIKNSRLELQKL 155

Query: 133  YSSKQEE--KIERICLNKLVLHNFKSYAGTQTIGPFHSSFSAVVGPNGSGKSNVIDSMLF 190
            Y +   +  K+ R+ ++KLVLHNFKSYAG QTIGPF +SFSAVVGPNGSGKSNVIDSMLF
Sbjct: 156  YDAHNAKIGKMNRLYIHKLVLHNFKSYAGEQTIGPFDASFSAVVGPNGSGKSNVIDSMLF 215

Query: 191  VFGFRANKMRQGKLADLIHKSEEYPDLTSCAVDVHFEYLID---YPDDTTKINPSKQPLI 247
            VFGFRANKMRQ +L+DLIHKSE + +L  C+V+VHF Y+ D    P D   +  ++  L+
Sbjct: 216  VFGFRANKMRQDRLSDLIHKSERFTNLNFCSVEVHFRYVKDEYTAPTDGDTME-AENTLV 274

Query: 248  ITRRAFKNSTSKYYLNGKESNYKTITALLKEEGIDLDHNRFLILQGEVENIAQMKPKAEK 307
            ITR+AFKN++SKY++NGKESN+  +T LLKE+GIDLDH RFLILQGEVENIAQMK KAEK
Sbjct: 275  ITRKAFKNNSSKYFINGKESNFTEVTKLLKEQGIDLDHKRFLILQGEVENIAQMKAKAEK 334

Query: 308  EGDDGLLEYLEDIIGTTKYKELIDKKFIEIEALNDICIERENRFDIIDRXXXXXXXXXXX 367
            + +DGLLEYLEDIIGT  YK LI++K +EIEA+N++CIE+ENRF I+D            
Sbjct: 335  DNEDGLLEYLEDIIGTKHYKPLIEQKTVEIEAMNELCIEKENRFRIVDDEKNSLEKDKDA 394

Query: 368  XXXXXXXXXXQVIVKSKLIQYKIWQNNIKLSNTLEKITKLEDEYNQEKNKNTELKNKIDE 427
                        ++KSKL QY ++ NN K+  TL +I  L  ++ QEK ++++   +++ 
Sbjct: 395  ALEFLEKEKQLTLLKSKLTQYHLYVNNDKIKTTLGQIDSLRTDFEQEKQRHSQFMKEVET 454

Query: 428  LRKLYTKNQDELQALLKDEKELVNAKRSLDSDNVSNTEQLKNIEKKLKKTAKEIEEDLKT 487
            L+    ++++ L +L  +EK L+  KR +++ +VS  E  KN+++KLKK    +E     
Sbjct: 455  LQNSIDESKNNLTSLTTEEKSLIQRKREINTQSVSLEETTKNLDQKLKKAKATVESSKSL 514

Query: 488  ISSSNVRLKNFHDNKKLFETQLIELDNNLVTESQLLENIKLDLKDKTVGLSEEILKTEKD 547
            IS +   L+     ++ +E ++ +L      E ++L +IKL LKDKTV  S+EI   EK+
Sbjct: 515  ISKNEHELQEQSQLQEEYEAEVNDLSKQREVEEKILLDIKLQLKDKTVTFSDEIASIEKE 574

Query: 548  LEPWNIKLDELKSEIQIKESEKALFEESKNKLKANIEALEKDVNEKSKLTEDRRKEVKNL 607
            LEP N ++ E KS+I++ E E  L  +SK K+ A IE+L++++ +  K  ED  K+V +L
Sbjct: 575  LEPSNTEIQEKKSQIKLVEMEIDLIRDSKRKVGAEIESLKEELLKLQKDLEDNEKDVTDL 634

Query: 608  MTKLENVSKEVIFGTNELKKANEKLCEMQKILIQDRQKANDARTSLSNVENRSKVLRALL 667
                 N+ KE   G  E K A  KL EM+ IL   RQK  +AR+++S  +N++KVL +L+
Sbjct: 635  NKSKRNLVKEKQEGDKECKDAGVKLNEMKAILNSHRQKTMEARSTVSTAQNKNKVLTSLM 694

Query: 668  KLQKSGRINGFHGRLGNLGVIDEKYDVAISTACPRLNDIVVDSVECGQQCIEYLRKNNLG 727
            ++Q+SGRINGFHGRLG+LG+I ++YDVAISTACPRL+D+VV+SVECGQ CIE+LRKN LG
Sbjct: 695  RMQQSGRINGFHGRLGDLGIIADQYDVAISTACPRLDDMVVESVECGQTCIEFLRKNKLG 754

Query: 728  HARFILLDKLNKFSMEKISTPRNVPRLFDLIKVNDEKFLPAFYSVLRNTLVANDLKEANA 787
            +ARF++LDKL +F M  I TP NVPRLFDL+K  +++F PA YSVLR+TLVA DLK+AN 
Sbjct: 755  YARFVVLDKLKRFDMSPIQTPENVPRLFDLVKPKEKRFAPAIYSVLRDTLVAKDLKQANR 814

Query: 788  VAYGKTRYRVVTLKGNLIDISGTMSGGGNQASKGAMQLXXXXXXXXXXXXXXXVMEIEKE 847
            VAYGK R+RVVTL G LIDISGTMSGGG++  KG M L               + ++E E
Sbjct: 815  VAYGKRRFRVVTLDGQLIDISGTMSGGGSRVFKGLMNLTTKVSGTSEIFSLEDMKKLEME 874

Query: 848  LSIREKNYQNAYNTVQEMEIELRNLKESEPKIELEISKLNFEIDSLENECSLKRKQLNEP 907
            L+ REK +  A  T   ME ELR L + EP++ELEISK   +ID+L  +  L R QL E 
Sbjct: 875  LAAREKQFDVASETFHSMEQELRKLCDREPQLELEISKKLIDIDALTQQIQLTRSQLTEK 934

Query: 908  NASFSIEDNMSADITEMDNALYTLNEKQKLIESQMKSKKDRIKELQDKIMKIGGIKLQMQ 967
            +  +      + D+  +   L  LN++ K ++ Q K+  +R+  L+D+IM+IGG +LQ+Q
Sbjct: 935  SNDYEKSIKDTDDLDLLLGNLEALNQELKYLQDQSKTSSERVSFLKDEIMRIGGSELQLQ 994

Query: 968  NSKVDXXXXXXXXXXXXXXXXXAGIMKIESDVRXXXXXXXXXXXDNTKLNEKKXXXXXXX 1027
            NSKV                    + K+ ++++           ++T   E+        
Sbjct: 995  NSKVSSLNQRIDILQAKLKKSKTVVKKLNTELKKARKSLIASTEESTNSTEEIAHAKARA 1054

Query: 1028 XXXXXXXXQNENNMNCIQDKKFTLREKSEITMNELTEMEGLLSEFKTLEVEYKIKSEKLA 1087
                        ++  IQD+K  L ++ E   ++L E    ++EFKT+++E + K E+  
Sbjct: 1055 EVAKNSLLDINKSLESIQDEKINLEQELENFSDKLHESNENVNEFKTIQLELENKIERAN 1114

Query: 1088 SLLNQIKKILKALEEDHSSLSIREVAYDLDLLNIKEQEAQKIKTELYADFEQNQSXXXXX 1147
            S+L+ +KK    L E+ ++  +R+V + LDLL  +E+E  +   +     ++  S     
Sbjct: 1115 SILSYLKKENGQLLEELNNFRLRDVTHTLDLL--REEEGTEANQQPTTGTDETTSNVDNE 1172

Query: 1148 XXXXXXXXXXXX---------------------------AKGIPSYMESDFKQFDISSLE 1180
                                                   ++GIP   + +    D  +L 
Sbjct: 1173 MLGAADAGVENMNTSSLSNSVKVASDEISMDVDDCGDLVSQGIPRLSDKELSTIDTDNLN 1232

Query: 1181 AELVQLQDYFEIAKVDLDILEEYTRRMIEYRQRKYDLNQSVEQRDKVRKELEDLKKCRFN 1240
             E+ QLQ +     ++++ILEEY +R++E+++RK DLN SV +R+++   +E+LKK R+N
Sbjct: 1233 EEINQLQSFINNVSINIEILEEYAKRLVEFKKRKIDLNNSVGERNQLTSIMEELKKKRYN 1292

Query: 1241 EFMESFNIISMTLKEMYQIITMGGNAELELVDSLDPFSEGVTFSVMPPKKSWRNISNLSG 1300
            EFME F+IISMTLKEMYQ+ITMGGNAELELVDSLDPFSEGVTFSVMPPKKSWRNI+NLSG
Sbjct: 1293 EFMEGFSIISMTLKEMYQMITMGGNAELELVDSLDPFSEGVTFSVMPPKKSWRNITNLSG 1352

Query: 1301 GEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKNAQFIVISLRN 1360
            GEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKNAQFIVISLRN
Sbjct: 1353 GEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKNAQFIVISLRN 1412

Query: 1361 NMFELAEQLVGIYKNVNQTKSATLKNNDILCR 1392
            NMFELA+QLVGIYK+ N TK+AT++N + L +
Sbjct: 1413 NMFELAKQLVGIYKHENMTKNATIRNREDLIQ 1444

>Ecym_4311 Chr4 complement(666871..671001) [4131 bp, 1376 aa] {ON}
            similar to Ashbya gossypii AGR089C
          Length = 1376

 Score = 1152 bits (2980), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 626/1302 (48%), Positives = 844/1302 (64%), Gaps = 28/1302 (2%)

Query: 113  KLELIQLSPIKNSRSELQKIYSSKQEEKIERICLNKLVLHNFKSYAGTQTIGPFHSSFSA 172
            ++ELIQLSPIKNSR ELQKIY  KQ    +R+ +  L+L+NFKSYAG Q +GPFHSSFSA
Sbjct: 76   RIELIQLSPIKNSRLELQKIYDGKQT-TTKRLSIKNLILNNFKSYAGVQVVGPFHSSFSA 134

Query: 173  VVGPNGSGKSNVIDSMLFVFGFRANKMRQGKLADLIHKSEEYPDLTSCAVDVHFEYLIDY 232
            VVGPNGSGKSNVIDSMLFVFGFRANKMRQGKL++LIHKSE + +L+ C+V++ F+Y++D 
Sbjct: 135  VVGPNGSGKSNVIDSMLFVFGFRANKMRQGKLSNLIHKSENHENLSFCSVEITFQYVMDD 194

Query: 233  PDDTTKINPSKQPLIITRRAFKNSTSKYYLNGKESNYKTITALLKEEGIDLDHNRFLILQ 292
             D  TK+ P  Q L + R+ FKN+TSKYY+NGKES+Y  +T  L+ EGIDLDH RFLILQ
Sbjct: 195  ADGNTKVLPDVQELSVMRKVFKNNTSKYYINGKESSYTEVTQFLRNEGIDLDHKRFLILQ 254

Query: 293  GEVENIAQMKPKAEKEGDDGLLEYLEDIIGTTKYKELIDKKFIEIEALNDICIERENRFD 352
            GEVE+IAQMKPKA+ EGDDGLLEYLEDIIGT KYK  I    +E++ LNDIC+E+E RF+
Sbjct: 255  GEVESIAQMKPKADHEGDDGLLEYLEDIIGTAKYKSQIRDALVEMDTLNDICMEKEIRFE 314

Query: 353  IIDRXXXXXXXXXXXXXXXXXXXXXQVIVKSKLIQYKIWQNNIKLSNTLEKITKLEDEYN 412
            ++++                       ++KSK +Q+ I +   KL+ TL+KI+   ++  
Sbjct: 315  LVEKEKRSLEAGKEQALEFIAKEKQLTLLKSKQLQWDINKETKKLAVTLDKISAFTEKLE 374

Query: 413  QEKNKNTELKNKIDELRKLYTKNQDELQALLKDEKELVNAKRSLDSDNVSNTEQLKNIEK 472
             E+NK  EL+ +I +LR+L    ++++  +  ++ +LV  K  L  + VS+ E+LK++ +
Sbjct: 375  NERNKYGELQKEITDLRELSDNLEEQITKINAEKSQLVKDKLQLQRELVSSEEKLKSLNQ 434

Query: 473  KLKKTAKEIEEDLKTISSSNVRLKNFHDNKKLFETQLIELDNNLVTESQLLENIKLDLKD 532
            K  K  K ++   K I      ++  ++ +  FE  L+EL+ +L +E   L+ IK+ L+D
Sbjct: 435  KRTKAEKTLQVAEKNIRHCENNIRRLNEAQTEFENSLLELNESLHSERSELDAIKMSLRD 494

Query: 533  KTVGLSEEILKTEKDLEPWNIKLDELKSEIQIKESEKALFEESKNKLKANIEALEKDVNE 592
            KT  +SEE+   EK+LEPW  KL+   S+I++ ESE  + +ESK KL+  I  L KD+  
Sbjct: 495  KTSSISEEVASLEKELEPWTTKLEAKNSQIKLAESEILIIKESKLKLEQEISQLRKDIES 554

Query: 593  KSKLTEDRRKEVKNLMTKLENVSKEVIFGTNELKKANEKLCEMQKILIQDRQKANDARTS 652
                 E+ +K++  L  +   ++  +     E   A +KL +M+++L   RQ+  DAR +
Sbjct: 555  YKDRIENHKKKINKLEKESAAITSFISTAQGECDSAKKKLVDMKQVLTNHRQRMTDARVA 614

Query: 653  LSNVENRSKVLRALLKLQKSGRINGFHGRLGNLGVIDEKYDVAISTACPRLNDIVVDSVE 712
            LSNVEN++KVL AL +LQKSGRI+GFHGRLG+LG ID+KYD+AIS ACPRL+DIVV++VE
Sbjct: 615  LSNVENKNKVLGALCRLQKSGRIHGFHGRLGDLGTIDDKYDIAISVACPRLDDIVVETVE 674

Query: 713  CGQQCIEYLRKNNLGHARFILLDKLNKFSMEKISTPRNVPRLFDLIKVNDEKFLPAFYSV 772
            C QQCIE+LRKN LG+ARFILLDKL KF+M K++TP NVPRLFDL    +E F PA YSV
Sbjct: 675  CAQQCIEHLRKNKLGYARFILLDKLKKFNMAKVTTPENVPRLFDLTTPKNEIFAPALYSV 734

Query: 773  LRNTLVANDLKEANAVAYGKTRYRVVTLKGNLIDISGTMSGGGNQASKGAMQLXXXXXXX 832
            LR+TLVA DL +AN VAYG  R+RVVTL G LIDISGTMSGGG++  KG M+        
Sbjct: 735  LRDTLVAKDLAQANRVAYGTRRFRVVTLDGKLIDISGTMSGGGDRVVKGLMK---SKQRS 791

Query: 833  XXXXXXXXVMEIEKELSIREKNYQNAYNTVQEMEIELRNLKESEPKIELEISKLNFEIDS 892
                    V  +E EL+ RE N++ A +T QEME  L+  K+ +P I++EISK   +ID+
Sbjct: 792  NDMYTSEEVQRMEAELTDRETNFKIATDTFQEMEAALQKYKDRQPNIDVEISKHKIDIDT 851

Query: 893  LENECSLKRKQLNEPNASFSIEDNMSADITEMDNALYTLNEKQKLIESQMKSKKDRIKEL 952
            L +E   K+  L E  ++       +  + +++N L  LN +   ++ + K K ++I EL
Sbjct: 852  LSSELQSKKDTLIELESTAENNQRDNGPLEDIENQLVALNSELVALKDESKVKNEQISEL 911

Query: 953  QDKIMKIGGIKLQMQNSKVDXXXXXXXXXXXXXXXXXAGIMKIESDVRXXXXXXXXXXXD 1012
            + +IMKIGG+KLQ QNSKVD                   + K E ++            D
Sbjct: 912  RAQIMKIGGLKLQSQNSKVDSLTQQLQIIVAKQKKNRTELKKNELEMNRASKQKLGAEND 971

Query: 1013 NTKLNEKKXXXXXXXXXXXXXXXQNENNMNCIQDKKFTLREKSEITMNELTEMEGLLSEF 1072
                  +                + E+ +  I+DKK  L ++ E     L +    + +F
Sbjct: 972  INHCEIELSKTNNSHEALQEGLRETEHLIEVIEDKKEQLNQEHETAKKNLDDKAAYVEKF 1031

Query: 1073 KTLEVEYKIKSEKLASLLNQIKKILKALEEDHSSLSIREV--------AYDLDLLNIKEQ 1124
            K+ E+E     EKL +L + IK  +   +E+ ++L +R+V         ++L L ++ ++
Sbjct: 1032 KSEEIEMCTHLEKLKNLEHHIKAEISRTDEELNTLKLRDVEQLLQKLDEHNLPLESLTDR 1091

Query: 1125 EA----QKIKTELYADFE------------QNQSXXXXXXXXXXXXXXXXXAKGIPSYME 1168
                  Q I      D +            ++ +                   G+P   E
Sbjct: 1092 AVTPSNQCIPEMTVEDHDADMNDGEAKLISEDPNSFNDQESMDVDQDASYIGPGLPKLTE 1151

Query: 1169 SDFKQFDISSLEAELVQLQDYFEIAKVDLDILEEYTRRMIEYRQRKYDLNQSVEQRDKVR 1228
            ++    DI  L  E+ QL++Y + A  D+DILEEY  R+ EY++RK DLN+SVE+R+++R
Sbjct: 1152 AELDNIDIEELALEIAQLKEYMDTAYADIDILEEYALRLAEYKRRKLDLNESVEKREEIR 1211

Query: 1229 KELEDLKKCRFNEFMESFNIISMTLKEMYQIITMGGNAELELVDSLDPFSEGVTFSVMPP 1288
               E LKK R  EFM+ F IISMT+KE+YQ+ITMGGNAELELVDSLDPFSEGV FSVMPP
Sbjct: 1212 NRYEMLKKSRLEEFMDGFGIISMTVKEIYQMITMGGNAELELVDSLDPFSEGVLFSVMPP 1271

Query: 1289 KKSWRNISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERT 1348
            KKSWRNISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERT
Sbjct: 1272 KKSWRNISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERT 1331

Query: 1349 KNAQFIVISLRNNMFELAEQLVGIYKNVNQTKSATLKNNDIL 1390
            KNAQFIVISLRNNMFELA+QL+GIYK+ N TKS TL+N DIL
Sbjct: 1332 KNAQFIVISLRNNMFELAQQLIGIYKSSNMTKSTTLQNIDIL 1373

>TBLA0E04410 Chr5 (1122005..1126273) [4269 bp, 1422 aa] {ON} Anc_8.259
            YLR086W
          Length = 1422

 Score = 1139 bits (2945), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 658/1324 (49%), Positives = 869/1324 (65%), Gaps = 30/1324 (2%)

Query: 88   GRAVKAYXXXXXXXXXXXXXXXXXXKLELIQLSPIKNSRSELQKIYSSKQEEKIE-RICL 146
            GR  K Y                   LELIQLSPIKN+R+ELQK+Y  +Q +K   R+ +
Sbjct: 108  GREHKFYSQSPPRSPHRSPVRSPKKALELIQLSPIKNNRAELQKMYELQQTQKRTIRLVI 167

Query: 147  NKLVLHNFKSYAGTQTIGPFHSSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQGKLAD 206
             +LVL NFKSYAG Q +GPFH++FSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQGKL D
Sbjct: 168  ERLVLTNFKSYAGRQVVGPFHTNFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQGKLKD 227

Query: 207  LIHKSEEYPDLTSCAVDVHFEYLIDYPDD-TTKINPSKQPLIITRRAFKNSTSKYYLNGK 265
            LIHKSE+YP+L+SC+V++HF+Y+ID P+   +KI+ SK+ L++ R+AFKN++SKYY+N K
Sbjct: 228  LIHKSEKYPELSSCSVEIHFQYVIDDPNGGPSKIDESKEKLVVMRKAFKNNSSKYYINDK 287

Query: 266  ESNYKTITALLKEEGIDLDHNRFLILQGEVENIAQMKPKAEKEGDDGLLEYLEDIIGTTK 325
            ES++  +T LLK EGIDLDH RFLILQGEVENIAQMKPK+EKEGDDGLLEYLEDIIGT+ 
Sbjct: 288  ESSFTQVTTLLKNEGIDLDHKRFLILQGEVENIAQMKPKSEKEGDDGLLEYLEDIIGTSH 347

Query: 326  YKELIDKKFIEIEALNDICIERENRFDIIDRXXXXXXXXXXXXXXXXXXXXXQVIVKSKL 385
            YK  I+    ++EALN+ICIE+ENRF+I+++                      V+ KSK 
Sbjct: 348  YKVQIEHNLSKVEALNEICIEKENRFNIVEKEKDSLVDGKNEALKYLANEKNLVLAKSKK 407

Query: 386  IQYKIWQNNIKLSNTLEKITKLEDEYNQEKNK----NTELKNKIDELRKLYTKNQDELQA 441
             Q++++ +N KL++TL KIT  ++ Y++E  K    + ELKN  DE   L  +    L  
Sbjct: 408  YQHQLYIDNKKLTSTLAKITDAQENYDKELEKYSTISKELKNLQDEEITLNKR----LNE 463

Query: 442  LLKDEKELVNAKRSLDSDNVSNTEQLKNIEKKLKKTAKEIEEDLKTISSSNVRLKNFHDN 501
              K E++L++ +R  +S+ +S  E +KNIEKK     K +    K+I+ +N +L+  ++ 
Sbjct: 464  TKKYEEKLLSNQRKNNSELISTQEMIKNIEKKKDNAEKLVNTTEKSITQTNNKLETLNNQ 523

Query: 502  KKLFETQLIELDNNLVTESQLLENIKLDLKDKTVGLSEEILKTEKDLEPWNIKLDELKSE 561
            ++ +  Q+ EL+  L  E   LE IK+ LK KT   S EILK EK+LEP+ I+L E  S+
Sbjct: 524  QEDYTKQIEELNEKLKIEKSKLEEIKISLKGKTEQFSNEILKNEKELEPYQIQLQEKMSQ 583

Query: 562  IQIKESEKALFEESKNKLKANIEALEKDVNEKSKLTEDRRKE-VKNLMTKLENVSKEVIF 620
            IQ+ +SE +L  E+K+ L   I +++K + EK KL+  R  E +     +L    KEV  
Sbjct: 584  IQLLQSEISLLNENKDNLSNEIISIKKLIEEK-KLSVVRMSEKITGWKQQLLEQRKEVES 642

Query: 621  GTNELKKANEKLCEMQKILIQDRQKANDARTSLSNVENRSKVLRALLKLQKSGRINGFHG 680
            G  E  K  +K+ EM+  L   RQKAND+RTSLSNV+N++ VL AL KLQKSGRI+GF+G
Sbjct: 643  GDIEFNKFTKKIQEMRDKLDSHRQKANDSRTSLSNVQNKNSVLTALFKLQKSGRISGFYG 702

Query: 681  RLGNLGVIDEKYDVAISTACPRLNDIVVDSVECGQQCIEYLRKNNLGHARFILLDKLNKF 740
            RLG+LGVIDEKYDVAISTACPRL D+VVDSV+CGQQCI+YLRKN LG+ARFILLDKL KF
Sbjct: 703  RLGDLGVIDEKYDVAISTACPRLEDLVVDSVDCGQQCIDYLRKNRLGYARFILLDKLRKF 762

Query: 741  SMEKISTPRNVPRLFDLIKVNDEKFLPAFYSVLRNTLVANDLKEANAVAYGKTRYRVVTL 800
            ++ +I TP N PRLFDLI+V ++KFLPAFYSVLR+TLVA +L  AN VAYGK R+RVVTL
Sbjct: 763  NLNRIETPDNAPRLFDLIQVREDKFLPAFYSVLRDTLVATNLLHANKVAYGKRRFRVVTL 822

Query: 801  KGNLIDISGTMSGGGNQASKGAMQLXXXXXXXX-XXXXXXXVMEIEKELSIREKNYQNAY 859
             G LIDISGTMSGGGN   +G M+L                V ++E+EL I EKN++ AY
Sbjct: 823  DGKLIDISGTMSGGGNYVLRGLMKLGQDLPENDFEQTSPEEVQKLERELEILEKNFKVAY 882

Query: 860  NTVQEMEIELRNLKESEPKIELEISKLNFEIDSLENECSLKRKQLNEPNASFSIEDNMSA 919
            N+++EM  E+ ++KE  P  EL ISK   EI+  ENE      QL E       E N + 
Sbjct: 883  NSLKEMNQEILHMKEQIPATELNISKTTIEIEYCENEIKQLISQLKEKQEIHDQESNNND 942

Query: 920  DITEMDNALYTLNEKQKLIESQMKSKKDRIKELQDKIMKIGGIKLQMQNSKVDXXXXXXX 979
            +I   D+ L  L ++   +  Q K  K  I++L+ +IM  GGI+L+MQNSKV        
Sbjct: 943  EIKVADDKLQALKKEYYSLNDQTKVTKQEIEKLRQQIMDAGGIELKMQNSKVTSLVNQLK 1002

Query: 980  XXXXXXXXXXAGIMKIESDVRXXXXXXXXXXXDNTKLNEKKXXXXXXXXXXXXXXXQNEN 1039
                      + I K  + ++           ++ +                    + E+
Sbjct: 1003 IVNSKQKNDKSAIKKNNNILKKLQNELNTTKDNSLEFKTNLENSKKKVTLLSEELAKLES 1062

Query: 1040 NMNCIQDKKFTLREKSEITMN------ELTEMEGLLSEFKTLEVEYKIKSEKLASLLNQI 1093
            ++N  Q+       K EI +N      +  E+E     FK+ E+E K K +KL  L + +
Sbjct: 1063 DINDTQNA------KEEILLNIDGNKEKAQELEEDSRNFKSFELEIKNKLDKLKDLSHHL 1116

Query: 1094 KKILKALEEDHSSLSIREVAYDLDLLNIKEQEAQKIKTELYADFEQNQSXXXXXXXXXXX 1153
            +K +  L+ + ++L+IRE++ +L+  + + ++    K     D +   S           
Sbjct: 1117 EKQIGKLDTELNALTIREISQNLESFDERLEKYDISKNGATEDTQHTSSALNSVSNINTD 1176

Query: 1154 XXXXXXA-----KGIPSYMESDFKQFDISSLEAELVQLQDYFEIAKVDLDILEEYTRRMI 1208
                         GI    E +  + DI SL+AE+  L++  E +  +++ILEEY RR+ 
Sbjct: 1177 TMDIDSTDNEINPGIKRLSELEINELDIESLDAEIENLEEQLEHSTANIEILEEYVRRLS 1236

Query: 1209 EYRQRKYDLNQSVEQRDKVRKELEDLKKCRFNEFMESFNIISMTLKEMYQIITMGGNAEL 1268
            EY++RK DL++S+ +++  ++E E LKK R  EF   F+IIS+TLKEMYQ+ITMGGNAEL
Sbjct: 1237 EYKKRKSDLDESISEKETAKEETEVLKKKRLEEFTTGFDIISLTLKEMYQMITMGGNAEL 1296

Query: 1269 ELVDSLDPFSEGVTFSVMPPKKSWRNISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEI 1328
            ELVDSLDPFSEGVTFSVMPPKKSWRNISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEI
Sbjct: 1297 ELVDSLDPFSEGVTFSVMPPKKSWRNISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEI 1356

Query: 1329 DAALDFRNVSIVANYIKERTKNAQFIVISLRNNMFELAEQLVGIYKNVNQTKSATLKNND 1388
            DAALDFRNVSIVANYIKERTK+AQ IVISLRNNMFEL++QLVGIYK+ N T+SATL NND
Sbjct: 1357 DAALDFRNVSIVANYIKERTKDAQLIVISLRNNMFELSKQLVGIYKSENMTQSATLVNND 1416

Query: 1389 ILCR 1392
            +L R
Sbjct: 1417 MLNR 1420

>NDAI0B01970 Chr2 (479208..483455) [4248 bp, 1415 aa] {ON} Anc_8.259
            YLR086W
          Length = 1415

 Score = 1136 bits (2938), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 640/1307 (48%), Positives = 875/1307 (66%), Gaps = 47/1307 (3%)

Query: 113  KLELIQLSPIKNSR-SELQKIYSSKQEEKIERICLNKLVLHNFKSYAGTQTIGPFHSSFS 171
            KLELIQLSP+KN+R  +LQ++Y+S+   K ER+ +NKLVL+NFKSYAG Q IGPF+++FS
Sbjct: 121  KLELIQLSPVKNNRIRKLQELYNSQI--KKERLFINKLVLNNFKSYAGEQVIGPFNTNFS 178

Query: 172  AVVGPNGSGKSNVIDSMLFVFGFRANKMRQGKLADLIHKSEEYPDLTSCAVDVHFEYLID 231
            AVVGPNGSGKSNVIDSMLFVFGFRANKMRQ +L+DLIHKSE +P+L SC+VDV F+Y++D
Sbjct: 179  AVVGPNGSGKSNVIDSMLFVFGFRANKMRQDRLSDLIHKSESFPNLPSCSVDVEFQYVVD 238

Query: 232  YPDDTTKINPSKQPLIITRRAFKNSTSKYYLNGKESNYKTITALLKEEGIDLDHNRFLIL 291
              + ++KI+ +K  LIITR+AFKN++SKY++NGKES+Y  +T LLKEEGIDLDH RFLIL
Sbjct: 239  KSNGSSKIDDNKPKLIITRKAFKNNSSKYFINGKESSYTEVTKLLKEEGIDLDHKRFLIL 298

Query: 292  QGEVENIAQMKPKAEKEGDDGLLEYLEDIIGTTKYKELIDKKFIEIEALNDICIERENRF 351
            QGEVENIAQMKPKAE+EGDDGLLEYLEDIIGT  YK  I+K  IE++ LN+ICIE+ENRF
Sbjct: 299  QGEVENIAQMKPKAEREGDDGLLEYLEDIIGTADYKSSIEKNTIEVDTLNEICIEKENRF 358

Query: 352  DIIDRXXXXXXXXXXXXXXXXXXXXXQVIVKSKLIQYKIWQNNIKLSNTLEKITKLEDEY 411
            +I++R                       + KSKL+QY I + + KL++TL+K++ L++EY
Sbjct: 359  EIVEREKNSLESSKNAALEFVKKERRLTLSKSKLLQYNILKEHEKLASTLQKLSVLQEEY 418

Query: 412  NQEKNKNTELKNKIDELRKLYTKNQDELQALLKDEKELVNAKRSLDSDNVSNTEQLKNIE 471
              E  K    + + ++L   + +   ++ ++ +D K   + KR L +   S  E++K+  
Sbjct: 419  QNESTKFENTQRETNKLEDNFKQMNKKIVSIKEDMKNNTSKKRELQNKKASLEEKIKSYT 478

Query: 472  KKLKKTAKEIEEDLKTISSSNVRLKNFHDNKKLFETQLIELDNNLVTESQLLENIKLDLK 531
            +K +K +K I +  K + +    ++  + +++  E+ L  L + L  E  +LE IKL LK
Sbjct: 479  RKKEKASKSIAQSKKLLKNYRNEIETLNVDQQERESNLQSLLSELKKEKNVLEEIKLSLK 538

Query: 532  DKTVGLSEEILKTEKDLEPWNIKLDELKSEIQIKESEKALFEESKNKLKANIEALEKDVN 591
            DKT  +S EI + E++LEPW  +L E K EIQ+ ES+ +L +E+++KLK  IE L+ D+ 
Sbjct: 539  DKTTDISNEIAQHERELEPWKKQLQEKKLEIQVAESQISLLQENQSKLKDEIEKLKNDLK 598

Query: 592  EKSKLTEDRRKEVKNLMTKLENVSKEVIFGTNELKKANEKLCEMQKILIQDRQKANDART 651
             + +  +++ +++ +L  +   +S E   G +E   A  K+ +MQ +L   RQK  DAR+
Sbjct: 599  CQFENKKNQEEKLIDLKVQFSAISTEFDRGESECANAKSKIKDMQHVLQTQRQKVMDARS 658

Query: 652  SLSNVENRSKVLRALLKLQKSGRINGFHGRLGNLGVIDEKYDVAISTACPRLNDIVVDSV 711
             L+ VEN+SKVL AL KLQKSGRI+GF+GRLG+LGVID +YD+AISTA  RL+DIVVDSV
Sbjct: 659  RLATVENKSKVLSALHKLQKSGRISGFYGRLGDLGVIDNEYDIAISTASARLDDIVVDSV 718

Query: 712  ECGQQCIEYLRKNNLGHARFILLDKLNKFSMEKISTPRNVPRLFDLIKVNDEKFLPAFYS 771
            ECGQ CIEYLRKN LG+ARFILL+KL    +++I TP NV RLFDL+K + + F+PAFYS
Sbjct: 719  ECGQHCIEYLRKNKLGYARFILLEKLRNLILKRIQTPENVKRLFDLVKPDKDIFIPAFYS 778

Query: 772  VLRNTLVANDLKEANAVAYGKTRYRVVTLKGNLIDISGTMSGGGNQASKGAMQLXXXXXX 831
            VLRNTLVA DLK+AN VAYG TR+RVVT+ G LIDISGT++GGG Q ++G M+L      
Sbjct: 779  VLRNTLVAKDLKQANRVAYGATRFRVVTMDGKLIDISGTITGGGKQTAQGLMKLRKKGQE 838

Query: 832  XXXXXXXXXVMEIEKELSIREKNYQNAYNTVQEMEIELRNLKESEPKIELEISKLNFEID 891
                     + +IEKEL  RE N++ A +T  EME  L+ LK+ +P++ELEISK   + D
Sbjct: 839  NIDIYSNDDIEKIEKELVERENNFKFANDTYFEMEQALQRLKDRKPELELEISKCLMDTD 898

Query: 892  SLENECSLKRKQLNEPNASFSIEDNMSADITEMDNALYTLNEKQKLIESQMKSKKDRIKE 951
                E    + QL +    +        ++ E+++ L  L ++ +L+    K+  ++I +
Sbjct: 899  ISSKELESTQDQLKQKITFYERHTQNKDEVVEIEHQLNLLQKEYQLLLDSTKNISEKIDK 958

Query: 952  LQDKIMKIGGIKLQMQNSKVDXXXXXXXXXXXXXXXXXAGIMKIESDVRXXXXXXXXXXX 1011
            L+ +IM+IGGI LQMQNSKV+                 + + KIE+++R           
Sbjct: 959  LKKRIMEIGGIDLQMQNSKVNSIIQNIDIIKSKQKRGISSMKKIENEIRRSEKALSGAEL 1018

Query: 1012 DNTKLNEKKXXXXXXXXXXXXX---------XXQNENN---MNCIQDKKFTLREKSEITM 1059
            D    +++                         +NEN+   + C       L+EK    +
Sbjct: 1019 DFKTCSKEMDSFSQEMESVERSLGSIDETFLKLENENSELEIECC-----NLKEK----I 1069

Query: 1060 NELTEMEGLLSEFKTLEVEYKIKSEKLASLLNQIKKILKALEEDHSSLSIREVAY----- 1114
            NE  E+EG  ++FK+ E++ K + EKL +LL  IK+++K  +E   +L +R         
Sbjct: 1070 NE-AEIEG--TKFKSYEIDVKDRLEKLNNLLKHIKRVIKEYDEQLRALELRNTTTIFGDE 1126

Query: 1115 -DLDLLN----------IKEQEAQKIKTELYADFEQNQSXXXXXXXXXXXXXXXXXAKGI 1163
             D + +N          +  Q+  K+  E     E+N +                 + GI
Sbjct: 1127 GDNNSINGVDRTSHGGGVPLQDQNKVVRENNMRNEKNST----EAEMEIDDVADEFSPGI 1182

Query: 1164 PSYMESDFKQFDISSLEAELVQLQDYFEIAKVDLDILEEYTRRMIEYRQRKYDLNQSVEQ 1223
            P   ++   Q D+ +LEAE+ QL++Y  I  V++D+LEEY RR+ +Y  RK DLNQ+VE+
Sbjct: 1183 PRISKAKLLQIDVQALEAEIGQLEEYVAITNVNIDVLEEYARRLADYNSRKLDLNQAVER 1242

Query: 1224 RDKVRKELEDLKKCRFNEFMESFNIISMTLKEMYQIITMGGNAELELVDSLDPFSEGVTF 1283
            R+ ++K L++LKK R++EFM+ F IISMTLKEMYQ+ITMGGNAELEL+DSLDPFSEGVTF
Sbjct: 1243 REALKKLLDELKKKRYDEFMQGFGIISMTLKEMYQMITMGGNAELELIDSLDPFSEGVTF 1302

Query: 1284 SVMPPKKSWRNISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANY 1343
            SVMPPKKSWRNI+NLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANY
Sbjct: 1303 SVMPPKKSWRNIANLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANY 1362

Query: 1344 IKERTKNAQFIVISLRNNMFELAEQLVGIYKNVNQTKSATLKNNDIL 1390
            IKERTKNAQFIVISLRNNMFELA+QL+GIYK  N+TKSA ++N D L
Sbjct: 1363 IKERTKNAQFIVISLRNNMFELAQQLIGIYKRDNKTKSAAIRNKDFL 1409

>KLLA0F19085g Chr6 (1758111..1762229) [4119 bp, 1372 aa] {ON} similar
            to uniprot|Q12267 Saccharomyces cerevisiae YLR086W SMC4
            subunit of the condensin complex which reorganizes
            chromosomes during cell division
          Length = 1372

 Score = 1058 bits (2735), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 623/1289 (48%), Positives = 839/1289 (65%), Gaps = 23/1289 (1%)

Query: 113  KLELIQLSPIKNSRSELQKIYSSKQEEKIERICLNKLVLHNFKSYAGTQTIGPFHSSFSA 172
            KLELI+LSP K++R ELQK++ +  +   +R+C++KLVL+NFKSYAG Q IGPFH+SFSA
Sbjct: 93   KLELIRLSPKKSTRLELQKMHEANTQTS-QRLCIDKLVLNNFKSYAGIQEIGPFHTSFSA 151

Query: 173  VVGPNGSGKSNVIDSMLFVFGFRANKMRQGKLADLIHKSEEYPDLTSCAVDVHFEYLIDY 232
            VVGPNGSGKSNVIDSMLFVFGFRANKMRQGKL++LIHKSE++P L SC+V +HF Y+ D 
Sbjct: 152  VVGPNGSGKSNVIDSMLFVFGFRANKMRQGKLSELIHKSEQFPSLASCSVQIHFHYVHDT 211

Query: 233  PDDTTKINPSKQPLIITRRAFKNSTSKYYLNGKESNYKTITALLKEEGIDLDHNRFLILQ 292
             +  TKI PS   +++ RRAFKN++SKYY+NGKESNY  +T LLKEEGIDLDH RFLILQ
Sbjct: 212  DNGETKILPSAGTMVVERRAFKNNSSKYYVNGKESNYTEVTRLLKEEGIDLDHKRFLILQ 271

Query: 293  GEVENIAQMKPKAEKEGDDGLLEYLEDIIGTTKYKELIDKKFIEIEALNDICIERENRFD 352
            GEVE+IAQMK KAEK+ DDGLLEYLEDIIGT K+K  I+K   EIE LN++C+E+ENRF+
Sbjct: 272  GEVESIAQMKAKAEKDNDDGLLEYLEDIIGTAKFKPQIEKCLEEIETLNEVCMEKENRFE 331

Query: 353  IIDRXXXXXXXXXXXXXXXXXXXXXQVIVKSKLIQYKIWQNNIKLSNTLEKITKLEDEYN 412
            ++D+                       I+K++L+Q +I+ +N KL+ + +KI+ L  E+ 
Sbjct: 332  LVDKEKQNLESGKEEALEFLDKERKHTILKAQLLQRQIYDSNRKLATSCDKISALNMEFQ 391

Query: 413  QEKNKNTELKNKIDELRKLYTKNQDELQALLKDEKELVNAKRSLDSDNVSNTEQLKNIEK 472
            +EK++   L+ + + L       + E  AL  + K + + KRSL+ D ++  E+LK+I +
Sbjct: 392  EEKSQYEHLQKEAETLTHEINNTKKESTALETESKNVNSKKRSLEKDFIATDEKLKSIAR 451

Query: 473  KLKKTAKEI---EEDLKTISSSNVRLKNFHDNKKLFETQLIELDNNLVTESQLLENIKLD 529
            KLK   K     E + K   +    LK  HD+    E +L  L++++  E + L  IK+ 
Sbjct: 452  KLKAAEKAFSQSESNGKAAVNEIESLKKNHDD---CEIELHNLNHSISIEKEKLNEIKIH 508

Query: 530  LKDKTVGLSEEILKTEKDLEPWNIKLDELKSEIQIKESEKALFEESKNKL---KANIEAL 586
            L +KT  LS+E+   E+ LEP+  ++ E +SEI++ E++  + + S + L   KA IE+ 
Sbjct: 509  LHEKTKDLSQEMESLERQLEPFRDQIQEKQSEIKLSETKITMLKSSHSNLLKEKATIESK 568

Query: 587  EKDVNEKSKLTEDRRKEVK-NLMTKLENVSKEVIFGTNELKKANEKLCEMQKILIQDRQK 645
             +D+    +L E ++KE + +L  +   V   +     E ++A ++  EM+ +LIQ RQ 
Sbjct: 569  IEDL----QLEELKQKETETSLRNEKSKVEARISTAQKECEEAQKQTNEMRDVLIQQRQI 624

Query: 646  ANDARTSLSNVENRSKVLRALLKLQKSGRINGFHGRLGNLGVIDEKYDVAISTACPRLND 705
              +A+ +L+  +N+++VL AL KLQ SGRI GFHGRLG+LG ID++YD+AISTACPRL+D
Sbjct: 625  VEEAKANLNGFQNKNRVLLALTKLQNSGRITGFHGRLGDLGTIDDQYDIAISTACPRLDD 684

Query: 706  IVVDSVECGQQCIEYLRKNNLGHARFILLDKLNKFSMEKISTPRNVPRLFDLIKVNDEKF 765
            IVV++VECGQQCI++LRKN LG+ RFILLDKL K ++++I+TP NVPRLFDLI    + F
Sbjct: 685  IVVETVECGQQCIDHLRKNKLGYGRFILLDKLRKCNLDRIATPENVPRLFDLITPVRDLF 744

Query: 766  LPAFYSVLRNTLVANDLKEANAVAYGKTRYRVVTLKGNLIDISGTMSGGGNQASKGAMQL 825
             PAFYSVLR+TLVA DL++AN VAYGK R+RVVTL G LIDISGTMSGGG+    G M+ 
Sbjct: 745  RPAFYSVLRDTLVARDLQQANRVAYGKRRFRVVTLDGKLIDISGTMSGGGSSPQSGLMR- 803

Query: 826  XXXXXXXXXXXXXXXVMEIEKELSIREKNYQNAYNTVQEMEIELRNLKESEPKIELEISK 885
                           V ++E +LS +E NY++A + V EME  L+ L +  P+I+++ISK
Sbjct: 804  --SKATTASQYSRDEVEKMEVQLSTKETNYRSALSMVHEMESALQKLTDRLPEIDIQISK 861

Query: 886  LNFEIDSLENECSLKRKQLNEPNASFSIEDNMSADITEMDNALYTLNEK-QKLIESQMKS 944
            +  E  S   E     ++L++     S+ +     + + +  L  L +  Q+ I++  K 
Sbjct: 862  IQLEKGSRVAEVESYHQRLSQLARELSMNEKNQQPLLDEEKKLDILRQHLQQTIDAS-KF 920

Query: 945  KKDRIKELQDKIMKIGGIKLQMQNSKVDXXXXXXXXXXXXXXXXXAGIMKIESDVRXXXX 1004
             +D+I +L+D+IM+ GGI+L+MQ +KV                      K++ D+     
Sbjct: 921  SQDKIDDLKDRIMQKGGIELKMQIAKVASLEQHIEILHEKQKKEKTRSKKLDIDLARATR 980

Query: 1005 XXXXXXXDNTKLNEKKXXXXXXXXXXXXXXXQNENNMNCIQDKKFTLREKSEITMNELTE 1064
                   +    N+                 + E  +    ++K  L    E    EL  
Sbjct: 981  EKNKYSEEVLVCNKDISILSEQLESIRLEKERIEEQVIENNERKAELNSSVEKLKQELLS 1040

Query: 1065 MEGLLSEFKTLEVEYKIKSEKLASLLNQIKKILKALEEDHSSLSIREVAYDLDLLN--IK 1122
            +E   +EFK  E+EY  + EKL  L   +KK L++ E    SL IR+V+  L  LN  I 
Sbjct: 1041 IERDSNEFKAKELEYSDRLEKLHGLQEYVKKQLRSYETSLQSLKIRDVSKLLSQLNDGII 1100

Query: 1123 EQEAQKIKTELYADFEQNQSXXXXXXXXXXXXXXXXXAK-GIPSYMESDFKQFDISSLEA 1181
            E         +  D  Q QS                    G+PS  E++ +  D+ +LE 
Sbjct: 1101 ESCTDVTAKVMNGDIVQTQSITDVGNNDAMEDSGEAATHSGLPSLTETELENLDLETLEL 1160

Query: 1182 ELVQLQDYFEIAKVDLDILEEYTRRMIEYRQRKYDLNQSVEQRDKVRKELEDLKKCRFNE 1241
            EL QLQDY +    D+++LEEY RR+ EY++RK DLNQ+V +R++VR + E  K  R  +
Sbjct: 1161 ELHQLQDYLDNFNGDIEVLEEYARRLAEYQRRKLDLNQAVAKREEVRNKCESFKNERLEK 1220

Query: 1242 FMESFNIISMTLKEMYQIITMGGNAELELVDSLDPFSEGVTFSVMPPKKSWRNISNLSGG 1301
            FME F IISMTLKEMYQ+ITMGGNAELELVDSLDPFSEGV FSVMPPKKSWRNISNLSGG
Sbjct: 1221 FMEGFGIISMTLKEMYQMITMGGNAELELVDSLDPFSEGVLFSVMPPKKSWRNISNLSGG 1280

Query: 1302 EKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKNAQFIVISLRNN 1361
            EKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKNAQFIVISLRNN
Sbjct: 1281 EKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKNAQFIVISLRNN 1340

Query: 1362 MFELAEQLVGIYKNVNQTKSATLKNNDIL 1390
            MFELA+ LVGIYKN N TKS TL+N DIL
Sbjct: 1341 MFELAQNLVGIYKNNNMTKSTTLQNIDIL 1369

>CAGL0L12188g Chr12 (1310968..1315164) [4197 bp, 1398 aa] {ON}
           similar to uniprot|Q12267 Saccharomyces cerevisiae
           YLR086w Stable Maintenance of Chromosomes
          Length = 1398

 Score =  748 bits (1930), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 408/816 (50%), Positives = 552/816 (67%), Gaps = 13/816 (1%)

Query: 87  RGRAVKAYXXXXXXXXXXXXXXXXXXKLELIQLSPIKNSRSELQKIYSSKQ-EEKIERIC 145
           RGR  K+Y                  +L+LI+LSPIKNSR+ELQK+Y SK+ + K ER+ 
Sbjct: 74  RGRDFKSYSQSPPRSPGRSPTR----RLKLIELSPIKNSRAELQKLYESKKLDVKKERLF 129

Query: 146 LNKLVLHNFKSYAGTQTIGPFHSSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQGKLA 205
           +++LVL++FKSYAG Q IGPFH+SFSA+VGPNGSGKSNVIDSMLFVFGFRANKMRQ +L+
Sbjct: 130 IHQLVLNDFKSYAGRQVIGPFHTSFSAIVGPNGSGKSNVIDSMLFVFGFRANKMRQDRLS 189

Query: 206 DLIHKSEEYPDLTSCAVDVHFEYLIDYPDDTTKINPSKQPLIITRRAFKNSTSKYYLNGK 265
           DLIHKSE +PDL SC+V+VHF+Y+ID  D +T I+ +K  L++TR+AFKN+ SKY++NGK
Sbjct: 190 DLIHKSETFPDLKSCSVEVHFKYVIDKDDGSTTIDETKGNLVVTRKAFKNNASKYFVNGK 249

Query: 266 ESNYKTITALLKEEGIDLDHNRFLILQGEVENIAQMKPKAEKEGDDGLLEYLEDIIGTTK 325
           ESNY  +T LLK+EGIDLDH RFLILQGEVENIAQMK KAEKE DDGLLEYLEDIIGT+K
Sbjct: 250 ESNYTEVTTLLKKEGIDLDHKRFLILQGEVENIAQMKAKAEKENDDGLLEYLEDIIGTSK 309

Query: 326 YKELIDKKFIEIEALNDICIERENRFDIIDRXXXXXXXXXXXXXXXXXXXXXQVIVKSKL 385
           YKE I+K  +EIE+LN+IC+E+ENRF I++R                      V+ KSKL
Sbjct: 310 YKESIEKLSMEIESLNEICVEKENRFSIVEREKNSLESGKEEALQFLNKEKELVLEKSKL 369

Query: 386 IQYKIWQNNIKLSNTLEKITKLEDEYNQEKNKNTELKNKIDELRKLYTKNQDELQALLKD 445
            QY + Q+N KL + L K T ++ E  +++++  +  + I ++       + +L+ +  +
Sbjct: 370 YQYNLMQDNKKLDDVLNKKTNVQQEQTKQEDEFRKANSHISDITASLNVLKADLEKVHTE 429

Query: 446 EKELVNAKRSLDSDNVSNTEQLKNIEKKLKKTAKEIEEDLKT----ISSSNVRLKNFHDN 501
           E  L   KR+L++  V N + + N++ K     KE EE  K     I+S++  ++   + 
Sbjct: 430 EVNLSKTKRTLENKKVENEQIVNNLDSK----RKEFEEQSKILQDKINSTDQEIQTIIEE 485

Query: 502 KKLFETQLIELDNNLVTESQLLENIKLDLKDKTVGLSEEILKTEKDLEPWNIKLDELKSE 561
           +         L  NL  E + LENIKL L++KT  L+ +I + EK+L PWN +  +LK E
Sbjct: 486 QSSLAEGTTVLSTNLDIEKEKLENIKLKLREKTEHLTIQIAEYEKELSPWNEQSQQLKKE 545

Query: 562 IQIKESEKALFEESKNKLKANIEALEKDVNEKSKLTEDRRKEVKNLMTKLENVSKEVIFG 621
           I+I ESE ++ EE++  L+ +I  LE  +  + +  E + +E+K+L+ +   V +E   G
Sbjct: 546 IKITESELSIIEENRKGLENDIAGLENAILSQKRDLEVQEQEIKSLLEQKTKVIQERELG 605

Query: 622 TNELKKANEKLCEMQKILIQDRQKANDARTSLSNVENRSKVLRALLKLQKSGRINGFHGR 681
             E K A   L  +++ +   RQKA + R++ S  EN +KVL ALL+LQKSGR+NGFHGR
Sbjct: 606 ERECKNAQATLANVREKVEALRQKAIEIRSTYSATENNNKVLSALLRLQKSGRLNGFHGR 665

Query: 682 LGNLGVIDEKYDVAISTACPRLNDIVVDSVECGQQCIEYLRKNNLGHARFILLDKLNKFS 741
           LG+L VID KYDVAISTACPRLND+VVD+VE GQQCIEYLRKN LG+ARFILLDKLN F+
Sbjct: 666 LGDLAVIDPKYDVAISTACPRLNDLVVDTVESGQQCIEYLRKNKLGYARFILLDKLNTFN 725

Query: 742 MEKISTPRNVPRLFDLIKVNDEKFLPAFYSVLRNTLVANDLKEANAVAYGKTRYRVVTLK 801
             +I TP    RLFDLI V +++F  AFYSVLR+TLV  ++++AN VAYGK RYRVVTL 
Sbjct: 726 TNRIDTPDQSQRLFDLITVKEKRFNNAFYSVLRDTLVCQNMEQANRVAYGKKRYRVVTLD 785

Query: 802 GNLIDISGTMSGGGNQASKGAMQLXXXXXXXXXXXXXXXVMEIEKELSIREKNYQNAYNT 861
           GNLID+SGTM+GGG   SKG M+L               V  IE EL+ +E  Y++A + 
Sbjct: 786 GNLIDLSGTMTGGGRNVSKGLMKLSKSSSKGSAFFSPEEVQAIENELNQKENQYKSALDA 845

Query: 862 VQEMEIELRNLKESEPKIELEISKLNFEIDSLENEC 897
             EME ELR L++  P+I+  +SK   +I++  N+ 
Sbjct: 846 YHEMEEELRRLRDRAPEIDNLVSKKEMDIETAHNDI 881

 Score =  355 bits (912), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 193/370 (52%), Positives = 246/370 (66%), Gaps = 21/370 (5%)

Query: 1044 IQDKKFTLREKSEITMNELTEMEGLLSEFKTLEVEYKIKSEKLASLLNQIKKILKALEED 1103
            +++ +  L  + E+  NEL   + ++S++K++ +EY  K EKL +    +KK +K   + 
Sbjct: 1028 LKENEVKLEHEIEMKHNELESHQKVVSDYKSISLEYNNKLEKLEASEASLKKSIKRYNDL 1087

Query: 1104 HSSLSIREVAYDLDLLNIKEQEA--------QKIKTELYAD------FEQNQSXXXX--- 1146
             S L+IR+V   L+ +  +E  +        +     + AD        +NQS       
Sbjct: 1088 LSELTIRDVTQVLNTIMTEENASVDKSDPKLENTSAVINADDDGISAVSENQSFNHNDEN 1147

Query: 1147 ----XXXXXXXXXXXXXAKGIPSYMESDFKQFDISSLEAELVQLQDYFEIAKVDLDILEE 1202
                               GIP    S+  + D   +E  +  L D+   ++ ++D+LEE
Sbjct: 1148 DDIDSNKMEIDSQGGFINPGIPVLSASELAKVDPQEVELLITSLDDFITSSEANVDVLEE 1207

Query: 1203 YTRRMIEYRQRKYDLNQSVEQRDKVRKELEDLKKCRFNEFMESFNIISMTLKEMYQIITM 1262
            Y  R +E+ +RK DLN +V+ RD V+  LE +K+ R++EFME F IISMTLKEMYQ+IT+
Sbjct: 1208 YALRFVEFNKRKNDLNSAVQSRDSVKDRLEGIKRKRYDEFMEGFKIISMTLKEMYQMITL 1267

Query: 1263 GGNAELELVDSLDPFSEGVTFSVMPPKKSWRNISNLSGGEKTLSSLALVFALHKYKPTPL 1322
            GGNAELELVDSLDPFSEGVTFSVMPPKKSWRNISNLSGGEKTLSSLALVFALHKYKPTPL
Sbjct: 1268 GGNAELELVDSLDPFSEGVTFSVMPPKKSWRNISNLSGGEKTLSSLALVFALHKYKPTPL 1327

Query: 1323 YVMDEIDAALDFRNVSIVANYIKERTKNAQFIVISLRNNMFELAEQLVGIYKNVNQTKSA 1382
            YVMDEIDAALDFRNVSIVANYIKERTKNAQFIVISLRNNMFEL +QLVGIYK+ N TKSA
Sbjct: 1328 YVMDEIDAALDFRNVSIVANYIKERTKNAQFIVISLRNNMFELTKQLVGIYKHENMTKSA 1387

Query: 1383 TLKNNDILCR 1392
             L N D++ R
Sbjct: 1388 ALVNEDLVGR 1397

>KAFR0C03200 Chr3 (643231..646902) [3672 bp, 1223 aa] {ON} Anc_8.68
           YFL008W
          Length = 1223

 Score =  152 bits (384), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 179/696 (25%), Positives = 327/696 (46%), Gaps = 66/696 (9%)

Query: 149 LVLHNFKSYAGTQTIGPFHSSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQGKLADLI 208
           L L+NFKSY G+  +G   S+F++++GPNGSGKSN++D++ FV G R++ +R   L DLI
Sbjct: 7   LELYNFKSYKGSVKLGFGESNFTSIIGPNGSGKSNMMDAISFVLGVRSSHLRSSILRDLI 66

Query: 209 HKS-----EEYPDLTSCAVDVHFEYLIDYPDDTTKINPSKQPLIITRRAFKNSTSKYYLN 263
           ++      +   D      +    Y+  + +   K       + + R   +N  + Y + 
Sbjct: 67  YRGVITGEDSESDEDGSVNNPSTAYVKAFYEKENK------TIELMRTISRNGDTNYKIG 120

Query: 264 GKESNYKTITALLKEEGIDLDHNRFLILQGEVENIAQMKPKAEKEGDDGLLEYLEDIIGT 323
           GK  +YK  ++ L+ E I +    FL+ QG+VE IA   P         L    E++ G+
Sbjct: 121 GKVVSYKDYSSFLESENILIKAKNFLVFQGDVEQIASQSPM-------DLSRLFEEVSGS 173

Query: 324 TKYKELIDKKFIEIEALNDICIERENRFDIIDRXXXXXXXXXXXXXXXXXXXXXQVIVKS 383
            +YK+  D+   ++E L+    E      I +R                       + K 
Sbjct: 174 IQYKKEYDQLKEKMEQLSKAATE-----SIKNRRRIHGELKTYKEGINKDEEYKSKVAKK 228

Query: 384 KLIQ--YKIWQ---------NNIK-LSNTLEKITKLEDEYNQEKNKNTELKNKIDELRKL 431
           K +Q    +WQ         N +K +++T  K++ L+D+ + E+      K  I +   +
Sbjct: 229 KELQTILVLWQLYHLEQKKINIMKNMADTKSKMSVLKDKIHNEERNLQRAKTSIAKEMSI 288

Query: 432 YTKNQDELQALLKDEKELVNAKRSLDSDNVSNTEQLKNIEKKLKKTAKEIEEDLKTISSS 491
            TK +D++   LK+++++ +  + +    +S  +++ NIEK+++   K+IE     +   
Sbjct: 289 ITKKKDKIDYKLKEKEKIASDLKLIKLPQLSTIKRIGNIEKRIESFEKDIERQSSFVERF 348

Query: 492 NVRLKNFHDNKKLFETQLIELDNNL----VTESQLLENIKLDLKDKTVGLS---EEILKT 544
             +LK     K+ FE +L E   N     + + +      L+ K  T G S   E+I+  
Sbjct: 349 TNQLKVVTKTKEAFERELKETSMNFDKYRLNDEEKENYQSLNEKYLTSGGSSIEEKIMIN 408

Query: 545 EKDLEPWNIKLDELKSEIQIKE---SEKALFEESKNKLKANIEALEKDVNEKSKLTEDRR 601
           E D +    +L+  +  I I +   ++  + E   N+L+A+   L   +NEK+ +  +R 
Sbjct: 409 ENDKQEVGEELNRFEKLIDISKQRINDVLMVELENNQLRAS--ELTTLLNEKNSIHAERL 466

Query: 602 KEVKNLMTKLENVSKEVIFGTNELKKANEKLCEMQKILIQDRQKANDARTSLSNVENRSK 661
           KE+K L + +E+ S       N+    N KL E    L+Q    + + R S+   + R  
Sbjct: 467 KELKGLQSDIESAS-------NQEYDLNYKLRET---LVQIDDLSANQRESMKERKLREN 516

Query: 662 VLRALLKLQKSGRINGFHGRLGNLGVIDEKYDVAISTACPR-LNDIVVDSVECGQQCIEY 720
           V  A+LK    G + G    L +     +KY +A+ST   R  + ++VD+    Q+CI Y
Sbjct: 517 V--AMLKRLFPG-VKGLVYDLCHPK--KDKYSLAVSTCLGRNFDSVIVDNASVAQECIAY 571

Query: 721 LRKNNLGHARFILLDKLN-KFSMEKISTPRNVPRLFDLIKVNDEKFLPAFYSVLRNTLVA 779
           L+K   G A FI L+ ++ +     +S  +      + I+  D ++  A   V  +T++ 
Sbjct: 572 LKKQRAGSASFIPLETIDSEIPTLSVSNSQGCILAINAIEY-DPRYERAMQYVCSDTIIC 630

Query: 780 NDLKEANAVAYGK-TRYRVVTLKGNLIDISGTMSGG 814
           + L  A  + + +  + ++VTL+G LI  +G M+GG
Sbjct: 631 DTLVIAKRLKWVEGVKAKLVTLEGALIHKAGLMTGG 666

 Score =  136 bits (342), Expect = 2e-31,   Method: Compositional matrix adjust.
 Identities = 69/163 (42%), Positives = 105/163 (64%), Gaps = 12/163 (7%)

Query: 1234 LKKCRFNEFMESFNIISMTLKEMYQIITM---------GGNAELELVDSLDPFSEGVTFS 1284
            +KK R   F ++F  ++  L  +Y+ +T          GGNA L L D  +PF+ G+ + 
Sbjct: 1054 IKKRRRELFEKAFEHVTNHLDSIYRELTRDPHSSAELSGGNASLTLEDEDEPFNAGIRYH 1113

Query: 1285 VMPPKKSWRNISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYI 1344
              PP K ++++  LSGGEKT+++LAL+FA++ ++P+P +V+DE+DAALD RNV  +A YI
Sbjct: 1114 ATPPLKRFKDMEYLSGGEKTMAALALLFAINSFQPSPFFVLDEVDAALDVRNVERIAAYI 1173

Query: 1345 KER-TKNAQFIVISLRNNMFELAEQLVGIYKNV--NQTKSATL 1384
            +     N QFIVISL+N MFE ++ LVG+Y+    N +K  TL
Sbjct: 1174 RRHGNPNLQFIVISLKNTMFEKSDALVGVYRQQQENSSKIVTL 1216

>Suva_6.52 Chr6 (91156..94950) [3795 bp, 1264 aa] {ON} YFL008W
           (REAL)
          Length = 1264

 Score =  150 bits (379), Expect = 8e-36,   Method: Compositional matrix adjust.
 Identities = 190/737 (25%), Positives = 338/737 (45%), Gaps = 94/737 (12%)

Query: 132 IYSSKQE-------EKIERICLNK--------LVLHNFKSYAGTQTIGPFHSSFSAVVGP 176
           +Y+S++E       E I+R+  N+        L L NFKSY G   +G   S+F++++GP
Sbjct: 11  LYASQRELLKASYPESIDRVAKNQSTMGRLVGLELSNFKSYRGITKVGFGESNFTSIIGP 70

Query: 177 NGSGKSNVIDSMLFVFGFRANKMRQGKLADLIHKSEEYPDLTSCAVDVHFEYLIDYPDDT 236
           NGSGKSN++D++ FV G R+N +R   L DLI++           +D   +  ID   D 
Sbjct: 71  NGSGKSNMMDAISFVLGVRSNHLRSNILKDLIYRG---------VLDDGNDENIDSGADD 121

Query: 237 TKI--NPSK-----------QPLIITRRAFKNSTSKYYLNGKESNYKTITALLKEEGIDL 283
             I  NP+            + + +TR   +N  + Y ++GK   YK  +  L+ E I +
Sbjct: 122 NAITSNPNSAYVKAFYQKGNKLVELTRLISRNGDTTYKIDGKTVTYKDYSIFLENENILI 181

Query: 284 DHNRFLILQGEVENIAQMKPKAEKEGDDGLLEYLEDIIGTTKYKELIDKKFIEIEALNDI 343
               FL+ QG+VE IA   P         L    E++ G+ +YK+  D+   +IE L+  
Sbjct: 182 KAKNFLVFQGDVEQIAAQSPT-------DLSRMFEEVSGSIQYKKEYDELKEKIEKLSKS 234

Query: 344 CIER-ENRFDIIDRXXXXXXXXXXXXXXXXXXXXXQVIVKSKLIQYK-IW---------- 391
             E  +NR     R                     QV  K++L +++ +W          
Sbjct: 235 ATESIKNR-----RRIHGELKTYKEGINKNEEYRKQVDKKNELQKFQALWKLYHLEQKKE 289

Query: 392 QNNIKLSNTLEKITKLEDEYNQEKNKNTELKNKIDELRKLYTKNQDELQALLKDEKELVN 451
           +   KLS +  +I  L++  N E       K+   +   + +K + +L  ++KD+++L++
Sbjct: 290 ELTDKLSASNSEIMSLKERINNETKSLQRSKSSFVKESTVISKQKSKLDYIVKDKEKLMS 349

Query: 452 AKRSLDSDNVSNTEQLKNIEKKLKKTAKEIEEDLKTISSSNVRLKNFHDNKKLFETQLIE 511
             R +     +   ++ +IEK++    +++E     +     +LK    +KK FE ++ E
Sbjct: 350 DLRLIKVPQQAAGRRISHIEKRIGSLQRDLERQESYVERFETQLKVITKSKKTFEEEIKE 409

Query: 512 LDNNL----VTESQLLENIKLDLKDKTVG---LSEEILKTEKDLEPWNIKLDELKSEIQI 564
              N     + ES L     L  K  T G   L E+I  +  D +    +LD       I
Sbjct: 410 SARNYDKFKLNESDLKTYDSLHEKYLTQGGSILEEKISLSNNDKQEIVDELDRFNKRADI 469

Query: 565 KESEKALFEE---SKNKLKANIEALEKDVNEKSKLTEDRRKEVKNLMTKLENVSKEVIFG 621
             S++ + EE   +  KL   +  L   +NEK+ L  +R  E+K L + +E+ +      
Sbjct: 470 --SKRRITEELFITGEKLDTQLNDLRASLNEKNALHTERLNELKKLQSDIESAN------ 521

Query: 622 TNELKKANEKLCEMQKILIQDRQKANDARTSLSNVENRSKVLRALLKLQKSGRINGFHGR 681
            N+    N KL E    L++    + + R ++   + R  +  A+LK        G  G 
Sbjct: 522 -NQEYDLNFKLRET---LVKIDDLSANQRETMKERKLRENI--AMLK----RFFPGVKGL 571

Query: 682 LGNL-GVIDEKYDVAISTACPR-LNDIVVDSVECGQQCIEYLRKNNLGHARFILLDKLNK 739
           + +L     EKY +A+ST   R  + ++V+++   Q+CI +L+K   G A FI LD + +
Sbjct: 572 VHDLCHPKKEKYGLAVSTILGRNFDSVIVENLTVAQECIAFLKKQRAGTASFIPLDTI-E 630

Query: 740 FSMEKISTPRNVPRLFDLIKVNDE-KFLPAFYSVLRNTLVANDLKEANAVAYGK-TRYRV 797
             +  +S P +   +  +  ++ E ++  A   V  ++++ N L  A  + + K  R ++
Sbjct: 631 TELPTLSLPDSQDYILSINAIDYEPEYEKAMQYVCGDSIICNTLNIAKDLKWKKGVRAKL 690

Query: 798 VTLKGNLIDISGTMSGG 814
           VT++G LI  +G M+GG
Sbjct: 691 VTIEGALIHKAGLMTGG 707

 Score =  139 bits (349), Expect = 3e-32,   Method: Compositional matrix adjust.
 Identities = 67/161 (41%), Positives = 105/161 (65%), Gaps = 10/161 (6%)

Query: 1234 LKKCRFNEFMESFNIISMTLKEMYQIIT---------MGGNAELELVDSLDPFSEGVTFS 1284
            +KK R   F ++F+ +S  L  +Y+ +T          GGNA L + D  +PF+ G+ + 
Sbjct: 1095 IKKKRKELFEKTFDYVSDHLDAIYRELTKNPNSTVELAGGNASLTIEDEDEPFNAGIKYH 1154

Query: 1285 VMPPKKSWRNISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYI 1344
              PP K ++++  LSGGEKT+++LAL+FA++ Y+P+P +V+DE+DAALD  NV  +A YI
Sbjct: 1155 ATPPLKRFKDMEYLSGGEKTVAALALLFAINSYQPSPFFVLDEVDAALDITNVQRIAAYI 1214

Query: 1345 -KERTKNAQFIVISLRNNMFELAEQLVGIYKNVNQTKSATL 1384
             + R  + QFIVISL+N MFE ++ LVG+Y+   +  S T+
Sbjct: 1215 RRHRNPDLQFIVISLKNTMFEKSDALVGVYRQQQENSSKTV 1255

>NDAI0G03320 Chr7 (781468..785163) [3696 bp, 1231 aa] {ON} 
          Length = 1231

 Score =  147 bits (370), Expect = 8e-35,   Method: Compositional matrix adjust.
 Identities = 205/800 (25%), Positives = 368/800 (46%), Gaps = 96/800 (12%)

Query: 146 LNKLVLHNFKSYAGTQTIGPFHSSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQGKLA 205
           L+ L L+NFKSY G   +G   S+F++++GPNGSGKSN++D++ FV G R++ +R   + 
Sbjct: 4   LSGLELNNFKSYKGITKVGFGDSNFTSIIGPNGSGKSNMMDAISFVLGVRSSHLRSNIVK 63

Query: 206 DLIHK--------SEEYPDLTSCAVDVHFEYLIDYPDDTTKINPSKQPLIITRRAFKNST 257
           DLI++        + E+  +TS  V   +E      D     +  ++P+ + R    N  
Sbjct: 64  DLIYRGVINDNGDTNEHGKVTSAYVKAFYEKNT-ADDGDNDDDDDERPVELMRAISTNGD 122

Query: 258 SKYYLNGKESNYKTITALLKEEGIDLDHNRFLILQGEVENIAQMKPKAEKEGDDGLLEYL 317
           + Y +NGK   YK  +  L+ E I +    FL+ QG+VE IA   P         L +  
Sbjct: 123 TTYKINGKTVTYKEYSEFLERENILIKAKNFLVFQGDVEQIASQSPM-------DLSKLF 175

Query: 318 EDIIGTTKYKELIDKKFIEIEALNDICIERENRFDIIDRXXXXXXXXXXXXXXXXXXXXX 377
           E++ G+ +YK+  D+   +IE LN    E      I +R                     
Sbjct: 176 EEVSGSIQYKKEYDELKEQIEKLNQSAAE-----SIRNRRRIHGELKTYKEGITKDEEYK 230

Query: 378 QVIVKSK-----LIQYKIWQNNIKLSNTLEKITKLEDEYNQEKNKNTELKNKIDELRKLY 432
             I K K     L+ ++++    +   +L+ +   + E +Q KNK T  +  +   +  +
Sbjct: 231 NNIEKRKKYYMYLVLWQLYHLENEKKKSLDNLKNAKSEISQLKNKITNEEKNLQRSKSSF 290

Query: 433 -------TKNQDELQALLKDEKELVNAKRSLDSDNVSNTEQLKNIEKKLKKTAKEIEEDL 485
                   K +++L   LK++ +L+    S+     + ++++ NIEK+++   K+IE   
Sbjct: 291 LKENLKVNKKREQLNYQLKEKDKLLEDLNSIKIPQRAASKRINNIEKRIESIQKDIERQQ 350

Query: 486 KTISSSNVRLKNFHDNKKLFETQLIELDNNLVTESQLLENIKL-------DLKDKTVGLS 538
             I++   +LK     K+ FE ++ E   N    S   +++KL        L +    + 
Sbjct: 351 GYINTFENQLKVVTKAKESFEREIKESAQNSNKYSLSDDDLKLYESLNEKYLMENGSAIE 410

Query: 539 EEILKTEKDLEPWNIKLDELKSEIQIKESEKALFEE---SKNKLK-ANIEALEKDVNEKS 594
           ++I     D +    ++D L  +I    S+K + EE   S+ +++  NIE L   +NEK+
Sbjct: 411 QQISLLNNDKQEVLEEMDRLNRKIDA--SKKRITEELLISQERIQNENIE-LVSSLNEKN 467

Query: 595 KLTEDRRKEVKNLMTKLENVSKEVIFGTNELKKANEKLCEMQKILIQDRQKANDARTSLS 654
            +  ++  E+K L  ++E+         N+    N KL E   +L  D   AN  R S+ 
Sbjct: 468 SIFSEKTHELKTLQAEIES-------SNNQEYDTNYKLRET--LLKLDDLNAN-QRESI- 516

Query: 655 NVENRSKVLRALLKLQKSGRINGFHGRLGNLGVI-DEKYDVAISTACPR-LNDIVVDSVE 712
               + K LR  + + K     G  G + +L     +KY +A+ST   +  + I+VD++ 
Sbjct: 517 ----KEKKLRENVTMLKRF-FPGVRGLVHDLCRPKKDKYGLAVSTILGKNFDSIIVDNLN 571

Query: 713 CGQQCIEYLRKNNLGHARFILLDKLNKFSMEKISTPRNVPRLFDLI-KVN----DEKFLP 767
             Q+CI + +K   G A FI LD +   S E+ +   N+P   D I  +N    D ++  
Sbjct: 572 VAQECIAFFKKQRSGTASFIPLDTI---SSEQPTL--NLPSSQDYILTINAIEYDPEYER 626

Query: 768 AFYSVLRNTLVANDLKEANAVAYGK-TRYRVVTLKGNLIDISGTMSGGGNQASKGAMQLX 826
           A   V  ++++ N L  A  + + K  R ++VT++G LI  +G M+GG ++ S       
Sbjct: 627 AMQYVCSDSIICNSLDIARDLKWNKGVRSKLVTIEGALIHKAGLMTGGISKDSNNRWD-- 684

Query: 827 XXXXXXXXXXXXXXVMEIEKELSIREKNYQNAYNTVQEMEIELRNLKESEPKIELEISKL 886
                         +M ++ +L ++          V+E+  + R        +E+E+S L
Sbjct: 685 --------KEEYQSLMTLKDKLLLQ----------VEEISTKSRLSSTRARDVEIELSTL 726

Query: 887 NFEIDSLENECSLKRKQLNE 906
           N EI SL  + S  ++ L+E
Sbjct: 727 NAEISSLRMQLSQVQRSLDE 746

 Score =  137 bits (344), Expect = 1e-31,   Method: Compositional matrix adjust.
 Identities = 81/207 (39%), Positives = 124/207 (59%), Gaps = 19/207 (9%)

Query: 1197 LDILEEYTR---RMIEYRQRKYDLNQSVEQ-RDKVRKELED---LKKCRFNEFMESFNII 1249
            LD+L+   R   R  E ++R   ++   E+ +   RK L+    +KK R   F  +F+ +
Sbjct: 1018 LDVLQPNARAADRFTEAQERFEIIDGETEKIKTTERKALQQFLKIKKKRKELFENAFDFV 1077

Query: 1250 SMTLKEMYQIIT---------MGGNAELELVDSLDPFSEGVTFSVMPPKKSWRNISNLSG 1300
            S  L  +Y+ +T          GGNA L L D  +PF+ GV +   PP K ++++  LSG
Sbjct: 1078 SEHLDNIYRELTRNPNSSADLAGGNASLTLEDEDEPFNAGVRYHATPPLKRFKDMEYLSG 1137

Query: 1301 GEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKER-TKNAQFIVISLR 1359
            GEKT+++LAL+FA++ Y+P+P +V+DE+DAALD  NV  +A YI+     N QFIVISL+
Sbjct: 1138 GEKTVAALALLFAINAYQPSPFFVLDEVDAALDITNVERIAAYIRRHGNPNLQFIVISLK 1197

Query: 1360 NNMFELAEQLVGIYKNV--NQTKSATL 1384
            N MFE ++ LVG+++    N +K  TL
Sbjct: 1198 NTMFEKSDALVGVFRQQQENSSKIVTL 1224

>KLLA0D07502g Chr4 complement(642751..646482) [3732 bp, 1243 aa]
           {ON} similar to uniprot|P32908 Saccharomyces cerevisiae
           YFL008W SMC1 Subunit of the multiprotein cohesin complex
           essential protein involved in chromosome segregation and
           in double-strand DNA break repair SMC chromosomal ATPase
           family member binds DNA with a preference for DNA with
           secondary structure
          Length = 1243

 Score =  141 bits (356), Expect = 4e-33,   Method: Compositional matrix adjust.
 Identities = 229/877 (26%), Positives = 380/877 (43%), Gaps = 154/877 (17%)

Query: 149 LVLHNFKSYAGTQTIGPFHSSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQGKLADLI 208
           L LHNFKSY  T  +G   S F++++GPNGSGKSN++D++ FV G R+N++R   L DLI
Sbjct: 7   LELHNFKSYKDTVQVGFGESYFTSIIGPNGSGKSNLMDAISFVLGVRSNQLRSSALVDLI 66

Query: 209 HKSE--------------EYPDLTSCAVDVHFEYLIDYPDDTT-----KINPSKQPLIIT 249
           ++                   D  S A   +  Y  + P         + +   +P   T
Sbjct: 67  YRGRIENGDPDNGNAKRMHRSDADSEAGPENATYSEEEPRSAYVSCVYQKDDLDEPTKFT 126

Query: 250 RRAFKNSTSKYYLNGKESNYKTITALLKEEGIDLDHNRFLILQGEVENIAQMKPKAEKEG 309
           R    +  S Y +N +  +YK     L+ E I +    FL+ QG+VE IA   P++    
Sbjct: 127 RTINTSGDSVYKINDRAVSYKKYNEELESENILVKAKNFLVFQGDVERIASQGPES---- 182

Query: 310 DDGLLEYLEDIIGTTKYKELIDKKFIEIE-ALNDICIERENRFDIIDRXXXXXXXXXXXX 368
              L   LE + G+  YK   +K   E + AL +      +R     +            
Sbjct: 183 ---LTLLLEQVSGSINYKNDYEKLKEEHKLALAEFTDAHNSR-----KKVQNDLKSFKEG 234

Query: 369 XXXXXXXXXQVIVKSKLIQ-YKIWQNNIKLSNTLEKITKLEDEYNQEKNKNTELKNKIDE 427
                     + ++ +L   + +W+    L + L++  KL D     K + T LKNK+ +
Sbjct: 235 VQRDEQYRTSLEIRDQLKHNFILWE----LFHILKRRKKLVDSLTVSKTETTALKNKLSD 290

Query: 428 LRKLYTK-----NQDELQ-ALLKDE-KELVNAKRSLDS-------DNVSNTEQLKNIEKK 473
             ++ TK      + ELQ + LKD   +L N K SL S       + ++  +++ N+EK+
Sbjct: 291 EERILTKIKSTTAKHELQLSKLKDTLVQLENEKTSLQSSLLPVGSERLATIKRIHNLEKR 350

Query: 474 LKKTAKEIEEDLKTISSSNVRLKNFHDNKKLFETQLIELDNNL----VTESQLLENIKLD 529
           +    K++E     +     +LK     KK FE +L  +  NL    ++E  L +   L 
Sbjct: 351 ISSFKKDMERQQAYVKQFENQLKVVSKTKKSFEKELENIHANLNKFNLSEEDLKQYELLK 410

Query: 530 LKDKTVGLS--EEILKTEKDLEPWNIKLDELKSEIQIKESEKALFEESKNKLKANIEALE 587
            K  + G S  EE L   K+ E    +L+E +SE+ I +  K   E   ++L+ +++ALE
Sbjct: 411 EKYLSSGGSHIEEKLAILKNDE---FELNE-ESEL-INKRLKTTRERISDELQVDVDALE 465

Query: 588 KDVNE-------KSKLTEDRRKEVKNLMTKLENVSKEVIFGTNELKKANEKLCEMQKILI 640
            D+NE       K+ +   + KE K + T LE++            K  E    ++ +L+
Sbjct: 466 ADLNEVTQRLNDKNSIAAAKSKEWKGIQTNLESLKN----------KEYELNFSLRDVLL 515

Query: 641 QDRQKANDARTSLSNVENRSKVLRALLKLQKSGRINGFHGRLGNLGVIDEKYDVAISTAC 700
           +      D R +    + R  V  ++LK    G + G    L +     EKY +A+ST  
Sbjct: 516 KIDDLNADQRETKKERKLRENV--SMLKRLYPG-VKGLVHDLCHPK--KEKYAIAVSTIL 570

Query: 701 PR-LNDIVVDSVECGQQCIEYLRKNNLGHARFILLDKLNKFSMEKISTPRNVPR------ 753
            +  + I+VDS+    +CI YL+K   G A FI LD ++         P ++P       
Sbjct: 571 GKNFDSIIVDSIATAHECITYLKKQRAGSASFIPLDTID-------VNPPSLPVSNVQGC 623

Query: 754 LFDLIKVNDEKFL-PAFYSVLRNTLVANDLKEANAVAYGK-TRYRVVTLKGNLIDISGTM 811
           L  +  +  E +L  A   V  ++++ ++L  A  + + +  + ++VTL G LI  +G M
Sbjct: 624 LLTINAIEYEGYLEKAMQYVCSDSIICDNLDLAKELKWSRNVKAKLVTLNGALIHKAGQM 683

Query: 812 SGGGNQAS---------KGAMQLXXXXXXXXXXXXXXXVMEIEKELSIREKNYQNAYNTV 862
           +GG  Q +         +G M L                 +I +EL+     ++      
Sbjct: 684 TGGTAQKNQNRWNKDEYQGLMVLKD---------------QITEELTALSDKFR------ 722

Query: 863 QEMEIELRNLKESEPKIELEISKLNFEIDSLENECSLKRKQLNEPNASFSIEDNMSADIT 922
                   N+K  E  +E EIS LN EI SL  + +   + L+  N    I+ N     T
Sbjct: 723 ------ADNMKSRE--LENEISLLNNEISSLRTQITQLERTLSGKNV--EIKHNEDLITT 772

Query: 923 EMDNALYTLNEKQKLIESQMKSKKDRIKELQDKIMKI 959
           E               E Q+KS   RI+EL+ K+ K+
Sbjct: 773 EY--------------EPQLKSFTQRIEELKSKLTKL 795

 Score =  133 bits (334), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 78/213 (36%), Positives = 127/213 (59%), Gaps = 21/213 (9%)

Query: 1197 LDILEEYTRRMIEYRQRKYDLNQSVEQ----RDKVRKELE---DLKKCRFNEFMESFNII 1249
            L+IL+  ++ +  Y + K+ L+Q   +    R+K RK  E   ++K  R   F   F  +
Sbjct: 1029 LEILQPNSKAVQRYDETKHKLDQVSNENERLRNKERKAKEKFLEVKAKRKELFEACFKHV 1088

Query: 1250 SMTLKEMYQIIT---------MGGNAELELVDSLDPFSEGVTFSVMPPKKSWRNISNLSG 1300
               + ++Y+ +T          GGNA L + +  +P+  G+ +   PP K ++++  LSG
Sbjct: 1089 DKHIDQIYRALTKNPHDKSELAGGNASLTVENEDEPYLGGIKYFATPPLKRFKDMEYLSG 1148

Query: 1301 GEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTK-NAQFIVISLR 1359
            GEKT+++LAL+F ++ Y+P+P +V+DE+DAALD  NV  +A+YIK     NAQFIVISL+
Sbjct: 1149 GEKTMAALALLFTINSYQPSPFFVLDEVDAALDITNVERIAHYIKRNANPNAQFIVISLK 1208

Query: 1360 NNMFELAEQLVGIYK----NVNQTKSATLKNND 1388
            N MFE ++ LVGI++    N ++  S  L+N D
Sbjct: 1209 NAMFEKSQSLVGIFREQEDNSSRMVSLNLENYD 1241

>Smik_6.71 Chr6 (132627..136313) [3687 bp, 1228 aa] {ON} YFL008W
           (REAL)
          Length = 1228

 Score =  141 bits (355), Expect = 5e-33,   Method: Compositional matrix adjust.
 Identities = 176/699 (25%), Positives = 323/699 (46%), Gaps = 67/699 (9%)

Query: 149 LVLHNFKSYAGTQTIGPFHSSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQGKLADLI 208
           L L NFKSY G   +G   S+F++++GPNGSGKSN++D++ FV G R+N +R   L DLI
Sbjct: 7   LELSNFKSYRGITKVGFGESNFTSIIGPNGSGKSNMMDAISFVLGVRSNHLRSNILKDLI 66

Query: 209 HKSEEYPDLTSCAVDVHFEYLIDYPDDTTKINPSKQP----LIITRRAFKNSTSKYYLNG 264
           ++     D      D   + +      +  +    Q     + + R   +N  + Y ++ 
Sbjct: 67  YRGVLNDDNDDNYNDTSDDDVASSNPKSAYVKAFYQKGNKMVELMRIISRNGDTSYKIDE 126

Query: 265 KESNYKTITALLKEEGIDLDHNRFLILQGEVENIAQMKPKAEKEGDDGLLEYLEDIIGTT 324
           K  +YK  +  L+ E I +    FL+ QG+VE IA   P         L    E++ G+ 
Sbjct: 127 KTVSYKDYSIFLENENILIKAKNFLVFQGDVEQIAAQSPIE-------LSRMFEEVSGSI 179

Query: 325 KYKELIDKKFIEIEALNDICIER-ENRFDIIDRXXXXXXXXXXXXXXXXXXXXXQVIVKS 383
           +YK+  D+   +IE L+    E  +NR     R                     QV  KS
Sbjct: 180 QYKKEYDELKEKIEKLSKSATESIKNR-----RRIHGELKTYKEGINKNEEYRKQVEKKS 234

Query: 384 KLIQYK-IWQ----------NNIKLSNTLEKITKLEDEYNQEKNKNTELKNKIDELRKLY 432
           +L +++ +WQ             KLS +  +I+ L+++ N E       K+   +   + 
Sbjct: 235 ELQKFQALWQLYHLEQQKEELTDKLSASNSEISSLKEKINHEMKSLQRSKSSFVKESAVI 294

Query: 433 TKNQDELQALLKDEKELVNAKRSLDSDNVSNTEQLKNIEKKLKKTAKEIEEDLKTISSSN 492
           +K + +L  ++KD+++LV+  R +     +  +++ +IEK+++   ++++     +    
Sbjct: 295 SKQKSKLNYIIKDKEKLVSDLRLIKVPQQAAGKRVLHIEKRIESLQRDLQRQKAYVERFE 354

Query: 493 VRLKNFHDNKKLFETQLIEL----------DNNLVTESQLLENIKLDLKDKTVGLSEEIL 542
            +LK    +KK FE ++ E           +N+L T + L E     L +    L E+I 
Sbjct: 355 TQLKVVTKSKKTFEEEIKESARNYDKFKLNENDLETYNCLHEKY---LTENGSILEEKIA 411

Query: 543 KTEKDLEPWNIKLDELKSEIQIKESEKALFEE---SKNKLKANIEALEKDVNEKSKLTED 599
               D +    +LD       I  S++ + EE   +  KL   +  L   +NEK+ +  +
Sbjct: 412 LYNNDKQEIQEELDRFNKRADI--SKRRITEELSVTGEKLDTQLNDLRASLNEKNAVHTE 469

Query: 600 RRKEVKNLMTKLENVSKEVIFGTNELKKANEKLCEMQKILIQDRQKANDARTSLSNVENR 659
           R  E+K L + +E+         N+    N KL E    L++    + + R ++   + R
Sbjct: 470 RLHELKKLQSDIES-------ANNQEYDLNFKLRET---LVKIDDLSANQRETMKERKLR 519

Query: 660 SKVLRALLKLQKSGRINGFHGRLGNL-GVIDEKYDVAISTACPR-LNDIVVDSVECGQQC 717
             +  A+LK        G  G + +L     EKY +A+ST   +  + ++V+++   Q+C
Sbjct: 520 ENI--AMLK----RFFPGVKGLVHDLCHPKKEKYGLAVSTILGKNFDSVIVENLTVAQEC 573

Query: 718 IEYLRKNNLGHARFILLDKLNKFSMEKISTPRNVPRLFDLIKVNDE-KFLPAFYSVLRNT 776
           I +L+K   G A FI LD + +  +  +S P +   +  +  ++ E ++  A   V  ++
Sbjct: 574 IAFLKKQRAGTASFIPLDTI-ETELPTLSLPDSQEYILSINAIDYEPEYEKAMQYVCGDS 632

Query: 777 LVANDLKEANAVAYGK-TRYRVVTLKGNLIDISGTMSGG 814
           ++ N LK A  + + K  R ++VT++G LI  +G M+GG
Sbjct: 633 IICNSLKIAKGLKWNKGVRAKLVTIEGALIHKAGLMTGG 671

 Score =  135 bits (341), Expect = 2e-31,   Method: Compositional matrix adjust.
 Identities = 65/158 (41%), Positives = 103/158 (65%), Gaps = 10/158 (6%)

Query: 1234 LKKCRFNEFMESFNIISMTLKEMYQIIT---------MGGNAELELVDSLDPFSEGVTFS 1284
            +K+ R   F ++F+ +S  L  +Y+ +T          GGNA L + D  +PF+ G+ + 
Sbjct: 1059 IKRKRKELFEKTFDYVSDHLDAIYRELTKNPNSNVELAGGNASLTIEDEDEPFNAGIKYH 1118

Query: 1285 VMPPKKSWRNISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYI 1344
              PP K ++++  LSGGEKT+++LAL+FA++ Y+P+P +V+DE+DAALD  NV  +A YI
Sbjct: 1119 ATPPLKRFKDMEYLSGGEKTVAALALLFAINSYQPSPFFVLDEVDAALDITNVQRIAAYI 1178

Query: 1345 -KERTKNAQFIVISLRNNMFELAEQLVGIYKNVNQTKS 1381
             + R  + QFIVISL+N MFE ++ LVG+Y+   +  S
Sbjct: 1179 RRHRNPDLQFIVISLKNTMFEKSDALVGVYRQQQENSS 1216

>Kwal_23.5043 s23 (978758..982435) [3678 bp, 1225 aa] {ON} YFL008W
            (SMC1) - SMC chromosomal ATPase family member [contig 7]
            FULL
          Length = 1225

 Score =  140 bits (353), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 68/171 (39%), Positives = 113/171 (66%), Gaps = 12/171 (7%)

Query: 1226 KVRKELEDLKKCRFNEFMESFNIISMTLKEMYQIIT---------MGGNAELELVDSLDP 1276
            KV ++   +K+ R   F ++F+ +S ++ E+Y+ +T          GGNA L L D  +P
Sbjct: 1048 KVNEDFTRIKRLRKEAFEKAFDHVSSSIDEIYRELTRDPHSRAELAGGNASLTLEDEDEP 1107

Query: 1277 FSEGVTFSVMPPKKSWRNISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRN 1336
            +  G+ +   PP K ++++  LSGGEKT+++LAL+FA++ ++P+P +V+DE+DAALD  N
Sbjct: 1108 YLAGIRYHATPPAKRFKDMEYLSGGEKTIAALALLFAINSFQPSPFFVLDEVDAALDISN 1167

Query: 1337 VSIVANYIKERT-KNAQFIVISLRNNMFELAEQLVGIYKNV--NQTKSATL 1384
            V  VA+YI+ +   + QFIVISL+N MFE ++ LVG+++    N +K+ TL
Sbjct: 1168 VERVASYIRRKAGADLQFIVISLKNTMFEKSQALVGVFRQQQNNTSKALTL 1218

 Score =  103 bits (258), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 68/214 (31%), Positives = 112/214 (52%), Gaps = 20/214 (9%)

Query: 149 LVLHNFKSYAGTQTIGPFHSSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQGKLADLI 208
           L L+NFKSY G  +IG   S+F++++GPNGSGKSN++D++ FV G ++  +R   LADLI
Sbjct: 7   LELNNFKSYKGKVSIGFRDSNFTSIIGPNGSGKSNLMDAISFVLGVKSVHLRSHLLADLI 66

Query: 209 HKSEEYPDLTSCAVDVHFEYLIDYPDDT------TKINPSKQPLIITRRAFKNSTSKYYL 262
           ++     +  S A D   E   ++P+        +  N     + ++R   ++  S Y +
Sbjct: 67  YRGTLSEEEASSA-DFESE---NHPNSAYVKAFYSPSNNEDDVVELSRTVTRSQESTYRI 122

Query: 263 NGKESNYKTITALLKEEGIDLDHNRFLILQGEVENIAQMKPKAEKEGDDGLLEYLEDIIG 322
           +GK   YK  +  L+ E I +    FL+ QG+VE +A  KP+        L +  E + G
Sbjct: 123 DGKTVGYKKYSQFLESENILIKARNFLVFQGDVEQVAAQKPQE-------LTDLFEQVSG 175

Query: 323 TTKYKELIDKKFIEIE---ALNDICIERENRFDI 353
           + +YK+  D+   E+E   +    CI+   R  I
Sbjct: 176 SLQYKQDYDRIREELERARSETSDCIQSRKRAHI 209

 Score = 53.9 bits (128), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 65/255 (25%), Positives = 122/255 (47%), Gaps = 38/255 (14%)

Query: 593 KSKLTEDRRKEVKNLMTKLENVSKEVIFGTNELKKANEKLCEMQKILIQDRQKANDART- 651
           K KL E+   E +NL  ++++++K     ++E  +  +KL E+Q      R ++N+ R  
Sbjct: 433 KEKLAEELGSEKENLEIEVQDITKSFDKKSHETSRTVKKLKELQ-----SRAESNNNREY 487

Query: 652 --------SLSNVENRSKVLRALLKLQKSGRINGFHGRL--GNLGVID-------EKYDV 694
                   +L+ +++ + V R   K +K         RL  G  G++        EK+ V
Sbjct: 488 EINYKLKETLTKLDDMNAVQRESAKEKKLRENVSMLRRLFPGVRGLVHDLCHPKKEKFAV 547

Query: 695 AISTACPR-LNDIVVDSVECGQQCIEYLRKNNLGHARFILLDKLNKFSMEKISTP-RNVP 752
           A+ST   +  + ++VD+    QQC+ +L+K   G   FI LD ++   +  I++  +   
Sbjct: 548 AVSTVLGKNFDAVIVDNFLVAQQCVSFLKKQRSGVVSFIPLDTVDVSKVPMIASEFKGCI 607

Query: 753 RLFDLIKVNDEKFLPAFY----SVLRNTL-VANDLKEANAVAYGKTRYRVVTLKGNLIDI 807
              D I    +      Y    S++ +TL +A DLK  + +     R ++V++ G+++  
Sbjct: 608 LAIDAIDYEPDLERAMQYVCSDSIICDTLQIAKDLKWKHNI-----RSKLVSINGSIVHR 662

Query: 808 SGTMSGGGNQASKGA 822
           +G M+GG   ASKG 
Sbjct: 663 AGLMTGG---ASKGG 674

>Skud_6.64 Chr6 (121616..125308) [3693 bp, 1230 aa] {ON} YFL008W
           (REAL)
          Length = 1230

 Score =  139 bits (351), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 211/865 (24%), Positives = 392/865 (45%), Gaps = 127/865 (14%)

Query: 149 LVLHNFKSYAGTQTIGPFHSSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQGKLADLI 208
           L L NFKSY G   +G   S+F++++GPNGSGKSN++D++ FV G R+N +R   L DLI
Sbjct: 7   LELSNFKSYRGVTKVGFGESNFTSIIGPNGSGKSNMMDAISFVLGVRSNHLRSNVLKDLI 66

Query: 209 HKSEEYPDLTSCAVDVHFEYLIDYPDDTTKINP-----------SKQPLIITRRAFKNST 257
                Y  + +   D   +      DD T  NP             + + + R   +N  
Sbjct: 67  -----YRGILNDGNDNDNDDDSASDDDATTSNPKSAYVKAFYQKGNKLVELMRIISRNGD 121

Query: 258 SKYYLNGKESNYKTITALLKEEGIDLDHNRFLILQGEVENIAQMKPKAEKEGDDGLLEYL 317
           + Y ++GK  +Y+  +  L+ E I +    FL+ QG+VE IA   P         L +  
Sbjct: 122 TSYKIDGKSVSYRDYSVFLENENILIKAKNFLVFQGDVEQIAAQSPIE-------LSKMF 174

Query: 318 EDIIGTTKYKELIDKKFIEIEALNDICIER-ENRFDIIDRXXXXXXXXXXXXXXXXXXXX 376
           E++ G+ +YK+  D+   +IE L     E  +NR     R                    
Sbjct: 175 EEVSGSIQYKKEYDELKEKIEKLGKSATESIKNR-----RRIHGELKTYKEGINKNEEYI 229

Query: 377 XQVIVKSKLIQYK-IWQNNI----------KLSNTLEKITKLEDEYNQEKNKNTELKNKI 425
            QV  K++L +++ +WQ             KLS +  +++ L+++ N E       K+  
Sbjct: 230 KQVDKKNELQRFQALWQLYHLEQQKEELMDKLSASNSEVSSLKEKINNEMKSLQRSKSSF 289

Query: 426 DELRKLYTKNQDELQALLKDEKELVNAKRSLDSDNVSNTEQLKNIEKKLKKTAKEIEEDL 485
            +   + +K + +L+ ++KD+++LV+  R +     +  +++ +IEK+++   +++    
Sbjct: 290 VKEGTIISKQKSKLEYIVKDKEKLVSDLRLIKVPQQAAGKRISHIEKRIESLQRDLGRQE 349

Query: 486 KTISSSNVRLKNFHDNKKLFETQLIE---------LDNNLVTESQLLENIKL----DLKD 532
             +     +LK    +KK FE ++ E         L+ N +    LL    L     + +
Sbjct: 350 AYVERFETQLKVVTKSKKTFEEEIKESARNYEKFKLNENDLKTYDLLHEKYLTQGGSVLE 409

Query: 533 KTVGLS----EEILKTEKDLEPWNIKLDELKSEIQIKESEKALFEESKNKLKANIEALEK 588
           + + LS    +EIL    +L+ +N + D  K  I    +E+ L   +  KL   +  L  
Sbjct: 410 EKISLSNNHKQEIL---DELDRFNKRADISKRRI----TEELLI--TGEKLDTQLNDLRA 460

Query: 589 DVNEKSKLTEDRRKEVKNLMTKLENVSKEVIFGTNELKKANEKLCEMQKILIQDRQKAND 648
            +NEK+ L  +R  ++K L + +E+ +       N+    N KL E    L++    + +
Sbjct: 461 SLNEKNALHTERLNQLKKLQSDIESAN-------NKEYDLNFKLRET---LVKIDDLSAN 510

Query: 649 ARTSLSNVENRSKVLRALLKLQKSGRINGFHGRLGNL-GVIDEKYDVAISTACPR-LNDI 706
            R ++   + R  +  A+LK        G  G + +L     EKY +A+ST   R  + +
Sbjct: 511 QRETMKERKLRENI--AMLK----RFFPGVKGLVHDLCHPKKEKYGLAVSTILGRNFDSV 564

Query: 707 VVDSVECGQQCIEYLRKNNLGHARFILLDKLNKFSMEKISTPRNVPRLFDLIKVN-DEKF 765
           +V+++   Q+CI +L+K   G A FI LD + +  +  +S P +   +  +  ++ D ++
Sbjct: 565 IVENLTVAQECIAFLKKQRAGTASFIPLDTI-ETDLPTLSLPDSQDYILSINAIDYDSEY 623

Query: 766 LPAFYSVLRNTLVANDLKEANAVAYGKT-RYRVVTLKGNLIDISGTMSGG-----GNQAS 819
             A   V  ++++ N L  A  + + K+ R ++VT++G LI  +G M+GG      N+  
Sbjct: 624 EKAMQYVCGDSIICNTLNIAKDLKWKKSVRAKLVTIEGALIHKAGLMTGGISGDANNRWD 683

Query: 820 KGAMQLXXXXXXXXXXXXXXXVMEIEKELSIREKNYQNAY--NTVQEMEIELRNLKESEP 877
           K   Q                +M ++ +L I+     N+   N+++  E           
Sbjct: 684 KEEYQ---------------GLMSLKDKLLIQIDELSNSQRSNSIRARE----------- 717

Query: 878 KIELEISKLNFEIDSLENECSLKRKQLNEPNASFS-----IEDNMSADITEMDNALYTLN 932
            +E  +S LN +I SL  + + +++ L+E N         IE  +   ITE++  L  L 
Sbjct: 718 -VENSVSLLNSDIASLRTQVTQQKRSLDENNLEIKYHNDLIEKEIQPKITELEEKLKNLE 776

Query: 933 EKQKLIESQMKS-KKDRIKELQDKI 956
             +  +E + ++ + D  K+  DKI
Sbjct: 777 NTRNDLEKEKEALQNDIFKKFTDKI 801

 Score =  138 bits (348), Expect = 4e-32,   Method: Compositional matrix adjust.
 Identities = 66/161 (40%), Positives = 105/161 (65%), Gaps = 10/161 (6%)

Query: 1234 LKKCRFNEFMESFNIISMTLKEMYQIIT---------MGGNAELELVDSLDPFSEGVTFS 1284
            +K+ R   F ++F+ +S  L  +Y+ +T          GGNA L + D  +PF+ G+ + 
Sbjct: 1061 IKRKRKELFEKTFDYVSDHLDAIYRELTKNPNSNVELAGGNASLTIEDEDEPFNAGIKYH 1120

Query: 1285 VMPPKKSWRNISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYI 1344
              PP K ++++  LSGGEKT+++LAL+FA++ Y+P+P +V+DE+DAALD  NV  +A YI
Sbjct: 1121 ATPPLKRFKDMEYLSGGEKTVAALALLFAINSYQPSPFFVLDEVDAALDITNVQRIAAYI 1180

Query: 1345 -KERTKNAQFIVISLRNNMFELAEQLVGIYKNVNQTKSATL 1384
             + R  + QFIVISL+N MFE ++ LVG+Y+   +  S T+
Sbjct: 1181 RRHRNPDLQFIVISLKNTMFEKSDALVGVYRQQQENSSKTI 1221

>ZYRO0F03828g Chr6 (318190..321843) [3654 bp, 1217 aa] {ON} similar
           to uniprot|P32908 Saccharomyces cerevisiae YFL008W SMC1
           Subunit of the multiprotein cohesin complex essential
           protein involved in chromosome segregation and in
           double-strand DNA break repair SMC chromosomal ATPase
           family member binds DNA with a preference for DNA with
           secondary structure
          Length = 1217

 Score =  139 bits (349), Expect = 3e-32,   Method: Compositional matrix adjust.
 Identities = 200/804 (24%), Positives = 349/804 (43%), Gaps = 124/804 (15%)

Query: 149 LVLHNFKSYAGTQTIGPFHSSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQGKLADLI 208
           L L+NFKSY GT  +G   S+F +++GPNGSGKSN++D++ FV G +++ +R   L DLI
Sbjct: 7   LELYNFKSYRGTVRVGFGDSNFISIIGPNGSGKSNMMDAISFVLGVKSSHLRSQILKDLI 66

Query: 209 HKS----EEYPDLTSCAVDVHFEYLIDYPDDTTKINPSKQPLIITRRAFKNSTSKYYLNG 264
           ++     E+  D       V   YL            S   + ++R   +N  ++Y +NG
Sbjct: 67  YRGVEGEEDEEDGEGRTAYVKAFYL-----------KSDSTVELSRSISRNGDTQYKMNG 115

Query: 265 KESNYKTITALLKEEGIDLDHNRFLILQGEVENIAQMKPKAEKEGDDGLLEYLEDIIGTT 324
           K   YK     L+EE I +    FL+ QG+V  IA             L +  E+I G+ 
Sbjct: 116 KNCGYKQYAEFLEEENILIKAQNFLVFQGDVVQIASQSAT-------DLTKLFEEISGSI 168

Query: 325 KYKELIDKKFIEIEALNDICIERENRFDIIDRXXXXXXXXXXXXXXXXXXXXXQVIVKSK 384
           +YK+  D    ++++LN    E      I +R                       + K K
Sbjct: 169 QYKKEYDSLKGKVDSLNQSAAE-----SIKNRRRIHGELKSYREGIDKNQEFYHQVEKRK 223

Query: 385 LIQ--YKIWQNNIKLSNTLEKITKLEDEYNQEKNKNTELKNKIDELRKLYTKNQDELQ-- 440
            +Q  Y +WQ           +  LE + ++ ++K   LKN I  +R   T  +  LQ  
Sbjct: 224 ELQRHYALWQ-----------LYHLETQRHELEDKLANLKNSIKTIRGKETSQEQILQRS 272

Query: 441 --ALLKDEKELVNAKRSLDSDNVSN---TEQLKNIEKKLKKTAKEIEEDLKTISSSNVRL 495
             +  ++   ++  +  ++S +       +QL  I+   +  AK I    K ISS    +
Sbjct: 273 RASFARESASILKQRSKMESKSREKEKINQQLLPIKLSQRSAAKRIANVQKRISSLQRDI 332

Query: 496 KNFHDNKKLFETQLIELDNNLVTESQLLENIKLDLKDKTVGLSEEILKTEKDLEPWNIKL 555
               +  + FE QL     N+VT+++                 +EI ++ KD + + +  
Sbjct: 333 DRQREYVERFENQL-----NVVTKAK-------------SDFEKEIKESSKDHDKYKLNE 374

Query: 556 DELKSEIQIK-----------ESEKALFEESKNKLKANIEALEK--DVNEKSKLTEDRRK 602
           D+ K    +            ES+K L    K +L   +E L+K  D++ +S++T+    
Sbjct: 375 DDTKLYASLNEKYLNQGGFSLESQKQLTLNDKQELMDEMETLKKRNDIS-RSRVTD---- 429

Query: 603 EVKNLMTKLENVSKEVIFGTNELKKAN-EKLCEMQKILIQDRQKANDA-------RTSLS 654
           E+  +  KLE+   E+    NE    + +K+ E+QK+  Q    +N         R  L 
Sbjct: 430 ELSVIAEKLESQLSEISSTLNERNSTHSDKVKELQKLHSQIESSSNKEYDLNYKLREVLV 489

Query: 655 NVENRSKVLRALLKLQK--------SGRINGFHGRLGNLGVI-DEKYDVAISTACPR-LN 704
            +E  S   R  +K +K             G  G + +L     +KY +AIST   +  +
Sbjct: 490 KIEELSASQRETVKERKLRENIATLKRFFPGVRGLVCDLCQPKKDKYALAISTILGKNFD 549

Query: 705 DIVVDSVECGQQCIEYLRKNNLGHARFILLDKLN-KFSMEKISTPRNVPRLFDLIKVNDE 763
            ++VD+V   Q+CI YL+K   G A FI LD ++ +     +S  +      + I    E
Sbjct: 550 SVIVDNVMVAQECIAYLKKQRAGIASFIPLDTIDVEIPTLTLSDSQGCTLAINAIDYEQE 609

Query: 764 KFLPAFYSVLRNTLVANDLKEANAVAYGK-TRYRVVTLKGNLIDISGTMSGGGNQASKGA 822
            +  A   V  ++++ +D+  A  + + K  R ++VTL+G LI  +G M+GG ++ +   
Sbjct: 610 -YERALQYVCSDSIICDDMNIAKDLKWNKGVRSKLVTLEGALIHKAGLMTGGISKNTSNR 668

Query: 823 MQLXXXXXXXXXXXXXXXVMEIEKELSIREKNYQNAYNTVQEMEIELRNLKESEPKIELE 882
                               E +  +++++K  Q     V+E  +E +N      ++E  
Sbjct: 669 WDKE----------------EYQSLMTLKDKLLQQ----VEEAALEGKNASLMARELEST 708

Query: 883 ISKLNFEIDSLENECSLKRKQLNE 906
           +S LN EI  L  + +L ++ L E
Sbjct: 709 LSLLNTEISELRTQLTLTQRTLKE 732

 Score =  127 bits (318), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 65/163 (39%), Positives = 102/163 (62%), Gaps = 12/163 (7%)

Query: 1234 LKKCRFNEFMESFNIISMTLKEMYQIIT---------MGGNAELELVDSLDPFSEGVTFS 1284
            +KK R   F  +F   S  +  +Y+ +T          GG+A L L D  +PF+ G+ + 
Sbjct: 1048 IKKKRKALFERAFEYASEHIDPIYRELTKNPGSTNELAGGSASLTLEDEDEPFNAGIRYH 1107

Query: 1285 VMPPKKSWRNISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYI 1344
              PP K ++++  LSGGEKT+++LAL+F ++ ++P+P +V+DE+DAALD  NV  +A YI
Sbjct: 1108 ATPPFKRFKDMEYLSGGEKTVAALALLFTINSFQPSPFFVLDEVDAALDSTNVDRIAAYI 1167

Query: 1345 -KERTKNAQFIVISLRNNMFELAEQLVGIYKNV--NQTKSATL 1384
             +   ++ QFIVISL+N MFE ++ LVG+Y+    N +K  TL
Sbjct: 1168 SRHGNRDLQFIVISLKNTMFEKSDALVGVYRQQQENSSKIVTL 1210

>TPHA0P00340 Chr16 (65711..69370) [3660 bp, 1219 aa] {ON} Anc_8.68
           YFL008W
          Length = 1219

 Score =  138 bits (347), Expect = 5e-32,   Method: Compositional matrix adjust.
 Identities = 187/714 (26%), Positives = 328/714 (45%), Gaps = 81/714 (11%)

Query: 149 LVLHNFKSYAGTQTIGPFHSSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQGKLADLI 208
           L L NFKSY G   +G   S+F++++GPNGSGKSN++D++ FV GF+++ +R   L DL+
Sbjct: 7   LELFNFKSYKGVTKVGFGESNFTSIIGPNGSGKSNMMDAISFVLGFQSSNLRSSTLKDLV 66

Query: 209 HKSEEYPDLTSCAVDVHFEYLID--YPDDTTKINPSKQPLIITRRAFKNSTSKYYLNGKE 266
           ++     D      D      +   Y  D T +        + R       S Y ++ K 
Sbjct: 67  YRDIASADENEFGEDGERSAYVKAFYEKDGTVVE-------LMRAITAGRDSVYKIDNKT 119

Query: 267 SNYKTITALLKEEGIDLDHNRFLILQGEVENIAQMKPKAEKEGDDGLLEYLEDIIGTTKY 326
           + YK  +  L  E I +    FL+ QG+VE IA   P+        L +  E++ G+ KY
Sbjct: 120 TTYKHYSDFLAAENILIKARNFLVFQGDVEQIAAQSPRQ-------LTKLFEEVSGSIKY 172

Query: 327 KELIDKKFIEIEALNDICIER-ENRFDIIDRXXXXXXXXXXXXXXXXXXXXXQVIVKSKL 385
           K+  ++   +IE L++   E  +NR     R                     Q+ V+ KL
Sbjct: 173 KKEYEELKEKIEKLSESAAESAKNR-----RRIQGEMKIYEDGISKDEKYKKQLEVRDKL 227

Query: 386 -IQYKIWQ----------NNIKLSNTLEKITKLEDEYNQEKNKNTELKNKIDELRKLYTK 434
            +   +WQ          +  KL     K+ KL D+ N+E+    + KN++ +   L  K
Sbjct: 228 QVHLALWQLFHLEQEEKLSTKKLKEVKNKVMKLTDQVNEEETNVKKAKNEVIKETSLQMK 287

Query: 435 NQDELQALLKDEKELVNAKRSLDSDNVSNTEQLKNIEKKLKKTAKEIEEDLKTISSSNVR 494
            Q+ L    K++  L++    +     S  ++L NIEK+++  A+++E     +S    +
Sbjct: 288 QQNRLDYKEKEKDNLLSELTPIQLSQRSAEKRLANIEKRIESIARDMERQKTYVSRYEKQ 347

Query: 495 LKNFHDNKKLFETQLIELDNNLVTESQLLENIKLDLKDKTVGLSEEILKTEKDLEPWNIK 554
           LK     K  FE +L + ++N   +   L +  + L ++   L+E+ L TE   E  + K
Sbjct: 348 LKVVKKTKDTFEEELKQSNSN--PDKYRLNDEDMKLYER---LNEQYL-TEGGFE-LDTK 400

Query: 555 LDELKSEIQIKESEKALFEE----SKNKLK-------ANIE----ALEKDVNEKSKLTED 599
           L  L +E +  + E  L ++    SKN++         N E     L  ++NEK+ L   
Sbjct: 401 LSLLNNEKKDIDDELELLQKRIDMSKNRITDEFAVKGENFELQAVELSSELNEKNSLH-- 458

Query: 600 RRKEVKNLMTKLENVSKEVIFGTNELKKANEKLCEMQKILIQDRQKANDARTSLSNVENR 659
                 NL  KL+ +  ++   +N+  + N KL   +  L++    + + R +L     +
Sbjct: 459 -----LNLANKLKKIQSDIESTSNKEYELNHKL---RDTLVKLDDASANQRETL-----K 505

Query: 660 SKVLRALLKLQKSGRINGFHGRLGNL-GVIDEKYDVAISTACPR-LNDIVVDSVECGQQC 717
            K LR  + + K     G  G + +L     EKY +A+ST   +  + +VVD++   Q+C
Sbjct: 506 EKKLRENVSMLKRF-FPGVKGLVSDLCHPKKEKYALAVSTILGKNFDSVVVDTLSVAQEC 564

Query: 718 IEYLRKNNLGHARFILLDKLNKFSMEKISTP-RNVPRLFDLIKVNDEKFLPAFYSVLRNT 776
           I YL+K   G   FI LD ++ F     +T  + +  + + I   D+++  A   V  ++
Sbjct: 565 ITYLKKQRAGIISFIPLDTIDAFVPTLPTTNIQGITLVLNAIDY-DQEYDKAMQYVCSDS 623

Query: 777 LVANDLKEANAVAY-GKTRYRVVTLKGNLIDISGTMSGG-----GNQASKGAMQ 824
           ++ + L  A ++ +      ++VTL+G LI  +G M+GG     GN+  K   Q
Sbjct: 624 IMCDTLSIAKSLKWKHNVTSKLVTLEGTLIHRAGLMTGGVSKEQGNRWDKEEYQ 677

 Score =  136 bits (343), Expect = 1e-31,   Method: Compositional matrix adjust.
 Identities = 64/158 (40%), Positives = 106/158 (67%), Gaps = 10/158 (6%)

Query: 1234 LKKCRFNEFMESFNIISMTLKEMYQIIT---------MGGNAELELVDSLDPFSEGVTFS 1284
            +KK R   F ++F+ +S  ++ +Y+ +T          GGNA L L D  +PF  G+ + 
Sbjct: 1050 IKKKRREVFEKAFDYVSEHIEPIYRELTKNPNSTAELSGGNASLTLEDEDEPFDAGIKYH 1109

Query: 1285 VMPPKKSWRNISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYI 1344
              PP K ++++  LSGGEKT+++LAL+FA++ Y+P+P +++DE+DAALD  N+  +ANYI
Sbjct: 1110 ATPPLKRFKDMEYLSGGEKTVAALALLFAINSYQPSPFFILDEVDAALDVTNIERIANYI 1169

Query: 1345 KERT-KNAQFIVISLRNNMFELAEQLVGIYKNVNQTKS 1381
            ++ +  + QFIVISL+N+MFE ++ LVGI++   +  S
Sbjct: 1170 RKHSNSDIQFIVISLKNSMFEKSDALVGIHRQQQENSS 1207

>KLTH0A02706g Chr1 complement(234723..238409) [3687 bp, 1228 aa] {ON}
            similar to uniprot|P32908 Saccharomyces cerevisiae
            YFL008W SMC1 Subunit of the multiprotein cohesin complex
            essential protein involved in chromosome segregation and
            in double-strand DNA break repair SMC chromosomal ATPase
            family member binds DNA with a preference for DNA with
            secondary structure
          Length = 1228

 Score =  138 bits (347), Expect = 5e-32,   Method: Compositional matrix adjust.
 Identities = 65/170 (38%), Positives = 111/170 (65%), Gaps = 12/170 (7%)

Query: 1227 VRKELEDLKKCRFNEFMESFNIISMTLKEMYQIIT---------MGGNAELELVDSLDPF 1277
            V ++   +++ R + F  +F+ +S  + ++Y+ +T          GGNA L L D  +P+
Sbjct: 1052 VNEQFAKIRRLRKDAFESAFDHVSNAIDDVYRELTRDPHSTAELAGGNASLTLEDEDEPY 1111

Query: 1278 SEGVTFSVMPPKKSWRNISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNV 1337
              G+ +   PP K ++++  LSGGEKT+++LAL+FA++ ++P+P +V+DE+DAALD  NV
Sbjct: 1112 LAGIRYHATPPTKRFKDMEFLSGGEKTIAALALLFAINSFQPSPFFVLDEVDAALDILNV 1171

Query: 1338 SIVANYIKERT-KNAQFIVISLRNNMFELAEQLVGIYKNV--NQTKSATL 1384
              +A YI++R   N QFIVISL+N MFE ++ LVG+++    N +++ TL
Sbjct: 1172 ERIATYIRQRALSNLQFIVISLKNTMFEKSQALVGVFRQQRDNTSRALTL 1221

 Score =  102 bits (253), Expect = 7e-21,   Method: Compositional matrix adjust.
 Identities = 65/197 (32%), Positives = 102/197 (51%), Gaps = 20/197 (10%)

Query: 151 LHNFKSYAGTQTIGPFHSSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQGKLADLIHK 210
           L+NFKSY G  +IG   S+F++V+GPNGSGKSN++D++ FV G ++  +R   LADLI++
Sbjct: 9   LYNFKSYKGKVSIGFGESNFTSVIGPNGSGKSNLMDAISFVLGMKSIHLRSHTLADLIYR 68

Query: 211 SEEYPDLTSCAVDVHFEYLIDYPDDTTKI------NPSKQP---LIITRRAFKNSTSKYY 261
                 L     D  +    D  ++ +        +PS Q      +TR    +  S Y 
Sbjct: 69  G----TLQDGDADSGYSETHDNENNPSSAYVKAFYSPSGQENDVAELTRTITLSQESTYK 124

Query: 262 LNGKESNYKTITALLKEEGIDLDHNRFLILQGEVENIAQMKPKAEKEGDDGLLEYLEDII 321
           LNG+  ++K     L+ E I +    FL+ QG+VE +A  KP+        L    E + 
Sbjct: 125 LNGETVSHKKYCDFLESENILIKARNFLVFQGDVEQVASQKPRE-------LTTLFEQVS 177

Query: 322 GTTKYKELIDKKFIEIE 338
           G+ +YK+  D+   E+E
Sbjct: 178 GSIQYKQEYDRLREELE 194

 Score = 58.9 bits (141), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 40/134 (29%), Positives = 69/134 (51%), Gaps = 6/134 (4%)

Query: 690 EKYDVAISTACPRLND-IVVDSVECGQQCIEYLRKNNLGHARFILLDKL--NKFSMEKIS 746
           EKY VA+ST   +  D ++VD     QQC+ +L+K   G   FI LD +  NK SM  + 
Sbjct: 546 EKYTVAVSTILGKSFDAVIVDHFSVAQQCVSFLKKQRSGILSFIPLDTIDVNKVSMMALD 605

Query: 747 TPRNVPRLFDLIKVNDEKFLPAFYSVLRNTLVANDLKEANAVAYGK-TRYRVVTLKGNLI 805
           T +      D I   +     A   V  ++++ + L  A  + + +  R ++V+L G+++
Sbjct: 606 T-KGCTLAIDAIDY-ERDLERAMQYVCSDSIICDSLAIAKDLKWRRNVRAKLVSLDGSIV 663

Query: 806 DISGTMSGGGNQAS 819
             +G M+GG  ++S
Sbjct: 664 HKAGLMTGGTTKSS 677

>SAKL0B02288g Chr2 (215750..219436) [3687 bp, 1228 aa] {ON} similar to
            uniprot|P32908 Saccharomyces cerevisiae YFL008W SMC1
            Subunit of the multiprotein cohesin complex essential
            protein involved in chromosome segregation and in
            double-strand DNA break repair SMC chromosomal ATPase
            family member binds DNA with a preference for DNA with
            secondary structure
          Length = 1228

 Score =  137 bits (344), Expect = 1e-31,   Method: Compositional matrix adjust.
 Identities = 69/188 (36%), Positives = 122/188 (64%), Gaps = 15/188 (7%)

Query: 1212 QRKYDL----NQSVEQRDK-VRKELEDLKKCRFNEFMESFNIISMTLKEMYQIIT----- 1261
            Q +YD+     +S++ ++K +R++   +K+ R   F +++N +S  + ++Y+ +T     
Sbjct: 1032 QMRYDVINGETESLKAKEKKIREQYLKVKQSRREMFEKAYNHVSDHIDQIYRELTKDPHS 1091

Query: 1262 ----MGGNAELELVDSLDPFSEGVTFSVMPPKKSWRNISNLSGGEKTLSSLALVFALHKY 1317
                 GG+A L L D  +P+  G+ +   PP K ++++ +LSGGEKT+++LAL+FA++ Y
Sbjct: 1092 TAALAGGSASLTLEDEDEPYLAGIKYHATPPMKRFKDMEHLSGGEKTVAALALLFAINSY 1151

Query: 1318 KPTPLYVMDEIDAALDFRNVSIVANYIKER-TKNAQFIVISLRNNMFELAEQLVGIYKNV 1376
            +P+P +V+DE+DAALD  NV  +A YIK   + N QFIVISL+N+MFE ++ LVG+++  
Sbjct: 1152 QPSPFFVLDEVDAALDNTNVEKIATYIKRHASPNFQFIVISLKNSMFEKSQALVGVFRQQ 1211

Query: 1377 NQTKSATL 1384
             +  S  +
Sbjct: 1212 QENTSKVI 1219

 Score = 98.2 bits (243), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 65/199 (32%), Positives = 100/199 (50%), Gaps = 19/199 (9%)

Query: 149 LVLHNFKSYAGTQTIGPFHSSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQGKLADLI 208
           L L NFKSY GT  +G   ++F++++GPNGSGKSN++D++ FV G R++ +R   L DL+
Sbjct: 7   LELSNFKSYKGTVKVGFGDANFTSIIGPNGSGKSNMMDAISFVLGVRSSHLRSHLLMDLV 66

Query: 209 HKSEEYPDLTSCAVDVHFEYLID-----YPDDTTKINPSKQPLIITRRAFKNSTSKYYLN 263
           ++     D      +      I      Y          + P+   R   ++  S Y +N
Sbjct: 67  YRGRRTGDEEESMEEEPSSSKISSTRSAYVKAFYLKEGEESPIEFMRTISRSGESAYKVN 126

Query: 264 GKESNYKTITALLKEEGIDLDHNRFLILQGEVENIAQMKPKAEKEGDDGLLEYLEDIIGT 323
           GK   YK  T +L++E I +    FL+ QG+VE IA     ++  G+  L +  E I G+
Sbjct: 127 GKTVGYKDYTDILEKENILIKARNFLVFQGDVEQIA-----SQSAGE--LTKLFEQISGS 179

Query: 324 TKYKELIDKKFIEIEALND 342
            +YK        E E LND
Sbjct: 180 VQYKR-------EYEILND 191

 Score = 62.8 bits (151), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 38/131 (29%), Positives = 69/131 (52%), Gaps = 4/131 (3%)

Query: 690 EKYDVAISTACPR-LNDIVVDSVECGQQCIEYLRKNNLGHARFILLDKLNKFSME-KIST 747
           +KY VA+ST   +  + ++VD+    Q+CI YL++   G A FI LD ++  +    +S 
Sbjct: 546 DKYAVAVSTVLGKNFDSVIVDNFSVAQECISYLKRQRSGVASFIPLDTIDAITANLPVSN 605

Query: 748 PRNVPRLFDLIKVNDEKFLPAFYSVLRNTLVANDLKEANAVAYGK-TRYRVVTLKGNLID 806
            +      D I   D +   A   V  ++++ + L  A  + + +  R ++VTL+G LI 
Sbjct: 606 TKGCILAIDSISY-DSELEKAMQYVCSDSIICDSLDLAKDLKWNRGIRSKLVTLEGALIH 664

Query: 807 ISGTMSGGGNQ 817
            +G M+GG ++
Sbjct: 665 KAGLMTGGASR 675

>YFL008W Chr6 (119429..123106) [3678 bp, 1225 aa] {ON}  SMC1Subunit of
            the multiprotein cohesin complex, essential protein
            involved in chromosome segregation and in double-strand
            DNA break repair; SMC chromosomal ATPase family member,
            binds DNA with a preference for DNA with secondary
            structure
          Length = 1225

 Score =  136 bits (343), Expect = 1e-31,   Method: Compositional matrix adjust.
 Identities = 66/158 (41%), Positives = 103/158 (65%), Gaps = 10/158 (6%)

Query: 1234 LKKCRFNEFMESFNIISMTLKEMYQIIT---------MGGNAELELVDSLDPFSEGVTFS 1284
            +KK R   F ++F+ +S  L  +Y+ +T          GGNA L + D  +PF+ G+ + 
Sbjct: 1056 IKKKRKELFEKTFDYVSDHLDAIYRELTKNPNSNVELAGGNASLTIEDEDEPFNAGIKYH 1115

Query: 1285 VMPPKKSWRNISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYI 1344
              PP K ++++  LSGGEKT+++LAL+FA++ Y+P+P +V+DE+DAALD  NV  +A YI
Sbjct: 1116 ATPPLKRFKDMEYLSGGEKTVAALALLFAINSYQPSPFFVLDEVDAALDITNVQRIAAYI 1175

Query: 1345 -KERTKNAQFIVISLRNNMFELAEQLVGIYKNVNQTKS 1381
             + R  + QFIVISL+N MFE ++ LVG+Y+   +  S
Sbjct: 1176 RRHRNPDLQFIVISLKNTMFEKSDALVGVYRQQQENSS 1213

 Score =  100 bits (248), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 54/162 (33%), Positives = 89/162 (54%), Gaps = 13/162 (8%)

Query: 149 LVLHNFKSYAGTQTIGPFHSSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQGKLADLI 208
           L L NFKSY G   +G   S+F++++GPNGSGKSN++D++ FV G R+N +R   L DLI
Sbjct: 7   LELSNFKSYRGVTKVGFGESNFTSIIGPNGSGKSNMMDAISFVLGVRSNHLRSNILKDLI 66

Query: 209 HK-------SEEYPDLTSCAVDVHFEYLIDYPDDTTKINPSKQPLIITRRAFKNSTSKYY 261
           ++       S++Y +  + + +    Y+  +     K+      + + R   +N  + Y 
Sbjct: 67  YRGVLNDENSDDYDNEGAASSNPQSAYVKAFYQKGNKL------VELMRIISRNGDTSYK 120

Query: 262 LNGKESNYKTITALLKEEGIDLDHNRFLILQGEVENIAQMKP 303
           ++GK  +YK  +  L+ E I +    FL+ QG+VE IA   P
Sbjct: 121 IDGKTVSYKDYSIFLENENILIKAKNFLVFQGDVEQIAAQSP 162

>NCAS0C04000 Chr3 (807106..810777) [3672 bp, 1223 aa] {ON} Anc_8.68
            YFL008W
          Length = 1223

 Score =  136 bits (342), Expect = 2e-31,   Method: Compositional matrix adjust.
 Identities = 69/163 (42%), Positives = 105/163 (64%), Gaps = 12/163 (7%)

Query: 1234 LKKCRFNEFMESFNIISMTLKEMYQIITM---------GGNAELELVDSLDPFSEGVTFS 1284
            +KK R   F  +F+ ++  L  +Y+ +T          GGNA L L D  +PF+ G+ + 
Sbjct: 1054 IKKRRRELFENAFDFVNEHLDPIYRELTRNPNSSALLSGGNASLTLEDEDEPFNAGIKYH 1113

Query: 1285 VMPPKKSWRNISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYI 1344
             MPP K ++++  LSGGEKT+++LAL+FA++ Y+P+P +V+DE+DAALD  NV  +A YI
Sbjct: 1114 AMPPLKRFKDMEYLSGGEKTVAALALLFAINAYQPSPFFVLDEVDAALDITNVERIAAYI 1173

Query: 1345 KER-TKNAQFIVISLRNNMFELAEQLVGIYKNV--NQTKSATL 1384
            +     + QFIVISL+N MFE ++ LVG+Y+    N +K  TL
Sbjct: 1174 RRHGNPDLQFIVISLKNTMFEKSDALVGVYRQQQENSSKIVTL 1216

 Score =  133 bits (334), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 179/715 (25%), Positives = 320/715 (44%), Gaps = 86/715 (12%)

Query: 146 LNKLVLHNFKSYAGTQTIGPFHSSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQGKLA 205
           L  L L NFKSY G   IG   S+F++++GPNGSGKSN++D++ FV G R++ +R   L 
Sbjct: 4   LTGLELSNFKSYRGVTKIGFGDSNFTSIIGPNGSGKSNMMDAISFVLGVRSSHLRSNILK 63

Query: 206 DLIHK------SEEYPD------LTSCAVDVHFEYLIDYPDDTTKINPSKQPLIITRRAF 253
           DLI++      SEE P+       TS  V   +E                + + + R   
Sbjct: 64  DLIYRGVIRDFSEEDPEDGEEQHPTSAYVKAFYEM-------------DGKVVELMRTIN 110

Query: 254 KNSTSKYYLNGKESNYKTITALLKEEGIDLDHNRFLILQGEVENIAQMKPKAEKEGDDGL 313
            N  + Y ++ K  +YK   A L++E I +    FL+ QG+VE IA             L
Sbjct: 111 INGDTTYKIDNKTVSYKQYAAFLEKENILIKAKNFLVFQGDVEQIASQSAL-------DL 163

Query: 314 LEYLEDIIGTTKYKELIDKKFIEIEALNDICIERENRFDIIDRXXXXXXXXXXXXXXXXX 373
            +  E+I G+ +YK+  D    E+E L     E      I +R                 
Sbjct: 164 SKLFEEISGSIQYKKEYDSLKDELEKLGKSTTE-----SIRNRRRIHGELKTYKEGISKD 218

Query: 374 XXXXQVIVKSKLIQ--YKIW----------QNNIKLSNTLEKITKLEDEYNQEKNKNTEL 421
                 + K K  +  + +W          Q   KL     +++KL+++ N E+   T  
Sbjct: 219 EEYKNNVEKKKKYEMYFTLWKLFHLDAQRIQFKDKLKQAKTEMSKLKEKINNEEKHLTRS 278

Query: 422 KNKIDELRKLYTKNQDELQALLKDEKELVNAKRSLDSDNVSNTEQLKNIEKKLKKTAKEI 481
           K+   +   + TK + +L   +K+++++++   S+     ++++++ NIEK+++   ++I
Sbjct: 279 KSAFLKENSILTKKRSQLDYTVKEKEKVISQCNSIKIPLRASSKRIMNIEKRIESFKRDI 338

Query: 482 EEDLKTISSSNVRLKNFHDNKKLFETQLIELDNNLVTESQLLENIKLDLKDKTV----GL 537
           E     +S+   +LK     K+LFE ++ +   N         + K  L D  +     L
Sbjct: 339 ERQKDYVSTFENQLKVVTKAKELFEVEIKKSARN---------HDKFRLTDTDLKWYEQL 389

Query: 538 SEEILKTEKDLEPWNIKLDELKSEIQIKESEKALFEE----SKNKLKANI----EALEKD 589
           +E+ L T   L    I L  L ++ Q K  E  L       SKN++   +    E L+  
Sbjct: 390 NEKYLSTGGSLLEQKISL--LNNDKQEKTDEMELLNRHIDVSKNRVTEELNITGENLQNQ 447

Query: 590 VNEKSKLTEDRRKEVKNLMTKLENVSKEVIFGTNELKKANEKLCEMQKILIQDRQKANDA 649
           V + +    ++       M KL++   +V    N+    N KL E    L++    + + 
Sbjct: 448 VTDMTSTLNEKNATYAEQMKKLKDYQMQVESSNNQEYDLNYKLRET---LVKLDDLSANQ 504

Query: 650 RTSLSNVENRSKVLRALLKLQKSGRINGFHGRLGNLGVI-DEKYDVAISTACPR-LNDIV 707
           R SL     + K LR  + + K     G  G + +L     EKY +A+S    +  + I+
Sbjct: 505 RESL-----KEKKLRENVTMLKRF-FPGVKGLVHDLCRPKKEKYGLAVSVMLGKNFDSII 558

Query: 708 VDSVECGQQCIEYLRKNNLGHARFILLDKLNKFSMEKISTPRNVPRLFDLIKVN-DEKFL 766
           V+++   ++CI +L+K   G A FI LD ++      +S P +   +  +  +  D  + 
Sbjct: 559 VENLSVARECISFLKKQRAGTASFIPLDTIDS-EQPTLSAPPSQEYILTINAIEYDLAYE 617

Query: 767 PAFYSVLRNTLVANDLKEANAVAYGK-TRYRVVTLKGNLIDISGTMSGGGNQASK 820
            A   V  ++++ + L  A  + + +  R ++V+L G+LI  +G M+GG ++ SK
Sbjct: 618 RAMQYVCGDSIICDTLDIARDLKWNRGVRSKLVSLDGSLIHKAGLMTGGISKDSK 672

>TDEL0C00960 Chr3 (153572..157240) [3669 bp, 1222 aa] {ON} Anc_8.68
            YFL008W
          Length = 1222

 Score =  135 bits (339), Expect = 5e-31,   Method: Compositional matrix adjust.
 Identities = 80/215 (37%), Positives = 129/215 (60%), Gaps = 21/215 (9%)

Query: 1191 EIAKVD--LDILE---EYTRRMIEYRQRKYDLNQSVEQ----RDKVRKELEDLKKCRFNE 1241
            E+ +VD  L++L+   + T R  E +Q+   +N   EQ      KV  +   +K+ R + 
Sbjct: 1001 ELKQVDEILNVLQPNAKATDRFNEAQQKFGSINDETEQLKKDEKKVLAQFIKIKRKRKSL 1060

Query: 1242 FMESFNIISMTLKEMYQIIT---------MGGNAELELVDSLDPFSEGVTFSVMPPKKSW 1292
            F E+F  ++  +  +Y+ +T          GG+A L L D  +PF+ G+ +   PP K +
Sbjct: 1061 FEEAFEYVTEHIDPIYRELTKNPNSTSELAGGSASLTLEDEDEPFNAGIRYHATPPLKRF 1120

Query: 1293 RNISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKER-TKNA 1351
            +++  LSGGEKT+++LAL+F ++ Y+P+P +V+DE+DAALD  NV  VA YI+     + 
Sbjct: 1121 KDMEYLSGGEKTVAALALLFTVNSYQPSPFFVLDEVDAALDTTNVERVATYIRRHGNPDL 1180

Query: 1352 QFIVISLRNNMFELAEQLVGIYKN--VNQTKSATL 1384
            QFIVISL+N MFE ++ LVG+Y+   +N +K  TL
Sbjct: 1181 QFIVISLKNTMFEKSDALVGVYRQQELNTSKIVTL 1215

 Score =  104 bits (259), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 64/190 (33%), Positives = 99/190 (52%), Gaps = 23/190 (12%)

Query: 149 LVLHNFKSYAGTQTIGPFHSSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQGKLADLI 208
           L LHNFKSY GT  +G   S+F++++GPNGSGKSN++D++ FV G R+  +R   L DLI
Sbjct: 7   LELHNFKSYKGTVKVGFGDSNFTSIIGPNGSGKSNMMDAISFVLGVRSRHLRSNVLKDLI 66

Query: 209 HK---SEEYPDLTSCAVD----VHFEYLIDYPDDTTKINPSKQPLIITRRAFKNSTSKYY 261
           ++   SEE  D  S  V+     + +      D T +         ++R   K   + Y 
Sbjct: 67  YRGVASEEEGDGESDVVNNPTTAYVKAFYSKGDSTIE---------LSRSISKGGDTTYR 117

Query: 262 LNGKESNYKTITALLKEEGIDLDHNRFLILQGEVENIAQMKPKAEKEGDDGLLEYLEDII 321
           +NGK  +YK   + L++E I +    FL+ QG+V  IA             L ++ E+  
Sbjct: 118 MNGKVVDYKRYASFLEDENILIRAKNFLVFQGDVVQIASQSAME-------LTQFFEEFS 170

Query: 322 GTTKYKELID 331
           G+ +YK+  D
Sbjct: 171 GSIQYKKEYD 180

>Kpol_1011.5 s1011 complement(13399..17064) [3666 bp, 1221 aa] {ON}
            complement(13399..17064) [3666 nt, 1222 aa]
          Length = 1221

 Score =  134 bits (336), Expect = 9e-31,   Method: Compositional matrix adjust.
 Identities = 69/160 (43%), Positives = 105/160 (65%), Gaps = 12/160 (7%)

Query: 1233 DLKKCRFNEFMESFNIISMTLKEMYQIIT---------MGGNAELELVDSLDPFSEGVTF 1283
            ++KK R   F ++F  ++  +  +Y+ +T          GGNA L L D  +P++ GV +
Sbjct: 1051 NIKKKRKELFEKAFEYVNEHIDPIYRELTKNPNSSVELAGGNASLTLEDEDEPYNGGVKY 1110

Query: 1284 SVMPPKKSWRNISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANY 1343
               PP K ++++  LSGGEKT+++LAL+FA++ Y+P+P +V+DEIDAALD  NV  +A Y
Sbjct: 1111 HATPPLKRFKDMEYLSGGEKTVAALALLFAINSYQPSPFFVLDEIDAALDITNVERIATY 1170

Query: 1344 IKERTKNA--QFIVISLRNNMFELAEQLVGIYKNVNQTKS 1381
            I +R  N   QFIVISL+N+MFE +E LVGIY++  +  S
Sbjct: 1171 I-QRHGNPELQFIVISLKNSMFEKSEALVGIYRHQKENSS 1209

 Score =  124 bits (310), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 185/733 (25%), Positives = 330/733 (45%), Gaps = 142/733 (19%)

Query: 149 LVLHNFKSYAGTQTIGPFHSSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQGKLADLI 208
           L L+NFKSY G   +G   S+F++++GPNGSGKSN++D++ FV G +++ +R   L DLI
Sbjct: 7   LELNNFKSYKGVVNVGFGESNFTSIIGPNGSGKSNMMDAISFVLGVQSSHLRSNVLKDLI 66

Query: 209 HKSEEYPDLTSCAVDVHFEYLIDYPDDTTKINPSK-------QPLIITR---RAFKNST- 257
           ++     D              D  ++   +NP+        Q   +T    R+  NS  
Sbjct: 67  YRGFLSGD--------------DEDNNNEDVNPNSAYVKAFYQKEDVTHELMRSISNSGD 112

Query: 258 SKYYLNGKESNYKTITALLKEEGIDLDHNRFLILQGEVENIAQMKPKAEKEGDDGLLEYL 317
           S Y +N K  +YK  T+ L++E I +    FL+ QG+VE IA        +    L +  
Sbjct: 113 STYKINNKTVSYKQYTSFLEDENILIKAKNFLVFQGDVEQIAS-------QSTTDLTKLF 165

Query: 318 EDIIGTTKYKELIDKKFIEIEALNDICIER-ENRFDIIDRXXXXXXXXXXXXXXXXXXXX 376
           E++ G+ +YK+  ++   ++E L+    E  +NR     R                    
Sbjct: 166 EEVSGSIQYKKEYEELKEKVEKLSQSTAESIKNR-----RRINNEIKVYKDGITKDEKYK 220

Query: 377 XQVIVKSKLIQY-KIWQNNIKLSNTLEKITKLEDEYNQEKNKNTELKNKIDELRKLYTKN 435
            Q+  +  L+ Y  +WQ           +  L+++ +Q KNK  E K+K+ +L++     
Sbjct: 221 AQLEKRRNLLVYSSLWQ-----------LYHLDEKKSQSKNKLKEAKSKVSKLKEKLANE 269

Query: 436 QDELQ----ALLKDEKELVNAK-----RSLDSDNVSN------------TEQLKNIEKKL 474
           +  LQ    +++KD   +   K     RS + + +++            T+++ NIE+++
Sbjct: 270 EKILQKAKNSIVKDTAAITKYKNKLEYRSKEKEKLASQLIPIKVSQRNTTKKISNIERRI 329

Query: 475 KKTAKEIEEDLKTISSSNVRLKNFHDNKKLFETQLIE----------LDNNLVTESQL-- 522
           +   ++IE     +     +LK    +K+ FE ++ E           D +LVT   L  
Sbjct: 330 EGIERDIERQKSYVERYESQLKVVTKSKESFELEIKESAKNFDKYRLSDEDLVTYDALSE 389

Query: 523 --LENIKLDLKDKTVGLSEEILKTEKDLEPWNIKLDELKSEIQIKESEKALFEESKNKLK 580
             L +   D+  K   L+ +  +T  ++  +  +++  KS+I    ++  + +    +L+
Sbjct: 390 KYLSSGGFDIDTKISLLNNDKQETSDEVAMFKNRIELAKSKI----ADDLVLQ--GERLE 443

Query: 581 ANIEALEKDVNEKSKLTEDRRKEVKNLMTKLENVS-KEVIFGTNELKKANEKLCEMQKIL 639
             I  L   +NEK+ L   +  E+K L  ++E+ S KE         K  E L ++  + 
Sbjct: 444 LEISELTSSLNEKNSLHSQKVSELKTLQGEIESTSNKEYDLNY----KLRETLVKLDDLS 499

Query: 640 IQDRQKANDARTSLSNVENRSKVLRALLKLQKSGRINGFHGRLGNLGVI-DEKYDVAIST 698
              R+  N+ +      EN S +LR L          G  G + +L     EKY +A+ST
Sbjct: 500 ASQRESTNERKLR----ENVS-MLRRLFP--------GVRGLVSDLCQPKKEKYALAVST 546

Query: 699 ACPR-LNDIVVDSVECGQQCIEYLRKNNLGHARFILLDKLNKFSMEKISTPRNVPRL-FD 756
              +  + I+ D++   Q+CI YL+K   G A FI L+          S    VP L F 
Sbjct: 547 ILGKNFDSIITDNISVAQECIAYLKKQRAGVASFIPLE----------SIESEVPTLPFS 596

Query: 757 -----LIKVNDEKFLPAFY---------SVLRNTL-VANDLKEANAVAYGKTRYRVVTLK 801
                ++ +N  ++ P +          S++ +TL +A DLK  + V     + ++VTL+
Sbjct: 597 DGQGCILTINAIEYEPEYERAMQYVCSDSIICDTLTIAKDLKWKHNV-----KSKLVTLE 651

Query: 802 GNLIDISGTMSGG 814
           G LI  +G M+GG
Sbjct: 652 GALIHKAGLMTGG 664

>KNAG0G00910 Chr7 (172759..176439) [3681 bp, 1226 aa] {ON} Anc_8.68
            YFL008W
          Length = 1226

 Score =  133 bits (335), Expect = 1e-30,   Method: Compositional matrix adjust.
 Identities = 66/157 (42%), Positives = 102/157 (64%), Gaps = 10/157 (6%)

Query: 1235 KKCRFNEFMESFNIISMTLKEMYQIIT---------MGGNAELELVDSLDPFSEGVTFSV 1285
            KK R   F  +F+ +S  +  +Y+ +T          GG+A L L D  +PF+ G+ +  
Sbjct: 1058 KKKRKELFDRAFDYVSTHIDGIYRELTKDPNSTAELAGGSASLTLEDEDEPFNAGIKYHA 1117

Query: 1286 MPPKKSWRNISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYI- 1344
             PP K ++++  LSGGEKT+++LAL+FA++ Y+P+P +V+DEIDAALD +NV  +A YI 
Sbjct: 1118 TPPLKRFKDMEYLSGGEKTVAALALLFAINSYQPSPFFVLDEIDAALDIKNVERIAAYIR 1177

Query: 1345 KERTKNAQFIVISLRNNMFELAEQLVGIYKNVNQTKS 1381
            K    + QFIVISL+N+MFE ++ LVG+Y+   +  S
Sbjct: 1178 KHGNPSLQFIVISLKNSMFEKSDALVGVYRRQQENSS 1214

 Score =  100 bits (248), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 59/187 (31%), Positives = 98/187 (52%), Gaps = 15/187 (8%)

Query: 149 LVLHNFKSYAGTQTIGPFHSSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQGKLADLI 208
           L L+NFKSY G   +G   S+F++++GPNGSGKSN++D++ FV G R++ +R   +ADLI
Sbjct: 7   LELYNFKSYRGVVKVGFGESNFTSIIGPNGSGKSNMMDAISFVLGVRSSYLRSSAVADLI 66

Query: 209 HKS----EEYPDLTSCAVDVHFEYLIDYPDDTTKINPSKQPLIITRRAFKNSTSKYYLNG 264
           ++     EE         D H  Y+  +        P +  + + R   KN  S Y ++ 
Sbjct: 67  YRGVVPEEEDDGEGEGDGDAHRAYVSAFYSK----GPQESTVELKRTISKNGDSTYQIDR 122

Query: 265 KESNYKTITALLKEEGIDLDHNRFLILQGEVENIAQMKPKAEKEGDDGLLEYLEDIIGTT 324
           ++  YK  +  L+ + I +    FL+ QG+VE +A   P         L +  E++ G+ 
Sbjct: 123 RQVTYKQYSEFLESQNILIKAKNFLVFQGDVEQVASQSPLQ-------LTKLFEEVSGSA 175

Query: 325 KYKELID 331
           +YK+  D
Sbjct: 176 QYKKEYD 182

 Score = 50.4 bits (119), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 60/244 (24%), Positives = 117/244 (47%), Gaps = 27/244 (11%)

Query: 578 KLKANIEALEKDVNEKSKLTEDRRKEVKNLMTKLENVSKEVIFGTNELKKANEKLCEMQK 637
           K++     L   +NEK+ L  +  KE+KNL +++E+  K+           N KL E   
Sbjct: 445 KIEMQATELSSSLNEKNALNAENLKELKNLQSEIESRGKQEY-------DLNYKLRET-- 495

Query: 638 ILIQDRQKANDARTSLSNVENRSKVLRALLKLQKSGRINGFHGRLGNL-GVIDEKYDVAI 696
            L++  + + + R ++   + R  V+ +L +L       G  G + +L     +KY V++
Sbjct: 496 -LVKIDELSANQRETVRERKLRENVV-SLKRL-----FPGVKGIVSDLCHPKKDKYSVSV 548

Query: 697 STACPR-LNDIVVDSVECGQQCIEYLRKNNLGHARFILLDKLNKFSMEKISTPRNVPRLF 755
           +T   +  + ++VDS+   Q+CI YL+K   G   FI LD ++      ++T  +V    
Sbjct: 549 ATVLGKNFDSVIVDSLSVAQECIAYLKKQRAGVISFIPLDTVDS----AVATLPSVNIQG 604

Query: 756 DLIKVN----DEKFLPAFYSVLRNTLVANDLKEANAVAYGKT-RYRVVTLKGNLIDISGT 810
            L+  N    + ++  A   V  + ++ + L  A  + +    + +++ L G+LI  +G 
Sbjct: 605 YLLAKNAMEYESQYERAINYVCGDAIICDTLDLAKKLKWDHGFKNKLIALDGSLIHRAGL 664

Query: 811 MSGG 814
           M+GG
Sbjct: 665 MTGG 668

>AGL023W Chr7 (670877..674545) [3669 bp, 1222 aa] {ON} Syntenic
            homolog of Saccharomyces cerevisiae YFL008W (SMC1)
          Length = 1222

 Score =  130 bits (328), Expect = 8e-30,   Method: Compositional matrix adjust.
 Identities = 59/161 (36%), Positives = 102/161 (63%), Gaps = 10/161 (6%)

Query: 1234 LKKCRFNEFMESFNIISMTLKEMYQIIT---------MGGNAELELVDSLDPFSEGVTFS 1284
            +K+ R N F+  FN +   +  +Y+ +T          GG+A L L D  +P+  G+ + 
Sbjct: 1051 IKEKRINTFLACFNHVRDNIDRIYRELTRNPGSTAELAGGSASLTLEDEDEPYLGGIRYH 1110

Query: 1285 VMPPKKSWRNISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYI 1344
              PP K ++++  LSGGEKT+++LAL+FA++ Y+P+P +++DE+DAALD  NV  +A YI
Sbjct: 1111 ATPPMKRFKDMDYLSGGEKTMAALALLFAINSYQPSPFFILDEVDAALDVTNVERIAAYI 1170

Query: 1345 KER-TKNAQFIVISLRNNMFELAEQLVGIYKNVNQTKSATL 1384
            +   +   QFIVISL++N+F  +E + G+++N ++  S  +
Sbjct: 1171 RRHASPKMQFIVISLKSNLFSKSESMAGVFRNQHENSSMVI 1211

 Score = 91.3 bits (225), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 57/181 (31%), Positives = 93/181 (51%), Gaps = 12/181 (6%)

Query: 149 LVLHNFKSYAGTQTIGPFHSSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQGKLADLI 208
           L + NFKSY G   +G    +F ++VGPNGSGKSN++D++ FV G R++ +R   L DLI
Sbjct: 7   LEVKNFKSYKGVHNVGFGGKNFISIVGPNGSGKSNMMDAISFVLGIRSSHLRSSALVDLI 66

Query: 209 HKSEEYPDLTSCAVDVHFEYLIDY--PDDTTKINPSKQPLIITRRAFKNSTSKYYLNGKE 266
           ++       ++   +    Y+  +    D +    +++ +  TR       S Y L+GK 
Sbjct: 67  YRGRMEEGGSAHENNPKSAYVTAFYVKQDAS---GAERRMEFTRVIHNTGDSTYKLDGKT 123

Query: 267 SNYKTITALLKEEGIDLDHNRFLILQGEVENIAQMKPKAEKEGDDGLLEYLEDIIGTTKY 326
             YK    +L+ E I +    FL+ QG+VE IA       + G D L +  E + G+ +Y
Sbjct: 124 VGYKEYVDVLEGERILVKARNFLVFQGDVEQIAS------QSGVD-LTKLFEQVSGSVQY 176

Query: 327 K 327
           +
Sbjct: 177 Q 177

 Score = 69.7 bits (169), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 96/366 (26%), Positives = 172/366 (46%), Gaps = 33/366 (9%)

Query: 462 SNTEQLKNIEKKLKKTAKEIEEDLKTISSSNVRLKNFHDNKKLFETQLIELDNNLVTESQ 521
             T ++ NIEK++    ++IE     +     +LK     K  FE    EL+ +   +  
Sbjct: 319 GTTRRMVNIEKRIDSLQRDIERQESYVKQLKNQLKVVGKTKASFEA---ELEKSASGKFT 375

Query: 522 LLENIKLDLKD-KTVGLSEEILKTEKDLEPWNIKLDELKSEIQIKESEKALFE-ESKNKL 579
           L E  K + ++ K V LS    + E+ L     K +EL  EI + E    + +  +++ L
Sbjct: 376 LSEEQKKEYEELKEVYLSSGGSEFEEKLAILQNKKEELSEEIAVFEKRIGISKTRAEHDL 435

Query: 580 KANIEALEKDV-------NEKSKLTEDRRKEVKNLMTKLENVSKEVIFGTNELKKANEKL 632
           K +IE LE +V       N+K+ +  ++ +E K + +++E+ + +    + +L++   KL
Sbjct: 436 KVDIERLEVEVSERTGNLNDKNAIHSEKVREWKQIQSEIESANNKEYELSYKLREVLAKL 495

Query: 633 CEMQKILIQDRQKANDARTSLSNVENRSKVLRALLKLQKSGRINGFHGRLGNLGVID-EK 691
            +    L  ++++ N  R    NV      LR L          G  G + +L     EK
Sbjct: 496 DD----LSANQRETNKERKLRENV----ATLRRLFP--------GVRGLVHDLCRPKKEK 539

Query: 692 YDVAISTACPR-LNDIVVDSVECGQQCIEYLRKNNLGHARFILLDKLNKFSMEKISTPRN 750
           Y V +ST   +  + ++VDS+   QQCI YL+K+  G A FI LD ++  S   +    N
Sbjct: 540 YAVGVSTILGKNFDSVIVDSLSVAQQCISYLKKHRSGVASFIPLDTIDT-SSPTLPAGDN 598

Query: 751 VPRLFDLIKVNDEKFL-PAFYSVLRNTLVANDLKEANAVAYGK-TRYRVVTLKGNLIDIS 808
              +  L  +  E  L  A   V  ++++ + L  A  + + +  + ++VTL+G LI  +
Sbjct: 599 TGCILTLDAIEYESSLEKAMQYVCSDSIICDSLDIARNLKWNRNVKSKLVTLEGALIHRA 658

Query: 809 GTMSGG 814
           G M+GG
Sbjct: 659 GLMTGG 664

>TBLA0G03530 Chr7 complement(941941..945639) [3699 bp, 1232 aa] {ON}
            Anc_8.68 YFL008W
          Length = 1232

 Score =  130 bits (327), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 65/162 (40%), Positives = 103/162 (63%), Gaps = 10/162 (6%)

Query: 1233 DLKKCRFNEFMESFNIISMTLKEMYQIITM---------GGNAELELVDSLDPFSEGVTF 1283
            ++KK R   F   F+ ++  ++ +Y+ +T          GG A L L D  +PF+ GV +
Sbjct: 1062 NIKKKRKELFESCFDFVNEHIEPIYKELTKDPNSTTELGGGQATLTLEDEDEPFNGGVKY 1121

Query: 1284 SVMPPKKSWRNISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANY 1343
               PP K ++++  LSGGEKT+++LAL+FA++ Y+P+P +V+DE+DAALD  NV  +A Y
Sbjct: 1122 HATPPLKRFKDMEYLSGGEKTVAALALLFAINSYQPSPFFVLDEVDAALDHTNVERIAAY 1181

Query: 1344 I-KERTKNAQFIVISLRNNMFELAEQLVGIYKNVNQTKSATL 1384
            I K   K+ QFI+ISL+N MFE ++ LVG+++   +  S  L
Sbjct: 1182 IRKHGNKDLQFIIISLKNTMFEKSDALVGVFRQQTENSSKAL 1223

 Score =  102 bits (253), Expect = 7e-21,   Method: Compositional matrix adjust.
 Identities = 62/188 (32%), Positives = 97/188 (51%), Gaps = 23/188 (12%)

Query: 149 LVLHNFKSYAGTQTIGPFHSSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQGKLADLI 208
           L L NFKSY GT  IG   S+F++++GPNGSGKSN++D++ FV G R+N +R   + DLI
Sbjct: 7   LELSNFKSYKGTVKIGFGDSNFTSIIGPNGSGKSNMMDAISFVLGVRSNDLRSSGMKDLI 66

Query: 209 HKS-----EEYPDLTSCAVDVHFEYLIDYPDDTTKINPSKQPLIITRRAFKNSTSKYYLN 263
           H+S         D TS  V   +           K+  + +   + R    +  + Y +N
Sbjct: 67  HRSVRDSQSSNDDPTSAYVKAFY-----------KVTDASEITELMRIVNLSGETIYKIN 115

Query: 264 GKESNYKTITALLKEEGIDLDHNRFLILQGEVENIAQMKPKAEKEGDDGLLEYLEDIIGT 323
           GK +++K  +  L +E I +    FL+ QG+VE IA        +    L +  E + G+
Sbjct: 116 GKTTSFKNYSDWLAKENILIKAKNFLVFQGDVETIAS-------QSSLELTKLFEQVSGS 168

Query: 324 TKYKELID 331
            +YK+  D
Sbjct: 169 IQYKKEYD 176

>CAGL0F02079g Chr6 (201002..204673) [3672 bp, 1223 aa] {ON} similar to
            uniprot|P32908 Saccharomyces cerevisiae YFL008w SMC1
            chromosome segregation protein
          Length = 1223

 Score =  126 bits (317), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 70/186 (37%), Positives = 111/186 (59%), Gaps = 26/186 (13%)

Query: 1225 DKVRKELEDLK---KCRFNEFME-----------SFNIISMTLKEMYQIITM-------- 1262
            D+V KE E LK   +  F+EF++           +F  I+  L  +Y  +T         
Sbjct: 1031 DEVDKETEGLKTEERKVFDEFLKVKQKRKELFENAFEKINEHLDAIYSELTRNVNSTSIL 1090

Query: 1263 -GGNAELELVDSLDPFSEGVTFSVMPPKKSWRNISNLSGGEKTLSSLALVFALHKYKPTP 1321
             GG+A + + D  +PF+ G+ +   PP K ++++  LSGGEKT+++LAL+FA++ Y P+P
Sbjct: 1091 GGGSASMTIEDEDEPFNAGIRYHATPPMKRFKDMEYLSGGEKTVAALALLFAINSYNPSP 1150

Query: 1322 LYVMDEIDAALDFRNVSIVANYIKER-TKNAQFIVISLRNNMFELAEQLVGIYKNV--NQ 1378
             +++DE+DAALD  NV  +A YI+     + QFIVISL+N MFE ++ LVG+++    N 
Sbjct: 1151 FFILDEVDAALDISNVQRIAAYIRRHGNPDLQFIVISLKNTMFEKSDALVGVFRQQQENS 1210

Query: 1379 TKSATL 1384
            +K  TL
Sbjct: 1211 SKIVTL 1216

 Score =  122 bits (307), Expect = 3e-27,   Method: Compositional matrix adjust.
 Identities = 192/729 (26%), Positives = 329/729 (45%), Gaps = 132/729 (18%)

Query: 149 LVLHNFKSYAGTQTIGPFHSSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQGKLADLI 208
           L L+NFKSY GT  +    S+F++++GPNGSGKSN++D++ FV G R++ +R   L DLI
Sbjct: 7   LELYNFKSYKGTVNVDFGDSNFTSIIGPNGSGKSNLMDAISFVLGIRSSSLRSSALKDLI 66

Query: 209 HKSEEYPDLTSCAVD--------VHFEYLIDYPDDTTKINPSKQPLIITRRAFKNSTSKY 260
           ++     + T    D         + +   +Y     ++       +I+R       + Y
Sbjct: 67  YRDIISRENTPTGADNDENGNRTAYVKAFYEYDGKVVEL-----MRLISRLG----DTSY 117

Query: 261 YLNGKESNYKTITALLKEEGIDLDHNRFLILQGEVENIAQMKPKAEKEGDDGLLEYLEDI 320
            L+G    YK  +  L+ + I +    FL+ QG+VE IA   P        GL + +E++
Sbjct: 118 KLDGNTVTYKEYSQFLESQNILIKAKNFLVFQGDVEQIASQSPL-------GLTKLIEEV 170

Query: 321 IGTTKYKELIDKKFIEIEALND----ICIERENRFDIIDRXXXXXXXXXXXXXXXXXXXX 376
            G+ +YK+       E E L D    IC  + +   I  R                    
Sbjct: 171 SGSMQYKK-------EYEELKDQYDKIC--QASTESIKKRRRIHAELKTYKEGMSRDEEY 221

Query: 377 XQVIVKSKLIQ--YKIWQNNIKLSNTLEKITKLEDEYNQEKNKNTELKNKIDELRKLYTK 434
            + + K K +Q    +WQ           +  +EDE  Q   K  E +N +D +R     
Sbjct: 222 RKYVQKKKRVQTNLSLWQ-----------LYHMEDERYQCLQKLEESQNDVDVIR----- 265

Query: 435 NQDELQALLKDEKELVNAKRSLDSDNVSNTEQLKNIEKKLKKTAKEIEEDLKTI----SS 490
                + L  +EK L   K++L  + V  T++ KN  + + K  ++ E DLK +    ++
Sbjct: 266 -----EKLEAEEKNLEVFKKALSKEAVLLTKK-KNHIRSISKEKEKAESDLKVVKIPQNA 319

Query: 491 SNVRLKNFHDNKKLFETQLIELDNNLVTESQLLENIKLDLK---DKTVGLSEEILKTEKD 547
           S  RLKN        + ++  L  +L  E   LE  K  LK   D      +EIL   K+
Sbjct: 320 SINRLKN-------LDKRVDSLQKDLEREEANLEKYKHQLKVVTDSKNAFEQEILSKSKN 372

Query: 548 -----LEPWNIKL-DELKSE------IQIKESEKALFEESKNKLKANIEALEKDVNEKSK 595
                L   ++KL DELK E      I+I+++   L +  K ++ A++    K +N+K +
Sbjct: 373 NNKFTLSEDDLKLYDELKGEYLNNGGIEIEDTLN-LLDNKKEEITADL----KIINDKVE 427

Query: 596 LTEDRRKEVKNLMTKLENVSKEVIFGTNELKKANE----KLCEMQKILIQDRQKANDA-- 649
           +++ R ++   L+TK E    ++   T  L + N+    KL E++K   +D +  N+   
Sbjct: 428 ISKQRIED--ELVTKKEEQDAKIRDSTLLLNEKNDLHSHKLDELRKTQ-KDIEYWNNKEF 484

Query: 650 ------RTSLSNVENRSKVLRALLKLQKSGRINGFHGRL--GNLGVIDE-------KYDV 694
                 R +L  +++ +   R   K +K         R   G  G++ E       KY +
Sbjct: 485 DLNHKLRDTLVKLDDLNATQRESNKERKLRENVAMLKRFFPGVRGLVHELCKPKRDKYKL 544

Query: 695 AISTACPR-LNDIVVDSVECGQQCIEYLRKNNLGHARFILLDKLNKFSMEKISTPR-NVP 752
           A+ST   +  + ++VDS+   Q+CI +L+K   G   FI LD ++       +TPR  VP
Sbjct: 545 AVSTVLGKNFDSVIVDSLSVAQECISFLKKQRAGVISFIPLDTIDA------ATPRMPVP 598

Query: 753 R------LFDLIKVNDEKFLPAFYSVLRNTLVANDLKEANAVAYGK-TRYRVVTLKGNLI 805
                    + ++  D+  + A Y V  +T++ ++L  A  + + K    ++VTL G LI
Sbjct: 599 ESETYTLAINTVEYKDD-LVRAMYYVCSDTIICDNLDIARDLKWNKNANVKIVTLDGALI 657

Query: 806 DISGTMSGG 814
           + +G M+GG
Sbjct: 658 NKTGLMTGG 666

>Ecym_7303 Chr7 (638719..642387) [3669 bp, 1222 aa] {ON} similar to
            Ashbya gossypii AGL023W
          Length = 1222

 Score =  125 bits (314), Expect = 4e-28,   Method: Compositional matrix adjust.
 Identities = 59/166 (35%), Positives = 103/166 (62%), Gaps = 11/166 (6%)

Query: 1234 LKKCRFNEFMESFNIISMTLKEMYQIIT---------MGGNAELELVDSLDPFSEGVTFS 1284
            +K+ R   F+  F  ++  +  +Y+ +T          GG+A L L D  +P+  G+ + 
Sbjct: 1051 IKEKRVKTFLSCFQHVTDHIDRIYRELTRNPGSTAELAGGSASLTLEDEDEPYLAGIRYH 1110

Query: 1285 VMPPKKSWRNISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYI 1344
              PP K ++++  LSGGEKT+++LAL+FA++ Y+P+P +++DE+DAALD  NV  +A YI
Sbjct: 1111 ATPPMKRFKDMDYLSGGEKTMAALALLFAINSYQPSPFFILDEVDAALDVTNVERIAAYI 1170

Query: 1345 KER-TKNAQFIVISLRNNMFELAEQLVGIYKNVNQTKSATLKNNDI 1389
            K   +   QFIVISL++N+F  ++ + G+++N  Q  S+ +   D+
Sbjct: 1171 KRHASPKFQFIVISLKSNLFGKSQSMAGVFRN-QQANSSMVITTDL 1215

 Score = 93.2 bits (230), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 62/186 (33%), Positives = 94/186 (50%), Gaps = 22/186 (11%)

Query: 149 LVLHNFKSYAGTQTIGPFHSSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQGKLADLI 208
           L L+NFKSY GT  +G  +  F ++VGPNGSGKSN++D++ FV G R+N +R   L DLI
Sbjct: 7   LELNNFKSYKGTHNVGFGNKHFISIVGPNGSGKSNMMDAISFVLGIRSNHLRSNALVDLI 66

Query: 209 H------KSEEYPDLTSCAVDVHFEYLIDYPDDTTKINPSKQPLIITRRAFKNST-SKYY 261
           +      +S+E+      A    F    D  +  TKI           R  +N+  S Y 
Sbjct: 67  YRGRMDDRSDEHVASPKSAYVKAFYLKDDNGEQGTKIE--------FMRIIQNTGDSVYR 118

Query: 262 LNGKESNYKTITALLKEEGIDLDHNRFLILQGEVENIAQMKPKAEKEGDDGLLEYLEDII 321
           ++GK  ++K     L+ E I +    FL+ QG+VE IA        +    L +  E + 
Sbjct: 119 IDGKTVSFKRYVEYLEGESILVKARNFLVFQGDVEQIAS-------QSGIELTKLFEQVS 171

Query: 322 GTTKYK 327
           G+ +Y+
Sbjct: 172 GSVQYQ 177

 Score = 64.3 bits (155), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 44/135 (32%), Positives = 74/135 (54%), Gaps = 18/135 (13%)

Query: 690 EKYDVAISTACPR-LNDIVVDSVECGQQCIEYLRKNNLGHARFILLDKLNKFSMEKISTP 748
           +KY +A+S+   +  + IVVDSV   QQCI YL+K+  G A FI LD ++      I+TP
Sbjct: 538 DKYALAVSSMLGKNFDSIVVDSVSVAQQCISYLKKHRSGAASFIPLDTID------INTP 591

Query: 749 ----RNVPRLFDLIKVN----DEKFLPAFYSVLRNTLVANDLKEANAVAYGK-TRYRVVT 799
               RN+     ++ VN    D +   A   V  ++++ + L  A  + + +  + ++VT
Sbjct: 592 TLPVRNLKGC--ILTVNAIEYDSELEKAMQYVCSDSIICDTLDIAKNLKWDRGIKSKLVT 649

Query: 800 LKGNLIDISGTMSGG 814
           ++G LI  +G M+GG
Sbjct: 650 IQGALIHRAGLMTGG 664

>KAFR0G02930 Chr7 complement(609210..612722) [3513 bp, 1170 aa] {ON}
           Anc_7.186 YFR031C
          Length = 1170

 Score = 98.2 bits (243), Expect = 9e-20,   Method: Compositional matrix adjust.
 Identities = 56/185 (30%), Positives = 101/185 (54%), Gaps = 13/185 (7%)

Query: 146 LNKLVLHNFKSYAGTQTIGPFHSSFSAVVGPNGSGKSNVIDSMLFVFGFRA-NKMRQGKL 204
           + +L++  FKSYA    I  +   F+A+ G NGSGKSN++D++ FV G  + + +R   L
Sbjct: 3   IEELIIDGFKSYAARTVISDWDPQFNAITGLNGSGKSNILDAICFVLGISSMSTVRASNL 62

Query: 205 ADLIHKSEEYPDLTSCAVDVHFEYLIDYPDDTTKINPSKQPLI-ITRRAFKNSTSKYYLN 263
            DLI+K  +   +T  +V V F+   +   D + I  +  P I +TR+     TSKY +N
Sbjct: 63  QDLIYKRGQ-AGVTKASVTVVFD---NSDRDNSPIGFTNSPKISVTRQVVLGGTSKYLIN 118

Query: 264 GKESNYKTITALLKEEGIDLDHNRFLILQGEVENIAQMKPKAEKEGDDGLLEYLEDIIGT 323
           G  +  +++  L +   +++++  FLI+QG++  +  MKP         +L  +E+  GT
Sbjct: 119 GHRAPQQSVLQLFQSVQLNINNPNFLIMQGKITKVLNMKPTE-------ILSLIEEAAGT 171

Query: 324 TKYKE 328
             +++
Sbjct: 172 KMFED 176

 Score = 81.3 bits (199), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 32/73 (43%), Positives = 54/73 (73%), Gaps = 1/73 (1%)

Query: 1292 WR-NISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKN 1350
            W+ ++  LSGG+++L +L+L+ AL +++P P+Y++DE+DAALD  +   + + IK R K 
Sbjct: 1077 WKESLVELSGGQRSLIALSLIMALLQFRPAPMYILDEVDAALDLSHTQNIGHLIKTRFKG 1136

Query: 1351 AQFIVISLRNNMF 1363
            +QFIV+SL+  MF
Sbjct: 1137 SQFIVVSLKEGMF 1149

 Score = 45.4 bits (106), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 43/156 (27%), Positives = 67/156 (42%), Gaps = 15/156 (9%)

Query: 680 GRLGNLGVIDEK-YDVAIS---TACPRLNDIVVDSVECGQQCIEYLRKNNLGHARFILLD 735
           G    L  +D++ +D AI+    A  RL +I+VD+     Q +E  R         I L 
Sbjct: 525 GVAAQLFTVDQQQFDNAIALQVCAGGRLYNIIVDNEITASQLLERGRLKK--RVTIIPLS 582

Query: 736 KL-------NKFSMEKISTPRNVPRLFDLIKVNDEKFLPAFYSVLRNTLVANDLKEANAV 788
           K+       N  ++ K   P  V    +LI  +DE    A   +  N LV  D   A  V
Sbjct: 583 KIATRTLNKNTLALAKELAPGKVELALNLIGYDDE-VSKAMEFIFGNGLVCKDADTAKKV 641

Query: 789 AYGKT-RYRVVTLKGNLIDISGTMSGGGNQASKGAM 823
            +    R R +T +G++ D  GT+SGG    ++  +
Sbjct: 642 TFHPNIRTRSITQQGDVYDPEGTLSGGSRNTTRSLL 677

>CAGL0D05258g Chr4 (500858..504370) [3513 bp, 1170 aa] {ON} similar
           to uniprot|P38989 Saccharomyces cerevisiae YFR031c SMC2
           chromosome segregation protein
          Length = 1170

 Score = 96.7 bits (239), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 57/182 (31%), Positives = 98/182 (53%), Gaps = 13/182 (7%)

Query: 149 LVLHNFKSYAGTQTIGPFHSSFSAVVGPNGSGKSNVIDSMLFVFGFRA-NKMRQGKLADL 207
           L++  FKSYA    I  +   F+A+ G NGSGKSN++D++ FV G  +   +R   L DL
Sbjct: 6   LIIDGFKSYATRTVISDWDPQFNAITGLNGSGKSNILDAICFVLGISSMATVRASNLQDL 65

Query: 208 IHKSEEYPDLTSCAVDVHFEYLIDYPDDTTKINPSKQPLI-ITRRAFKNSTSKYYLNGKE 266
           I+K  +   +T  +V + F+   +     T I  S+ P I +TR+     TSKY +NG  
Sbjct: 66  IYKRGQ-AGVTKASVTIVFD---NTDKSNTPIGFSEYPKISVTRQIVLGGTSKYLINGHR 121

Query: 267 SNYKTITALLKEEGIDLDHNRFLILQGEVENIAQMKPKAEKEGDDGLLEYLEDIIGTTKY 326
           +  +++  L +   +++++  FLI+QG++  I  MKP         +L  +E+  GT  +
Sbjct: 122 APQQSVLQLFQSVQLNINNPNFLIMQGKITKILNMKPSE-------ILSLIEEAAGTKMF 174

Query: 327 KE 328
           ++
Sbjct: 175 ED 176

 Score = 81.6 bits (200), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 32/73 (43%), Positives = 54/73 (73%), Gaps = 1/73 (1%)

Query: 1292 WR-NISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKN 1350
            W+ ++  LSGG+++L +L+L+ AL +++P P+Y++DE+DAALD  +   + + IK R K 
Sbjct: 1077 WKESLVELSGGQRSLIALSLIMALLQFRPAPMYILDEVDAALDLSHTQNIGHLIKTRFKG 1136

Query: 1351 AQFIVISLRNNMF 1363
            +QFIV+SL+  MF
Sbjct: 1137 SQFIVVSLKEGMF 1149

 Score = 52.0 bits (123), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 42/151 (27%), Positives = 72/151 (47%), Gaps = 16/151 (10%)

Query: 675 INGFHGRLGNLGVIDEKYDVAIS-TACPRLNDIVVDSVECGQQCIE--YLRKNNLGHARF 731
           + G    L ++   + KY + +   A  RL +++VD+ + G   ++   LRK        
Sbjct: 523 VKGVTAELFSIPEQNMKYVIGLQICAGGRLYNVIVDNEKTGSALLQKGRLRK----RVTI 578

Query: 732 ILLDKL-------NKFSMEKISTPRNVPRLFDLIKVNDEKFLPAFYSVLRNTLVANDLKE 784
           I LDK+       NK  + K   P  V    +LI  +DE  + A   +  N+L+ +D + 
Sbjct: 579 IPLDKVISRPLNQNKLKLAKQLAPGKVELALNLIGYSDE-VVKAMEFIFGNSLICDDAET 637

Query: 785 ANAVAYGK-TRYRVVTLKGNLIDISGTMSGG 814
           A  + +    R R +TL+G++ D  GT+SGG
Sbjct: 638 AKKITFNPGIRTRSITLEGDIYDPEGTLSGG 668

>NDAI0G02070 Chr7 (461697..465212) [3516 bp, 1171 aa] {ON} Anc_7.186
           YFR031C
          Length = 1171

 Score = 96.3 bits (238), Expect = 4e-19,   Method: Compositional matrix adjust.
 Identities = 56/186 (30%), Positives = 98/186 (52%), Gaps = 21/186 (11%)

Query: 149 LVLHNFKSYAGTQTIGPFHSSFSAVVGPNGSGKSNVIDSMLFVFGFRA-NKMRQGKLADL 207
           L++  FKSYA    I  +   F+A+ G NGSGKSN++D++ FV G  +   +R   L DL
Sbjct: 6   LIIDGFKSYATRTVISDWDPQFNAITGLNGSGKSNILDAICFVLGITSMTTVRASNLQDL 65

Query: 208 IHKSEEYPDLTSCAVDVHFEYLIDYPDDTTKINP-----SKQPLIITRRAFKNSTSKYYL 262
           I+K  +   +T  +V + F       D+T K N      +   + +TR+     TSKY +
Sbjct: 66  IYKRGQ-AGITKASVTIVF-------DNTDKTNSPIGFNNSAKISVTRQVVLGGTSKYLI 117

Query: 263 NGKESNYKTITALLKEEGIDLDHNRFLILQGEVENIAQMKPKAEKEGDDGLLEYLEDIIG 322
           NG  +  +++  L +   +++++  FLI+QG++  +  MKPK        +L  +E+  G
Sbjct: 118 NGHRAPQQSVLQLFQSVQLNINNPNFLIMQGKITKVLNMKPKE-------ILSLIEEAAG 170

Query: 323 TTKYKE 328
           T  +++
Sbjct: 171 TKMFED 176

 Score = 81.3 bits (199), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 32/73 (43%), Positives = 54/73 (73%), Gaps = 1/73 (1%)

Query: 1292 WR-NISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKN 1350
            W+ ++  LSGG+++L +L+L+ AL +++P P+Y++DE+DAALD  +   + + IK R K 
Sbjct: 1078 WKESLVELSGGQRSLIALSLIMALLQFRPAPMYILDEVDAALDLSHTQNIGHLIKTRFKG 1137

Query: 1351 AQFIVISLRNNMF 1363
            +QFIV+SL+  MF
Sbjct: 1138 SQFIVVSLKEGMF 1150

 Score = 33.1 bits (74), Expect = 6.9,   Method: Compositional matrix adjust.
 Identities = 33/124 (26%), Positives = 56/124 (45%), Gaps = 16/124 (12%)

Query: 699 ACPRLNDIVVDSVECGQQCIEY--LRKNNLGHARFILLDKLNKFSMEKIS--------TP 748
           A  RL ++VVD+ +     +E   LRK        I L+K++  ++ + S         P
Sbjct: 548 AGGRLYNVVVDNEKTASSLLERGRLRK----RVTIIPLNKISARTLNERSCTTKRKKLAP 603

Query: 749 RNVPRLFDLIKVNDEKFLPAFYSVLRNTLVANDLKEANAVAYG-KTRYRVVTLKGNLIDI 807
             V    +LI  +DE    A   +   +L+  D   A  V +  + R R +TL+G++ D 
Sbjct: 604 GKVELALNLIGYDDE-VSNAMEFIFGGSLICQDADTAKKVTFHPQIRTRSITLEGDVYDP 662

Query: 808 SGTM 811
            GT+
Sbjct: 663 EGTL 666

>TDEL0H02610 Chr8 (434116..437628) [3513 bp, 1170 aa] {ON} Anc_7.186
           YFR031C
          Length = 1170

 Score = 95.9 bits (237), Expect = 4e-19,   Method: Compositional matrix adjust.
 Identities = 58/193 (30%), Positives = 102/193 (52%), Gaps = 21/193 (10%)

Query: 146 LNKLVLHNFKSYAGTQTIGPFHSSFSAVVGPNGSGKSNVIDSMLFVFGFRA-NKMRQGKL 204
           + +L++  FKSYA    I  +   F+A+ G NGSGKSN++D++ FV G  A   +R   L
Sbjct: 3   IEELIIDGFKSYATRTVISDWDPQFNAITGLNGSGKSNILDAICFVLGISAMTTVRASSL 62

Query: 205 ADLIHKSEEYPDLTSCAVDVHFEYLIDYPDDTTKINP-----SKQPLIITRRAFKNSTSK 259
            DLI+K  +   +T  +V V F       D++ K N      +   + +TR+     +SK
Sbjct: 63  QDLIYKRGQ-AGVTKASVTVVF-------DNSDKSNSPIGFTNSAKISVTRQVMLGGSSK 114

Query: 260 YYLNGKESNYKTITALLKEEGIDLDHNRFLILQGEVENIAQMKPKAEKEGDDGLLEYLED 319
           Y +NG  +  +++  L +   +++++  FLI+QG++  +  MKPK        +L  +E+
Sbjct: 115 YLINGHRAPQQSVLQLFQSVQLNINNPNFLIMQGKITKVLNMKPKE-------ILSLIEE 167

Query: 320 IIGTTKYKELIDK 332
             GT  +++  DK
Sbjct: 168 AAGTKMFEDRKDK 180

 Score = 83.6 bits (205), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 35/86 (40%), Positives = 58/86 (67%)

Query: 1278 SEGVTFSVMPPKKSWRNISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNV 1337
            +EG+ F V        ++  LSGG+++L +L+L+ AL +++P P+Y++DE+DAALD  + 
Sbjct: 1064 TEGLEFKVRLGSIWKESLVELSGGQRSLIALSLIMALLQFRPAPMYILDEVDAALDLSHT 1123

Query: 1338 SIVANYIKERTKNAQFIVISLRNNMF 1363
              + + IK R K +QFIV+SL+  MF
Sbjct: 1124 QNIGHLIKTRFKGSQFIVVSLKEGMF 1149

>SAKL0F07282g Chr6 complement(554459..557971) [3513 bp, 1170 aa]
           {ON} similar to uniprot|P38989 Saccharomyces cerevisiae
           YFR031C SMC2 Component of the condensin complex
           essential SMC chromosomal ATPase family member that
           forms a complex with Smc4p to form the active ATPase
           Smc2p/Smc4p complex binds DNA possibly in the cleft
           formed by the coiled-coil of the folded dimer
          Length = 1170

 Score = 95.5 bits (236), Expect = 7e-19,   Method: Compositional matrix adjust.
 Identities = 56/182 (30%), Positives = 97/182 (53%), Gaps = 13/182 (7%)

Query: 149 LVLHNFKSYAGTQTIGPFHSSFSAVVGPNGSGKSNVIDSMLFVFGFRAN-KMRQGKLADL 207
           L++  FKSYA    I  +   F+A+ G NGSGKSN++DS+ FV G  +   +R   L DL
Sbjct: 6   LIIDGFKSYATRTVISNWDPQFNAITGLNGSGKSNILDSICFVLGISSMVTVRASNLQDL 65

Query: 208 IHKSEEYPDLTSCAVDVHFEYLIDYPDDTTKINPSKQPLI-ITRRAFKNSTSKYYLNGKE 266
           I+K  +   +T  +V + F+   +    ++ I     P I +TR+     TSKY +NG  
Sbjct: 66  IYKRGQ-AGVTKASVTIVFD---NTDKSSSPIGFESYPKISVTRQIILGGTSKYLINGHR 121

Query: 267 SNYKTITALLKEEGIDLDHNRFLILQGEVENIAQMKPKAEKEGDDGLLEYLEDIIGTTKY 326
           +  +T+  L +   +++++  FLI+QG++  +  MKP         +L  +E+  GT  +
Sbjct: 122 AQQQTVLHLFQSVQLNINNPNFLIMQGKITKVLNMKPTE-------ILSLIEEAAGTRMF 174

Query: 327 KE 328
           ++
Sbjct: 175 ED 176

 Score = 68.6 bits (166), Expect = 9e-11,   Method: Compositional matrix adjust.
 Identities = 42/140 (30%), Positives = 83/140 (59%), Gaps = 1/140 (0%)

Query: 1224 RDKVRKELEDLKKCRFNEFMESFNIISMTLKEMYQIITMGGNAELELVDSLDPFSEGVTF 1283
            + K+++ +E L + + +  ++++  +S+    ++  +     A+L   +  D  +EG+  
Sbjct: 1011 KTKIQETIEKLNEYKRDTLLKTWEKVSVDFGNIFGDLLPNSFAKLVPCEGKD-VTEGLEV 1069

Query: 1284 SVMPPKKSWRNISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANY 1343
             V        ++  LSGG+++L +L+L+ AL ++KP P+Y++DE+DAALD  +   + + 
Sbjct: 1070 KVKLGSIWKESLVELSGGQRSLIALSLILALLQFKPAPMYILDEVDAALDLSHTQNIGHL 1129

Query: 1344 IKERTKNAQFIVISLRNNMF 1363
            IK R K +QFIV+SL+  MF
Sbjct: 1130 IKTRFKGSQFIVVSLKEGMF 1149

>Kwal_55.20421 s55 (391382..394894) [3513 bp, 1170 aa] {ON} YFR031C
           (SMC2) - SMC chromosomal ATPase family member [contig
           149] FULL
          Length = 1170

 Score = 94.0 bits (232), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 55/182 (30%), Positives = 97/182 (53%), Gaps = 13/182 (7%)

Query: 149 LVLHNFKSYAGTQTIGPFHSSFSAVVGPNGSGKSNVIDSMLFVFGFRA-NKMRQGKLADL 207
           L++  FKSYA    I  +   F+A+ G NGSGKSN++D++ FV G  + + +R   L DL
Sbjct: 6   LIIDGFKSYATRTVISNWDPQFNAITGLNGSGKSNILDAICFVLGISSMSTVRASNLQDL 65

Query: 208 IHKSEEYPDLTSCAVDVHFEYLIDYPDDTTKINPSKQPLI-ITRRAFKNSTSKYYLNGKE 266
           I+K  +   +T  +V + F    +   + + I     P I +TR+     TSKY +NG  
Sbjct: 66  IYKRGQ-AGVTKASVTIVF---ANSDKNNSPIGFESYPKISVTRQIVLGGTSKYLINGHR 121

Query: 267 SNYKTITALLKEEGIDLDHNRFLILQGEVENIAQMKPKAEKEGDDGLLEYLEDIIGTTKY 326
           +  +T+  L +   +++++  FLI+QG++  +  MKP         +L  +E+  GT  +
Sbjct: 122 AQQQTVLHLFQSVQLNINNPNFLIMQGKITKVLNMKPTE-------ILSLIEEAAGTKMF 174

Query: 327 KE 328
           ++
Sbjct: 175 ED 176

 Score = 67.8 bits (164), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 33/73 (45%), Positives = 54/73 (73%), Gaps = 1/73 (1%)

Query: 1292 WR-NISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKN 1350
            W+ ++  LSGG+++L +L+L+ AL ++KP P+Y++DE+DAALD  +   + + IK R K 
Sbjct: 1077 WKESLVELSGGQRSLIALSLILALLQFKPAPMYILDEVDAALDLSHTQNIGHLIKTRFKG 1136

Query: 1351 AQFIVISLRNNMF 1363
            +QFIV+SL+  MF
Sbjct: 1137 SQFIVVSLKEGMF 1149

 Score = 43.9 bits (102), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 37/129 (28%), Positives = 58/129 (44%), Gaps = 21/129 (16%)

Query: 699 ACPRLNDIVVDSVECGQQCIEY--LRKNNLGHARFILLDKLNKFSMEKIS---------- 746
           A  RL ++VV++     Q +E   LRK        + +  LNK S  ++           
Sbjct: 548 AGGRLFNVVVNNESTASQLLERGRLRKR-------VTIIPLNKISARRLHQDTVNFAKQL 600

Query: 747 TPRNVPRLFDLIKVNDEKFLPAFYSVLRNTLVANDLKEANAVAYG-KTRYRVVTLKGNLI 805
            P +V    +LI   DE    A   +   +L+  D + A  V +  K R R +TL+G++ 
Sbjct: 601 APDSVELALNLIGYEDE-VAKAMEFIFGTSLICRDAETAKKVTFHPKVRARSITLQGDIY 659

Query: 806 DISGTMSGG 814
           D  GT+SGG
Sbjct: 660 DPEGTLSGG 668

>Suva_6.104 Chr6 complement(183396..186908) [3513 bp, 1170 aa] {ON}
           YFR031C (REAL)
          Length = 1170

 Score = 94.0 bits (232), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 57/186 (30%), Positives = 98/186 (52%), Gaps = 21/186 (11%)

Query: 149 LVLHNFKSYAGTQTIGPFHSSFSAVVGPNGSGKSNVIDSMLFVFGFRA-NKMRQGKLADL 207
           L++  FKSYA    I  +   F+A+ G NGSGKSN++D++ FV G  +   +R   L DL
Sbjct: 6   LIIDGFKSYATRTVITDWDPQFNAITGLNGSGKSNILDAICFVLGIASMTTVRASSLQDL 65

Query: 208 IHKSEEYPDLTSCAVDVHFEYLIDYPDDTTKINP----SKQPLI-ITRRAFKNSTSKYYL 262
           I+K  +   +T  +V + F       D+T K N     +  P I +TR+     TSKY +
Sbjct: 66  IYKRGQ-AGVTKASVTIVF-------DNTDKSNSPIGFTNSPQISVTRQVVLGGTSKYLI 117

Query: 263 NGKESNYKTITALLKEEGIDLDHNRFLILQGEVENIAQMKPKAEKEGDDGLLEYLEDIIG 322
           NG  +  +++  L +   +++++  FLI+QG++  +  MKP         +L  +E+  G
Sbjct: 118 NGHRAPQQSVLQLFQSVQLNINNPNFLIMQGKITKVLNMKPTE-------ILSLIEEAAG 170

Query: 323 TTKYKE 328
           T  +++
Sbjct: 171 TKMFED 176

 Score = 82.4 bits (202), Expect = 6e-15,   Method: Compositional matrix adjust.
 Identities = 33/73 (45%), Positives = 54/73 (73%), Gaps = 1/73 (1%)

Query: 1292 WRN-ISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKN 1350
            W++ +  LSGG+++L +LAL+ AL +++P P+Y++DE+DAALD  +   + + IK R K 
Sbjct: 1077 WKDSLIELSGGQRSLIALALIMALLQFRPAPMYILDEVDAALDLSHTQNIGHLIKTRFKG 1136

Query: 1351 AQFIVISLRNNMF 1363
            +QFIV+SL+  MF
Sbjct: 1137 SQFIVVSLKEGMF 1149

 Score = 54.7 bits (130), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 48/163 (29%), Positives = 74/163 (45%), Gaps = 25/163 (15%)

Query: 674 RINGFHGRLGNLGVIDE---KYDVAIST-ACPRLNDIVVDSVECGQQCIEY--LRKNNLG 727
           + N  +G +G L  +D+   +Y  A+ T A  RL ++VV   +   Q +E   LRK    
Sbjct: 519 KANLVYGVVGQLFELDDDKIRYSTALQTCAGGRLFNVVVQDSQTATQLLERGRLRKR--- 575

Query: 728 HARFILLDKLNKFSMEKIS----------TPRNVPRLFDLIKVNDEKFLPAFYSVLRNTL 777
               + +  LNK S   IS           P  V    +LIK  D+    A   +  N+L
Sbjct: 576 ----VTIIPLNKISTRPISPQVLELAKKIAPGKVELAINLIKF-DKSVTKAMEFIFGNSL 630

Query: 778 VANDLKEANAVAYG-KTRYRVVTLKGNLIDISGTMSGGGNQAS 819
           +  D + A  + +  K R R +TL+G++ D  GT+SGG    S
Sbjct: 631 ICEDPETAKKITFHPKIRARSITLQGDVYDPEGTLSGGSRNTS 673

>Smik_7.346 Chr7 complement(577634..581146) [3513 bp, 1170 aa] {ON}
           YFR031C (REAL)
          Length = 1170

 Score = 94.0 bits (232), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 54/182 (29%), Positives = 98/182 (53%), Gaps = 13/182 (7%)

Query: 149 LVLHNFKSYAGTQTIGPFHSSFSAVVGPNGSGKSNVIDSMLFVFGFRA-NKMRQGKLADL 207
           L++  FKSYA    I  +   F+A+ G NGSGKSN++D++ FV G  + + +R   L DL
Sbjct: 6   LIIDGFKSYATRTVITDWDPQFNAITGLNGSGKSNILDAICFVLGIASMSTVRASSLQDL 65

Query: 208 IHKSEEYPDLTSCAVDVHFEYLIDYPDDTTKINPSKQPLI-ITRRAFKNSTSKYYLNGKE 266
           I+K  +   +T  +V + F+   +     + I  +  P I +TR+     TSKY +NG  
Sbjct: 66  IYKRGQ-AGVTKASVTIVFD---NTDKSNSPIGFANSPQISVTRQVVLGGTSKYLINGHR 121

Query: 267 SNYKTITALLKEEGIDLDHNRFLILQGEVENIAQMKPKAEKEGDDGLLEYLEDIIGTTKY 326
           +  +++  L +   +++++  FLI+QG++  +  MKP         +L  +E+  GT  +
Sbjct: 122 APQQSVLQLFQSVQLNINNPNFLIMQGKITKVLNMKPSE-------ILSLIEEAAGTKMF 174

Query: 327 KE 328
           ++
Sbjct: 175 ED 176

 Score = 80.9 bits (198), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 33/79 (41%), Positives = 57/79 (72%), Gaps = 1/79 (1%)

Query: 1292 WR-NISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKN 1350
            W+ ++  LSGG+++L +L+L+ AL +++P P+Y++DE+DAALD  +   + + IK R K 
Sbjct: 1077 WKESLIELSGGQRSLVALSLIMALLQFRPAPMYILDEVDAALDLSHTQNIGHLIKTRFKG 1136

Query: 1351 AQFIVISLRNNMFELAEQL 1369
            +QFIV+SL+  MF  A ++
Sbjct: 1137 SQFIVVSLKEGMFSNANRV 1155

 Score = 53.5 bits (127), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 65/253 (25%), Positives = 113/253 (44%), Gaps = 21/253 (8%)

Query: 583 IEALEKDVNEKSKLTEDRRKEVKNLMTKLENVSKEVIFGTNELKKANEKLCEMQKILIQD 642
           IE   K+  + ++L+    KE + +  KL+    E  F  + +K   +K  +M+    Q 
Sbjct: 434 IEPKLKEATKDNELSIKHVKECQEICNKLQAQLVEFGFDPSRIKDLEQKENKMKSQYYQI 493

Query: 643 RQKANDARTSLSNVE-NRSKVLRALLKLQKSGRINGFHGRLGNLGVIDEKYDVAIST-AC 700
             +A   +  ++N+E N +K         ++  + G  GRL  L   + +Y  A+ T A 
Sbjct: 494 CNEAEHLKRRVANLEFNYTKPYPDF----ETSSVYGVVGRLFQLDNDNIRYSSALQTCAG 549

Query: 701 PRLNDIVVDSVECGQQCIE--YLRKNNLGHARFILLDKL-------NKFSMEKISTPRNV 751
            RL ++VV   +   Q +E   LRK        I LDK+           + K   P  V
Sbjct: 550 GRLFNVVVRDSQTATQLLEGGRLRK----RVTIIPLDKIYTRPITPQVLELAKSIAPGKV 605

Query: 752 PRLFDLIKVNDEKFLPAFYSVLRNTLVANDLKEANAVAYG-KTRYRVVTLKGNLIDISGT 810
               +LI+  D+    A   +  N+L+ +D + A  + +  K R R +TL+G++ D  GT
Sbjct: 606 ELAINLIRF-DKPVTKAMEFIFGNSLICDDPETAKKITFHPKIRARSITLQGDVYDPEGT 664

Query: 811 MSGGGNQASKGAM 823
           +SGG    S+  +
Sbjct: 665 LSGGSRNTSQSLL 677

>YFR031C Chr6 complement(216594..220106) [3513 bp, 1170 aa] {ON}
           SMC2Subunit of the condensin complex; essential SMC
           chromosomal ATPase family member that forms a complex
           with Smc4p to form the active ATPase; Smc2p/Smc4p
           complex binds DNA; required for clustering of tRNA genes
           at the nucleolus
          Length = 1170

 Score = 94.0 bits (232), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 57/186 (30%), Positives = 99/186 (53%), Gaps = 21/186 (11%)

Query: 149 LVLHNFKSYAGTQTIGPFHSSFSAVVGPNGSGKSNVIDSMLFVFGFRA-NKMRQGKLADL 207
           L++  FKSYA    I  +   F+A+ G NGSGKSN++D++ FV G  + + +R   L DL
Sbjct: 6   LIIDGFKSYATRTVITDWDPQFNAITGLNGSGKSNILDAICFVLGIASMSTVRASSLQDL 65

Query: 208 IHKSEEYPDLTSCAVDVHFEYLIDYPDDTTKINP----SKQPLI-ITRRAFKNSTSKYYL 262
           I+K  +   +T  +V + F       D+T K N     +  P I +TR+     TSKY +
Sbjct: 66  IYKRGQ-AGVTKASVTIVF-------DNTDKSNSPIGFTNSPQISVTRQVVLGGTSKYLI 117

Query: 263 NGKESNYKTITALLKEEGIDLDHNRFLILQGEVENIAQMKPKAEKEGDDGLLEYLEDIIG 322
           NG  +  +++  L +   +++++  FLI+QG++  +  MKP         +L  +E+  G
Sbjct: 118 NGHRAPQQSVLQLFQSVQLNINNPNFLIMQGKITKVLNMKPSE-------ILSLIEEAAG 170

Query: 323 TTKYKE 328
           T  +++
Sbjct: 171 TKMFED 176

 Score = 80.9 bits (198), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 32/73 (43%), Positives = 54/73 (73%), Gaps = 1/73 (1%)

Query: 1292 WR-NISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKN 1350
            W+ ++  LSGG+++L +L+L+ AL +++P P+Y++DE+DAALD  +   + + IK R K 
Sbjct: 1077 WKESLIELSGGQRSLIALSLIMALLQFRPAPMYILDEVDAALDLSHTQNIGHLIKTRFKG 1136

Query: 1351 AQFIVISLRNNMF 1363
            +QFIV+SL+  MF
Sbjct: 1137 SQFIVVSLKEGMF 1149

 Score = 55.8 bits (133), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 48/159 (30%), Positives = 72/159 (45%), Gaps = 19/159 (11%)

Query: 679 HGRLGNLGVIDE---KYDVAIST-ACPRLNDIVVDSVECGQQCIEY--LRKNNLGHARFI 732
           HG +G L  ID    +Y  A+ T A  RL ++VV   +   Q +E   LRK        I
Sbjct: 524 HGVVGQLFQIDNDNIRYATALQTCAGGRLFNVVVQDSQTATQLLERGRLRK----RVTII 579

Query: 733 LLDKL-------NKFSMEKISTPRNVPRLFDLIKVNDEKFLPAFYSVLRNTLVANDLKEA 785
            LDK+           + K   P  V    +LI+  DE    A   +  N+L+  D + A
Sbjct: 580 PLDKIYTRPISSQVLDLAKKIAPGKVELAINLIRF-DESITKAMEFIFGNSLICEDPETA 638

Query: 786 NAVAYG-KTRYRVVTLKGNLIDISGTMSGGGNQASKGAM 823
             + +  K R R +TL+G++ D  GT+SGG    S+  +
Sbjct: 639 KKITFHPKIRARSITLQGDVYDPEGTLSGGSRNTSESLL 677

>AGR236W Chr7 (1189845..1193357) [3513 bp, 1170 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YFR031C (SMC2)
          Length = 1170

 Score = 93.2 bits (230), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 58/189 (30%), Positives = 95/189 (50%), Gaps = 27/189 (14%)

Query: 149 LVLHNFKSYAGTQTIGPFHSSFSAVVGPNGSGKSNVIDSMLFVFGFRA-NKMRQGKLADL 207
           L++  FKSYA    I  +   F+A+ G NGSGKSN++DS+ FV G  +   +R   L DL
Sbjct: 6   LIIDGFKSYATRTVISGWDPQFNAITGLNGSGKSNILDSICFVLGISSMATVRAQNLQDL 65

Query: 208 IHKSEEYPDLTSCAVDVHFEYLIDYPDDTTKINPSKQP--------LIITRRAFKNSTSK 259
           I+K  +   +   +V + F    D  D      PS  P        + +TR+     TSK
Sbjct: 66  IYKRGQ-AGVIKASVTIVF----DNSD------PSSSPFGFETYPKISVTRQIILGGTSK 114

Query: 260 YYLNGKESNYKTITALLKEEGIDLDHNRFLILQGEVENIAQMKPKAEKEGDDGLLEYLED 319
           Y +NG  +   T+  L +   +++++  FLI+QG++  +  MKP       D +L  +E+
Sbjct: 115 YLINGHRAQQLTVLHLFQSVQLNINNPNFLIMQGKITKVLNMKP-------DEILALIEE 167

Query: 320 IIGTTKYKE 328
             GT  +++
Sbjct: 168 AAGTRMFED 176

 Score = 68.2 bits (165), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 33/73 (45%), Positives = 54/73 (73%), Gaps = 1/73 (1%)

Query: 1292 WR-NISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKN 1350
            W+ ++  LSGG+++L +L+L+ AL ++KP P+Y++DE+DAALD  +   + + IK R K 
Sbjct: 1077 WKESLVELSGGQRSLIALSLILALLQFKPAPMYILDEVDAALDLSHTQNIGHLIKTRFKG 1136

Query: 1351 AQFIVISLRNNMF 1363
            +QFIV+SL+  MF
Sbjct: 1137 SQFIVVSLKEGMF 1149

 Score = 44.3 bits (103), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 43/138 (31%), Positives = 62/138 (44%), Gaps = 16/138 (11%)

Query: 689 DEKYDVAIS---TACPRLNDIVVDSVECGQQCIEY--LRKN------NLGHARFILLDKL 737
           +E +D A +    A  RL +++VD+ +   Q +E   LRK       N   AR I  D L
Sbjct: 535 EENFDSANALQVCAGGRLFNVIVDNEKTASQLLERGRLRKRVTIIPLNKISARVINTDAL 594

Query: 738 NKFSMEKISTPRNVPRLFDLIKVNDEKFLPAFYSVLRNTLVANDLKEANAVAYG-KTRYR 796
           NK    K   P  V    +LI    E    A   +   +L+  D   A  V +  + R R
Sbjct: 595 NK---AKSLAPGAVELALNLIGYEAE-VARAMEFIFGGSLICRDAATAKKVTFHPQVRAR 650

Query: 797 VVTLKGNLIDISGTMSGG 814
            +TL G++ D  GT+SGG
Sbjct: 651 SITLDGDIYDPEGTLSGG 668

>Skud_6.119 Chr6 complement(211918..215430) [3513 bp, 1170 aa] {ON}
           YFR031C (REAL)
          Length = 1170

 Score = 93.2 bits (230), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 56/186 (30%), Positives = 100/186 (53%), Gaps = 21/186 (11%)

Query: 149 LVLHNFKSYAGTQTIGPFHSSFSAVVGPNGSGKSNVIDSMLFVFGFRA-NKMRQGKLADL 207
           L++  FKSYA    I  +   F+A+ G NGSGKSN++D++ FV G  + + +R   L DL
Sbjct: 6   LIIDGFKSYATRTVITDWDPQFNAITGLNGSGKSNILDAICFVLGIASMSTVRASSLQDL 65

Query: 208 IHKSEEYPDLTSCAVDVHFEYLIDYPDDTTKINP----SKQPLI-ITRRAFKNSTSKYYL 262
           I+K  +   +T  +V + F       ++T K+N     +  P I +TR+     TSKY +
Sbjct: 66  IYKRGQ-AGVTKASVTIVF-------NNTDKLNSPIGFTNSPQISVTRQVVLGGTSKYLI 117

Query: 263 NGKESNYKTITALLKEEGIDLDHNRFLILQGEVENIAQMKPKAEKEGDDGLLEYLEDIIG 322
           NG  +  +++  L +   +++++  FLI+QG++  +  MKP         +L  +E+  G
Sbjct: 118 NGHRAPQQSVLQLFQSVQLNINNPNFLIMQGKITKVLNMKPSE-------ILSLIEEAAG 170

Query: 323 TTKYKE 328
           T  +++
Sbjct: 171 TKMFED 176

 Score = 80.9 bits (198), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 33/79 (41%), Positives = 57/79 (72%), Gaps = 1/79 (1%)

Query: 1292 WRN-ISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKN 1350
            W++ +  LSGG+++L +L+L+ AL +++P P+Y++DE+DAALD  +   + + IK R K 
Sbjct: 1077 WKDSLIELSGGQRSLIALSLIMALLQFRPAPMYILDEVDAALDLSHTQNIGHLIKTRFKG 1136

Query: 1351 AQFIVISLRNNMFELAEQL 1369
            +QFIV+SL+  MF  A ++
Sbjct: 1137 SQFIVVSLKEGMFSNANRV 1155

 Score = 55.5 bits (132), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 48/160 (30%), Positives = 72/160 (45%), Gaps = 19/160 (11%)

Query: 674 RINGFHGRLGNLGVIDE---KYDVAIST-ACPRLNDIVVDSVECGQQCIEY--LRKNNLG 727
           + N  HG +G L  +D    +Y  A+ T A  RL ++VV   +   Q +E   LRK    
Sbjct: 519 KANFVHGVVGQLFQLDYDNIRYSTALQTCAGGRLFNVVVQDSQTATQLLERGRLRK---- 574

Query: 728 HARFILLDKL-------NKFSMEKISTPRNVPRLFDLIKVNDEKFLPAFYSVLRNTLVAN 780
               I LDK+           + K   P  V    +LIK  D+    A   +  N+L+  
Sbjct: 575 RVTIIPLDKIYARTINPQVLELAKTVAPGKVELAINLIKF-DKTVTKAMEFIFGNSLICE 633

Query: 781 DLKEANAVAYG-KTRYRVVTLKGNLIDISGTMSGGGNQAS 819
           D + A  + +  K R R +TL+G++ D  GT+SGG    S
Sbjct: 634 DPETAKKITFHPKIRIRSITLQGDVYDPEGTLSGGSKNTS 673

>ZYRO0D15642g Chr4 complement(1307703..1311215) [3513 bp, 1170 aa]
           {ON} similar to uniprot|P38989 Saccharomyces cerevisiae
           YFR031C SMC2 Component of the condensin complex
           essential SMC chromosomal ATPase family member that
           forms a complex with Smc4p to form the active ATPase
           Smc2p/Smc4p complex binds DNA possibly in the cleft
           formed by the coiled-coil of the folded dimer
          Length = 1170

 Score = 93.2 bits (230), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 56/185 (30%), Positives = 98/185 (52%), Gaps = 13/185 (7%)

Query: 146 LNKLVLHNFKSYAGTQTIGPFHSSFSAVVGPNGSGKSNVIDSMLFVFGFRA-NKMRQGKL 204
           + +L++  FKSYA    I  +   F+A+ G NGSGKSNV+D++ FV G  + + +R   L
Sbjct: 3   IEELIIDGFKSYATRTVISDWDPQFNAITGLNGSGKSNVLDAICFVLGIASMSTVRASSL 62

Query: 205 ADLIHKSEEYPDLTSCAVDVHFEYLIDYPDDTTKINPSKQP-LIITRRAFKNSTSKYYLN 263
            DLI+K  +   +T  +V + F  L       + I     P L +TR+     TSKY +N
Sbjct: 63  QDLIYKRGQ-AGVTKASVTIVFSNL---DPKCSPIGFENSPKLSVTRQIILGGTSKYLIN 118

Query: 264 GKESNYKTITALLKEEGIDLDHNRFLILQGEVENIAQMKPKAEKEGDDGLLEYLEDIIGT 323
           G  +  +++  L +   +++++  FLI+QG++  +  MKP         +L  +E+  GT
Sbjct: 119 GHRAPQQSVLQLFQSVQLNINNPNFLIMQGKITKVLNMKPSE-------ILSLIEEAAGT 171

Query: 324 TKYKE 328
             +++
Sbjct: 172 KMFED 176

 Score = 81.3 bits (199), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 32/73 (43%), Positives = 54/73 (73%), Gaps = 1/73 (1%)

Query: 1292 WR-NISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKN 1350
            W+ ++  LSGG+++L +L+L+ AL +++P P+Y++DE+DAALD  +   + + IK R K 
Sbjct: 1077 WKESLVELSGGQRSLIALSLIMALLQFRPAPMYILDEVDAALDLSHTQNIGHLIKTRFKG 1136

Query: 1351 AQFIVISLRNNMF 1363
            +QFIV+SL+  MF
Sbjct: 1137 SQFIVVSLKEGMF 1149

 Score = 42.7 bits (99), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 51/197 (25%), Positives = 86/197 (43%), Gaps = 33/197 (16%)

Query: 643 RQKANDARTSLSNVENRSKVLR-ALLKLQKSGRI-------NGFHGRLGNLGVIDEK-YD 693
           RQK    R  L NV   ++ LR ++  ++ +  +       N   G    L  + E  YD
Sbjct: 480 RQKEYSMRQELHNVGRETEYLRRSVANIEFNYTMPSEKFDPNSVKGVAAQLFTLSENNYD 539

Query: 694 VAIS---TACPRLNDIVVDSVECGQQCIEY--LRKNNLGHARFILLDKLNKFSMEKIST- 747
            A++    A  RL +++VD      Q +E   LRK        + +  LNK +   I++ 
Sbjct: 540 SALALQVCAGGRLFNVIVDDQNTASQLLERGKLRKR-------VTIIPLNKIATRVINSE 592

Query: 748 ---------PRNVPRLFDLIKVNDEKFLPAFYSVLRNTLVANDLKEANAVAYG-KTRYRV 797
                    P  V    +L+   +E+   A   +  N+LV ND + A  + +  + R R 
Sbjct: 593 SLKLAKQLAPGKVQLALNLVGY-EEEVSKAMEYIFGNSLVCNDAETAKRLTFHPQIRTRS 651

Query: 798 VTLKGNLIDISGTMSGG 814
           +T +G++ D  GT+SGG
Sbjct: 652 ITQQGDVYDPEGTLSGG 668

>Ecym_4390 Chr4 (816076..819588) [3513 bp, 1170 aa] {ON} similar to
           Ashbya gossypii AGR236W
          Length = 1170

 Score = 93.2 bits (230), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 57/183 (31%), Positives = 97/183 (53%), Gaps = 15/183 (8%)

Query: 149 LVLHNFKSYAGTQTIGPFHSSFSAVVGPNGSGKSNVIDSMLFVFGFRA-NKMRQGKLADL 207
           L++  FKSYA    I  +   F+A+ G NGSGKSN++DS+ FV G  +   +R   L DL
Sbjct: 6   LIIDGFKSYATRTVISDWDPQFNAITGLNGSGKSNILDSICFVLGISSMATVRAQNLQDL 65

Query: 208 IHKSEEYPDLTSCAVDVHFEYLIDYPD-DTTKINPSKQPLI-ITRRAFKNSTSKYYLNGK 265
           I+K  +   +   +V + F    D  D  ++ I   + P I +TR+     TSKY +NG 
Sbjct: 66  IYKRGQ-AGVIKASVTIVF----DNSDIKSSPIGFERYPKISVTRQIALGGTSKYLINGH 120

Query: 266 ESNYKTITALLKEEGIDLDHNRFLILQGEVENIAQMKPKAEKEGDDGLLEYLEDIIGTTK 325
            +  +T+  L +   +++++  FLI+QG++  +  MKP         +L  +E+  GT  
Sbjct: 121 RAQQQTVLHLFQSVQLNINNPNFLIMQGQITKVLNMKPTE-------ILSLIEEAAGTRM 173

Query: 326 YKE 328
           +++
Sbjct: 174 FED 176

 Score = 68.2 bits (165), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 33/73 (45%), Positives = 54/73 (73%), Gaps = 1/73 (1%)

Query: 1292 WR-NISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKN 1350
            W+ ++  LSGG+++L +L+L+ AL ++KP P+Y++DE+DAALD  +   + + IK R K 
Sbjct: 1077 WKESLVELSGGQRSLIALSLILALLQFKPAPMYILDEVDAALDLNHTQNIGHLIKTRFKG 1136

Query: 1351 AQFIVISLRNNMF 1363
            +QFIV+SL+  MF
Sbjct: 1137 SQFIVVSLKEGMF 1149

 Score = 41.6 bits (96), Expect = 0.020,   Method: Compositional matrix adjust.
 Identities = 40/155 (25%), Positives = 70/155 (45%), Gaps = 20/155 (12%)

Query: 675 INGFHGRLGNLGVIDEKYDVAIS---TACPRLNDIVVDSVECGQQCIE--YLRKNNLGHA 729
           + G   ++  LG   + +D A +    A  RL +I+VD+ +   Q +E   LRK      
Sbjct: 523 VKGVAAQVFTLG--KDNFDSANALQVCAGGRLFNIIVDNEKTASQLLEKGMLRK----RV 576

Query: 730 RFILLDKLN-------KFSMEKISTPRNVPRLFDLIKVNDEKFLPAFYSVLRNTLVANDL 782
             I L+K++         ++ K   P  V    +LI   +E    A   +   +L+  D 
Sbjct: 577 TIIPLNKISTRVLSDESLALAKKIAPGKVELALNLIGY-EEDVSKAMQYIFGGSLICADA 635

Query: 783 KEANAVAYG-KTRYRVVTLKGNLIDISGTMSGGGN 816
           + A  + +  + R R +TL G++ D  GT+SGG +
Sbjct: 636 ETAKKITFHPQIRARSITLDGDIYDPEGTLSGGSS 670

>Kpol_1063.20 s1063 (46233..49748) [3516 bp, 1171 aa] {ON}
           (46233..49748) [3516 nt, 1172 aa]
          Length = 1171

 Score = 92.8 bits (229), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 56/183 (30%), Positives = 96/183 (52%), Gaps = 15/183 (8%)

Query: 149 LVLHNFKSYAGTQTIGPFHSSFSAVVGPNGSGKSNVIDSMLFVFGFRA-NKMRQGKLADL 207
           L++  FKSYA    I  +   F+A+ G NGSGKSN++D++ FV G  +   +R   L DL
Sbjct: 6   LIIDGFKSYATRTVISDWDPQFNAITGLNGSGKSNILDAICFVLGISSMATVRASNLQDL 65

Query: 208 IHKSEEYPDLTSCAVDVHFEYLIDYPDDT-TKINPSKQPLI-ITRRAFKNSTSKYYLNGK 265
           I+K  +   +T  +V + F    D  D +   I     P I +TR+     TSKY +NG 
Sbjct: 66  IYKRGQ-AGVTKASVTIVF----DNSDKSNAPIGFESSPTISVTRQVALGGTSKYLINGH 120

Query: 266 ESNYKTITALLKEEGIDLDHNRFLILQGEVENIAQMKPKAEKEGDDGLLEYLEDIIGTTK 325
            +  +++  L +   +++++  FLI+QG++  +  MKP         +L  +E+  GT  
Sbjct: 121 RAPQQSVLHLFQSVQLNINNPNFLIMQGKITKVLNMKPTE-------ILSLIEEAAGTKM 173

Query: 326 YKE 328
           +++
Sbjct: 174 FED 176

 Score = 81.3 bits (199), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 32/73 (43%), Positives = 54/73 (73%), Gaps = 1/73 (1%)

Query: 1292 WR-NISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKN 1350
            W+ ++  LSGG+++L +L+L+ AL +++P P+Y++DE+DAALD  +   + + IK R K 
Sbjct: 1077 WKESLVELSGGQRSLIALSLIMALLQFRPAPMYILDEVDAALDLSHTQNIGHLIKTRFKG 1136

Query: 1351 AQFIVISLRNNMF 1363
            +QFIV+SL+  MF
Sbjct: 1137 SQFIVVSLKEGMF 1149

 Score = 35.0 bits (79), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 95/428 (22%), Positives = 183/428 (42%), Gaps = 53/428 (12%)

Query: 423 NKIDELRKLYTKNQDELQALLKD------------------------EKELVNAKRSLDS 458
           N+I EL++L TK  DEL +L +D                        E +L+N    L +
Sbjct: 258 NRIIELKELITKVTDELGSLNEDLEQIQVQKKNELDKNGKLAKLESNESKLMNEISRLKT 317

Query: 459 DNVSNTEQLKNIEKKLKKTAKEIEEDLKTISSSNVRLKNFHDNKKLFETQLIELDNNLVT 518
               + + L +   KLK   K +E + + +S+ +   +   +  K    QL E       
Sbjct: 318 SYKISEDNLSDTLSKLKSKGKNLEANKQELSNKSKMFEKIEEEYKGINIQLDEYKQTYKK 377

Query: 519 ESQLLENIKLDLKDKT---VGLSEEILKTEKDLEPWNIKLDELKSEIQIKESEKALFEES 575
           + +LL  +   +        G S ++   +  L   N+ +   KS I+I+  ++ L   +
Sbjct: 378 KEELLSTLSTGISSTGGTDGGYSAQLNNAKTKLNEANVSIK--KSNIKIEALQREL---A 432

Query: 576 KNKLKANIEALEKDVNEKSKLTEDRRKEVKNLMTKLENVSKEVIFGTNELKKANEKLCEM 635
            N+ K  +E+ +KD+    K  +   ++   +  K+    KE  +    +K+  +K   +
Sbjct: 433 SNEPK--MESAKKDLEISLKQIKQYEEQCSQIQLKI----KEHGYDAETVKELKQKKIAI 486

Query: 636 QKILIQDRQKANDARTSLSNVENRSKVLRALLKLQKSGRINGFHGRLGNLGVIDEKYDVA 695
           ++ L +  ++    +  ++N++          + Q    + G   RL +L   +  Y  A
Sbjct: 487 EQQLNKIERENEYLKRKVANIDFTYTKPTGDFQEQS---VKGVAARLFHLN--ENNYSSA 541

Query: 696 IS---TACPRLNDIVVDSVECGQQCIE--YLRKN-NLGHARFILLDKLN--KFSMEKIST 747
            +    A  RL ++VVD+ +   Q ++   LRK   +     I+  KLN    ++ K  +
Sbjct: 542 TALQVCAGGRLYNVVVDNEKTASQLLQRGRLRKRVTIIPLNKIMARKLNDKTLNIAKEIS 601

Query: 748 PRNVPRLFDLIKVNDEKFLPAFYSVLRNTLVANDLKEANAVAYG-KTRYRVVTLKGNLID 806
           P NV    +LI   +E    A   +  ++L+  D + A  V +  + R R +TL+G++ D
Sbjct: 602 PGNVELALNLIGY-EEDVAKAMEFIFGSSLICKDAETAKKVTFHPQVRTRSITLQGDVYD 660

Query: 807 ISGTMSGG 814
             GT+SGG
Sbjct: 661 PEGTLSGG 668

>KLTH0E04774g Chr5 (426535..430047) [3513 bp, 1170 aa] {ON} similar
           to uniprot|P38989 Saccharomyces cerevisiae YFR031C SMC2
           Component of the condensin complex essential SMC
           chromosomal ATPase family member that forms a complex
           with Smc4p to form the active ATPase Smc2p/Smc4p complex
           binds DNA possibly in the cleft formed by the
           coiled-coil of the folded dimer
          Length = 1170

 Score = 92.4 bits (228), Expect = 5e-18,   Method: Compositional matrix adjust.
 Identities = 57/184 (30%), Positives = 96/184 (52%), Gaps = 17/184 (9%)

Query: 149 LVLHNFKSYAGTQTIGPFHSSFSAVVGPNGSGKSNVIDSMLFVFGFRA-NKMRQGKLADL 207
           L++  FKSYA    I  +   F+A+ G NGSGKSN++D++ FV G  +   +R   L DL
Sbjct: 6   LIIDGFKSYATRTVISDWDPQFNAITGLNGSGKSNILDAICFVLGISSMATVRASNLQDL 65

Query: 208 IHKSEEYPDLTSCAVDVHFEYLIDYPDD--TTKINPSKQPLI-ITRRAFKNSTSKYYLNG 264
           I+K  +   +T  +V + F       DD   + I     P I +TR+     TSKY +NG
Sbjct: 66  IYKRGQ-AGVTKASVTIVF-----TNDDKANSPIGFESYPKISVTRQIVLGGTSKYLING 119

Query: 265 KESNYKTITALLKEEGIDLDHNRFLILQGEVENIAQMKPKAEKEGDDGLLEYLEDIIGTT 324
             +  +T+  L +   +++++  FLI+QG++  +  MKP         +L  +E+  GT 
Sbjct: 120 HRAQQQTVLHLFQSVQLNINNPNFLIMQGKITKVLNMKPSE-------ILSLIEEAAGTK 172

Query: 325 KYKE 328
            +++
Sbjct: 173 MFED 176

 Score = 68.2 bits (165), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 33/73 (45%), Positives = 54/73 (73%), Gaps = 1/73 (1%)

Query: 1292 WR-NISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKN 1350
            W+ ++  LSGG+++L +L+L+ AL ++KP P+Y++DE+DAALD  +   + + IK R K 
Sbjct: 1077 WKESLVELSGGQRSLIALSLILALLQFKPAPMYILDEVDAALDLSHTQNIGHLIKTRFKG 1136

Query: 1351 AQFIVISLRNNMF 1363
            +QFIV+SL+  MF
Sbjct: 1137 SQFIVVSLKEGMF 1149

 Score = 39.3 bits (90), Expect = 0.078,   Method: Compositional matrix adjust.
 Identities = 41/146 (28%), Positives = 67/146 (45%), Gaps = 19/146 (13%)

Query: 680 GRLGNLGVIDEK-YDVAIS---TACPRLNDIVVDSVECGQQCIEY--LRKNNLGHARFIL 733
           G    L  +DEK Y  A +    A  RL ++VVD+     Q +E   LRK        I 
Sbjct: 525 GVAAQLFSLDEKNYSSATALQVCAGGRLFNVVVDNEGTASQLLERGRLRK----RVTIIP 580

Query: 734 LDKLNKFSMEKIS-------TPRNVPRLFDLIKVNDEKFLPAFYSVLRNTLVANDLKEAN 786
           L+K++  S+ + +        P NV    +LI   +E+   A   +   +L+  D + A 
Sbjct: 581 LNKISARSLHQNAVKAAKELAPGNVELALNLIGY-EEEVSKAMEFIFGTSLICQDAETAK 639

Query: 787 AVAYG-KTRYRVVTLKGNLIDISGTM 811
            V +  + R R +TL+G++ D  GT+
Sbjct: 640 KVTFHPRVRARSITLQGDIYDPEGTL 665

>NCAS0E01920 Chr5 (368382..371894) [3513 bp, 1170 aa] {ON} Anc_7.186
          Length = 1170

 Score = 92.0 bits (227), Expect = 6e-18,   Method: Compositional matrix adjust.
 Identities = 54/179 (30%), Positives = 96/179 (53%), Gaps = 11/179 (6%)

Query: 149 LVLHNFKSYAGTQTIGPFHSSFSAVVGPNGSGKSNVIDSMLFVFGFRANKM-RQGKLADL 207
           L++  FKSYA    I  +   F+A+ G NGSGKSN++D++ FV G  +  + R   L DL
Sbjct: 6   LIIDGFKSYATRTVIADWDPQFNAITGLNGSGKSNILDAICFVLGISSMTIVRASNLQDL 65

Query: 208 IHKSEEYPDLTSCAVDVHFEYLIDYPDDTTKINPSKQPLIITRRAFKNSTSKYYLNGKES 267
           I+K  +   +T  +V + F+   D  +     N S + + +TR+     TSKY +NG  +
Sbjct: 66  IYKRGQ-AGVTKASVTIVFDN-SDKTNSPIGFNNSSK-ISVTRQIILGGTSKYLINGHRA 122

Query: 268 NYKTITALLKEEGIDLDHNRFLILQGEVENIAQMKPKAEKEGDDGLLEYLEDIIGTTKY 326
             +++  L +   +++++  FLI+QG++  +  MKP       + +L  +E+  GT  +
Sbjct: 123 PQQSVLQLFQSVQLNINNPNFLIMQGKITKVLNMKP-------NEILSLIEEAAGTKMF 174

 Score = 81.6 bits (200), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 32/73 (43%), Positives = 54/73 (73%), Gaps = 1/73 (1%)

Query: 1292 WRN-ISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKN 1350
            W++ +  LSGG+++L +L+L+ AL +++P P+Y++DE+DAALD  +   + + IK R K 
Sbjct: 1077 WKDSLVELSGGQRSLVALSLIMALLQFRPAPMYILDEVDAALDLSHTQNIGHLIKTRFKG 1136

Query: 1351 AQFIVISLRNNMF 1363
            +QFIV+SL+  MF
Sbjct: 1137 SQFIVVSLKEGMF 1149

 Score = 40.8 bits (94), Expect = 0.032,   Method: Compositional matrix adjust.
 Identities = 40/138 (28%), Positives = 60/138 (43%), Gaps = 18/138 (13%)

Query: 690 EKYDVAIS---TACPRLNDIVVDSVECGQQCIE--YLRKNNLGHARFILLDKL------- 737
           + +D A +    A  RL ++VVD+ +     +E   LRK        I L+K+       
Sbjct: 536 DHFDAASALQVCAGGRLYNVVVDNEKTASLLLEKGRLRK----RVTIIPLNKIAARTLNA 591

Query: 738 NKFSMEKISTPRNVPRLFDLIKVNDEKFLPAFYSVLRNTLVANDLKEANAVAYG-KTRYR 796
               M K   P  V    +LI  +DE    A   +   +LV  D   A  V +  + R R
Sbjct: 592 RTLQMAKDIAPGKVELALNLIGYDDE-VSRAMEFIFGGSLVCQDANTAKKVTFHPQIRTR 650

Query: 797 VVTLKGNLIDISGTMSGG 814
            +TL G++ D  GT+SGG
Sbjct: 651 SITLDGDVYDPEGTLSGG 668

>KNAG0L01160 Chr12 complement(206434..209946) [3513 bp, 1170 aa]
           {ON} Anc_7.186 YFR031C
          Length = 1170

 Score = 90.9 bits (224), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 52/181 (28%), Positives = 99/181 (54%), Gaps = 11/181 (6%)

Query: 149 LVLHNFKSYAGTQTIGPFHSSFSAVVGPNGSGKSNVIDSMLFVFGFRA-NKMRQGKLADL 207
           L++  FKSYA    I  + + F+A+ G NGSGKSN++D++ FV G  + + +R   + DL
Sbjct: 6   LIIDGFKSYATRTVISGWDAQFNAITGLNGSGKSNILDAICFVLGISSMSTVRASNMQDL 65

Query: 208 IHKSEEYPDLTSCAVDVHFEYLIDYPDDTTKINPSKQPLIITRRAFKNSTSKYYLNGKES 267
           I+K  +   +T  +V + F+   D  +     N S + + +TR+     TSKY +NG  +
Sbjct: 66  IYKRGQ-AGVTKASVTIVFDN-SDKSNSPIGFNDSLK-ISVTRQIVLGGTSKYLINGHRA 122

Query: 268 NYKTITALLKEEGIDLDHNRFLILQGEVENIAQMKPKAEKEGDDGLLEYLEDIIGTTKYK 327
             +++  L +   +++++  FLI+QG++  +  M+P         +L  +E+  GT  ++
Sbjct: 123 PQQSVLQLFQSVQLNINNPNFLIMQGKITKVLNMRPSE-------ILSLIEEAAGTKMFE 175

Query: 328 E 328
           +
Sbjct: 176 D 176

 Score = 80.9 bits (198), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 32/73 (43%), Positives = 54/73 (73%), Gaps = 1/73 (1%)

Query: 1292 WR-NISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKN 1350
            W+ ++  LSGG+++L +L+L+ AL +++P P+Y++DE+DAALD  +   + + IK R K 
Sbjct: 1077 WKESLIELSGGQRSLIALSLIMALLQFRPAPMYILDEVDAALDLSHTQNIGHLIKTRFKG 1136

Query: 1351 AQFIVISLRNNMF 1363
            +QFIV+SL+  MF
Sbjct: 1137 SQFIVVSLKEGMF 1149

 Score = 48.9 bits (115), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 76/302 (25%), Positives = 128/302 (42%), Gaps = 62/302 (20%)

Query: 676 NGFHGRLGNLGVIDEK--YDVAISTACP--RLNDIVVDSVECGQQCIEY--LRKNNLGHA 729
           N   G    L  +DE+  Y       C   RL ++VVD+     Q +E   LRK     A
Sbjct: 521 NSVKGIAAQLFSLDEQNFYSATALQVCAGGRLFNVVVDNENTAAQLLERGRLRK----RA 576

Query: 730 RFILLDKL-------NKFSMEKISTPRNVPRLFDLIKVNDEKFLPAFYSVLRNTLVANDL 782
             I L+K+       N  +M K   P  V    +LI   +E+   A   +  ++LV  D 
Sbjct: 577 TIIPLNKIAARTLNDNIVNMAKSVAPGRVELALNLIGY-EEEVRRAMEFIFGSSLVCKDA 635

Query: 783 KEANAVAYG-KTRYRVVTLKGNLIDISGTMSGGGNQASKGAMQLXXXXXXXXXXXXXXXV 841
           + A  V +  K R R +TL G++ D  GT+SGG    +   +                  
Sbjct: 636 EAAKMVTFNPKIRTRSITLDGDVYDPEGTLSGGSRNNTSSLL------------------ 677

Query: 842 MEIEKELSIREKNYQNAYNTVQEMEIELRNLKESEPKIELEIS----KLNFEIDSLENEC 897
           ++I++        Y N  N V+E+E +L ++ + +  I+ EIS     L  E++  +++ 
Sbjct: 678 IDIQR--------YNNNCNLVKELETKLNDIAK-KIAIQFEISNKTKNLQKELELAQHKL 728

Query: 898 SLKRKQLNEPNASFSIEDNMSADITEMDNALYTLNEKQKLIESQMKSKKDRIKELQDKIM 957
            L  + L    A+  I  N      E+++ +    E       ++K K  +IK+L+ +I 
Sbjct: 729 KLSERNLQSNTAAQLIRKN-----EELESEIAQCKE-------EIKDKTSQIKQLKKQIA 776

Query: 958 KI 959
           KI
Sbjct: 777 KI 778

>TPHA0C04440 Chr3 complement(958279..961791) [3513 bp, 1170 aa] {ON}
           Anc_7.186 YFR031C
          Length = 1170

 Score = 90.9 bits (224), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 56/189 (29%), Positives = 99/189 (52%), Gaps = 27/189 (14%)

Query: 149 LVLHNFKSYAGTQTIGPFHSSFSAVVGPNGSGKSNVIDSMLFVFGFRA-NKMRQGKLADL 207
           L++  FKSYA    I  +   F+A+ G NGSGKSN++D++ FV G  + + +R   L DL
Sbjct: 6   LIIDGFKSYATRTVISEWDPQFNAITGLNGSGKSNILDAICFVLGISSMSTVRASNLQDL 65

Query: 208 IHKSEEYPDLTSCAVDVHFEYLIDYPDDTTKINPSKQP--------LIITRRAFKNSTSK 259
           I+K  +   +T  +V + F       D++ K   SK P        + +TR+     TSK
Sbjct: 66  IYKRGQ-AGVTKASVTIVF-------DNSDK---SKAPIGFETSLTISVTRQIVLGGTSK 114

Query: 260 YYLNGKESNYKTITALLKEEGIDLDHNRFLILQGEVENIAQMKPKAEKEGDDGLLEYLED 319
           Y +NG  +  +++  L +   +++++  FLI+QG++  +  MKP         +L  +E+
Sbjct: 115 YLINGHRAPQQSVLHLFQSVQLNINNPNFLIMQGKITKVLNMKPTE-------ILALIEE 167

Query: 320 IIGTTKYKE 328
             GT  +++
Sbjct: 168 AAGTKMFED 176

 Score = 81.3 bits (199), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 33/75 (44%), Positives = 55/75 (73%), Gaps = 1/75 (1%)

Query: 1290 KSWR-NISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERT 1348
            K W+ ++  LSGG+++L +L+L+ AL +++P P+Y++DE+DAALD  +   + + IK R 
Sbjct: 1075 KLWKESLVELSGGQRSLIALSLIMALLQFRPAPMYILDEVDAALDLSHTQNIGHLIKTRF 1134

Query: 1349 KNAQFIVISLRNNMF 1363
            K +QFIV+SL+  MF
Sbjct: 1135 KGSQFIVVSLKEGMF 1149

 Score = 48.5 bits (114), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 45/150 (30%), Positives = 68/150 (45%), Gaps = 19/150 (12%)

Query: 680 GRLGNLGVIDEK-YDVAIS---TACPRLNDIVVDSVECGQQCIE--YLRKNNLGHARFIL 733
           G    L  ID++ YD A +    A  RL ++VVD+     + +E   LRK        I 
Sbjct: 525 GVAARLFTIDKQNYDSATALQVCAGGRLYNVVVDNETTASKLLEKGRLRK----RVTIIP 580

Query: 734 LDKL-------NKFSMEKISTPRNVPRLFDLIKVNDEKFLPAFYSVLRNTLVANDLKEAN 786
           L+K+       N  +  K   P  V    +LI   DE    A   +  ++L+ ND + A 
Sbjct: 581 LNKISARTIDNNTLNYAKQLAPGKVELALNLIGYEDE-VAKALQFIFGSSLICNDAETAK 639

Query: 787 AVAYG-KTRYRVVTLKGNLIDISGTMSGGG 815
            + +  K R R +TL G++ D  GT+SGG 
Sbjct: 640 KITFNPKIRTRSITLDGDVYDPEGTLSGGS 669

>TBLA0D04610 Chr4 complement(1139885..1143409) [3525 bp, 1174 aa]
           {ON} Anc_7.186 YFR031C
          Length = 1174

 Score = 90.5 bits (223), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 55/182 (30%), Positives = 96/182 (52%), Gaps = 13/182 (7%)

Query: 149 LVLHNFKSYAGTQTIGPFHSSFSAVVGPNGSGKSNVIDSMLFVFGFRA-NKMRQGKLADL 207
           L++  FKSYA    I  +   F+A+ G NGSGKSN++D++ FV G  +   +R   L DL
Sbjct: 6   LIIDGFKSYATRTVISDWDPQFNAITGLNGSGKSNILDAICFVLGISSMTTVRASNLQDL 65

Query: 208 IHKSEEYPDLTSCAVDVHFEYLIDYPDDTTKINPSKQPLI-ITRRAFKNSTSKYYLNGKE 266
           I+K  +   +T  +V + F+   D  +     N S  P I +TR+     TSKY +NG  
Sbjct: 66  IYKRGQ-AGVTKASVTIVFDN-TDKSNSPIGFNTS--PRISVTRQIVIGGTSKYLINGHR 121

Query: 267 SNYKTITALLKEEGIDLDHNRFLILQGEVENIAQMKPKAEKEGDDGLLEYLEDIIGTTKY 326
           +  +++  L +   +++++  FLI+QG++  +  MK          +L  +E+  GT  +
Sbjct: 122 APQQSVLQLFQSVQLNINNPNFLIMQGKITKVLNMKSTE-------ILSLIEEAAGTKMF 174

Query: 327 KE 328
           ++
Sbjct: 175 ED 176

 Score = 82.0 bits (201), Expect = 7e-15,   Method: Compositional matrix adjust.
 Identities = 34/79 (43%), Positives = 57/79 (72%), Gaps = 1/79 (1%)

Query: 1292 WR-NISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKN 1350
            W+ ++  LSGG+++L +L+L+ AL +++P P+Y++DE+DAALD  +   + + IK R K 
Sbjct: 1081 WKESLVELSGGQRSLVALSLILALLQFRPAPMYILDEVDAALDLSHTQNIGHLIKTRFKG 1140

Query: 1351 AQFIVISLRNNMFELAEQL 1369
            AQFIV+SL+  MF  A ++
Sbjct: 1141 AQFIVVSLKEGMFTNANRV 1159

>KLLA0D16005g Chr4 complement(1346492..1350004) [3513 bp, 1170 aa]
           {ON} similar to uniprot|P38989 Saccharomyces cerevisiae
           YFR031C SMC2 Component of the condensin complex
           essential SMC chromosomal ATPase family member that
           forms a complex with Smc4p to form the active ATPase
           Smc2p/Smc4p complex binds DNA possibly in the cleft
           formed by the coiled-coil of the folded dimer
          Length = 1170

 Score = 90.1 bits (222), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 55/185 (29%), Positives = 96/185 (51%), Gaps = 19/185 (10%)

Query: 149 LVLHNFKSYAGTQTIGPFHSSFSAVVGPNGSGKSNVIDSMLFVFGFRA-NKMRQGKLADL 207
           L++  FKSYA    I  +   F+A+ G NGSGKSN++D++ FV G  +   +R   L DL
Sbjct: 6   LIIDGFKSYATRTVITDWDPQFNAITGLNGSGKSNILDAICFVLGISSMATVRAQNLQDL 65

Query: 208 IHKSEEYPDLTSCAVDVHFEYLIDYPDDTTKINP----SKQPLIITRRAFKNSTSKYYLN 263
           I+K  +   +T  +V + F       +  T  +P    S   + ITR+      SKY +N
Sbjct: 66  IYKRGQ-AGVTKASVTIVFN------NSDTSNSPIGFESHAKISITRQIILGGVSKYLIN 118

Query: 264 GKESNYKTITALLKEEGIDLDHNRFLILQGEVENIAQMKPKAEKEGDDGLLEYLEDIIGT 323
           G  +  +T+  L +   +++++  FLI+QG++  +  MKP+        +L  +E+  GT
Sbjct: 119 GHRAQQQTVLQLFQSVQLNINNPNFLIMQGKITKVLNMKPQE-------ILSLIEEAAGT 171

Query: 324 TKYKE 328
             +++
Sbjct: 172 RMFED 176

 Score = 71.6 bits (174), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 44/140 (31%), Positives = 84/140 (60%), Gaps = 1/140 (0%)

Query: 1224 RDKVRKELEDLKKCRFNEFMESFNIISMTLKEMYQIITMGGNAELELVDSLDPFSEGVTF 1283
            + K+++ +E L + +    ++++  +S+    ++  +     A+LE  +  D  +EG+  
Sbjct: 1011 KQKIQETIEKLNEYKRETLIKTWEKVSVDFGNIFGDLLPNSFAKLEPSEGKD-VTEGLEV 1069

Query: 1284 SVMPPKKSWRNISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANY 1343
             V   K    ++  LSGG+++L +L+L+ AL ++KP P+Y++DE+DAALD  +   + + 
Sbjct: 1070 KVKLGKIWKESLVELSGGQRSLIALSLILALLQFKPAPMYILDEVDAALDLSHTQNIGHL 1129

Query: 1344 IKERTKNAQFIVISLRNNMF 1363
            IK R K +QFIV+SL+  MF
Sbjct: 1130 IKTRFKGSQFIVVSLKEGMF 1149

 Score = 37.0 bits (84), Expect = 0.40,   Method: Compositional matrix adjust.
 Identities = 41/157 (26%), Positives = 71/157 (45%), Gaps = 25/157 (15%)

Query: 675 INGFHGRLGNLGVIDEK-YDVAIS---TACPRLNDIVVDSVECGQQCIEY--LRKNNLGH 728
           ++   G +G L  +DE   D + +    A  RL ++VVD+     Q +E+  LRK     
Sbjct: 520 VSSVKGVVGQLFTLDEANIDSSAALQVCAGGRLFNVVVDNERTASQLLEHGRLRKR---- 575

Query: 729 ARFILLDKLNKFSMEKIS----------TPRNVPRLFDLIKVNDEKFLPAFYSVLRNTLV 778
              + +  LNK S  +I+           P  V    +LI   +E+   A   +   + +
Sbjct: 576 ---VTIIPLNKISSRRINESILHLAKELAPGKVELAINLIGF-EEEVTRAMEFIFGTSFI 631

Query: 779 ANDLKEANAVAYG-KTRYRVVTLKGNLIDISGTMSGG 814
             D + A  + +  + R R +TL+G++ D  GT+SGG
Sbjct: 632 CRDAETAKQITFNPRIRSRSITLQGDVYDPEGTLSGG 668

>Kwal_14.2435 s14 complement(756213..759956) [3744 bp, 1247 aa] {ON}
           YJL074C (SMC3) - SMC chromosomal ATPase family member
           [contig 224] FULL
          Length = 1247

 Score = 88.2 bits (217), Expect = 9e-17,   Method: Compositional matrix adjust.
 Identities = 165/728 (22%), Positives = 301/728 (41%), Gaps = 93/728 (12%)

Query: 134 SSKQEEKIERICLNKLVLHNFKSYAGTQTIGPFHSSFSAVVGPNGSGKSNVIDSMLFVFG 193
           +S +  +I  + +  +++  FK+Y     +  F   F+ V+G NGSGKSN   ++ FV  
Sbjct: 15  ASFRAREIVEMYIQSVLIQGFKTYRNITAVEDFSPHFNVVIGGNGSGKSNFFAAVRFVLS 74

Query: 194 FRANKMRQGKLADLIHKSEEYPDLTSCAVDVHFEYLIDYPDD----TTKINPSKQPLIIT 249
              + +++ +   LIH+       T   +  + E +   P D    T+ I  +++ ++  
Sbjct: 75  DDYSSLKREERQGLIHQG------TGSIMSAYVEIVFHDPSDQMMMTSGIPVTEEHIVRV 128

Query: 250 RRAFKNSTSKYYLNGKESNYKTITALLKEEGIDLDHNRFLILQGEVENIAQMKPKAEKEG 309
           RR       +Y +NGK  +   I+ + +  G    +   ++ QG +  +   K K     
Sbjct: 129 RRTIGLKKDEYSVNGKTCHKSDISRMFESVGFSASNPYNIVPQGRIVAVTNAKDKER--- 185

Query: 310 DDGLLEYLEDIIGTTKYKELIDKKFIEIEALNDICIERENRFDIIDRXXXXXXXXXXXXX 369
               L  LED++G   ++  + +   ++EA N       +R  I                
Sbjct: 186 ----LLLLEDVVGARSFEIKLRESSKKMEATN------RDRAKITSELSELKARLEELDE 235

Query: 370 XXXXXXXXQVIVKSKLI-QYKIWQNNIKLSNTLEKITKLEDEYNQEKNKNTELKNKIDEL 428
                   Q + + + I Q+ ++    +L+    +I  LEDEYN     + E    I EL
Sbjct: 236 ERQELEKYQELERDRRIFQFVLYDR--ELNEVTSQIESLEDEYNNVLQSSEEY---IQEL 290

Query: 429 RKL------YTKNQDELQALLKDE------------KELVNAKRSLDSDNVSNTEQLKNI 470
            K        TKN   ++A LK +            +E+V  K  L+        Q   +
Sbjct: 291 YKRETLIANLTKNISNVEAELKLKESTDFQQDKSRLQEIVKRKADLEIRYEETKRQRDQV 350

Query: 471 EKKL---KKTAKEIEEDLKTISSSNVRLKNFHDNKKL----FETQLIELDNNLVTESQLL 523
             +    +K    +EE+++  S+   RL   ++  KL    FE QL +       + +++
Sbjct: 351 HGQCAVYRKNLATVEEEIQNTSTQLNRLSPRYEQLKLEAEAFEAQLSQYQRK---QREII 407

Query: 524 ENIKLDLKDKTVGLSEEILKTEKDLEPWNIKLDELKSEIQIKESEKALFEESKNKLKANI 583
              K  +  +    SE      K+L     + D+LK  ++I E+EK   E+   +++ + 
Sbjct: 408 S--KRGIYAQFENQSERDAWIAKELSSLKAQTDDLKKNVEIMEAEK---EQVAAEIQQDK 462

Query: 584 EALEKDVNEKSKLTEDRR-----KEVKNLMTKLENVSK---EVIFGTNELKKANEKLCEM 635
           EA+       ++L +  R      E++++ T L ++ +   E I    EL ++ ++L  +
Sbjct: 463 EAI-------TELNDSVRGPGISSELQDIQTHLNDLKRSYLEKIDERKELWRSEQRLQTV 515

Query: 636 QKILIQD--RQKANDARTSLSNVENRSKVLRAL---LKLQKSGRINGFHGRLGNLGVIDE 690
            + L+    R + N + T   N+ N  K +R +   LKL         HG LG L  ++E
Sbjct: 516 SEALLDGVKRSERNLSETMDRNLANGLKAVREITQRLKLPP----GAVHGPLGELIKVNE 571

Query: 691 KY-DVAISTACPRLNDIVVDSVECGQQCIEYLRKNNLGHARFILLDKL---NKFSMEKIS 746
           KY   A +     L  +VVD+ E     +  L     G   FI L+++   N  +  + +
Sbjct: 572 KYKTCAEAVGGNSLLHVVVDTEETASILMSELYNTKAGRVTFIPLNRISDRNAVTFPENA 631

Query: 747 TPRNVPRLFDLIKVNDEKFLPAFYSVLRNTLVANDLKEANAVAYGKTRYRVVTLKGNLID 806
                P L+  IK  D+ F  A   V   T+V  DL   + +A        VTL G+  D
Sbjct: 632 QAECTPLLWK-IKY-DKVFEKAVRHVFGRTIVVRDLGNGSKLARSYN-LDAVTLDGDRAD 688

Query: 807 ISGTMSGG 814
             G ++GG
Sbjct: 689 NRGVITGG 696

 Score = 82.8 bits (203), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 41/104 (39%), Positives = 62/104 (59%), Gaps = 2/104 (1%)

Query: 1271 VDSLDPFSEGVTFSVMPPKKSWRN--ISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEI 1328
             D+LD    GV+ SV    K+     +  LSGG+KT+ ++AL+ A+    P P Y+ DEI
Sbjct: 1114 ADTLDSMYSGVSISVSFNSKNNEQLYVEQLSGGQKTVCAIALILAIQMVDPAPFYLFDEI 1173

Query: 1329 DAALDFRNVSIVANYIKERTKNAQFIVISLRNNMFELAEQLVGI 1372
            DAALD +  + VAN IKE + +AQFI  + R +M ++A+    +
Sbjct: 1174 DAALDKQYRTSVANTIKELSAHAQFICTTFRTDMLQVADSFYRV 1217

>SAKL0D06116g Chr4 complement(503196..506885) [3690 bp, 1229 aa]
           {ON} similar to uniprot|P47037 Saccharomyces cerevisiae
           YJL074C SMC3 Subunit of the multiprotein cohesin complex
           required for sister chromatid cohesion in mitotic cells
           also required with Rec8p for cohesion and recombination
           during meiosis phylogenetically conserved SMC
           chromosomal ATPase family member
          Length = 1229

 Score = 86.7 bits (213), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 159/723 (21%), Positives = 299/723 (41%), Gaps = 104/723 (14%)

Query: 144 ICLNKLVLHNFKSYAGTQTIGPFHSSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQGK 203
           + + ++ +  FK+Y  T  I  F    + V+G NGSGKSN   ++ FV     N +++ +
Sbjct: 1   MYIKRVTIQGFKTYKNTTLIDNFSPHHNVVIGSNGSGKSNFFAAIRFVLSDDYNNLKREE 60

Query: 204 LADLIHKSEEYPDLTSCAVDVHFEYLIDYPDD---TTKINPSKQPLIITRRAFKNSTSKY 260
              LIH+       +   +  + E + D  D        +PS    ++ RR       +Y
Sbjct: 61  RQGLIHQG------SGSVMSAYVEIVFDNSDGRLLNAAASPSSPDEVVIRRTIGLKKDEY 114

Query: 261 YLNGKESNYKTITALLKEEGIDLDHNRFLILQGEVENIAQMKPKAEKEGDDGLLEYLEDI 320
            LN K  +   I  LL+  G    +  +++ QG +  +   K       D   L+ L+++
Sbjct: 115 SLNSKSCSKIEIKNLLESAGFSTANPYYIVPQGRIVALTNAK-------DYERLQLLKEV 167

Query: 321 IGTTKY-KELIDKKFIEIEALNDICIERENRFDIIDRXXXXXXXXXXXXXXXXXXXXXQV 379
            G   + K+L D       +LN +     NR  I                          
Sbjct: 168 TGANSFEKKLRD-------SLNKMDATNRNRKKIDSELRELDEKLQELNEEREELEKYNA 220

Query: 380 IVKS-KLIQYKIWQNNIKLSNTLEKITKLEDEYNQEKNKNTELKNKIDELRKLYTKNQDE 438
           + +  K+ Q+ ++    +L++    I KL+ EYN          N +D   + Y +  D+
Sbjct: 221 LERDRKVFQFTLYDR--ELNDVTNHIEKLDSEYN----------NTVDSSEQ-YVQEMDK 267

Query: 439 LQALLKD-EKELVNAKRSLDSDNVSNTEQLK------------------NIEKKLKKTAK 479
            + L+ +  K LVN    L     ++ EQ K                   ++++++ T++
Sbjct: 268 REVLISNVTKNLVNIDAELKIKKSTDLEQSKANQLDVEEKKADLDVKCEELQRQIRSTSE 327

Query: 480 EIEED-------LKTISSSNVRLKNFHDNKKLFETQLIELDNNLVTESQLLENIKLDLKD 532
           + + D       L  IS    ++K        FE +L   ++   T+ +LL+  + DL  
Sbjct: 328 QAKTDESNLASVLNDISRKETQIKRISPR---FE-ELTREEHQFKTDLELLQQKQRDLLA 383

Query: 533 KTVGLSEEILKTEKDLEPW-NIKLDELKSEIQIKESEKALFEESKNKLKANIEALEKDVN 591
           K    ++   KT+++   W   ++ +LK E QI ES      + ++ L+  +  L++   
Sbjct: 384 KRGRYAQ--FKTQEERNGWIQSEIADLKQEAQILESTYQELSQERSDLQEQLAELDEQAK 441

Query: 592 EKSKLTEDRRKEVKNLMTKLENVSKEV-----IFGT-----NELKKANEKLCEMQKILIQ 641
           E +   +        +  +LE+++ E+     ++ T      EL ++ +KL  + + L+ 
Sbjct: 442 ELNDSIQG-----PGITAELEDLNSEISQLKQLYTTKIDERKELWRSEQKLQTILETLMD 496

Query: 642 DRQKANDA--RTSLSNVENRSKVLRAL---LKLQKSGRINGFHGRLGNLGVIDEKYDVAI 696
           D +++  +   T   ++ N  K +R +   LKL +    N  +G LG L  ++EKY    
Sbjct: 497 DVKRSERSVNETMDRSLANGLKAVREISERLKLPE----NAVYGPLGELIKVNEKYKTCA 552

Query: 697 STACP-RLNDIVVDSVECGQQCIEYLRKNNLGHARFILLDKLNKFSMEKISTP----RNV 751
            T     L  +VVD+ +     ++ L     G   F+ L++L+  +   ++ P     N 
Sbjct: 553 ETVGGNSLFHVVVDTEDTAGLLMQELYNVKGGRVTFMPLNRLH--ADNNVTYPSNEQSNC 610

Query: 752 PRLFDLIKVNDEKFLPAFYSVLRNTLVANDLKEANAVAYGKTRYRVVTLKGNLIDISGTM 811
             L   IK  DEKF  A   V   T+V  DL     +A  + +   +TL G+  D  G +
Sbjct: 611 TALIKKIKY-DEKFERAVKHVFGKTIVVRDLTLGTKLAR-QYKLNAITLDGDRADKRGVL 668

Query: 812 SGG 814
           +GG
Sbjct: 669 TGG 671

 Score = 81.3 bits (199), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 39/90 (43%), Positives = 58/90 (64%), Gaps = 2/90 (2%)

Query: 1280 GVTFSVM--PPKKSWRNISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNV 1337
            GV+ SV     +    ++  LSGG+KT+ ++AL+ A+ K  P P Y+ DEIDAALD +  
Sbjct: 1103 GVSISVSFNSRQDEQLHVEQLSGGQKTVCAIALILAIQKVDPAPFYLFDEIDAALDKQYR 1162

Query: 1338 SIVANYIKERTKNAQFIVISLRNNMFELAE 1367
            + VAN IKE + NAQFI  + R++M  +A+
Sbjct: 1163 TSVANTIKELSANAQFICTTFRSDMLRVAD 1192

>ZYRO0G21296g Chr7 (1747217..1750900) [3684 bp, 1227 aa] {ON} similar
            to uniprot|P47037 Saccharomyces cerevisiae YJL074C SMC3
            Subunit of the multiprotein cohesin complex required for
            sister chromatid cohesion in mitotic cells also required
            with Rec8p for cohesion and recombination during meiosis
            phylogenetically conserved SMC chromosomal ATPase family
            member
          Length = 1227

 Score = 85.1 bits (209), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 60/219 (27%), Positives = 112/219 (51%), Gaps = 39/219 (17%)

Query: 1196 DLDILEEYTRRMIE----YRQRKYDLNQSVEQRDKVRKELEDL----KKCRFNEFMESFN 1247
            D+  L    +R  E    + +++ +L +  E+ D+ +  +++L    K+ + N    +FN
Sbjct: 983  DISGLSNVNKRAFENFKKFGEKRTELEERAEELDESKSSIQNLITRLKRQKVNAVDSTFN 1042

Query: 1248 IISMTLKEMYQIITMGGNAEL---------------ELVD-------------SLDPFSE 1279
             +S    ++++ +   G A+L               E V+             S++    
Sbjct: 1043 KVSENFSKVFEKLVPRGTAKLIIHRNTDIQEDPNDDEDVNMSDGDENDESRSKSVEAMYS 1102

Query: 1280 GVTFSVM--PPKKSWRNISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNV 1337
            GV+ SV     K   +++  LSGG+KT+ ++AL+ A+   +P P Y+ DEIDAALD +  
Sbjct: 1103 GVSISVSFNSKKNEQQHVEQLSGGQKTVCAVALILAIQMVEPAPFYLFDEIDAALDKQYR 1162

Query: 1338 SIVANYIKERTKNAQFIVISLRNNMFELAEQLVGI-YKN 1375
            + VA+ IKE ++NAQFI  + R++M E+A++   + Y+N
Sbjct: 1163 TAVASTIKELSENAQFICTTFRSDMLEVADKFYRVKYEN 1201

 Score = 57.8 bits (138), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 42/186 (22%), Positives = 79/186 (42%), Gaps = 15/186 (8%)

Query: 144 ICLNKLVLHNFKSYAGTQTIGPFHSSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQGK 203
           + + ++V+  FK+Y     I  F    + V+G NGSGKSN   ++ FV       +++ +
Sbjct: 1   MYIRRVVIKGFKTYRNETIIDNFSPHHNIVIGSNGSGKSNFFAAIRFVLSNDYANLKREE 60

Query: 204 LADLIHKSEEYPDLTSCAVDVHFE---YLIDYPDDTTKINPSKQPLIITRRAFKNSTSKY 260
              LIH+      + S +V++ F    + I  P   + I P +   +  RR        Y
Sbjct: 61  RQGLIHQGS--GSVMSASVEIVFHDPSHRIILP---SGIPPRENDEVFVRRTVGLKKDDY 115

Query: 261 YLNGKESNYKTITALLKEEGIDLDHNRFLILQGEVENIAQMKPKAEKEGDDGLLEYLEDI 320
            LN +      +  +L+  G  + +   ++ QG +  +   K       D   L  LE++
Sbjct: 116 QLNDRNVTKSDVVRMLESAGFSMSNPYNIVPQGRIVALTNAK-------DRERLHLLEEV 168

Query: 321 IGTTKY 326
           +G   +
Sbjct: 169 VGAKSF 174

 Score = 44.7 bits (104), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 41/140 (29%), Positives = 62/140 (44%), Gaps = 9/140 (6%)

Query: 680 GRLGNLGVIDEKYD-VAISTACPRLNDIVVDSVECGQQCIEYLRKNNLGHARFILLDKLN 738
           G LG L  +++KY   A       L  IVVD+ E     I+ L +   G   F+ L+++ 
Sbjct: 537 GTLGELIKVNDKYKKCAEVVGGNSLFHIVVDTDETASLIIQELYRMKGGRVTFLPLNRV- 595

Query: 739 KFSMEKISTPRN----VPRLFDLIKVNDEKFLPAFYSVLRNTLVANDLKEANAVAYGKTR 794
            +S   I+ P N       L   I+  D +F  A   V   T+V  DL     +A  + R
Sbjct: 596 -YSDPNITYPPNEQASCTPLIKKIRY-DARFEKAVKQVFGKTIVVRDLSTGARLA-KRFR 652

Query: 795 YRVVTLKGNLIDISGTMSGG 814
              +TL G+  D  G ++GG
Sbjct: 653 LNAITLDGDRADKKGALTGG 672

>KAFR0A01610 Chr1 complement(326620..330303) [3684 bp, 1227 aa] {ON}
            Anc_1.295 YJL074C
          Length = 1227

 Score = 84.3 bits (207), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 42/103 (40%), Positives = 65/103 (63%), Gaps = 3/103 (2%)

Query: 1276 PFSEGVTFSVMPPKKS--WRNISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALD 1333
            P   GV+ SV    K+    ++  LSGG+KT+ ++AL+ A+    P P Y+ DEIDAALD
Sbjct: 1099 PMYTGVSISVSFNSKNDEQLHVEQLSGGQKTVCAIALILAIQMVDPAPFYLFDEIDAALD 1158

Query: 1334 FRNVSIVANYIKERTKNAQFIVISLRNNMFELAEQLVGI-YKN 1375
             +  + VAN +KE +KNAQFI  + R +M ++A++   + Y+N
Sbjct: 1159 KQYRTAVANTLKELSKNAQFICTTFRTDMLQVADKFFRVKYEN 1201

 Score = 60.8 bits (146), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 42/190 (22%), Positives = 83/190 (43%), Gaps = 18/190 (9%)

Query: 144 ICLNKLVLHNFKSYAGTQTIGPFHSSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQGK 203
           + + ++++  FK+Y     I  F    + ++G NGSGKSN+  ++ FV     + +++ +
Sbjct: 1   MYIKRVIIKGFKTYRNETIIDNFSPHHNIIIGSNGSGKSNLFAAIRFVLSDDYSNLKREE 60

Query: 204 LADLIHK-SEEYPDLTSCAVDVHFEYLIDYPDD------TTKINPSKQPLIITRRAFKNS 256
              LIH+ +     + SC+V++ F      PD+         I P     +  RR     
Sbjct: 61  RQGLIHQGTSGGSSVMSCSVEIVFH----DPDNRMILASNASIVPRPNNEVFIRRTVGLK 116

Query: 257 TSKYYLNGKESNYKTITALLKEEGIDLDHNRFLILQGEVENIAQMKPKAEKEGDDGLLEY 316
              Y +N +      I  +L+  G  + +   ++ QG++  +   K K         L+ 
Sbjct: 117 KDDYQINDRNVTKSDIVRILETAGFSMSNPYNIVPQGKIIALTNAKDKER-------LQL 169

Query: 317 LEDIIGTTKY 326
           LED++G   +
Sbjct: 170 LEDVVGAKSF 179

 Score = 41.2 bits (95), Expect = 0.024,   Method: Compositional matrix adjust.
 Identities = 65/246 (26%), Positives = 105/246 (42%), Gaps = 31/246 (12%)

Query: 577 NKLKANIEALEKDVNEKSKLTE---DRRKEVKNLMTKLENVSKEVIFGTNELKKANEKLC 633
           N++ +N+E L    NE+ +L     D+RKE+     KL+ +   V   +N+LK++   L 
Sbjct: 457 NEITSNMEGLTTQYNERKRLYSEKIDQRKELWRREQKLQAILDTV---SNDLKQSERNLN 513

Query: 634 EMQKILIQDRQKANDARTSLSNVENRSKVLRALLKLQKSGRINGFHGRLGNLGVIDEKYD 693
           E       DR        +LS+     K +   LKL      +   G +G L    EKY 
Sbjct: 514 ET-----MDR--------NLSHGIASIKEITQKLKLPP----DSVFGTVGELIKASEKYK 556

Query: 694 VAIS-TACPRLNDIVVDSVECGQQCIEYLRKNNLGHARFILLDKLNKFSMEKISTP--RN 750
             +      +L  I+VD+ E     ++ L +   G   FI L+K+  ++   I+ P    
Sbjct: 557 NCVEIIGGNQLFHIIVDTEETASLLMQELYRMKGGRVTFIPLNKI--YNDPNITYPPADQ 614

Query: 751 VPRLFDLIK--VNDEKFLPAFYSVLRNTLVANDLKEANAVAYGKTRYRVVTLKGNLIDIS 808
                 LIK    + KF  A   +   T+V  DL     +A  K +   +TL G+  D  
Sbjct: 615 YSSFTPLIKKLKYESKFEGAMKHIFGKTIVVKDLSYGLKLA-KKFKLNAITLDGDRADKR 673

Query: 809 GTMSGG 814
           G ++GG
Sbjct: 674 GVLTGG 679

>Kpol_1018.2 s1018 complement(5901..9536) [3636 bp, 1211 aa] {ON}
            complement(5901..9536) [3636 nt, 1212 aa]
          Length = 1211

 Score = 80.5 bits (197), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 51/185 (27%), Positives = 95/185 (51%), Gaps = 19/185 (10%)

Query: 1210 YRQRKYDLNQSVEQRD----KVRKELEDLKKCRFNEFMESFNIISMTLKEMYQIITMGGN 1265
            + ++K +LN+   + D     ++  +E LK+ +      +F  +S     +++ +   G 
Sbjct: 1001 FNEKKIELNERAAELDDSKVSIQNLIEKLKQQKVTAVDSTFKKVSENFSTVFEKLVPRGT 1060

Query: 1266 AELELV------------DSLDPFSEGVTFSVM--PPKKSWRNISNLSGGEKTLSSLALV 1311
            A+L +             +S +    G++ SV     K    ++  LSGG+KT+ ++AL+
Sbjct: 1061 AKLIIHRQEENKTRSKDKNSTESIYSGISISVSFNSKKNEQLHVEQLSGGQKTVCAIALI 1120

Query: 1312 FALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKNAQFIVISLRNNMFELAEQLVG 1371
             A+    P P Y+ DEIDAALD +  + VA+ IK  + NAQFI  + R +M ++A++   
Sbjct: 1121 LAIQMVDPAPFYLFDEIDAALDKQYRAAVADVIKSLSGNAQFICTTFRTDMLQVADKFFR 1180

Query: 1372 I-YKN 1375
            + Y+N
Sbjct: 1181 VKYEN 1185

 Score = 61.2 bits (147), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 41/186 (22%), Positives = 84/186 (45%), Gaps = 15/186 (8%)

Query: 144 ICLNKLVLHNFKSYAGTQTIGPFHSSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQGK 203
           + ++++V+  FK+Y     I  F  +++ V+G NGSGKSN   ++ FV     + +++ +
Sbjct: 1   MYIHRIVIKGFKTYRNETVIDFFSPNYNIVIGSNGSGKSNFFAAIRFVLSDDYSNLKREE 60

Query: 204 LADLIHKSEEYPDLTSCAVDVHFE---YLIDYPDDTTKINPSKQPLIITRRAFKNSTSKY 260
              LIH+      + S +V++ F    + +  P   + + P +   I  RR        Y
Sbjct: 61  RQGLIHQGS--GSVMSASVEIVFRDPGHRMILP---SGVVPRENDEIFIRRTVGLKKDDY 115

Query: 261 YLNGKESNYKTITALLKEEGIDLDHNRFLILQGEVENIAQMKPKAEKEGDDGLLEYLEDI 320
            +N +      +  +L+  G  + +   ++ QG +  +   K K         L+ LED+
Sbjct: 116 QVNDRNVTKSDVVRMLESAGFSMSNPYNIVPQGRIIAVTNAKDKER-------LQLLEDV 168

Query: 321 IGTTKY 326
           +G   +
Sbjct: 169 VGAKSF 174

 Score = 40.0 bits (92), Expect = 0.049,   Method: Compositional matrix adjust.
 Identities = 40/144 (27%), Positives = 63/144 (43%), Gaps = 9/144 (6%)

Query: 676 NGFHGRLGNLGVIDEKYD-VAISTACPRLNDIVVDSVECGQQCIEYLRKNNLGHARFILL 734
           +   G LG L  + EKY   A       L ++VVD+ E     +  L     G   F+ L
Sbjct: 533 DAVFGTLGELIKVSEKYKRCAEVIGGNSLFNVVVDTEETATIIMNELYHMKGGRVTFMPL 592

Query: 735 DKLNKFSMEKISTPRN----VPRLFDLIKVNDEKFLPAFYSVLRNTLVANDLKEANAVAY 790
           ++++  +   I+ P N       L   IK  D ++  A   +   T+V  DL E + +A 
Sbjct: 593 NRIHVDN--NITYPPNEQASCTPLIKKIKY-DVRYEKAVKHIFGRTIVVKDLLEGSKIA- 648

Query: 791 GKTRYRVVTLKGNLIDISGTMSGG 814
            K +   VTL G+  D  G ++GG
Sbjct: 649 KKLKLNAVTLDGDRADKMGVLTGG 672

>KNAG0B05230 Chr2 complement(1005244..1008921) [3678 bp, 1225 aa] {ON}
            Anc_1.295 YJL074C
          Length = 1225

 Score = 80.5 bits (197), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 43/105 (40%), Positives = 66/105 (62%), Gaps = 3/105 (2%)

Query: 1274 LDPFSEGVTFSV-MPPKKSWR-NISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAA 1331
            L+    GV+ SV    KK+ +  +  LSGG+KT+ ++AL+ A+    P P Y+ DEIDAA
Sbjct: 1095 LESVYTGVSISVSFSSKKNEQLRVEQLSGGQKTVCAIALILAIQMVDPAPFYLFDEIDAA 1154

Query: 1332 LDFRNVSIVANYIKERTKNAQFIVISLRNNMFELAEQLVGI-YKN 1375
            LD +  + VAN IK+ +KNAQFI  + R +M  +A++   + Y+N
Sbjct: 1155 LDKQYRTSVANAIKKLSKNAQFICTTFRTDMLAVADRFYRVKYEN 1199

 Score = 56.2 bits (134), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 42/187 (22%), Positives = 78/187 (41%), Gaps = 17/187 (9%)

Query: 144 ICLNKLVLHNFKSYAGTQTIGPFHSSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQGK 203
           + + ++V+  FK+Y     I  F    + V+G NGSGKSN   ++ FV     + +++ +
Sbjct: 1   MYIKRVVIKGFKTYRNETIIDNFSPHHNIVIGSNGSGKSNFFAAIRFVLSDDYSNLKREE 60

Query: 204 LADLIHKSEEYPDLTSCAVDVHFEYLIDYPDD----TTKINPSKQPLIITRRAFKNSTSK 259
              LIH+      + S +V++ F      PD     ++ + P     +  RR        
Sbjct: 61  RQGLIHQGS--GSVMSASVEIVFH----DPDHRIILSSGVIPRPNDEVFVRRTVGLKKDD 114

Query: 260 YYLNGKESNYKTITALLKEEGIDLDHNRFLILQGEVENIAQMKPKAEKEGDDGLLEYLED 319
           Y +N +      +  +L+  G  +     ++ QG +  +   K K         L  LED
Sbjct: 115 YQINDRNVTKSDLVRMLESAGFSMGSPYNIVPQGRIIALTNAKDKER-------LLLLED 167

Query: 320 IIGTTKY 326
           +IG   +
Sbjct: 168 VIGAKSF 174

>TBLA0C02740 Chr3 (656941..660300) [3360 bp, 1119 aa] {ON} Anc_1.295
            YJL074C
          Length = 1119

 Score = 80.5 bits (197), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 46/142 (32%), Positives = 80/142 (56%), Gaps = 4/142 (2%)

Query: 1231 LEDLKKCRFNEFMESFNIISMTLKEMYQIITMGGNAELELVDSLDPFSEGVTFSVMPPKK 1290
            +++LK+ + N    +FN +S    ++++ +   G  EL +      +S GV+  V    K
Sbjct: 952  IDNLKEQKVNAVERTFNQVSENFSDIFEQLVPRGTGELVIGRQGQEYS-GVSIQVSFNSK 1010

Query: 1291 S--WRNISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERT 1348
            +     I  LSGG+KT+ ++AL+ A+ +  P P Y+ DEIDAALD      V+  IK  +
Sbjct: 1011 NDEQLQIEQLSGGQKTVCAIALILAIQQVDPAPFYLFDEIDAALDKEYRKSVSQVIKRLS 1070

Query: 1349 KNA-QFIVISLRNNMFELAEQL 1369
            +N  QFI+ + R++M E+A+ +
Sbjct: 1071 QNGTQFILTTFRSDMIEIADMI 1092

 Score = 51.6 bits (122), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 43/141 (30%), Positives = 67/141 (47%), Gaps = 5/141 (3%)

Query: 677 GFHGRLGNLGVIDEKYDVAIST-ACPRLNDIVVDSVECGQQCIEYLRKNNLGHARFILLD 735
             +G LG L  + EKY   +   A   L +I+VD+ E   Q +  L +   G   FI L+
Sbjct: 460 SIYGTLGELIKVSEKYKRCVEIIAGNSLFNIIVDTDETASQIMNELIRMQNGRVTFIPLN 519

Query: 736 KL-NKFSMEKISTPR-NVPRLFDLIKVNDEKFLPAFYSVLRNTLVANDLKEANAVAYGKT 793
           ++ N  ++   S    N   L   IK  D+KF     +V   T+V  DL+  N +   + 
Sbjct: 520 RIENGVNINYPSNEESNCTALIKKIKY-DKKFEKVIRNVFGKTIVVKDLQLGNRLC-KEF 577

Query: 794 RYRVVTLKGNLIDISGTMSGG 814
           + + +TL G+ ID  G +SGG
Sbjct: 578 KLQAITLDGDRIDSKGVVSGG 598

>KLTH0H09966g Chr8 complement(859362..863036) [3675 bp, 1224 aa] {ON}
            similar to uniprot|P47037 Saccharomyces cerevisiae
            YJL074C SMC3 Subunit of the multiprotein cohesin complex
            required for sister chromatid cohesion in mitotic cells
            also required with Rec8p for cohesion and recombination
            during meiosis phylogenetically conserved SMC chromosomal
            ATPase family member
          Length = 1224

 Score = 80.5 bits (197), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 40/100 (40%), Positives = 62/100 (62%), Gaps = 2/100 (2%)

Query: 1272 DSLDPFSEGVTFSVMPPKKSWRN--ISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEID 1329
            DS++    GV+ SV    K+     +  LSGG+KT+ ++AL+ A+    P P Y+ DEID
Sbjct: 1092 DSIETMYSGVSISVSFNSKNNEQLYVEQLSGGQKTVCAIALILAIQMVDPAPFYLFDEID 1151

Query: 1330 AALDFRNVSIVANYIKERTKNAQFIVISLRNNMFELAEQL 1369
            AALD +  + VAN IKE + +AQFI  + R++M ++A+  
Sbjct: 1152 AALDKQYRTSVANVIKELSVHAQFICTTFRSDMLQVADSF 1191

 Score = 78.2 bits (191), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 160/728 (21%), Positives = 291/728 (39%), Gaps = 113/728 (15%)

Query: 144 ICLNKLVLHNFKSYAGTQTIGPFHSSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQGK 203
           + +  +V+  FK+Y  T ++      F+ ++G NGSGKSN   ++ FV     + +++ +
Sbjct: 1   MYIKSVVIQGFKTYKNTTSVEGLSPRFNVIIGGNGSGKSNFFAAVRFVLSDDYSNLKREE 60

Query: 204 LADLIHKSEEYPDLTSCAVDVHFEYLIDYPDD----TTKINPSKQPLIITRRAFKNSTSK 259
              LIH+       T   +  + E +   P      T+ I  +++ ++  RR       +
Sbjct: 61  RQGLIHQG------TGSVMSAYVEIIFHDPSGQMMITSGIPMTEEHIVRVRRTIGLKKDE 114

Query: 260 YYLNGKESNYKTITALLKEEGIDLDHNRFLILQGEVENIAQMKPKAEKEGDDGLLEYLED 319
           Y +NGK  +   I+ + +  G    +   ++ QG +  +   K       D   L  LE+
Sbjct: 115 YSVNGKTCHKSDISRMFESVGFSAVNPYNIVPQGRIVAVTNAK-------DRERLALLEE 167

Query: 320 IIGTTKYKELIDKKFIEIEALNDICIERENRFDIIDRXXXXXXXXXXXXXXXXXXXXXQV 379
           ++G   ++  + +   ++EA N       +R  I                        Q 
Sbjct: 168 VVGAKSFEIKLRESAKKMEATN------RDRTRIDSELAELRTRLDELNEERQELEKYQK 221

Query: 380 IVKSKLI-QYKIWQNNIKLSNTLEKITKLEDEYN----------QEKNKNTEL------- 421
           + + + I Q+ ++    +L+    +I  LEDEYN          QE  K  EL       
Sbjct: 222 LERDRRIFQFVLYDR--ELNEVTSQIESLEDEYNHVLQSSEEFLQELYKREELIENVTKN 279

Query: 422 -KNKIDELR--------------KLYTKNQDELQALLKDEKELVNAKR---SLDSDNVSN 463
             N   ELR              +  +K + +L+  L++ K    A +   S+D +N+  
Sbjct: 280 ISNIETELRVKESMDLQQEKSRLQEISKRKADLEVHLEEAKRQAEAHKKQTSVDQNNLKT 339

Query: 464 TEQLKNIEKK-------------LKKTAKEIEEDLKTISSSNVRLKNFHDNKKLFETQLI 510
            E+   IEKK             LK  ++E E  L     S   + +       F+++ +
Sbjct: 340 VEE--EIEKKSLQLERLIPRFEQLKSESQEFESQLSNYQRSQREIVSKRGIYAQFKSK-V 396

Query: 511 ELDNNLVTESQLLENIKLDLKDKTVGLSEEILKTEKDLEPWNIKLDELKSEIQIKESEKA 570
           E D  L  E   L+    DL ++   L+ E  +T  ++E +N ++ EL   ++    +  
Sbjct: 397 ERDEWLKNEIASLKAQHQDLAEQLAALTREKEQTGSEVEVFNEEITELNDSVRGPGIQAE 456

Query: 571 LFEESKNKLKANIEALEKDVNEKSKLTEDRRKEVKNLMTKLENVSKEVIFGTNELKKANE 630
           L       L++++++L++    K     D RKE+     K   VS  +  G   +K++  
Sbjct: 457 L-----QDLQSHLDSLKQSYLGKI----DERKELWRAEQKFLTVSDALNDG---VKRSER 504

Query: 631 KLCEMQKILIQDRQKANDARTSLSNVENRSKVLRALLKLQKSGRINGFHGRLGNLGVIDE 690
            L E       DR  A+  R ++  +  R       LKL      +  HG LG L  ++E
Sbjct: 505 NLSET-----MDRGLASGLR-AVREISER-------LKLP----ADSVHGPLGELIKVNE 547

Query: 691 KYDV-AISTACPRLNDIVVDSVECGQQCIEYLRKNNLGHARFILLDKL---NKFSMEKIS 746
           KY   A +     L  +VVD+ E     +E L     G   FI L+++   N  +    S
Sbjct: 548 KYKACAEAVGGNALLHVVVDTDETASILMEELYNTKAGRVTFIPLNRIADSNPVTFPDNS 607

Query: 747 TPRNVPRLFDLIKVNDEKFLPAFYSVLRNTLVANDLKEANAVAYGKTRYRVVTLKGNLID 806
                P ++ +    +++F  A   V   T+V  D+   + +A        VTL G+  D
Sbjct: 608 QAECTPLIWKM--KYEKRFEKAVRHVFGRTIVVRDIGTGSKLAKS-FNLDAVTLDGDRTD 664

Query: 807 ISGTMSGG 814
             G ++GG
Sbjct: 665 KRGLITGG 672

>NCAS0A09330 Chr1 (1844122..1847805) [3684 bp, 1227 aa] {ON} Anc_1.295
            YJL074C
          Length = 1227

 Score = 80.1 bits (196), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 41/110 (37%), Positives = 68/110 (61%), Gaps = 3/110 (2%)

Query: 1269 ELVDSLDPFSEGVTFSVMPPKKS--WRNISNLSGGEKTLSSLALVFALHKYKPTPLYVMD 1326
            E++++ +    GV+ SV    K     ++  LSGG+KT+ ++AL+ A+    P P Y+ D
Sbjct: 1092 EVINNNESIYTGVSISVSFNSKENEQLHVEQLSGGQKTVCAIALILAIQMVDPAPFYLFD 1151

Query: 1327 EIDAALDFRNVSIVANYIKERTKNAQFIVISLRNNMFELAEQLVGI-YKN 1375
            EIDAALD +  + VAN IK+ + NAQFI  + R +M ++A++   + Y+N
Sbjct: 1152 EIDAALDKQYRTAVANIIKQLSVNAQFICTTFRTDMLQVADRFFRVKYEN 1201

 Score = 58.2 bits (139), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 42/186 (22%), Positives = 82/186 (44%), Gaps = 13/186 (6%)

Query: 144 ICLNKLVLHNFKSYAGTQTIGPFHSSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQGK 203
           + + ++V+  FK+Y     I  F    + V+G NGSGKSN   ++ FV     + +++ +
Sbjct: 1   MYIKRVVIKGFKTYRNQTVIDDFSPHHNIVIGSNGSGKSNFFSAIRFVLSDDYSNLKREE 60

Query: 204 LADLIHKSEEYPDLTSCAVDVHF---EYLIDYPDDTTKINPSKQPLIITRRAFKNSTSKY 260
              LIH+      + S +V++ F   E+ +  P        + +  I  RR        Y
Sbjct: 61  RQGLIHQGSG-GSVMSASVEIVFHDPEHKMILPSGVVPRENNDE--ICIRRTVGLKKDDY 117

Query: 261 YLNGKESNYKTITALLKEEGIDLDHNRFLILQGEVENIAQMKPKAEKEGDDGLLEYLEDI 320
            LN +      +  +L+  G  + +   ++ QG++ ++   K K         L+ LED+
Sbjct: 118 QLNDRNVTKGDVVRMLESTGFSMSNPYNIVPQGKIISLTNAKDKER-------LQLLEDV 170

Query: 321 IGTTKY 326
           +G   +
Sbjct: 171 VGAKSF 176

>TDEL0D01620 Chr4 complement(321963..325634) [3672 bp, 1223 aa] {ON}
            Anc_1.295 YJL074C
          Length = 1223

 Score = 79.7 bits (195), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 40/99 (40%), Positives = 61/99 (61%), Gaps = 3/99 (3%)

Query: 1280 GVTFSVMPPKKSWR--NISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNV 1337
            GV+ SV    K  R  ++  LSGG+KT+ ++AL+ A+    P P Y+ DEIDAALD +  
Sbjct: 1099 GVSISVSFNSKKTRQLHVEQLSGGQKTVCAVALILAIQMVDPAPFYLFDEIDAALDKQYR 1158

Query: 1338 SIVANYIKERTKNAQFIVISLRNNMFELAEQLVGI-YKN 1375
            + VA  IK  + NAQFI  + R +M ++A++   + Y+N
Sbjct: 1159 TAVAGIIKALSANAQFICTTFRTDMLQVADKFFRVKYEN 1197

 Score = 61.6 bits (148), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 41/186 (22%), Positives = 83/186 (44%), Gaps = 15/186 (8%)

Query: 144 ICLNKLVLHNFKSYAGTQTIGPFHSSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQGK 203
           + + ++++  FK+Y     I  F    + V+G NGSGKSN   ++ FV     + +++ +
Sbjct: 1   MYIRRVIIKGFKTYRNETVIDDFSPHHNIVIGSNGSGKSNFFAAIRFVLSGDYSNLKREE 60

Query: 204 LADLIHKSEEYPDLTSCAVDVHF---EYLIDYPDDTTKINPSKQPLIITRRAFKNSTSKY 260
              LIH+      + S +V++ F   ++ I  P   + + P     ++ RR        Y
Sbjct: 61  RQGLIHQGS--GSVMSASVEIVFHDPDHRIILP---SGVAPRSNDEVLVRRTVGLKKDDY 115

Query: 261 YLNGKESNYKTITALLKEEGIDLDHNRFLILQGEVENIAQMKPKAEKEGDDGLLEYLEDI 320
            LN +      +  +L+  G  +++   ++ QG +  +   K K         L+ LED+
Sbjct: 116 QLNDRNVTKGDVVRMLESAGFSMNNPYNIVPQGRIIALTNAKDKER-------LQLLEDV 168

Query: 321 IGTTKY 326
           +G   +
Sbjct: 169 VGAKSF 174

 Score = 46.2 bits (108), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 48/156 (30%), Positives = 75/156 (48%), Gaps = 18/156 (11%)

Query: 673 GRINGFHGRLGNLGVIDEKYDV-AISTACPRLNDIVVDSVECGQQCIEYLRKNNLGHARF 731
           GR+    G LG L  ++EKY + A       L  IVVD+ E     I+ L +   G   F
Sbjct: 533 GRV---FGTLGELIKVNEKYKMCAEVVGGNSLFHIVVDTDETASLMIQELYRMRGGRVTF 589

Query: 732 ILLDKLNKFSMEKISTPRNV-PRLFDLIKVNDEKFLPAFYSVLRN----TLVANDLKEAN 786
           + L+++  ++   I+ P N       LIK    KF   F SV++N    T+V  DL   +
Sbjct: 590 MPLNRI--YNDPNITYPPNAQSSCTPLIK--KIKFDAQFESVVKNVFGKTIVVRDLAAGS 645

Query: 787 AVAYGKTRYRV--VTLKGNLIDISGTMSGGGNQASK 820
            +A     Y++  +TL G+  D SG ++GG ++  K
Sbjct: 646 KIA---KHYKLDAITLDGDRADKSGLLTGGYHEHHK 678

>NDAI0G05630 Chr7 complement(1393671..1397360) [3690 bp, 1229 aa] {ON}
            Anc_1.295 YJL074C
          Length = 1229

 Score = 79.0 bits (193), Expect = 8e-14,   Method: Compositional matrix adjust.
 Identities = 40/105 (38%), Positives = 63/105 (60%), Gaps = 3/105 (2%)

Query: 1274 LDPFSEGVTFSVMPPKKS--WRNISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAA 1331
            ++P   GV+ SV    K     ++  LSGG+KT+ ++AL+ A+    P P Y+ DEIDAA
Sbjct: 1099 IEPIYTGVSISVSFNSKENEQLHVEQLSGGQKTVCAIALILAIQMVDPAPFYLFDEIDAA 1158

Query: 1332 LDFRNVSIVANYIKERTKNAQFIVISLRNNMFELAEQLVGI-YKN 1375
            LD +  + VA  I++ + NAQFI  + R +M E+A+    + Y+N
Sbjct: 1159 LDKQYRTSVAKLIEKLSANAQFICTTFRTDMLEVADTFFRVKYEN 1203

 Score = 58.5 bits (140), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 42/186 (22%), Positives = 82/186 (44%), Gaps = 14/186 (7%)

Query: 144 ICLNKLVLHNFKSYAGTQTIGPFHSSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQGK 203
           + + ++V+  FK+Y     I  F    + V+G NGSGKSN   ++ FV     + +++ +
Sbjct: 1   MYIKRVVIKGFKTYRNETIIDNFSPHHNIVIGSNGSGKSNFFSAIRFVLSDDYSNLKREE 60

Query: 204 LADLIHKSEEYPDLTSCAVDVHFE---YLIDYPDDTTKINPSKQPLIITRRAFKNSTSKY 260
              LIH+      + S +V++ F    + I  P   + + P +   +  RR        Y
Sbjct: 61  RQGLIHQGSGGA-VMSASVEIVFHDPNHKIILP---SGVVPRENDEVYIRRTVGLKKDDY 116

Query: 261 YLNGKESNYKTITALLKEEGIDLDHNRFLILQGEVENIAQMKPKAEKEGDDGLLEYLEDI 320
            LN +      +  +L+  G  +++   ++ QG++  +   K K         L  LED+
Sbjct: 117 QLNDRNVTKGDVVRMLESTGFSMNNPYNIVPQGKIIALTNAKDKER-------LNLLEDV 169

Query: 321 IGTTKY 326
           +G   +
Sbjct: 170 VGAKSF 175

 Score = 43.9 bits (102), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 63/242 (26%), Positives = 102/242 (42%), Gaps = 28/242 (11%)

Query: 579 LKANIEALEK---DVNEKSKLTEDRRKEVKNLMTKLENVSKEVIFGTNELKKANEKLCEM 635
           + A +E LE    D+ ++   + D+RKE+     KLE V + ++   + +K +   + E 
Sbjct: 454 INAELEDLESNIDDIKQQYNSSIDQRKELWRNEQKLETVLQTIL---DNVKDSERAVGET 510

Query: 636 QKILIQDRQKANDARTSLSNVENRSKVLRALLKLQKSGRINGFHGRLGNLGVIDEKYDVA 695
                 DR  AN  ++         K +   LKL +    +   G LG L  ++ KY   
Sbjct: 511 -----MDRSLANGLKS--------VKEIAEKLKLPE----DSVFGTLGELVSVNSKYKTC 553

Query: 696 IST-ACPRLNDIVVDSVECGQQCIEYLRKNNLGHARFILLDKLNKFSMEKISTPRNVPRL 754
                   L  ++VD+ E   + ++ L +   G   FI L+K+  F       P +    
Sbjct: 554 AEVIGGNSLFHVIVDTEETASKIMKELYRMKGGRVTFIPLNKV-YFDNSITFPPEDQSSY 612

Query: 755 FDLIK--VNDEKFLPAFYSVLRNTLVANDLKEANAVAYGKTRYRVVTLKGNLIDISGTMS 812
             LIK    DEKF  A   V   T+V  DL     +A  K +   +TL G+  D  G ++
Sbjct: 613 TPLIKKIKYDEKFDKAVKHVFGKTIVVKDLSTGLKLA-KKYKLSAITLDGDRADKRGVLT 671

Query: 813 GG 814
           GG
Sbjct: 672 GG 673

>Smik_10.167 Chr10 complement(290936..294625) [3690 bp, 1229 aa] {ON}
            YJL074C (REAL)
          Length = 1229

 Score = 79.0 bits (193), Expect = 8e-14,   Method: Compositional matrix adjust.
 Identities = 55/199 (27%), Positives = 100/199 (50%), Gaps = 33/199 (16%)

Query: 1210 YRQRKYDLNQSVEQRDKVRKELEDL----KKCRFNEFMESFNIISMTLKEMYQIITMGGN 1265
            + +++ DL++   + D+ +  ++DL    K+ + N    +F  +S   + +++ +   G 
Sbjct: 1005 FDEKRKDLSERASELDESKDSIQDLIVKLKQQKVNAVDSTFQKVSENFEAVFERLVPRGI 1064

Query: 1266 AELEL---------VDSLDP-----------------FSEGVTFSVMPPKKS--WRNISN 1297
            A+L +         +DS+D                     GV+ SV    K     ++  
Sbjct: 1065 AKLVIHRRDDTKDQMDSIDDDMDVASSERTSSKDGDIMYTGVSISVSFNSKQNEQLHVEQ 1124

Query: 1298 LSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKNAQFIVIS 1357
            LSGG+KT+ ++AL+ A+    P   Y+ DEIDAALD +  + VA  IKE +KNAQFI  +
Sbjct: 1125 LSGGQKTVCAIALILAIQMVDPASFYLFDEIDAALDKQYRTAVATLIKELSKNAQFICTT 1184

Query: 1358 LRNNMFELAEQLVGI-YKN 1375
             R +M ++A++   + Y+N
Sbjct: 1185 FRTDMLQVADKFFRVKYEN 1203

 Score = 57.0 bits (136), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 42/188 (22%), Positives = 82/188 (43%), Gaps = 18/188 (9%)

Query: 144 ICLNKLVLHNFKSYAGTQTIGPFHSSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQGK 203
           + + ++++  FK+Y     I  F    + ++G NGSGKSN   ++ FV     + +++ +
Sbjct: 1   MYIKRVIIKGFKTYRNETIIDNFSPHQNVIIGSNGSGKSNFFAAIRFVLSDDYSNLKREE 60

Query: 204 LADLIHKSEEYPDLTSCAVDVHFEYLIDYPDDTTKINPS-----KQPLIITRRAFKNSTS 258
              LIH+      + S +V++ F     +  D + I PS         +  RR       
Sbjct: 61  RQGLIHQG-SGGSVMSASVEIVF-----HDPDHSMILPSGVLSRGDDEVTIRRTVGLKKD 114

Query: 259 KYYLNGKESNYKTITALLKEEGIDLDHNRFLILQGEVENIAQMKPKAEKEGDDGLLEYLE 318
            Y LN +      I  +L+  G  +++   ++ QG++  +   K K         L+ LE
Sbjct: 115 DYQLNDRNVTKGDIVRMLETAGFSMNNPYNIVPQGKIVALTNAKDKER-------LQLLE 167

Query: 319 DIIGTTKY 326
           D++G   +
Sbjct: 168 DVVGAKSF 175

>YJL074C Chr10 complement(299157..302849) [3693 bp, 1230 aa] {ON}
            SMC3Subunit of the multiprotein cohesin complex required
            for sister chromatid cohesion in mitotic cells; also
            required, with Rec8p, for cohesion and recombination
            during meiosis; phylogenetically conserved SMC
            chromosomal ATPase family member
          Length = 1230

 Score = 77.4 bits (189), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 56/200 (28%), Positives = 99/200 (49%), Gaps = 34/200 (17%)

Query: 1210 YRQRKYDLNQSVEQRDKVRKELEDL----KKCRFNEFMESFNIISMTLKEMYQIITMGGN 1265
            + +R+ DL +   + D+ +  ++DL    K+ + N    +F  +S   + +++ +   G 
Sbjct: 1005 FNERRKDLAERASELDESKDSIQDLIVKLKQQKVNAVDSTFQKVSENFEAVFERLVPRGT 1064

Query: 1266 AEL-------------ELVD-SLDPFSE-------------GVTFSVMPPKKS--WRNIS 1296
            A+L             E +D  +D  S              GV+ SV    K     ++ 
Sbjct: 1065 AKLIIHRKNDNANDHDESIDVDMDAESNESQNGKDSEIMYTGVSISVSFNSKQNEQLHVE 1124

Query: 1297 NLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKNAQFIVI 1356
             LSGG+KT+ ++AL+ A+    P   Y+ DEIDAALD +  + VA  +KE +KNAQFI  
Sbjct: 1125 QLSGGQKTVCAIALILAIQMVDPASFYLFDEIDAALDKQYRTAVATLLKELSKNAQFICT 1184

Query: 1357 SLRNNMFELAEQLVGI-YKN 1375
            + R +M ++A++   + Y+N
Sbjct: 1185 TFRTDMLQVADKFFRVKYEN 1204

 Score = 57.0 bits (136), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 42/188 (22%), Positives = 82/188 (43%), Gaps = 18/188 (9%)

Query: 144 ICLNKLVLHNFKSYAGTQTIGPFHSSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQGK 203
           + + ++++  FK+Y     I  F    + ++G NGSGKSN   ++ FV     + +++ +
Sbjct: 1   MYIKRVIIKGFKTYRNETIIDNFSPHQNVIIGSNGSGKSNFFAAIRFVLSDDYSNLKREE 60

Query: 204 LADLIHKSEEYPDLTSCAVDVHFEYLIDYPDDTTKINPS-----KQPLIITRRAFKNSTS 258
              LIH+      + S +V++ F     +  D + I PS         +  RR       
Sbjct: 61  RQGLIHQG-SGGSVMSASVEIVF-----HDPDHSMILPSGVLSRGDDEVTIRRTVGLKKD 114

Query: 259 KYYLNGKESNYKTITALLKEEGIDLDHNRFLILQGEVENIAQMKPKAEKEGDDGLLEYLE 318
            Y LN +      I  +L+  G  +++   ++ QG++  +   K K         L+ LE
Sbjct: 115 DYQLNDRNVTKGDIVRMLETAGFSMNNPYNIVPQGKIVALTNAKDKER-------LQLLE 167

Query: 319 DIIGTTKY 326
           D++G   +
Sbjct: 168 DVVGAKSF 175

 Score = 41.2 bits (95), Expect = 0.022,   Method: Compositional matrix adjust.
 Identities = 40/141 (28%), Positives = 61/141 (43%), Gaps = 9/141 (6%)

Query: 680 GRLGNLGVIDEKYDVAIST-ACPRLNDIVVDSVECGQQCIEYLRKNNLGHARFILLDKLN 738
           G LG L  +++KY           L  IVVD+ E     +  L +   G   FI L++L+
Sbjct: 538 GTLGELIKVNDKYKTCAEVIGGNSLFHIVVDTEETATLIMNELYRMKGGRVTFIPLNRLS 597

Query: 739 -----KFSMEKISTPRNVPRLFDLIKVNDEKFLPAFYSVLRNTLVANDLKEANAVAYGKT 793
                KF     +  +  P L   IK  + +F  A   V   T+V  DL +   +A  K 
Sbjct: 598 LDSDVKFPSNTTTQIQFTP-LIKKIKY-EPRFEKAVKHVFGKTIVVKDLGQGLKLA-KKH 654

Query: 794 RYRVVTLKGNLIDISGTMSGG 814
           +   +TL G+  D  G ++GG
Sbjct: 655 KLNAITLDGDRADKRGVLTGG 675

>TPHA0I01090 Chr9 complement(252902..256552) [3651 bp, 1216 aa] {ON}
            Anc_1.295 YJL074C
          Length = 1216

 Score = 77.0 bits (188), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 37/99 (37%), Positives = 61/99 (61%), Gaps = 3/99 (3%)

Query: 1280 GVTFSVM--PPKKSWRNISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNV 1337
            GV+ SV     +    ++  LSGG+KT+ ++A++ A+    P P Y+ DEIDAALD +  
Sbjct: 1092 GVSISVSFNSKRDEQLHVEQLSGGQKTVCAIAMILAIQMVDPAPFYLFDEIDAALDKQYR 1151

Query: 1338 SIVANYIKERTKNAQFIVISLRNNMFELAEQLVGI-YKN 1375
            + VA+ IK  + NAQFI  + R +M ++A++   + Y+N
Sbjct: 1152 TAVADVIKSLSSNAQFICTTFRTDMLQVADKFFRVKYEN 1190

 Score = 60.5 bits (145), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 41/188 (21%), Positives = 81/188 (43%), Gaps = 19/188 (10%)

Query: 144 ICLNKLVLHNFKSYAGTQTIGPFHSSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQGK 203
           + + K+++  FK+Y     I  F   ++ ++G NGSGKSN   ++ FV     + +++ +
Sbjct: 1   MYIQKVIIKGFKTYRNETIIDDFSPHYNIIIGSNGSGKSNFFAAIRFVLSDDYSNLKREE 60

Query: 204 LADLIHKSEEYPDLTSCAVDVHFEYLIDYPDDTTKINPSKQPL-----IITRRAFKNSTS 258
              LIH+      + S +V++ F     Y    + I PS   +     +  RR       
Sbjct: 61  RQGLIHQGS--GSVMSASVEIQF-----YDPGNSMILPSGVAVNPDSTVSIRRTVGLKKD 113

Query: 259 KYYLNGKESNYKTITALLKEEGIDLDHNRFLILQGEVENIAQMKPKAEKEGDDGLLEYLE 318
            Y +N +      I  +++  G  + +   ++ QG +  +   K K         L+ LE
Sbjct: 114 DYQINDRNVTKSDIVRMMESTGFSMSNPYNIVPQGRIVALTNAKDKER-------LQILE 166

Query: 319 DIIGTTKY 326
           D++G   +
Sbjct: 167 DVVGAKSF 174

>Ecym_6322 Chr6 (611978..615676) [3699 bp, 1232 aa] {ON} similar to
            Ashbya gossypii AAL182W
          Length = 1232

 Score = 76.3 bits (186), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 40/107 (37%), Positives = 62/107 (57%), Gaps = 3/107 (2%)

Query: 1272 DSLDPFSEGVTFSVM--PPKKSWRNISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEID 1329
            D+ D    GV+  V     K    ++  LSGG+KT+ ++AL+ A+    P P Y+ DEID
Sbjct: 1093 DNEDSVYSGVSIGVSFNSKKDEQLHVEQLSGGQKTVCAIALILAIQMVDPAPFYLFDEID 1152

Query: 1330 AALDFRNVSIVANYIKERTKNAQFIVISLRNNMFELAEQLVGI-YKN 1375
            AALD +  + VA  IKE +  AQFI  + R++M  +A++   + Y+N
Sbjct: 1153 AALDKQYRTAVAATIKELSSEAQFICTTFRSDMIGIADKFYRVKYEN 1199

 Score = 62.0 bits (149), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 163/717 (22%), Positives = 299/717 (41%), Gaps = 94/717 (13%)

Query: 144 ICLNKLVLHNFKSYAGTQTIGPFHSSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQGK 203
           + + K+++  FK+Y     I  F +  + VVG NGSGKSN   ++ FV       +++ +
Sbjct: 1   MYIRKVIISGFKTYKNKTEIDNFSAHHNVVVGLNGSGKSNFFAAIRFVLSDDYTNLKREE 60

Query: 204 LADLIHKSEEYPDLTSCAVDVHFEYLIDYPDDTTKIN-PSKQPLIITRRAFKNSTSKYYL 262
              LI++       TS  +  + E +    ++ T +  P     I  RR       +Y +
Sbjct: 61  RRSLIYQG------TSSVMSGYVEIVFHDAENRTLLGIPDSNGAIRIRRTVGLKKDEYMI 114

Query: 263 NGKESNYKTITALLKEEGIDLDHNRFLILQGEVENIAQMKPKAEKEGDDGLLEYLEDIIG 322
           N K S+   +  LL+  G    +   ++ QG + ++   K       D   L+ LE+++G
Sbjct: 115 NNKNSSRSDVQRLLESAGFSTSNPYNIVPQGRIVSLTNAK-------DRERLQLLEEVVG 167

Query: 323 TTKYKELIDKKFIEIEALNDICIERENRFDI-IDRXXXXXXXXXXXXXXXXXXXXXQVIV 381
              ++  +       E+L  +    +NR  I I+                      ++  
Sbjct: 168 AKSFERKLK------ESLQRMDATEKNREKIRIELQEVEDKLNELNEEREELETYNELDR 221

Query: 382 KSKLIQYKIWQNNI-KLSNTLEKITK-------LEDEYNQEKNKNTELKNKIDELRKLYT 433
             K+ Q+ ++   + +++N +EK+         L ++Y +E +K   L   I+ L K   
Sbjct: 222 SRKMFQFTLYDRELNEITNLIEKLDGEYNNTLVLSEQYIEELDKREIL---IESLNKKLN 278

Query: 434 KNQDELQALLKDEKELVNAKRSLDSDNVSNTEQLKNIEKK---LKKTAKEIEE----DLK 486
           +   EL+  +K+  EL  AK   D+D    +++L ++  K   LK   + I++    D +
Sbjct: 279 QTNSELK--IKESTELQQAK---DAD-AEVSKRLADLHVKNEDLKLQCQTIQQQSVTDSE 332

Query: 487 TISSSNVRLKNFHDNKKLFETQLIELDNNLVTESQL------LENIKLDLKDKTVGLSEE 540
            +SS N +++      K FE +  EL      ES++      L+  + DL  K    ++ 
Sbjct: 333 MLSSINAQIEAKELQLKKFEPRFDELTK---AESEMKANFISLQQRQRDLLSKRGKYAKF 389

Query: 541 ILKTEKDLEPW-NIKLDELKSEIQIKESEKALFEESKNKLKANIEALEKDVNEKSKLTED 599
             K E+D   W N ++  L+  +   ++ +   EE + K+ A+I AL++ + E     + 
Sbjct: 390 KNKDERD--SWLNQEILVLEEALASSKASRESLEEERAKIAADIAALDEQIVELMDYVQG 447

Query: 600 RRKEVKNLMTKLENVSKEVIFGTNELKKANEKLCEMQKILIQDRQKANDARTSLSNVENR 659
                  +  +LE++  EVI     +KK      + +K L +  QK      +L     R
Sbjct: 448 -----PGITAELEDLQNEVI----SMKKTYLSKIDERKGLWRTEQKLQSVFETLVEEVKR 498

Query: 660 SK-------------VLRALLKLQKSGRINGFHGRL-GNLG---VIDEKY-DVAISTACP 701
           S+              LR + ++ +  R+N   G + G LG    + EKY   A      
Sbjct: 499 SEGNLNEIMDRNLAIGLRNVTEIVQ--RLNLPEGSVFGPLGELIKVSEKYKTCAEVVGGN 556

Query: 702 RLNDIVVDSVECGQQCIEYLRKNNLGHARFILLDKLNKFSMEKISTPR----NVPRLFDL 757
            L  +VVD+       ++ L  +  G   F+ L+++  +    I  P     N   L   
Sbjct: 557 SLFHVVVDTENTASLIMQELYNSKGGRVTFMPLNRI--YVDPNIQYPSNEEYNCTPLIKK 614

Query: 758 IKVNDEKFLPAFYSVLRNTLVANDLKEANAVAYGKTRYRVVTLKGNLIDISGTMSGG 814
           IK  D KF  A   V   T+V  DL + + +A  +     VTL G+  D  G ++GG
Sbjct: 615 IKF-DGKFEKAVKHVFGKTIVVKDLLQGSKLA-KQFNLNSVTLDGDKADNKGVLTGG 669

>Suva_6.149 Chr6 (248275..251967) [3693 bp, 1230 aa] {ON} YJL074C
            (REAL)
          Length = 1230

 Score = 76.3 bits (186), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 54/200 (27%), Positives = 99/200 (49%), Gaps = 34/200 (17%)

Query: 1210 YRQRKYDLNQSVEQRDKVRKELEDL----KKCRFNEFMESFNIISMTLKEMYQIITMGGN 1265
            + +++ DL+    + D+ +  ++DL    K+ + +    +F  +S   K +++ +   G 
Sbjct: 1005 FNEKRKDLSGRASELDESKDSIQDLIVKLKQQKVSAVDSTFQKVSENFKTVFERLVPRGT 1064

Query: 1266 AELELV----DSLDPFSE-----------------------GVTFSVMPPKKS--WRNIS 1296
            A+L +     DS+D  ++                       GV+ SV    K     ++ 
Sbjct: 1065 AKLVIHRRNEDSIDQANDVDVDMDTGNNEDTINKEGETVYTGVSISVSFNSKQNEQLHVE 1124

Query: 1297 NLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKNAQFIVI 1356
             LSGG+KT+ ++AL+ A+    P   Y+ DEIDAALD +  + VA  IKE + NAQFI  
Sbjct: 1125 QLSGGQKTVCAIALILAIQMVDPASFYLFDEIDAALDKQYRTAVATMIKELSTNAQFICT 1184

Query: 1357 SLRNNMFELAEQLVGI-YKN 1375
            + R +M ++A++   + Y+N
Sbjct: 1185 TFRTDMLQVADKFFRVKYEN 1204

 Score = 57.8 bits (138), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 43/188 (22%), Positives = 82/188 (43%), Gaps = 18/188 (9%)

Query: 144 ICLNKLVLHNFKSYAGTQTIGPFHSSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQGK 203
           + + ++V+  FK+Y     I  F    + ++G NGSGKSN   ++ FV     + +++ +
Sbjct: 1   MYIKRVVIKGFKTYRNETIIDNFSPHQNVIIGSNGSGKSNFFAAIRFVLSDDYSNLKREE 60

Query: 204 LADLIHKSEEYPDLTSCAVDVHFEYLIDYPDDTTKINPS-----KQPLIITRRAFKNSTS 258
              LIH+      + S +V++ F     +  D + I PS         +  RR       
Sbjct: 61  RQGLIHQG-SGGSVMSASVEIVF-----HDPDHSMILPSGVLSRGDDEVTIRRTVGLKKD 114

Query: 259 KYYLNGKESNYKTITALLKEEGIDLDHNRFLILQGEVENIAQMKPKAEKEGDDGLLEYLE 318
            Y LN +      I  +L+  G  +++   ++ QG++  +   K K         L+ LE
Sbjct: 115 DYQLNDRNVTKGDIVRMLETAGFSMNNPYNIVPQGKIVALTNAKDKER-------LQLLE 167

Query: 319 DIIGTTKY 326
           D++G   +
Sbjct: 168 DVVGAKSF 175

>CAGL0H02805g Chr8 complement(256682..260341) [3660 bp, 1219 aa] {ON}
            similar to uniprot|P47037 Saccharomyces cerevisiae
            YJL074c SMC3 required for structural maintenance of
            chromosomes
          Length = 1219

 Score = 76.3 bits (186), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 53/190 (27%), Positives = 97/190 (51%), Gaps = 24/190 (12%)

Query: 1210 YRQRKYDLNQSVEQRDKVRKELEDL----KKCRFNEFMESFNIISMTLKEMYQIITMGGN 1265
            + +++ +L +   + D  ++ ++DL    K+ + N   ++F+ +S     +++ I   G 
Sbjct: 1004 FNEKQSELRERATELDDSKQSIQDLIIKLKEQKLNAVDKTFDKVSKNFVMIFEKIVPRGT 1063

Query: 1266 AELELV--------DSLDPFS---------EGVTFSVMPPKKS--WRNISNLSGGEKTLS 1306
            A L +         D+ + F+         EGV+ SV    K      +  LSGG+KT+ 
Sbjct: 1064 ATLNIHRINLQGTDDNSELFTQSNEHTTPYEGVSISVSFNSKQDEQLKVEQLSGGQKTVC 1123

Query: 1307 SLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKNAQFIVISLRNNMFELA 1366
            ++AL+ A+   +P P Y+ DEIDAALD +    VA  I + + NAQFI  + R++M + A
Sbjct: 1124 AIALILAIQMVEPAPFYLFDEIDAALDKQYRRAVAQTISQLSNNAQFICTTFRSDMVDAA 1183

Query: 1367 EQLVGI-YKN 1375
             +   + Y+N
Sbjct: 1184 NKFYRVKYEN 1193

 Score = 67.0 bits (162), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 175/735 (23%), Positives = 304/735 (41%), Gaps = 116/735 (15%)

Query: 146 LNKLVLHNFKSYAGTQTIGPFHSSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQGKLA 205
           + ++++  FK+Y     IG F    + V+G NGSGKSN   ++ FV     + +++ +  
Sbjct: 3   IKRVIIKGFKTYRNETIIGDFSPHHNVVIGANGSGKSNFFAAVRFVLSDDYSNLKREERQ 62

Query: 206 DLIHKSEEYPDLTSCAVDVHF---EYLIDYPDDTTKINPSKQPLIITRRAFKNSTSKYYL 262
            LIH+      + S +V++ F   E+ I  P        S +  I  RR        Y +
Sbjct: 63  GLIHQGA-GASVMSASVEIVFHDPEHSIIAPTGINSNGSSDEVRI--RRTVGLKKDDYQV 119

Query: 263 NGKESNYKTITALLKEEGIDLDHNRFLILQGEVENIAQMKPKAEKEGDDGLLEYLEDIIG 322
           N +      +  +L+  G  + +   ++ QG + ++   K K         L+ LE+++G
Sbjct: 120 NDRNVTKGDLVRMLESAGFYMSNPYNIVPQGRIVSLTNAKDKER-------LQLLEEVVG 172

Query: 323 -----------------TTKYKELIDKKFIEIEA-LNDICIEREN--RFDIIDRXXXXXX 362
                            T + +  I  +  E+E+ LN++  ER+   +++ ++R      
Sbjct: 173 AKSFEVKLKASMKQMDETEQKRAQISAEMEELESKLNEMEKERKELEKYNSLERDRKVLR 232

Query: 363 XXXXXXXXXXXXXXXQVIVKSKLIQYKIWQNNIKLSNTLEKITKLEDEYNQEKNKNTELK 422
                          Q I+    I+      N  L ++ + I +LE   N  K  N E+K
Sbjct: 233 YTLHDREL-------QDIISQ--IESLDGDYNDTLGSSKKYILELEKRENMIKEVNEEIK 283

Query: 423 NKIDELRKLYTKNQDELQALLKDEKELVNAKRSLDSDNVSNTEQLKNIEKKLKKTAKEIE 482
           N    L+   T + ++ +A+L++  E   A +           QLK+I++K+K+  ++ +
Sbjct: 284 NLQKSLKLKATVDLEQAKAILEESLERSEAIKL----------QLKDIKEKIKQNKEQHD 333

Query: 483 ED---LKTISS-----------SNVRLKNFHDNKKLFETQL---IELDNNLVTESQLLEN 525
            D   LK I+             + R       +KL +  L   IE  NN + +      
Sbjct: 334 NDRKNLKLITEIIDSKKSKRRKISPRFDQLQSEEKLIKHHLKECIEKQNNFLLKKGSYAR 393

Query: 526 IKLD------LKDKTVGLSEEILKTEKDLEPWNIKLDELKSEIQIK--ESEKAL--FEES 575
            K        +  K   LSE I      ++    +L E KS I +K  ESE  +   E+S
Sbjct: 394 FKSKEERDEWINSKIKELSESI----NTMKASTTELKEQKSSIDVKINESENNIEELEDS 449

Query: 576 KN--KLKANIEALEKD-VNEKSKLTE--DRRKEVKNLMTKLENVSKEVIFGTNELKKANE 630
            N   +KA IE +EK+ +N + K T   D RKE      KL+ +S  ++   NE+K+   
Sbjct: 450 LNGPGIKAEIEDIEKELINLRRKYTANIDARKEKWREEQKLQMISDSLV---NEVKENER 506

Query: 631 KLCEMQKILIQDRQKANDARTSLSNVENRSKVLRALLKLQKSGRINGFHGRLGNLGVIDE 690
            L E                T   ++ N  K ++ + +    G  + F G +G L  ++E
Sbjct: 507 SLNE----------------TMSRSLANGFKNVKEICERLNLGTESVF-GTVGELIQVNE 549

Query: 691 KYDVAIST-ACPRLNDIVVDSVECGQQCIEYLRKNNLGHARFILLDKLNKFSMEKISTPR 749
           KY V         L  +VVD+ E     +  L +   G   F+ L+KL K   + I  P 
Sbjct: 550 KYKVCAEVIGGNSLFHVVVDTDETASILMNELFRMKGGRVTFMPLNKL-KNGNQNIDYPS 608

Query: 750 --NVPRLFDLIKVN-DEKFLPAFYSVLRNTLVANDLKEANAVAYGKT-RYRVVTLKGNLI 805
             N+P    + K+  D +F      V    LV  DL   N ++  K  +   +TL G+ +
Sbjct: 609 DPNIPCTPLIKKIKYDMQFDCVVKQVFGRALVVKDL--TNGLSISKQYKLSCITLDGDRV 666

Query: 806 DISGTMSGGGNQASK 820
           D  G ++GG  + SK
Sbjct: 667 DGKGVLTGGYLEQSK 681

>AAL182W Chr1 (16155..19850) [3696 bp, 1231 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YJL074C (SMC3)
          Length = 1231

 Score = 74.7 bits (182), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 172/724 (23%), Positives = 301/724 (41%), Gaps = 109/724 (15%)

Query: 144 ICLNKLVLHNFKSYAGTQTIGPFHSSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQGK 203
           + + K+++  FK+Y     I  F    + VVG NGSGKSN   ++ FV       +++ +
Sbjct: 1   MYIKKVIIRGFKTYKNKTEIDNFSPHHNVVVGFNGSGKSNFFAAIRFVLSDDYTNLKREE 60

Query: 204 LADLIHKSEEYPDLTSCAVDVHFEYLIDYPDDTTKINPSKQPLIITRRAFKNSTSKYYLN 263
              LI++       TS  +  + E +    ++ T +      +I  RR       +Y +N
Sbjct: 61  RRSLIYQG------TSSVMSGYVEIVFHGAENRTLLGAQDGGVIHIRRTVGLKKDEYMIN 114

Query: 264 GKESNYKTITALLKEEGIDLDHNRFLILQGEVENIAQMKPKAEKEGDDGLLEYLEDIIG- 322
            K ++   +  LL+  G    +   ++ QG + ++   + +         L+ LE++IG 
Sbjct: 115 NKNASRSDVQRLLESAGFSTSNPYNIVPQGRIVSLTNAQNRER-------LQLLEEVIGA 167

Query: 323 ----------------TTKYKELIDKKFIEIEA-LNDICIERE--NRFDIIDRXXXXXXX 363
                           T K +E I  +  E+EA LN++  ER+   +++ +DR       
Sbjct: 168 KSFERKLKESLQKMETTEKNREKIRIELEEVEAKLNELDEERKELEKYNSLDR------- 220

Query: 364 XXXXXXXXXXXXXXQVIVKSKLIQYKIWQNNI-KLSNTLEKITK-------LEDEYNQEK 415
                             K K+ Q+ ++   + ++++ +EK+         L ++Y QE 
Sbjct: 221 ------------------KRKMCQFALYDRELNEVTSMVEKLDGEYTNTLVLSEQYIQEL 262

Query: 416 NKNTELKNKIDELRKLYTKNQDELQALLKDEKELVNAKRS-------LDSDNVSNTEQLK 468
            K   L   I+ L K   +   EL+  +K+  +L  AK S       L   NV   E+L 
Sbjct: 263 EKRESL---IETLTKSLNQLGSELK--MKESTDLQQAKDSELELAKHLADLNV-KYEELI 316

Query: 469 NIEKKLKKTAKEIEEDLKTISSS-NVRLKNFHDNKKLFETQLIELDNNLVTESQLLENIK 527
           +    LK+ +    E L  I S   V+ +        FE   IE +  +  E + L+  +
Sbjct: 317 SQNNALKEQSASNSESLLAIRSQIAVKEQQLARLSPRFEQLTIE-EAAMKAEFKALQQRQ 375

Query: 528 LDLKDKTVGLSEEILKTEKDLEPW-NIKLDELKSEIQIKESEKALFEESKNKLKANIEAL 586
            DL  K    S+   K E+D   W + +L  LK E+Q          E ++ L+  +  L
Sbjct: 376 RDLLAKRGKYSQFRNKAERD--AWIDQELSILKEELQCSSIALTSISEERDSLRIKLTTL 433

Query: 587 EKDVNE--KSKLTEDRRKEVKNLMTKLENVSKEVIFGTNELK---KANEKLCEMQKILIQ 641
           +  + E   S        E++++  +L  + K  +F  +E K   ++ +K+  + + L+ 
Sbjct: 434 DDQIMELNDSAHGPGINAELEDVQQELTVLKKAHLFKIDERKQLWRSEQKIQSVLESLVD 493

Query: 642 DRQKANDARTSLSNVENRSKVLRALLK--LQKSGRIN----GFHGRLGNLGVIDEKYDV- 694
           D ++A     +LS   +RS  L   LK   + + R+N       G LG L  I EKY   
Sbjct: 494 DVKRAE---GTLSETMDRS--LATGLKNVSEIAQRLNLPEGSVFGPLGELIKISEKYKAC 548

Query: 695 AISTACPRLNDIVVDSVECGQQCIEYLRKNNLGHARFILLDKLNKFSMEKISTPRN---- 750
           A       L  +VVD+       ++ L  +  G   FI L++++  S   I  P N    
Sbjct: 549 AEVVGGTSLFHVVVDTENTAALLMQELYNSKGGRVTFIPLNRVHVDS--NIVYPSNDEHH 606

Query: 751 VPRLFDLIKVNDEKFLPAFYSVLRNTLVANDLKEANAVAYGKTRYRVVTLKGNLIDISGT 810
              L   IK  D KF  A   V   T+V  DL +   +A  + R   +TL G+  D  G 
Sbjct: 607 CTPLIKKIKY-DPKFERAIKHVFGKTIVVKDLNQGTKLA-KQFRLNAITLDGDKADSRGV 664

Query: 811 MSGG 814
           ++GG
Sbjct: 665 LTGG 668

 Score = 74.3 bits (181), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 36/102 (35%), Positives = 57/102 (55%), Gaps = 2/102 (1%)

Query: 1273 SLDPFSEGVTFSVM--PPKKSWRNISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDA 1330
            S D    GV+  V     K    ++  LSGG+KT+ ++AL+ A+    P P Y+ DEIDA
Sbjct: 1099 SQDSIYSGVSIEVSFNSKKDEQVHVEQLSGGQKTVCAIALILAIQMVDPAPFYLFDEIDA 1158

Query: 1331 ALDFRNVSIVANYIKERTKNAQFIVISLRNNMFELAEQLVGI 1372
            ALD +  + VA  +K+ +  AQFI  + R +M  +A++   +
Sbjct: 1159 ALDKQYRTAVAATVKQLSSQAQFICTTFRGDMIAVADRFYRV 1200

>Skud_10.170 Chr10 (316063..319755) [3693 bp, 1230 aa] {ON} YJL074C
            (REAL)
          Length = 1230

 Score = 73.6 bits (179), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 38/99 (38%), Positives = 60/99 (60%), Gaps = 3/99 (3%)

Query: 1280 GVTFSVMPPKKS--WRNISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNV 1337
            GV+ SV    K     ++  LSGG+KT+ ++AL+ A+    P   Y+ DEIDAALD +  
Sbjct: 1106 GVSISVSFNSKQNEQLHVEQLSGGQKTVCAIALILAIQMVDPASFYLFDEIDAALDKQYR 1165

Query: 1338 SIVANYIKERTKNAQFIVISLRNNMFELAEQLVGI-YKN 1375
            + VA  IKE + +AQFI  + R +M ++A++   + Y+N
Sbjct: 1166 TAVATLIKELSNDAQFICTTFRTDMLQVADKFFRVKYEN 1204

 Score = 56.6 bits (135), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 43/188 (22%), Positives = 81/188 (43%), Gaps = 18/188 (9%)

Query: 144 ICLNKLVLHNFKSYAGTQTIGPFHSSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQGK 203
           + + ++V+  FK+Y     I  F    + ++G NGSGKSN   ++ FV     + +++ +
Sbjct: 1   MYIKRVVIKGFKTYRNETIIDNFSPHQNVIIGSNGSGKSNFFAAIRFVLSDDYSNLKREE 60

Query: 204 LADLIHKSEEYPDLTSCAVDVHFEYLIDYPDDTTKINPS-----KQPLIITRRAFKNSTS 258
              LIH+      + S +V++ F     +  D + I PS         +  RR       
Sbjct: 61  RQGLIHQG-SGGSVMSASVEIVF-----HDPDHSMILPSGVLSRGDDEVTIRRTVGLKKD 114

Query: 259 KYYLNGKESNYKTITALLKEEGIDLDHNRFLILQGEVENIAQMKPKAEKEGDDGLLEYLE 318
            Y LN +      I  +L+  G  + +   ++ QG++  +   K K         L+ LE
Sbjct: 115 DYQLNDRNVTKGDIVRMLETAGFSMTNPYNIVPQGKIVALTNAKDKER-------LQLLE 167

Query: 319 DIIGTTKY 326
           D++G   +
Sbjct: 168 DVVGAKSF 175

>KLLA0A00286g Chr1 complement(22024..25698) [3675 bp, 1224 aa] {ON}
            similar to uniprot|P47037 Saccharomyces cerevisiae
            YJL074C SMC3 Subunit of the multiprotein cohesin complex
            required for sister chromatid cohesion in mitotic cells
          Length = 1224

 Score = 68.9 bits (167), Expect = 8e-11,   Method: Compositional matrix adjust.
 Identities = 31/78 (39%), Positives = 46/78 (58%)

Query: 1295 ISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKNAQFI 1354
            +  LSGG+KT+ ++AL+ A+    P P Y+ DEIDAALD +    VA  IK  +  AQFI
Sbjct: 1117 VEQLSGGQKTVCAIALILAIQMVDPAPFYLFDEIDAALDKQYRIAVARTIKNLSDTAQFI 1176

Query: 1355 VISLRNNMFELAEQLVGI 1372
              + R +M  +A+    +
Sbjct: 1177 CTTFRTDMINVADTFFRV 1194

 Score = 50.4 bits (119), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 44/201 (21%), Positives = 87/201 (43%), Gaps = 22/201 (10%)

Query: 144 ICLNKLVLHNFKSYAGTQTIGPFHSSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQGK 203
           + +  +++  FK+Y     +  F    + VVG NGSGKSN   ++ FV     + +++  
Sbjct: 2   VHIKTVIISGFKTYKNRTVVENFSPHHNVVVGSNGSGKSNFFAAIRFVLSEENSNLKRED 61

Query: 204 LADLIHKSEEYPDLTSCAVDVHF---EYLIDYP--DDTTKINPSKQPLIITRRAFKNSTS 258
               I++      + S  V++ F   E L+  P  +DT ++          RR       
Sbjct: 62  RKGFIYQG--AGQVMSAFVEIIFDDPENLMLAPLRNDTGEVR--------IRRTVGLKKD 111

Query: 259 KYYLNGKESNYKTITALLKEEGIDLDHNRFLILQGEVENIAQMKPKAEKEGDDGLLEYLE 318
           +Y +N K S  + +  +L+  G    +   ++ QG + ++   K       D   L  LE
Sbjct: 112 EYMINDKNSTRQDVRRVLENVGFSTSNPYNIVPQGRIISLTNAK-------DLERLHLLE 164

Query: 319 DIIGTTKYKELIDKKFIEIEA 339
           D++G   ++  + +   ++EA
Sbjct: 165 DVVGAKSFENKLKESLKKMEA 185

>KNAG0L00630 Chr12 complement(93928..97254) [3327 bp, 1108 aa] {ON}
           Anc_7.101 YOL034W
          Length = 1108

 Score = 51.6 bits (122), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 44/157 (28%), Positives = 77/157 (49%), Gaps = 16/157 (10%)

Query: 148 KLVLHNFKSYAGTQTIGPFHSSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQGKLADL 207
           +L LHNF +Y+  +    F  S + VVGPNGSGKS ++ ++      R   + + K +D 
Sbjct: 59  RLRLHNFVTYSLAEF--EFSPSLNMVVGPNGSGKSTLVCALCLGLAGRTEYLGRMKRSDS 116

Query: 208 IHKSEEYPDLTSCAVDVHFEYLIDYPDDTTKINPSKQPLIITRRAFKNSTSKYYLNGKES 267
             K+       S  +DV      + P  T K++      ++TR   K S   YY++G E+
Sbjct: 117 FIKN----GADSARIDVWLAG--EDPGTTLKVS-----RVLTRNHKKASL--YYVDGVET 163

Query: 268 NYKTITALLK-EEGIDLDHNRFLILQGEVENIAQMKP 303
           + + +  L+  +  I LD+    + Q  V+  A+++P
Sbjct: 164 SEQRVRQLVATQHNIQLDNLCQFLSQERVQEFARLRP 200

 Score = 41.2 bits (95), Expect = 0.020,   Method: Compositional matrix adjust.
 Identities = 17/42 (40%), Positives = 27/42 (64%)

Query: 1299 SGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIV 1340
            SGGE+ +S++  + AL ++   P  V+DEI+  +D RN  IV
Sbjct: 1003 SGGERAVSTVLYIIALQEFTSAPFRVVDEINQGMDQRNERIV 1044

>Kwal_26.7204 s26 complement(263266..266619) [3354 bp, 1117 aa] {ON}
           YOL034W - Protein required for cell viability [contig
           47] FULL
          Length = 1117

 Score = 51.6 bits (122), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 48/168 (28%), Positives = 73/168 (43%), Gaps = 35/168 (20%)

Query: 148 KLVLHNFKSYAGTQTIGPFH--SSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQGKLA 205
           KL L NF +Y+ T+    FH   S + ++GPNGSGKS  + ++      +   + +GK  
Sbjct: 71  KLRLENFVTYSLTE----FHLSPSLNMIIGPNGSGKSTFVCAVCLGLAGKPEYIGRGKRV 126

Query: 206 DLIHKSEEY-----------PDLTSCAVDVHFEYLIDYPDDTTKINPSKQPLIITRRAFK 254
           D   K+ E            P  T   V V         D TTK+         +R  + 
Sbjct: 127 DSFIKNGENRGLIEVTLKRDPGRTGSFVAV---------DGTTKV---------SRVLWV 168

Query: 255 NSTSKYYLNGKESNYKTITALLKEEGIDLDHNRFLILQGEVENIAQMK 302
              S+YYLN +  +  T+  L+ E  I LD+    + Q  VE  A++K
Sbjct: 169 GKKSEYYLNDEPVSELTVKNLMGELNIQLDNLCQFLSQERVEEFARLK 216

 Score = 44.3 bits (103), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 20/62 (32%), Positives = 37/62 (59%), Gaps = 3/62 (4%)

Query: 1299 SGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERT---KNAQFIV 1355
            SGGE+ +S++  + AL ++   P  ++DEI+  +D RN  IV   + E     K +Q+I+
Sbjct: 1012 SGGERAVSTVLYMIALQEFTSAPFRIVDEINQGMDTRNERIVHKAMVENACAEKTSQYIL 1071

Query: 1356 IS 1357
            ++
Sbjct: 1072 VT 1073

 Score = 33.9 bits (76), Expect = 3.9,   Method: Compositional matrix adjust.
 Identities = 30/78 (38%), Positives = 45/78 (57%), Gaps = 10/78 (12%)

Query: 387 QYKIWQNNIKLSNTLEKIT--KLEDEYNQEKNKNTELKNKIDELRKLYTK----NQDE-- 438
           +YK W   IK  ++ EK T  KL +EY  EKN + ELK   D + +L+++    NQDE  
Sbjct: 854 EYKSWIEQIKTYSSAEKSTLAKLAEEY--EKNNSLELKFVSDLIDRLHSEIGMMNQDESV 911

Query: 439 LQALLKDEKELVNAKRSL 456
           ++ + + EKEL    RS+
Sbjct: 912 IEKMRQTEKELETLNRSI 929

>KLTH0D02816g Chr4 complement(272310..275594) [3285 bp, 1094 aa]
           {ON} similar to uniprot|Q08204 Saccharomyces cerevisiae
           YOL034W SMC5 Structural maintenance of chromosomes (SMC)
           protein interacts with Rhc18p and Nse1p to form a large
           complex S. pombe homolog forms a heterodimer with S.
           pombe Rad18p that is involved in DNA repair
          Length = 1094

 Score = 50.8 bits (120), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 55/201 (27%), Positives = 93/201 (46%), Gaps = 24/201 (11%)

Query: 149 LVLHNFKSYAGTQTIGPFH--SSFSAVVGPNGSGKSNVIDSMLFVFGFRANKM-RQGKLA 205
           L L NF +YA T+    FH   S + ++GPNGSGKS  + ++      +   + R  K+ 
Sbjct: 50  LRLENFVTYALTE----FHMSPSLNMIIGPNGSGKSTFVCAVCLGLAGKPEYIGRSTKIE 105

Query: 206 DLIHKSEEYPDL-TSCAVDVHFEYLIDYPDDTTKINPSKQPLIITRRAFKNS-TSKYYLN 263
           D I   E+   +  +   D   E      D TTK+         TR   +N   S+Y+LN
Sbjct: 106 DYIKNGEDRSVIEVTLKRDPEAEDRYVASDGTTKV---------TRVLHRNRKASEYFLN 156

Query: 264 GKESNYKTITALLKEEGIDLDHNRFLILQGEVENIAQMKP-----KAEKEGDDGLLEYLE 318
           G+      +  L+ E  I LD+    + Q  VE  A++K      +  +  D  ++  LE
Sbjct: 157 GQSVTESAVKRLVSELNIQLDNLCQFLSQERVEEFARLKSDKLLVETARSVDVNMVADLE 216

Query: 319 DIIGTTKYKELIDKKFIEIEA 339
           D +   + +EL++ K +E+++
Sbjct: 217 D-LKALQGEELVEAKELELKS 236

 Score = 42.0 bits (97), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 21/62 (33%), Positives = 35/62 (56%), Gaps = 3/62 (4%)

Query: 1299 SGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERT---KNAQFIV 1355
            SGGE+ +S++  + AL      P  V+DEI+  +D RN  IV   + E      N+Q+I+
Sbjct: 989  SGGERAVSTVLYMIALQDVTSAPFRVVDEINQGMDSRNERIVHKSMVESACSQNNSQYIL 1048

Query: 1356 IS 1357
            ++
Sbjct: 1049 VT 1050

>Skud_15.121 Chr15 (218825..222106) [3282 bp, 1093 aa] {ON} YOL034W
           (REAL)
          Length = 1093

 Score = 47.8 bits (112), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 44/163 (26%), Positives = 76/163 (46%), Gaps = 16/163 (9%)

Query: 145 CLNKLVLHNFKSYAGTQ-TIGPFHSSFSAVVGPNGSGKSNVIDSMLFVFGFRANKM-RQG 202
           C+ K+ L +F +Y  T+  + P   S + ++GPNGSGKS  + ++      +   + R  
Sbjct: 41  CITKIRLQDFVTYTLTEFNLSP---SLNMIIGPNGSGKSTFVCAVCLGLAGKPEYIGRSK 97

Query: 203 KLADLIHKSEEYPDLTSC---AVDVHFEYLIDYPDDTTKINPSKQPLIITRRAFKNSTSK 259
           K+ D I   ++   +      +  VH    I+  D+T KI       IITR   +   S 
Sbjct: 98  KVEDFIKNGQDVSRIEITLKNSPKVHDIENINAHDETIKIT-----RIITRSKRR---SD 149

Query: 260 YYLNGKESNYKTITALLKEEGIDLDHNRFLILQGEVENIAQMK 302
           Y +N  + +  T+  L+ +  I LD+    + Q  VE  A++K
Sbjct: 150 YLINDGQVSENTVKTLVTQLNIQLDNLCQFLSQERVEEFARLK 192

 Score = 41.6 bits (96), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 20/62 (32%), Positives = 35/62 (56%), Gaps = 3/62 (4%)

Query: 1299 SGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERT---KNAQFIV 1355
            SGGE+ +S++  + AL ++   P  V+DEI+  +D RN  IV   + E       +Q+ +
Sbjct: 987  SGGERAVSTVLYMIALQEFTSAPFRVVDEINQGMDSRNERIVHKAMVENACAENTSQYFL 1046

Query: 1356 IS 1357
            I+
Sbjct: 1047 IT 1048

 Score = 35.4 bits (80), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 32/114 (28%), Positives = 60/114 (52%), Gaps = 7/114 (6%)

Query: 422 KNKIDELRKLYTKNQDELQALLKDEKELVNAKRSLDS--DNVSNTEQLKNIE-KKLKKTA 478
           K K++  ++ Y + +  L+ALLKD+K   N K++L+   + +++    KN E  K K+  
Sbjct: 279 KEKLNTYKEEYERAKANLKALLKDKKPFSNTKKTLEGRVEELTDKCSFKNAEFVKAKEKI 338

Query: 479 KEIEEDLKTISSSNVRLKN----FHDNKKLFETQLIELDNNLVTESQLLENIKL 528
            EI E+L TI    ++ KN    +    K  +  +I  + +LV   ++L+  +L
Sbjct: 339 NEIFEELNTIRDEVIKKKNQNEYYRGRTKKLQATIISTNQDLVRNREMLKQTQL 392

>TDEL0E01340 Chr5 complement(265681..269001) [3321 bp, 1106 aa] {ON}
            Anc_4.237 YLR383W
          Length = 1106

 Score = 47.0 bits (110), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 27/85 (31%), Positives = 44/85 (51%), Gaps = 3/85 (3%)

Query: 1276 PFSEGVTFSVMPPKKSWRNISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFR 1335
            P  + + +++ P     RN+  LSGGEK+ S +AL+ A  K   + +  +DE D  +D  
Sbjct: 987  PAKQLMIYTLTPNDNRPRNVDTLSGGEKSFSQMALLLATWKPMRSRIIALDEFDVFMDQV 1046

Query: 1336 NVSIVANYIKERTKN---AQFIVIS 1357
            N  +    I E+ KN    Q I+I+
Sbjct: 1047 NRKMGTRLILEKLKNNSRTQTIIIT 1071

>Suva_15.133 Chr15 (232441..235719) [3279 bp, 1092 aa] {ON} YOL034W
           (REAL)
          Length = 1092

 Score = 45.4 bits (106), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 90/398 (22%), Positives = 174/398 (43%), Gaps = 66/398 (16%)

Query: 148 KLVLHNFKSYAGTQ-TIGPFHSSFSAVVGPNGSGKSNVIDSMLFVFGFRANKM-RQGKLA 205
           K+ L +F +Y  T+  + P   S + ++GPNGSGKS  + ++      +   + R  K+ 
Sbjct: 44  KIRLQDFVTYTLTEFNLSP---SLNMIIGPNGSGKSTFVCAVCLGLAGKPEYIGRSKKVE 100

Query: 206 DLIHKSEEYPDLTSC---AVDVHFEYLIDYPDDTTKINPSKQPLIITRRAFKNSTSKYYL 262
           D I   ++   +      +  +H    I+  D+T K+       IITR   +   S Y +
Sbjct: 101 DFIKNGQDTSRIEITLKNSPKIHDIEFINTHDETIKVTR-----IITRSKRR---SDYLI 152

Query: 263 NGKESNYKTITALLKEEGIDLDHNRFLILQGEVENIAQMKP-----KAEKEGDDGLLEYL 317
           N ++ +   +  L+ +  I LD+    + Q  VE  A++K      +  +  D  LL+ L
Sbjct: 153 NDEQVSENVVKTLVAQLNIQLDNLCQFLSQERVEEFARLKSVKLLVETIRSIDASLLDVL 212

Query: 318 EDIIGTTKYKELIDKKFIEIEALNDICIERENRFDIIDRXXXXXXXXXXXXXXXXXXXXX 377
           ++++     ++ + K  ++++ L  + + +E+     D+                     
Sbjct: 213 DELMELQANEQSLQKD-LDVKKLKVVHLRQES-----DKLRKS----------------- 249

Query: 378 QVIVKSKLIQYKIWQNNIKLSNTLEKITKLEDEYNQEKNKNTELKNKIDELRKLYTKNQD 437
              V+S L  ++  +  I+L + L    K++D            K K++  ++ Y + + 
Sbjct: 250 ---VES-LRDFQKKKGEIELHSQLLPYVKVKDH-----------KEKLNTYKEEYERAKS 294

Query: 438 ELQALLKDEKELVNAKRSLDSDNVSNTEQ--LKNIE-KKLKKTAKEIEEDLKTISSSNVR 494
            L+ALLKD+K   N K++L++     TE+  LKN E  K K+   EI E L  I    ++
Sbjct: 295 NLRALLKDKKPFANTKKTLENRVHELTEKCSLKNDEFVKAKEKVNEIFERLNIIRDDVIK 354

Query: 495 LKN----FHDNKKLFETQLIELDNNLVTESQLLENIKL 528
            K     +    K  +  +I    +LV   ++LE  +L
Sbjct: 355 KKTQNEYYRGRTKKLQATIISTKEDLVRNQEILEQTQL 392

 Score = 41.6 bits (96), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 20/62 (32%), Positives = 35/62 (56%), Gaps = 3/62 (4%)

Query: 1299 SGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERT---KNAQFIV 1355
            SGGE+ +S++  + AL ++   P  V+DEI+  +D RN  IV   + E       +Q+ +
Sbjct: 987  SGGERAVSTVLYMIALQEFTSAPFRVVDEINQGMDSRNERIVHKAMVENACAENTSQYFL 1046

Query: 1356 IS 1357
            I+
Sbjct: 1047 IT 1048

>KAFR0D01330 Chr4 complement(263879..267121) [3243 bp, 1080 aa] {ON}
           Anc_7.101 YOL034W
          Length = 1080

 Score = 44.3 bits (103), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 52/196 (26%), Positives = 90/196 (45%), Gaps = 24/196 (12%)

Query: 148 KLVLHNFKSYAGTQ-TIGPFHSSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQGKLAD 206
           KL L N  +Y+ T+  + P   S + +VGPNGSGKS  + ++      +   + + K  D
Sbjct: 39  KLRLQNVMTYSITEFNLSP---SLNMLVGPNGSGKSTFVCAVCLGLAGKPEYIGRSKKID 95

Query: 207 LIHKSEEYPDLTSCAVDVHFEYLIDYPDDTTKINPSKQPLIITRRAFKNSTSKYYLNGKE 266
              K+ E     +  +D      +  P++  KI       I+TR   K   S+YY++   
Sbjct: 96  NFIKNGE----NTAQIDTFLRGHM--PNEVIKIT-----RIMTRNKKK---SEYYIDDSP 141

Query: 267 SNYKTITALLKEEGIDLDHNRFLILQGEVENIAQMKP-----KAEKEGDDGLLEYLEDII 321
           S    +  L  E  I LD+    + Q  VE+ A++K      +  +  +  LLE LED +
Sbjct: 142 STETAVRKLASELNIQLDNLCQFLSQEHVEDFAKLKSDKLLIETIRSINPSLLETLED-L 200

Query: 322 GTTKYKELIDKKFIEI 337
              + KE++  + +E+
Sbjct: 201 KQLQTKEIVSSQDVEL 216

 Score = 41.2 bits (95), Expect = 0.021,   Method: Compositional matrix adjust.
 Identities = 20/62 (32%), Positives = 35/62 (56%), Gaps = 3/62 (4%)

Query: 1299 SGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERT---KNAQFIV 1355
            SGGE+ +S++  + AL ++   P  V+DEI+  +D RN  IV   + E       +Q+ +
Sbjct: 975  SGGERAVSTVLYMIALQEFTAAPFRVVDEINQGMDQRNERIVHRAMVENACAENTSQYFL 1034

Query: 1356 IS 1357
            I+
Sbjct: 1035 IT 1036

>SAKL0B09526g Chr2 (805816..809115) [3300 bp, 1099 aa] {ON} similar
           to uniprot|Q08204 Saccharomyces cerevisiae YOL034W SMC5
           Structural maintenance of chromosomes (SMC) protein
           interacts with Rhc18p and Nse1p to form a large complex
           S. pombe homolog forms a heterodimer with S. pombe
           Rad18p that is involved in DNA repair
          Length = 1099

 Score = 44.3 bits (103), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 41/165 (24%), Positives = 77/165 (46%), Gaps = 26/165 (15%)

Query: 148 KLVLHNFKSYAGTQTIGPFH--SSFSAVVGPNGSGKSNVIDSMLFVFGFRANKM-RQGKL 204
           K+ L NF +YA T+    FH   S + ++GPNGSGKS  + ++      R   + R  ++
Sbjct: 50  KIRLKNFVTYALTE----FHLSPSLNMIIGPNGSGKSTFVCAICLGLAGRPEYIGRSKRV 105

Query: 205 ADLIHKSEEYPDLTSCAVDVHFEYLIDYPDDTTKIN------PSKQPLIITRRAFKN-ST 257
            D I   E+      C +++  +       + +KI        S   + ITR   ++   
Sbjct: 106 EDFIKNGED-----ECEIEITLK-------NNSKIQGIANVLSSDDVIKITRVLIRHRKK 153

Query: 258 SKYYLNGKESNYKTITALLKEEGIDLDHNRFLILQGEVENIAQMK 302
           S Y++N + ++   + +++ +  I LD+    + Q  VE  A++K
Sbjct: 154 SDYFINDRPASEGVVKSMILQLNIQLDNLCQFLSQERVEEFARLK 198

 Score = 41.6 bits (96), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 20/62 (32%), Positives = 35/62 (56%), Gaps = 3/62 (4%)

Query: 1299 SGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERT---KNAQFIV 1355
            SGGE+ +S++  + AL ++   P  V+DEI+  +D RN  IV   + E       +Q+ +
Sbjct: 994  SGGERAVSTVLYMIALQEFTTAPFRVVDEINQGMDTRNERIVHKAMVENACAENTSQYFL 1053

Query: 1356 IS 1357
            I+
Sbjct: 1054 IT 1055

>ZYRO0B12122g Chr2 (972611..975940) [3330 bp, 1109 aa] {ON} similar to
            uniprot|Q12749 Saccharomyces cerevisiae YLR383W RHC18
            Protein involved in structural maintenance of chromosomes
            required for interchromosomal and sister chromatid
            recombination
          Length = 1109

 Score = 43.9 bits (102), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 26/78 (33%), Positives = 40/78 (51%), Gaps = 3/78 (3%)

Query: 1283 FSVMPPKKSWRNISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVAN 1342
            F + P  +  RN+  LSGGEK+ S +AL+ A  K   + +  +DE D  +D  N  I   
Sbjct: 997  FILTPNDEKARNVDTLSGGEKSFSQMALLLATWKPMRSRIIALDEFDVFMDQVNRQIGTK 1056

Query: 1343 YIKERTKN---AQFIVIS 1357
             I  + K+    Q I+I+
Sbjct: 1057 LILNKLKDIARTQTIIIT 1074

>TBLA0E02190 Chr5 complement(534078..537347) [3270 bp, 1089 aa] {ON}
           Anc_7.101 YOL034W
          Length = 1089

 Score = 43.9 bits (102), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 51/193 (26%), Positives = 86/193 (44%), Gaps = 30/193 (15%)

Query: 118 QLSPIKNSRSELQKIYSSKQEEKIERICLNKLVLHNFKSYAGTQ-TIGPFHSSFSAVVGP 176
           Q+S  K +R  L+   ++   E+ +   + K+ L NF +Y+  + T+ P   S + ++GP
Sbjct: 18  QISTSKPARKRLK--ITAIDTEQFQPGSIIKIKLWNFVTYSLAEFTLSP---SLNMIIGP 72

Query: 177 NGSGKSNVIDSMLFVFGFRANKM-RQGKLADLIHKSEEYPDLTSCAVDVHFEYLI--DYP 233
           NGSGKS  + ++      +   + R  KL D I   E+        V+V  + +   D+ 
Sbjct: 73  NGSGKSTFVCAVCLGLAGKPEYIGRSSKLEDYIKNGED-----QSVVEVTLKNVPESDFN 127

Query: 234 DDT----TKINPSKQPLIITRRAFKNSTSKYYLNGKESNYKTITALLKEEGIDLDHNRFL 289
            DT    T IN  K+              +Y +NG       I A +K+  I LD+    
Sbjct: 128 TDTILIKTTINRGKK------------KPEYAINGSTVTETYIRAFVKKLNIQLDNLCQF 175

Query: 290 ILQGEVENIAQMK 302
           + Q  VE  A++K
Sbjct: 176 LSQERVEEFARLK 188

 Score = 40.8 bits (94), Expect = 0.029,   Method: Compositional matrix adjust.
 Identities = 19/62 (30%), Positives = 35/62 (56%), Gaps = 3/62 (4%)

Query: 1299 SGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERT---KNAQFIV 1355
            SGGE+ +S++  + AL ++   P  V+DEI+  +D RN  I+   + E       +Q+ +
Sbjct: 984  SGGERAVSTVLYMIALQEFTSAPFRVVDEINQGMDSRNERIIHKAMVENACAENTSQYFL 1043

Query: 1356 IS 1357
            I+
Sbjct: 1044 IT 1045

>KLLA0F07997g Chr6 complement(748561..751920) [3360 bp, 1119 aa] {ON}
            similar to uniprot|Q08204 YOL034W Saccharomyces
            cerevisiae YOL034W SMC5 Structural maintenance of
            chromosomes (SMC) protein, interacts with Rhc18p and
            Nse1p to form a large complex
          Length = 1119

 Score = 43.9 bits (102), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 34/128 (26%), Positives = 55/128 (42%), Gaps = 20/128 (15%)

Query: 1249 ISMTLKEMYQIITMGGNAELELVDSLDPFSEGVTFSVMPPKKSWRNISNL--------SG 1300
            IS     ++  +   G  EL+  DS + +        +  K  +R+ S L        SG
Sbjct: 963  ISKKFSHLFAYVGSAGQVELKKPDSFNDW-------CIEIKVKFRDNSELQQLNPHVQSG 1015

Query: 1301 GEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVA-----NYIKERTKNAQFIV 1355
            GE+ +S++  + AL ++  +P  V+DEI+  +D  N  IV      N   E T     I 
Sbjct: 1016 GERAVSTVLYMIALQQFTSSPFRVVDEINQGMDQTNERIVHRIMVENACAENTSQYFLIT 1075

Query: 1356 ISLRNNMF 1363
              L  N+F
Sbjct: 1076 PKLLTNLF 1083

 Score = 38.1 bits (87), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 69/298 (23%), Positives = 126/298 (42%), Gaps = 60/298 (20%)

Query: 148 KLVLHNFKSYAGTQTIGPFH--SSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQGKLA 205
           KL L NF +YA T+    FH   S + ++GPNGSGKS  + ++      +   + + K  
Sbjct: 62  KLKLTNFVTYALTE----FHLSPSLNMIIGPNGSGKSTFVCAICLGLAGKPEYIGRSK-- 115

Query: 206 DLIHKSEEYP-----------DLTSCAVDVHFEY-LIDYPDDTTKINPSKQPLIITRRAF 253
               K EEY             L + +  +H ++ +I+  DD   +   K+ L + ++  
Sbjct: 116 ----KVEEYIKNGTDEGVIEITLKNSSALLHSDFNMINTDDDVVHV---KRVLSMEKKK- 167

Query: 254 KNSTSKYYLNGKESNYKTITALLKEEGIDLDHNRFLILQGEVENIAQMKP-----KAEKE 308
               SKYY+N K    + + ++++   I LD+    + Q  VE  A++KP     +  + 
Sbjct: 168 ----SKYYINNKVVTEEVVKSMVRVLNIQLDNLCQFLSQERVEEFARLKPDTLLNETIRS 223

Query: 309 GDDGLLEYLEDIIGTTKYKELIDKKFIEIEALNDICIE---RENRFDIIDRXXXXXXXXX 365
            + GLLE L ++            K ++ E  N++ I+   +EN+   +           
Sbjct: 224 IEAGLLEKLSEL------------KSLQAEG-NELQIDLGAKENKLKELT-SSRAALESQ 269

Query: 366 XXXXXXXXXXXXQVIVKSKLIQYKIWQNNIKLSNTLEKITKLEDEYNQEKNKNTELKN 423
                       ++ +  KL+ Y        L    EKI  L+D+ N  +N+   ++N
Sbjct: 270 AHALELYEEKARELDIHQKLLNYTY------LKEHKEKIRGLKDKRNALRNEVKTMEN 321

>YOL034W Chr15 (259923..263204) [3282 bp, 1093 aa] {ON}
           SMC5Component of the SMC5-SMC6 complex; this complex
           plays a key role in the removal of X-shaped DNA
           structures that arise between sister chromatids during
           DNA replication and repair; binds single-stranded DNA
           and has ATPase activity; S. pombe homolog forms a
           heterodimer with S. pombe Rad18p that is involved in DNA
           repair
          Length = 1093

 Score = 43.5 bits (101), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 42/163 (25%), Positives = 74/163 (45%), Gaps = 22/163 (13%)

Query: 148 KLVLHNFKSYAGTQ-TIGPFHSSFSAVVGPNGSGKSNVIDSMLFVFGFRANKM-RQGKLA 205
           K+ L +F +Y  T+  + P   S + ++GPNGSGKS  + ++      +   + R  K+ 
Sbjct: 44  KIRLQDFVTYTLTEFNLSP---SLNMIIGPNGSGKSTFVCAVCLGLAGKPEYIGRSKKVE 100

Query: 206 DLIHKSEEYPDL------TSCAVDVHFEYLIDYPDDTTKINPSKQPLIITRRAFKNSTSK 259
           D I   ++   +      +    D+ +   ID  D+T KI       IITR   +   S 
Sbjct: 101 DFIKNGQDVSKIEITLKNSPNVTDIEY---IDARDETIKIT-----RIITRSKRR---SD 149

Query: 260 YYLNGKESNYKTITALLKEEGIDLDHNRFLILQGEVENIAQMK 302
           Y +N  + +   +  L+ +  I LD+    + Q  VE  A++K
Sbjct: 150 YLINDYQVSESVVKTLVAQLNIQLDNLCQFLSQERVEEFARLK 192

 Score = 41.6 bits (96), Expect = 0.020,   Method: Compositional matrix adjust.
 Identities = 20/62 (32%), Positives = 35/62 (56%), Gaps = 3/62 (4%)

Query: 1299 SGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERT---KNAQFIV 1355
            SGGE+ +S++  + AL ++   P  V+DEI+  +D RN  IV   + E       +Q+ +
Sbjct: 987  SGGERAVSTVLYMIALQEFTSAPFRVVDEINQGMDSRNERIVHKAMVENACAENTSQYFL 1046

Query: 1356 IS 1357
            I+
Sbjct: 1047 IT 1048

>Kpol_1044.13 s1044 complement(23616..26927) [3312 bp, 1103 aa] {ON}
           complement(23616..26927) [3312 nt, 1104 aa]
          Length = 1103

 Score = 43.1 bits (100), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 40/175 (22%), Positives = 84/175 (48%), Gaps = 16/175 (9%)

Query: 148 KLVLHNFKSYAGTQ-TIGPFHSSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQGKLAD 206
           K+ + NF +Y   +  + P   SF+ ++GPNGSGKS V+ ++      + +   +G +  
Sbjct: 53  KIKMKNFMTYGLVEYQLCP---SFNMIIGPNGSGKSTVVCALGLGLASKLDITGRGDIVT 109

Query: 207 LIHKSEEYPDLTSCAVDVHFEYLIDYPDDTTKINPSKQPLIITRR-AFKNSTSKYYLNGK 265
              ++ +    TS  +++  +Y  D   +   +NP+++ + I R  +     S Y +N  
Sbjct: 110 QYIQNGK----TSGKIEITLKYS-DRIKNVKGVNPNRETVTIKREISIDAKKSNYKINNT 164

Query: 266 ESNYKTITALLKEEGIDLDHNRFLILQGEVENIAQMKPKAEKEGDDGLLEYLEDI 320
             N K +  ++ +  I LD+    + Q  +++ A++K      G+  LLE +  +
Sbjct: 165 VVNEKDVRDIVSKLNIQLDNLCQYLPQERLKDFARLK------GEKLLLETIRAV 213

 Score = 41.6 bits (96), Expect = 0.020,   Method: Compositional matrix adjust.
 Identities = 19/62 (30%), Positives = 34/62 (54%), Gaps = 3/62 (4%)

Query: 1299 SGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERT---KNAQFIV 1355
            SGGEK +S+   + +L  +   P  V+DEI+  +D RN  I+   + E       +Q+I+
Sbjct: 995  SGGEKAVSTALYIISLQNFTKAPFRVVDEINQGMDSRNEKIIHRIMVENACEDNTSQYIL 1054

Query: 1356 IS 1357
            ++
Sbjct: 1055 VT 1056

>Ecym_2625 Chr2 (1208550..1211843) [3294 bp, 1097 aa] {ON} similar to
            Ashbya gossypii AEL337
          Length = 1097

 Score = 43.1 bits (100), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 38/142 (26%), Positives = 71/142 (50%), Gaps = 25/142 (17%)

Query: 1227 VRKELEDLKKCRFNEFMESFNIISMTLKEMYQIITMGGNAELELVDSLDPFSEGVTFSVM 1286
            +R ELE     R +E +E+   IS   ++++  + +G   E+ LV   D +SE      +
Sbjct: 926  IRSELEP----RLDEIVEN---ISTRFRKLF--LNVGSAGEVCLVKP-DLYSEWK----I 971

Query: 1287 PPKKSWRNISNL--------SGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVS 1338
              K  +R+++ L        SGGE+ +S++  + +L ++   P  V+DEI+  +D RN  
Sbjct: 972  EIKVKFRDVAELKKLDSHIQSGGERAVSTVLYMISLQEFTNAPFRVVDEINQGMDARNER 1031

Query: 1339 IVANYIKERT---KNAQFIVIS 1357
            IV   + E       +Q+ +I+
Sbjct: 1032 IVHKAMVENACAKNTSQYFLIT 1053

 Score = 40.8 bits (94), Expect = 0.028,   Method: Compositional matrix adjust.
 Identities = 47/163 (28%), Positives = 74/163 (45%), Gaps = 22/163 (13%)

Query: 148 KLVLHNFKSYAGTQTIGPFH--SSFSAVVGPNGSGKSNVIDSMLFVFGFRANKM-RQGKL 204
           KL L NF +Y+ T+    FH   S + ++GPNGSGKS+ + ++      +   + R  K+
Sbjct: 48  KLRLVNFVTYSLTE----FHLSPSLNMIIGPNGSGKSSFVCAICLGLAGKPEYIGRAKKV 103

Query: 205 ADLIHKS--EEYPDLT---SCAVDVHFEYLIDYPDDTTKINPSKQPLIITRRAFKNSTSK 259
            D I     E   +LT   S AV  +   +I   D+   I        +  +A K     
Sbjct: 104 EDFIKNGTEESVIELTVKNSKAVSGY--SMIGGSDEVINIKT------VIMKAKKKCI-- 153

Query: 260 YYLNGKESNYKTITALLKEEGIDLDHNRFLILQGEVENIAQMK 302
           YY+NG+      + AL+    I LD+    + Q  VE  A++K
Sbjct: 154 YYINGQSVGENQVKALVCLLNIQLDNLCQFLSQERVEEFARLK 196

>CAGL0H05071g Chr8 (486899..490231) [3333 bp, 1110 aa] {ON} similar to
            uniprot|Q12749 Saccharomyces cerevisiae YLR383w RHC18
          Length = 1110

 Score = 42.7 bits (99), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 24/76 (31%), Positives = 40/76 (52%), Gaps = 3/76 (3%)

Query: 1285 VMPPKKSWRNISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYI 1344
            + P    +R +S  SGGEK+ S +AL+ A  +   + +  +DE D  +D  N  I +  I
Sbjct: 1007 LTPNDDRYREVSTFSGGEKSYSQMALLLATWRPMRSRIIALDEFDVFMDQVNRKIGSKLI 1066

Query: 1345 KERTK---NAQFIVIS 1357
             ++ K   N Q I+I+
Sbjct: 1067 VKKLKDIPNTQTIIIT 1082

 Score = 41.2 bits (95), Expect = 0.026,   Method: Compositional matrix adjust.
 Identities = 23/65 (35%), Positives = 36/65 (55%), Gaps = 5/65 (7%)

Query: 146 LNKLVLHNFKSYAGTQT-IGPFHSSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQG-K 203
           + KL LHNF  +      +GP     + +VG NGSGKS ++ ++    G +A++  +G  
Sbjct: 80  IKKLTLHNFMCHRNFDVELGP---GLNFIVGKNGSGKSAILTAITIGLGAKASETNRGSS 136

Query: 204 LADLI 208
           L DLI
Sbjct: 137 LKDLI 141

>NCAS0J01390 Chr10 (242118..245408) [3291 bp, 1096 aa] {ON} Anc_4.237
          Length = 1096

 Score = 42.4 bits (98), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 24/68 (35%), Positives = 37/68 (54%), Gaps = 3/68 (4%)

Query: 1293 RNISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKN-- 1350
            RN+  LSGGEK+ S LAL+ A  K   + +  +DE D  +D  N  I    + ++ K+  
Sbjct: 992  RNVDTLSGGEKSFSQLALLLATWKPMRSRIIALDEFDVFMDQVNRRIGTTLVVKKLKDLA 1051

Query: 1351 -AQFIVIS 1357
              Q I+I+
Sbjct: 1052 RTQTIIIT 1059

 Score = 34.3 bits (77), Expect = 3.3,   Method: Compositional matrix adjust.
 Identities = 20/65 (30%), Positives = 35/65 (53%), Gaps = 5/65 (7%)

Query: 146 LNKLVLHNFKSYAGTQ-TIGPFHSSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQG-K 203
           + K+ L NF  +   +  +GP     + +VG NGSGKS ++ ++    G +A+   +G  
Sbjct: 64  IKKVSLRNFMCHENFELELGP---KLNFIVGSNGSGKSAILTAITIALGAKASDTNRGNS 120

Query: 204 LADLI 208
           L +LI
Sbjct: 121 LKELI 125

>NCAS0I00570 Chr9 complement(90806..94093) [3288 bp, 1095 aa] {ON}
           Anc_7.101 YOL034W
          Length = 1095

 Score = 42.0 bits (97), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 50/191 (26%), Positives = 87/191 (45%), Gaps = 29/191 (15%)

Query: 148 KLVLHNFKSYAGTQ-TIGPFHSSFSAVVGPNGSGKSNVIDSMLFVFGFRANKM-RQGKLA 205
           K+ L NF +Y  T+  + P   S + ++GPNGSGKS  + ++      +   + R  ++ 
Sbjct: 40  KIKLQNFVTYRLTEFNLSP---SLNMIIGPNGSGKSTFVCAVCLGLAGKPEFIGRAKRVD 96

Query: 206 DLIHKSEEYPDLTSCAVDVHFEYLIDYPDDT-------TKINPSKQPLI-ITR---RAFK 254
           D I   E+     +  +++   +L +Y D T        K N + + L+ +TR   R   
Sbjct: 97  DFIKNGED-----TSRIEI---FLKNYEDPTELQSSLNLKFNLAGKDLLKVTRLIQRDGN 148

Query: 255 NSTSKYYLNGKESNYKTITALLKEEGIDLDHNRFLILQGEVENIAQMKP-----KAEKEG 309
              S Y++N K      I  L+K   I LD+    + Q  VE  A++K      +  +  
Sbjct: 149 KCKSDYFINDKPVTENVIKNLVKFLNIQLDNLCQFLSQERVEEFARLKSDKLLVETVRSI 208

Query: 310 DDGLLEYLEDI 320
           D  LL+ L+D+
Sbjct: 209 DAQLLQILDDL 219

 Score = 42.0 bits (97), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 20/62 (32%), Positives = 35/62 (56%), Gaps = 3/62 (4%)

Query: 1299 SGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERT---KNAQFIV 1355
            SGGE+ +S++  + AL ++   P  V+DEI+  +D RN  IV   + E       +Q+ +
Sbjct: 990  SGGERAVSTVLYMIALQEFTSAPFRVVDEINQGMDARNERIVHKAMVENACAENTSQYFL 1049

Query: 1356 IS 1357
            I+
Sbjct: 1050 IT 1051

>NDAI0A08450 Chr1 (1947452..1950811) [3360 bp, 1119 aa] {ON} Anc_7.101
            YOL034W
          Length = 1119

 Score = 42.0 bits (97), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 20/62 (32%), Positives = 35/62 (56%), Gaps = 3/62 (4%)

Query: 1299 SGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERT---KNAQFIV 1355
            SGGE+ +S++  + AL ++   P  V+DEI+  +D RN  IV   + E       +Q+ +
Sbjct: 1014 SGGERAVSTVLYMIALQEFTAAPFRVVDEINQGMDSRNERIVHKAMVENACAENTSQYFL 1073

Query: 1356 IS 1357
            I+
Sbjct: 1074 IT 1075

>TPHA0B00840 Chr2 complement(194812..198171) [3360 bp, 1119 aa] {ON}
            Anc_4.237 YLR383W
          Length = 1119

 Score = 42.0 bits (97), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 24/68 (35%), Positives = 37/68 (54%), Gaps = 3/68 (4%)

Query: 1293 RNISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKN-- 1350
            R I NLSGGEK+ + +AL+ A  K   + +  +DE D  +D  N  I    + ++ KN  
Sbjct: 1019 RTIDNLSGGEKSFAQMALLLATWKPMRSRIIALDEFDVFMDQVNRKIGTGLLVKKLKNQT 1078

Query: 1351 -AQFIVIS 1357
              Q I+I+
Sbjct: 1079 RTQTIIIT 1086

 Score = 33.9 bits (76), Expect = 3.7,   Method: Compositional matrix adjust.
 Identities = 21/64 (32%), Positives = 33/64 (51%), Gaps = 3/64 (4%)

Query: 146 LNKLVLHNFKSYAGTQTIGPFHSSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQG-KL 204
           + K+ L NF  +   +    F    + +VG NGSGKS V+ ++    G +A+   +G  L
Sbjct: 85  IKKIKLRNFMCHENFEM--EFGPRLNFIVGNNGSGKSAVLTAITIGLGAKASDTNRGNSL 142

Query: 205 ADLI 208
            DLI
Sbjct: 143 KDLI 146

>Skud_12.468 Chr12 (825378..828740) [3363 bp, 1120 aa] {ON} YLR383W
            (REAL)
          Length = 1120

 Score = 41.6 bits (96), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 24/68 (35%), Positives = 37/68 (54%), Gaps = 3/68 (4%)

Query: 1293 RNISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKN-- 1350
            RN+  LSGGEK+ S +AL+ A  K   + +  +DE D  +D  N  I    I ++ K+  
Sbjct: 1020 RNVDTLSGGEKSFSQMALLLATWKPMRSRIIALDEFDVFMDQVNRKIGTTLIVKKLKDIA 1079

Query: 1351 -AQFIVIS 1357
              Q I+I+
Sbjct: 1080 RTQTIIIT 1087

 Score = 36.2 bits (82), Expect = 0.82,   Method: Compositional matrix adjust.
 Identities = 23/83 (27%), Positives = 41/83 (49%), Gaps = 8/83 (9%)

Query: 146 LNKLVLHNFKSYAGTQTIGPFHSSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQG-KL 204
           + K++L NF  +   +      S  + +VG NGSGKS ++ ++    G +A++  +G  L
Sbjct: 88  IKKVILRNFMCHEHFEL--ELGSRLNFIVGNNGSGKSAILTAITIGLGAKASETNRGSSL 145

Query: 205 ADLIHKSEEYPDLTSCAVDVHFE 227
            DLI +        S  + +H E
Sbjct: 146 KDLIREG-----CYSAKITLHLE 163

>YLR383W Chr12 (885288..888632) [3345 bp, 1114 aa] {ON}  SMC6Component
            of the SMC5-SMC6 complex; this complex plays a key role
            in the removal of X-shaped DNA structures that arise
            between sister chromatids during DNA replication and
            repair; homologous to S. pombe rad18
          Length = 1114

 Score = 41.6 bits (96), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 24/68 (35%), Positives = 37/68 (54%), Gaps = 3/68 (4%)

Query: 1293 RNISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKN-- 1350
            RN+  LSGGEK+ S +AL+ A  K   + +  +DE D  +D  N  I    I ++ K+  
Sbjct: 1014 RNVDTLSGGEKSFSQMALLLATWKPMRSRIIALDEFDVFMDQVNRKIGTTLIVKKLKDIA 1073

Query: 1351 -AQFIVIS 1357
              Q I+I+
Sbjct: 1074 RTQTIIIT 1081

 Score = 35.0 bits (79), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 20/67 (29%), Positives = 36/67 (53%), Gaps = 3/67 (4%)

Query: 146 LNKLVLHNFKSYAGTQTIGPFHSSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQG-KL 204
           + K++L NF  +   +      S  + +VG NGSGKS ++ ++    G +A++  +G  L
Sbjct: 82  IKKVILRNFMCHEHFEL--ELGSRLNFIVGNNGSGKSAILTAITIGLGAKASETNRGSSL 139

Query: 205 ADLIHKS 211
            DLI + 
Sbjct: 140 KDLIREG 146

>ZYRO0G01584g Chr7 (120582..123848) [3267 bp, 1088 aa] {ON} similar to
            uniprot|Q08204 Saccharomyces cerevisiae YOL034W SMC5
            Structural maintenance of chromosomes (SMC) protein
            interacts with Rhc18p and Nse1p to form a large complex
            S. pombe homolog forms a heterodimer with S. pombe Rad18p
            that is involved in DNA repair
          Length = 1088

 Score = 41.6 bits (96), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 22/64 (34%), Positives = 37/64 (57%), Gaps = 7/64 (10%)

Query: 1299 SGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRN-----VSIVANYIKERTKNAQF 1353
            SGGE+ +S++  + AL ++   P  V+DEI+  +D RN      S+V N   E T  +Q+
Sbjct: 981  SGGERAVSTVLYMIALQEFTTAPFRVVDEINQGMDSRNERIVHKSMVENACAENT--SQY 1038

Query: 1354 IVIS 1357
             +I+
Sbjct: 1039 FLIT 1042

 Score = 40.4 bits (93), Expect = 0.043,   Method: Compositional matrix adjust.
 Identities = 42/161 (26%), Positives = 74/161 (45%), Gaps = 18/161 (11%)

Query: 148 KLVLHNFKSYAGTQ-TIGPFHSSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQGK-LA 205
           K+ L NF +Y  T+  + P   S + ++GPNGSGKS  + ++      +   +++ K + 
Sbjct: 38  KMRLENFVTYTLTEFDLSP---SLNMIIGPNGSGKSTFVCAVCLGLAGKPEFIKRSKRVE 94

Query: 206 DLIHKSEEYPDLTSC---AVDVHFEYLIDYPDDTTKINPSKQPLIITRRAFKN-STSKYY 261
           D I   E+   +      +  V     +D   DT K         ITR   K+ S S+Y 
Sbjct: 95  DFIKNGEDRGSIEITLKNSPKVEGMPGVDSEADTIK---------ITRELIKSKSKSRYM 145

Query: 262 LNGKESNYKTITALLKEEGIDLDHNRFLILQGEVENIAQMK 302
           +N +  + + +  L+ +  I LD+    + Q  VE  A++K
Sbjct: 146 INDRVVSEEDVRLLVSKLNIQLDNLCQFLSQERVEEFARLK 186

>NDAI0J02180 Chr10 (529566..532892) [3327 bp, 1108 aa] {ON} Anc_4.237
            YLR383W
          Length = 1108

 Score = 41.6 bits (96), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 32/107 (29%), Positives = 51/107 (47%), Gaps = 15/107 (14%)

Query: 1266 AELELVDSLD--PFSEGVTFSVMPPK----------KSWRNISNLSGGEKTLSSLALVFA 1313
            A+L+   SL    F+  +TF +   K          +  RN+  LSGGEK+ S LAL+ A
Sbjct: 969  ADLDFRASLKVRKFTGNLTFQIAERKLDMLILTANDEKARNVDTLSGGEKSFSQLALLLA 1028

Query: 1314 LHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKN---AQFIVIS 1357
              K   + +  +DE D  +D  N  I    + ++ K+    Q I+I+
Sbjct: 1029 TWKPMRSRIIALDEFDVFMDQVNRRIGTTLVVKKLKDLLRTQTIIIT 1075

 Score = 35.0 bits (79), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 21/65 (32%), Positives = 36/65 (55%), Gaps = 5/65 (7%)

Query: 146 LNKLVLHNFKSYAGTQ-TIGPFHSSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQG-K 203
           + K++L NF  +   +  +GP     + +VG NGSGKS V+ ++    G +A+   +G  
Sbjct: 76  IKKVILRNFMCHEHFELDLGP---RLNFIVGNNGSGKSAVLTAITIGLGAKASDTNRGNA 132

Query: 204 LADLI 208
           + DLI
Sbjct: 133 MKDLI 137

>Smik_12.470 Chr12 (824001..827345) [3345 bp, 1114 aa] {ON} YLR383W
            (REAL)
          Length = 1114

 Score = 41.6 bits (96), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 24/68 (35%), Positives = 37/68 (54%), Gaps = 3/68 (4%)

Query: 1293 RNISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKN-- 1350
            RN+  LSGGEK+ S +AL+ A  K   + +  +DE D  +D  N  I    I ++ K+  
Sbjct: 1014 RNVDTLSGGEKSFSQMALLLATWKPMRSRIIALDEFDVFMDQVNRKIGTTLIVKKLKDIA 1073

Query: 1351 -AQFIVIS 1357
              Q I+I+
Sbjct: 1074 RTQTIIIT 1081

 Score = 35.0 bits (79), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 20/67 (29%), Positives = 36/67 (53%), Gaps = 3/67 (4%)

Query: 146 LNKLVLHNFKSYAGTQTIGPFHSSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQG-KL 204
           + K++L NF  +   +      S  + +VG NGSGKS ++ ++    G +A++  +G  L
Sbjct: 82  IKKVILRNFMCHEHFEL--ELGSRLNFIVGNNGSGKSAILTAITIGLGAKASETNRGSSL 139

Query: 205 ADLIHKS 211
            DLI + 
Sbjct: 140 KDLIREG 146

>Smik_15.131 Chr15 (226115..229396) [3282 bp, 1093 aa] {ON} YOL034W
            (REAL)
          Length = 1093

 Score = 41.6 bits (96), Expect = 0.019,   Method: Compositional matrix adjust.
 Identities = 20/62 (32%), Positives = 35/62 (56%), Gaps = 3/62 (4%)

Query: 1299 SGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERT---KNAQFIV 1355
            SGGE+ +S++  + AL ++   P  V+DEI+  +D RN  IV   + E       +Q+ +
Sbjct: 987  SGGERAVSTVLYMIALQEFTSAPFRVVDEINQGMDSRNERIVHKAMVENACAENTSQYFL 1046

Query: 1356 IS 1357
            I+
Sbjct: 1047 IT 1048

 Score = 39.3 bits (90), Expect = 0.090,   Method: Compositional matrix adjust.
 Identities = 39/157 (24%), Positives = 73/157 (46%), Gaps = 16/157 (10%)

Query: 151 LHNFKSYAGTQ-TIGPFHSSFSAVVGPNGSGKSNVIDSMLFVFGFRANKM-RQGKLADLI 208
           L +F +Y  T+  + P   S + ++GPNGSGKS  + ++      +   + R  ++ D I
Sbjct: 47  LQDFVTYTLTEFNLSP---SLNMIIGPNGSGKSTFVCAVCLGLAGKPEYIGRSKRVEDFI 103

Query: 209 HKSEEYPDLTSCAVDVHFEYLIDYP--DDTTKINPSKQPLIITRRAFKNS-TSKYYLNGK 265
              +   D++   +      L + P  +D   +N   + + ITR   ++   S Y +N  
Sbjct: 104 KNGQ---DVSRIEIT-----LKNSPKVNDIENVNAHDETIKITRIITRSKRRSDYLINDC 155

Query: 266 ESNYKTITALLKEEGIDLDHNRFLILQGEVENIAQMK 302
           E +   + AL+ +  I LD+    + Q  VE  A++K
Sbjct: 156 EVSESVVKALVAQLNIQLDNLCQFLSQERVEEFARLK 192

>Suva_10.500 Chr10 (850833..854180) [3348 bp, 1115 aa] {ON} YLR383W
            (REAL)
          Length = 1115

 Score = 41.6 bits (96), Expect = 0.019,   Method: Compositional matrix adjust.
 Identities = 24/68 (35%), Positives = 37/68 (54%), Gaps = 3/68 (4%)

Query: 1293 RNISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKN-- 1350
            RN+  LSGGEK+ S +AL+ A  K   + +  +DE D  +D  N  I    I ++ K+  
Sbjct: 1015 RNVDTLSGGEKSFSQMALLLATWKPMRSRIIALDEFDVFMDQVNRKIGTTLIVKKLKDIA 1074

Query: 1351 -AQFIVIS 1357
              Q I+I+
Sbjct: 1075 RTQTIIIT 1082

 Score = 34.7 bits (78), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 20/64 (31%), Positives = 35/64 (54%), Gaps = 3/64 (4%)

Query: 146 LNKLVLHNFKSYAGTQTIGPFHSSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQG-KL 204
           + K++L NF  +   +      S  + +VG NGSGKS ++ ++    G +A++  +G  L
Sbjct: 83  IKKVILRNFMCHEHFEL--ELGSRLNFIVGNNGSGKSAILTAITIGLGAKASETNRGSSL 140

Query: 205 ADLI 208
            DLI
Sbjct: 141 KDLI 144

>KNAG0B06010 Chr2 (1178430..1181783) [3354 bp, 1117 aa] {ON} Anc_4.237
            YLR383W
          Length = 1117

 Score = 41.2 bits (95), Expect = 0.023,   Method: Compositional matrix adjust.
 Identities = 24/68 (35%), Positives = 37/68 (54%), Gaps = 3/68 (4%)

Query: 1293 RNISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKN-- 1350
            R++  LSGGEK+ S +AL+ A  K   + +  +DE D  +D  N  I    I ++ KN  
Sbjct: 1014 RDVDTLSGGEKSFSQMALLLATWKPMRSRIIALDEFDVFMDQVNRKIGTALIVKKLKNES 1073

Query: 1351 -AQFIVIS 1357
              Q I+I+
Sbjct: 1074 RTQTIIIT 1081

>TPHA0L00600 Chr12 complement(102317..105670) [3354 bp, 1117 aa] {ON}
            Anc_7.101 YOL034W
          Length = 1117

 Score = 41.2 bits (95), Expect = 0.025,   Method: Compositional matrix adjust.
 Identities = 21/62 (33%), Positives = 35/62 (56%), Gaps = 3/62 (4%)

Query: 1299 SGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERT---KNAQFIV 1355
            SGGEK +S++  + AL ++   P  V+DEI+  +D RN  IV   + E       +Q+ +
Sbjct: 1012 SGGEKAVSTVFYMIALQEFTIAPFRVVDEINQGMDPRNEKIVHQSMVENACADNTSQYFL 1071

Query: 1356 IS 1357
            I+
Sbjct: 1072 IT 1073

 Score = 38.1 bits (87), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 22/72 (30%), Positives = 38/72 (52%), Gaps = 5/72 (6%)

Query: 148 KLVLHNFKSYAGTQ-TIGPFHSSFSAVVGPNGSGKSNVIDSMLFVFGFRANKM-RQGKLA 205
           K+ LHNF +Y  T+  + P   S + ++GPNGSGKS  + ++      +   + R   + 
Sbjct: 68  KIKLHNFVTYEFTEFDLSP---SLNMIIGPNGSGKSTFVCAVCLGLAGKPEYIGRSRNVD 124

Query: 206 DLIHKSEEYPDL 217
           D I   EE+ ++
Sbjct: 125 DYIKNDEEHGEI 136

>TDEL0H03490 Chr8 (578645..581956) [3312 bp, 1103 aa] {ON} Anc_7.101
            YOL034W
          Length = 1103

 Score = 40.8 bits (94), Expect = 0.034,   Method: Compositional matrix adjust.
 Identities = 21/64 (32%), Positives = 36/64 (56%), Gaps = 7/64 (10%)

Query: 1299 SGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRN-----VSIVANYIKERTKNAQF 1353
            SGGE+ +S++  + AL +Y   P  ++DEI+  +D  N      S+V N   E T  +Q+
Sbjct: 998  SGGERAVSTVLYMIALQQYTTAPFRIVDEINQGMDSHNERIVHKSMVINACAENT--SQY 1055

Query: 1354 IVIS 1357
             +I+
Sbjct: 1056 FLIT 1059

 Score = 36.2 bits (82), Expect = 0.75,   Method: Compositional matrix adjust.
 Identities = 23/70 (32%), Positives = 35/70 (50%), Gaps = 5/70 (7%)

Query: 146 LNKLVLHNFKSYAGTQ-TIGPFHSSFSAVVGPNGSGKSNVIDSMLFVFGFRANKM-RQGK 203
           L KL + NF +Y   +  + P   S + ++GPNGSGKS  + ++      +   + R  K
Sbjct: 46  LIKLRMENFVTYKVAEFDLSP---SLNMIIGPNGSGKSTFVCAVCIGLAGKPRFIGRSSK 102

Query: 204 LADLIHKSEE 213
           L D I   EE
Sbjct: 103 LEDFIKNGEE 112

>CAGL0F01155g Chr6 complement(116762..120079) [3318 bp, 1105 aa] {ON}
            similar to uniprot|Q08204 Saccharomyces cerevisiae
            YOL034w SMC5
          Length = 1105

 Score = 40.4 bits (93), Expect = 0.042,   Method: Compositional matrix adjust.
 Identities = 37/151 (24%), Positives = 68/151 (45%), Gaps = 15/151 (9%)

Query: 1217 LNQSVEQRDKVRKELEDLKKCRFNEFMESFNIISMTLKEMYQIITMGGNAELELVDSLDP 1276
            L   V + + +RKE+ D +K          + I     E+++ +   G   L     L  
Sbjct: 916  LPTQVRKCNTIRKEMSDKQKVLEPRLESIVSGIGRKFSELFKDVGTAGGVTLNRKSKL-- 973

Query: 1277 FSEGVTFSVMPPKKSWRNISNL-----SGGEKTLSSLALVFALHKYKPTPLYVMDEIDAA 1331
            FS+     +M   +    +S L     SGGE+ +S++  + AL K+   P  V+DEI+  
Sbjct: 974  FSDW-KLEIMVQFRDEGKLSGLDSHTQSGGERAVSTVLYMIALQKFTQAPFRVVDEINQG 1032

Query: 1332 LD-----FRNVSIVANYIKERTKNAQFIVIS 1357
            +D       + ++V N  +E T  +Q+ +I+
Sbjct: 1033 MDTNFERLVHKAMVQNACEEGT--SQYFLIT 1061

 Score = 38.9 bits (89), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 41/171 (23%), Positives = 72/171 (42%), Gaps = 18/171 (10%)

Query: 148 KLVLHNFKSYAGTQ-TIGPFHSSFSAVVGPNGSGKSNVIDSMLFVFGFRANKM-RQGKLA 205
           K+ L NF +Y  T+  + P   S + ++GPNGSGKS  + ++      +   + R  ++ 
Sbjct: 40  KIRLENFVTYNYTEFNLSP---SLNMIIGPNGSGKSTYVCAVCLGLAGKPEYIGRSKQVE 96

Query: 206 DLIHKSEEYPDLTSCAVD---VHFEYLIDYPDDTTKINPSKQPLIITRRAFKNS------ 256
           D I   ++   +     D   +  E+L             K  L ITR   K +      
Sbjct: 97  DFIKNGQDTSKIEIVLKDDPNIDIEFLGSSFHRIRNNGNYKGLLTITRNLEKRTKIGRNL 156

Query: 257 ----TSKYYLNGKESNYKTITALLKEEGIDLDHNRFLILQGEVENIAQMKP 303
               T +Y +NG  +    +  L+ +  I LD+    + Q  VE  A+++P
Sbjct: 157 EKRRTQEYSINGLPTTESNVRNLVSKFHIQLDNLCQFLSQERVEEFAKLRP 207

>KLLA0E05303g Chr5 complement(472583..475879) [3297 bp, 1098 aa] {ON}
            similar to uniprot|Q12749 Saccharomyces cerevisiae
            YLR383W RHC18 Protein involved in structural maintenance
            of chromosomes required for interchromosomal and sister
            chromatid recombination
          Length = 1098

 Score = 40.0 bits (92), Expect = 0.051,   Method: Compositional matrix adjust.
 Identities = 24/70 (34%), Positives = 36/70 (51%), Gaps = 5/70 (7%)

Query: 1293 RNISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYI-----KER 1347
            RN+  LSGGEK+ S +AL+ A      + +  +DE D  +D  N  I  N I     K+ 
Sbjct: 997  RNVDTLSGGEKSFSQIALLLATWLTMRSRIIALDEFDVFMDQVNRKIGTNLIIRRLGKDV 1056

Query: 1348 TKNAQFIVIS 1357
              + Q I+I+
Sbjct: 1057 KSDTQTIIIT 1066

>TBLA0I02890 Chr9 (683688..686984) [3297 bp, 1098 aa] {ON} Anc_4.237
            YLR383W
          Length = 1098

 Score = 39.7 bits (91), Expect = 0.061,   Method: Compositional matrix adjust.
 Identities = 24/71 (33%), Positives = 37/71 (52%), Gaps = 3/71 (4%)

Query: 1290 KSWRNISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTK 1349
            K  RN+  LSGGEK+ S +AL+ A  K   + +  +DE D  +D  N       I ++ K
Sbjct: 995  KEPRNVDTLSGGEKSFSQIALLLATWKPMRSRIIALDEYDVFMDQVNRKTSTQLIVQKLK 1054

Query: 1350 N---AQFIVIS 1357
            +    Q I+I+
Sbjct: 1055 DDSRTQTIIIT 1065

 Score = 37.4 bits (85), Expect = 0.36,   Method: Compositional matrix adjust.
 Identities = 23/65 (35%), Positives = 36/65 (55%), Gaps = 5/65 (7%)

Query: 146 LNKLVLHNFKSYAGTQ-TIGPFHSSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQG-K 203
           + K+ L NF  +   + T+GP     + +VG NGSGKS ++ ++    G +AN   +G  
Sbjct: 71  IKKIKLVNFMCHEHFELTLGP---RLNFIVGNNGSGKSAILTAITIGLGAKANSTNRGNS 127

Query: 204 LADLI 208
           L DLI
Sbjct: 128 LKDLI 132

>TBLA0A05300 Chr1 (1297764..1299887) [2124 bp, 707 aa] {ON} Anc_1.67
            YLR188W
          Length = 707

 Score = 39.3 bits (90), Expect = 0.071,   Method: Compositional matrix adjust.
 Identities = 28/67 (41%), Positives = 40/67 (59%), Gaps = 5/67 (7%)

Query: 1296 SNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKNAQFIV 1355
            + LSGG+K   +LA  F L   +PT L V+DE  +ALD R+ SIVA  +K+R     F  
Sbjct: 600  TQLSGGQKQRVALARAFLL---EPT-LLVLDEATSALDPRSESIVAQTLKQRCAKG-FTT 654

Query: 1356 ISLRNNM 1362
            IS+ + +
Sbjct: 655  ISIAHRV 661

>TDEL0G02810 Chr7 (540540..543824) [3285 bp, 1094 aa] {ON} Anc_2.351
            YDL102W
          Length = 1094

 Score = 39.3 bits (90), Expect = 0.078,   Method: Compositional matrix adjust.
 Identities = 25/71 (35%), Positives = 38/71 (53%), Gaps = 9/71 (12%)

Query: 1321 PLYVMD---EIDAALDFRN------VSIVANYIKERTKNAQFIVISLRNNMFELAEQLVG 1371
            PLYV++   +ID+     N      +SI+A  I E+  NA F+V S++ N  E+   L+G
Sbjct: 939  PLYVLEHNIQIDSRYYLTNQLQNPLISIIAPIIGEKQANAMFVVKSIKINTGEMKGGLMG 998

Query: 1372 IYKNVNQTKSA 1382
              K V+  KS 
Sbjct: 999  FIKKVDSCKSC 1009

>KAFR0A06040 Chr1 complement(1222239..1225547) [3309 bp, 1102 aa]
           {ON} Anc_4.237 YLR383W
          Length = 1102

 Score = 38.5 bits (88), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 23/75 (30%), Positives = 40/75 (53%), Gaps = 5/75 (6%)

Query: 146 LNKLVLHNFKSYAGTQT-IGPFHSSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQG-K 203
           L K++L NF  +   +  +GP     + +VG NGSGKS ++ ++    G +A++  +G  
Sbjct: 72  LKKVILRNFMCHENFEMELGP---RLNFIVGNNGSGKSAILTAIAVGLGVKASETNRGVS 128

Query: 204 LADLIHKSEEYPDLT 218
           L DLI +      +T
Sbjct: 129 LKDLIREGSYSAKIT 143

 Score = 37.0 bits (84), Expect = 0.44,   Method: Compositional matrix adjust.
 Identities = 22/68 (32%), Positives = 35/68 (51%), Gaps = 3/68 (4%)

Query: 1293 RNISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKN-- 1350
            R++  LSGGEK+ S +AL+ A      + +  +DE D  +D  N  I    I +  K+  
Sbjct: 1002 RDVDTLSGGEKSFSQMALLLATWAPMRSRITALDEFDVFMDQVNRKIGTGLIVKTLKDNA 1061

Query: 1351 -AQFIVIS 1357
              Q I+I+
Sbjct: 1062 RTQTIIIT 1069

>SAKL0H03322g Chr8 complement(314365..317700) [3336 bp, 1111 aa] {ON}
            similar to uniprot|Q12749 Saccharomyces cerevisiae
            YLR383W RHC18 Protein involved in structural maintenance
            of chromosomes required for interchromosomal and sister
            chromatid recombination
          Length = 1111

 Score = 38.1 bits (87), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 23/85 (27%), Positives = 39/85 (45%), Gaps = 6/85 (7%)

Query: 1293 RNISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKNAQ 1352
            RN+  LSGGEK+ S ++L+ A  +   + +  +DE D  +D  N +I    I  +     
Sbjct: 1010 RNVDTLSGGEKSFSQISLLLATWRPMRSRIIALDEFDVFMDQVNRTIGTKLIMSK----- 1064

Query: 1353 FIVISLRNNMFELAEQLVGIYKNVN 1377
             + +  R     +  Q +G   N N
Sbjct: 1065 -LSVETRTQTIIITPQDIGKIANFN 1088

 Score = 35.4 bits (80), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 26/80 (32%), Positives = 40/80 (50%), Gaps = 6/80 (7%)

Query: 146 LNKLVLHNFKSYAGTQ-TIGPFHSSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQG-K 203
           + K++L NF  +   +  +GP     + +VG NGSGKS V+ ++    G +A    +G  
Sbjct: 75  IKKVILKNFMCHEHFELELGP---RLNFIVGNNGSGKSAVLTAITIGLGAKATDTNRGSS 131

Query: 204 LADLIHKSEEYPDLTSCAVD 223
           L DLI K   Y    S  +D
Sbjct: 132 LKDLI-KEGRYSSKISIILD 150

>AEL337C Chr5 complement(14613..17906) [3294 bp, 1097 aa] {ON}
            Syntenic homolog of Saccharomyces cerevisiae YOL034W
            (SMC5)
          Length = 1097

 Score = 38.1 bits (87), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 20/64 (31%), Positives = 36/64 (56%), Gaps = 7/64 (10%)

Query: 1299 SGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFR-----NVSIVANYIKERTKNAQF 1353
            SGGE+ +S++  + AL  +   P  V+DEI+  +D R     + ++V N   E T  +Q+
Sbjct: 992  SGGERAVSTVLYMIALQHFTNAPFRVVDEINQGMDTRYERIVHKAMVENACAENT--SQY 1049

Query: 1354 IVIS 1357
             +I+
Sbjct: 1050 FLIT 1053

>Kpol_483.10 s483 (21646..25002) [3357 bp, 1118 aa] {ON}
            (21646..25002) [3357 nt, 1119 aa]
          Length = 1118

 Score = 38.1 bits (87), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 17/47 (36%), Positives = 28/47 (59%)

Query: 1293 RNISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSI 1339
            R++  LSGGEK+ S +AL+ A  K   + +  +DE D  +D  N ++
Sbjct: 1018 RSVDTLSGGEKSFSQMALLLATWKPMKSRIIALDEFDVFMDQVNRTV 1064

 Score = 37.0 bits (84), Expect = 0.48,   Method: Compositional matrix adjust.
 Identities = 22/83 (26%), Positives = 41/83 (49%), Gaps = 8/83 (9%)

Query: 146 LNKLVLHNFKSYAGTQTIGPFHSSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQG-KL 204
           + K++L NF  +           + + +VG NGSGKS ++ +++   G +A++  +G  L
Sbjct: 73  IRKVILRNFMCHENFSV--ELTPNLNFIVGNNGSGKSAILTAIIVALGVKASETSRGSSL 130

Query: 205 ADLIHKSEEYPDLTSCAVDVHFE 227
            +LI K        S  V +H +
Sbjct: 131 KELIRKG-----CNSSKVTLHLD 148

>Kwal_26.9380 s26 (1189521..1192829) [3309 bp, 1102 aa] {ON} YLR383W
            (RHC18) - involved in recombination repair [contig 72]
            FULL
          Length = 1102

 Score = 37.7 bits (86), Expect = 0.26,   Method: Compositional matrix adjust.
 Identities = 28/87 (32%), Positives = 45/87 (51%), Gaps = 7/87 (8%)

Query: 1277 FSEG-VTFSVMPPKKSW-RNISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDF 1334
            FS+G +T  V  P     RN+  LSGGEK+ S  +L+ A  +   + +  +DE D  +D 
Sbjct: 984  FSKGALTMLVKTPNDDQPRNVDTLSGGEKSFSQTSLLLATWRPMRSRIIALDEFDVFMDQ 1043

Query: 1335 RNVSI----VANYIKERTKNAQFIVIS 1357
             N  I    + N + + T+  Q I+I+
Sbjct: 1044 VNRQIGTKLIMNKLSKETR-TQTIIIT 1069

>KNAG0A03170 Chr1 (394019..395434) [1416 bp, 471 aa] {ON} Anc_8.636
           YOR216C
          Length = 471

 Score = 37.0 bits (84), Expect = 0.32,   Method: Compositional matrix adjust.
 Identities = 60/250 (24%), Positives = 117/250 (46%), Gaps = 23/250 (9%)

Query: 381 VKSKLIQYKIWQNNIKLSNTLEKITKLEDEYNQEKNKNTELKNKIDELRKLYTKNQDELQ 440
           V+ +L +Y+    N++L N +   +K          +N EL+  +  L K Y   + E +
Sbjct: 146 VQEQLQEYE--SQNLRLKNKVSSTSK----------ENEELRTTVTTLNKEYDSMESEYE 193

Query: 441 ALLKDEKELVNAKRSLDSDNVSNTEQLKNIEKKLKKTAKEIEEDLKTISSSNVRLKNFHD 500
            L   +K++ + +R ++   +      ++   +L    KEIE     I    V L+N H 
Sbjct: 194 NL---QKQVTSYERQIEKCEIKLEHATESHSDELNAYIKEIENLTLKIQKLTVALENSHQ 250

Query: 501 NKKLFETQLIELDNNLVTESQLLENIKLDLKD--KTVGLSEEILKTEKDLEPWNIKLDEL 558
           +    +++  EL ++L T    L N+K  + D   T+   EE L+  +D +  ++++  +
Sbjct: 251 SISDLKSERQELAHDLATSESTLSNLKQTIADLEATLNTKEESLR--EDCKDRDLQIKAI 308

Query: 559 KSEIQIKESEKALFEESKNKLKANIEALEKDVNEKSKLTEDRRKEVKNLMTKLENVSKEV 618
           ++++     EK    E  + LK+ I A+E++V  K K      KEVK+   ++  +  E 
Sbjct: 309 RAQLDTALEEKTAQGEQISSLKSQISAMEEEVFLKEKF----EKEVKDKTLQIGKLRHEA 364

Query: 619 IFGTNELKKA 628
           I   + L+KA
Sbjct: 365 IILNDHLRKA 374

>TDEL0D05180 Chr4 complement(940548..943061) [2514 bp, 837 aa] {ON}
           Anc_3.106 YOL091W
          Length = 837

 Score = 37.4 bits (85), Expect = 0.35,   Method: Compositional matrix adjust.
 Identities = 50/168 (29%), Positives = 86/168 (51%), Gaps = 30/168 (17%)

Query: 474 LKKTAKEIEEDLKTISSSNVRLKNFHDNKKLFETQLIELDNNLVTESQLLENIKLDLKD- 532
           L+K   E++E++K   +  +  K+    KK+ E Q  EL+ +L   S++L+++KL+L + 
Sbjct: 428 LQKQLDEVKENVKAHRADLIYSKD-ECQKKIAEKQ--ELERSLKETSEILKSLKLELSEF 484

Query: 533 ---------KTVGL-------SEEILKTEKDLEPWNIKLDELKSEIQIKESEKALFEESK 576
                    K V L       +E+I K +KDLE    ++D L  E+   ES K   +E+K
Sbjct: 485 KEQCLKKDAKKVELEKALDNSNEKIYKMDKDLEEATDEIDMLSEEV---ESYKGKIQEAK 541

Query: 577 NKLKANIEALEKDVNEKSKLTEDR-------RKEVKNLMTKLENVSKE 617
              +  IE  EKD+++  K TE         + ++  L +KLE++ KE
Sbjct: 542 TSERMAIERAEKDISQAKKETESEIKSKNELKTDIAVLKSKLEDLQKE 589

>Ecym_5344 Chr5 (696147..699455) [3309 bp, 1102 aa] {ON} similar to
           Ashbya gossypii AER044W
          Length = 1102

 Score = 37.4 bits (85), Expect = 0.35,   Method: Compositional matrix adjust.
 Identities = 18/58 (31%), Positives = 32/58 (55%), Gaps = 4/58 (6%)

Query: 146 LNKLVLHNFKSYAGTQ-TIGPFHSSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQG 202
           + ++ L NF  +   +   GP     + +VG NGSGKS ++ ++  VFG +A+   +G
Sbjct: 62  IKRITLKNFMCHEHFELEFGPM---LNFIVGSNGSGKSAILTAITIVFGAKASDTNRG 116

 Score = 35.0 bits (79), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 17/52 (32%), Positives = 26/52 (50%)

Query: 1293 RNISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYI 1344
            RN+  LSGGEK+ S + L+ +        +  +DE D  +D  N +I    I
Sbjct: 1001 RNVDTLSGGEKSFSQITLLLSTWSTMRARVIALDEFDVFMDQVNRTIGTKMI 1052

>KLTH0D14080g Chr4 (1149555..1152863) [3309 bp, 1102 aa] {ON} similar
            to uniprot|Q12749 Saccharomyces cerevisiae YLR383W RHC18
            Protein involved in structural maintenance of chromosomes
            required for interchromosomal and sister chromatid
            recombination
          Length = 1102

 Score = 36.6 bits (83), Expect = 0.53,   Method: Compositional matrix adjust.
 Identities = 22/78 (28%), Positives = 35/78 (44%), Gaps = 10/78 (12%)

Query: 1277 FSEGVTFSV----------MPPKKSWRNISNLSGGEKTLSSLALVFALHKYKPTPLYVMD 1326
            FS G+ F+            P  +  RN+   SGGEK+ S ++L+ A  +   + +  +D
Sbjct: 976  FSGGLNFNFSKETLNMLVKTPNDEKPRNVDTFSGGEKSFSQISLLLATWRPMRSRIIALD 1035

Query: 1327 EIDAALDFRNVSIVANYI 1344
            E D  +D  N  I    I
Sbjct: 1036 EFDVFMDQVNRQIGTKLI 1053

>AER044W Chr5 (714355..717666) [3312 bp, 1103 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YLR383W (RHC18)
          Length = 1103

 Score = 36.6 bits (83), Expect = 0.60,   Method: Compositional matrix adjust.
 Identities = 18/58 (31%), Positives = 32/58 (55%), Gaps = 4/58 (6%)

Query: 146 LNKLVLHNFKSYAGTQ-TIGPFHSSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQG 202
           + ++ L NF  +   +   GP     + +VG NGSGKS ++ ++  VFG +A+   +G
Sbjct: 62  MKRITLKNFMCHEHFELEFGP---RLNFIVGSNGSGKSAILTAITVVFGAKASDTNRG 116

 Score = 35.0 bits (79), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 17/52 (32%), Positives = 26/52 (50%)

Query: 1293 RNISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYI 1344
            RN+  LSGGEK+ S + L+ +        +  +DE D  +D  N +I    I
Sbjct: 1002 RNVDTLSGGEKSFSQITLLLSTWSTMRARIIALDEFDVFMDQVNRTIGTRMI 1053

>NCAS0B08700 Chr2 (1674262..1676409) [2148 bp, 715 aa] {ON} Anc_1.67
          Length = 715

 Score = 36.2 bits (82), Expect = 0.74,   Method: Compositional matrix adjust.
 Identities = 27/72 (37%), Positives = 36/72 (50%), Gaps = 10/72 (13%)

Query: 1277 FSEGVTFSVMPPKKSWRNISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRN 1336
            F EGV   V P        + LSGG+K   +LA  F LH      L ++DE  +ALD ++
Sbjct: 572  FPEGVNTLVGPRG------TQLSGGQKQRIALARAFLLHP----ALLILDEATSALDSQS 621

Query: 1337 VSIVANYIKERT 1348
              IVA  + ER 
Sbjct: 622  EEIVAKNLSERV 633

>Ecym_5514 Chr5 (1043659..1046223) [2565 bp, 854 aa] {ON} similar to
           Ashbya gossypii AER241W
          Length = 854

 Score = 36.2 bits (82), Expect = 0.75,   Method: Compositional matrix adjust.
 Identities = 62/207 (29%), Positives = 95/207 (45%), Gaps = 11/207 (5%)

Query: 426 DELRKLYTKNQDELQALLKDEKELVNAKRSLDSDNVS---NTEQLKNIEKKLKKTAKEIE 482
           D +  L  ++Q  +Q+L K+   L      L+ DN S     EQL       K T  E+ 
Sbjct: 430 DAIHDLRLEHQKRVQSLHKEVSNLREMNSKLEGDNQSYKKRFEQLVKPSPHRKSTEDELI 489

Query: 483 EDLKTISSSNVRLKNFHDNKKLFETQLIELDNNLVTESQLLENIKLDLKDKTVGLSEEIL 542
              + I +    L++  D  K  E +L  + +    E  LLE  KL   D+   L   +L
Sbjct: 490 RKNREIGTLKATLRDLEDKIKYVEHELESVHSKYRREKALLE-AKLAQADREKPLESNLL 548

Query: 543 KTEKDLEPWNIKLDELKSEIQIKESEKALFEESKNKLKANIE-ALEKDVNEK-SKLTEDR 600
           + E  +    +KL EL S    KE E AL+E     LK   E  L++D N   + + E R
Sbjct: 549 EKEISI----LKL-ELNSIQDTKEREIALWENKYESLKQTYENMLKQDRNNDFNNILEQR 603

Query: 601 RKEVKNLMTKLENVSKEVIFGTNELKK 627
           R+E+K+LM +  +++ E +  T EL K
Sbjct: 604 REELKSLMRRYNDLTTENLSLTKELNK 630

>ZYRO0A07524g Chr1 (615902..619174) [3273 bp, 1090 aa] {ON} highly
            similar to uniprot|P15436 Saccharomyces cerevisiae
            YDL102W CDC2 Catalytic subunit of DNA polymerase delta
            required for chromosomal DNA replication during mitosis
            and meiosis intragenic recombination repair of double
            strand DNA breaks and DNA replication during nucleotide
            excision repair (NER)
          Length = 1090

 Score = 35.4 bits (80), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 23/71 (32%), Positives = 37/71 (52%), Gaps = 9/71 (12%)

Query: 1321 PLYVMD---EIDAALDFRN------VSIVANYIKERTKNAQFIVISLRNNMFELAEQLVG 1371
            PLYV++   +ID+     N      +SIVA  + E+  NA F+V S++ N   +   L+G
Sbjct: 935  PLYVLEHNMQIDSRYYLTNQLQNPIISIVAPILGEKQANAMFVVKSIKINTGNMKGGLMG 994

Query: 1372 IYKNVNQTKSA 1382
              K V+  K+ 
Sbjct: 995  FVKKVDSCKNC 1005

>Suva_16.214 Chr16 (374778..376259) [1482 bp, 493 aa] {ON} YPL097W
            (REAL)
          Length = 493

 Score = 34.7 bits (78), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 41/155 (26%), Positives = 69/155 (44%), Gaps = 37/155 (23%)

Query: 1167 MESDFKQFDISSLEAELVQLQDYFEIA---------KVDLDILEEYTRR----------M 1207
            ME+D +Q ++ S+ A   QLQ +F+           K  ++   +YT R          M
Sbjct: 145  MENDIRQNNVQSISA---QLQRFFQNGLKYYTDRRDKRGIESYGKYTPRNNFNWWKDIKM 201

Query: 1208 IEYRQ--RKYDLNQSVEQRDKVRKELEDLKKCRFNEF----MESFNIISMTLKEMYQIIT 1261
            +++     K+   QS+  RD V   LE      FNEF    +++++   +  KE    + 
Sbjct: 202  LDFLADFGKHIRVQSMLARDSVSSRLESQNSLGFNEFTYQILQAYDFYHL-YKEENVSVQ 260

Query: 1262 MGGN-------AELELVDSLDPFS-EGVTFSVMPP 1288
            +GGN       A ++L++ L P   +GV F V  P
Sbjct: 261  VGGNDQWGNITAGIDLINRLQPTQKKGVPFGVTVP 295

>ZYRO0F17050g Chr6 complement(1417445..1419589) [2145 bp, 714 aa] {ON}
            similar to uniprot|P33310 Saccharomyces cerevisiae
            YLR188W MDL1 Half-type ATP-binding cassette (ABC)
            transporter of the inner mitochondrial membrane mediates
            export of peptides generated upon proteolysis of
            mitochondrial proteins plays a role in the regulation of
            cellular resistance to oxidative stress
          Length = 714

 Score = 33.9 bits (76), Expect = 3.2,   Method: Compositional matrix adjust.
 Identities = 24/72 (33%), Positives = 38/72 (52%), Gaps = 5/72 (6%)

Query: 1296 SNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKNAQFIV 1355
            + LSGG+K   +LA  F L       L V+DE  +ALD ++  IVA  ++ER +      
Sbjct: 588  AQLSGGQKQRVALARAFLLDP----ALLVLDEATSALDSQSEEIVARTLQERVRRG-LTT 642

Query: 1356 ISLRNNMFELAE 1367
            IS+ + +  +A 
Sbjct: 643  ISIAHRISTIAH 654

>TPHA0E02320 Chr5 complement(482429..488176) [5748 bp, 1915 aa] {ON}
            Anc_5.267 YHR023W
          Length = 1915

 Score = 33.9 bits (76), Expect = 3.6,   Method: Compositional matrix adjust.
 Identities = 51/178 (28%), Positives = 88/178 (49%), Gaps = 17/178 (9%)

Query: 495  LKNFHDNKKLFETQLIELDNNLVTESQLLENIKLDLKDKTVGLSE-EILKTEKDLEPWNI 553
            +KN  +  K+ E+Q ++L   L  +   L N++  L++++  L E E+L  E  ++   +
Sbjct: 869  VKNMEEAIKITESQCVDLTRKLCDKESELTNVQALLQEESKKLKEHEMLAEEAKVQEGIL 928

Query: 554  --KLDELKSEIQIKESEKALFEESKNKLKANIEALEKDVNEKSK----LTEDRRKEVKNL 607
              KLDEL++  +  ES +A+           IE+LEK +NE+ +    L E R ++    
Sbjct: 929  TEKLDELRTINKEIESNQAILASENKDYIEKIESLEKSINEQEQETKTLYEKREQKYIIE 988

Query: 608  MTKLE---NVSKEVI----FGTNELKKANEKLCEMQKILIQDRQKANDARTSLSNVEN 658
            +++LE      KE +       NEL    +KL ++ K+  + R K  D    LSN EN
Sbjct: 989  ISELEADLKAKKETLHSLTLNNNEL---TDKLSKLTKVESEQRLKIKDMELQLSNSEN 1043

>TBLA0I01050 Chr9 (210595..211710) [1116 bp, 371 aa] {ON} Anc_7.419
           YER118C
          Length = 371

 Score = 33.1 bits (74), Expect = 5.8,   Method: Composition-based stats.
 Identities = 26/109 (23%), Positives = 50/109 (45%), Gaps = 25/109 (22%)

Query: 393 NNIKLSNTLEKITKLEDEYNQEKNKNTELKNKIDELRKLYTKNQDELQALLKDEKELVNA 452
           NN+    ++   ++L DEY+ +++ N  L N+                 +    ++++N 
Sbjct: 196 NNVDFEGSMGVGSRL-DEYSLQRHNNPNLHNR----------------NMTNGGEQMINY 238

Query: 453 KRSLDSDNVSNTEQLKNIEKKLKKTAKEIEEDLKTISSSNVRLKNFHDN 501
             S++ + + NTE         KKT +EI  DLK IS  ++ L   +D+
Sbjct: 239 MSSVELNGLENTEP--------KKTQQEITNDLKDISDDDMELSGNNDS 279

>Kwal_33.15561 s33 (1157299..1161192) [3894 bp, 1297 aa] {ON} YKL209C
            (STE6) - ABC transporter, glycoprotein, component of
            a-factor secretory pathway [contig 290] FULL
          Length = 1297

 Score = 33.1 bits (74), Expect = 6.4,   Method: Compositional matrix adjust.
 Identities = 23/73 (31%), Positives = 41/73 (56%), Gaps = 4/73 (5%)

Query: 1298 LSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKNAQFIVIS 1357
            LSGG+  +  LA+V AL + KP  L V+DE  +ALD R+  I++ ++K    +   +V++
Sbjct: 1197 LSGGQ--VQRLAIVRALLR-KPQ-LLVLDECTSALDARHSFIMSEFVKHHLYHTTTLVVT 1252

Query: 1358 LRNNMFELAEQLV 1370
                M     +++
Sbjct: 1253 HSEQMMRSCHRIL 1265

>TDEL0D03740 Chr4 complement(686950..688332) [1383 bp, 460 aa] {ON}
           Anc_3.251 YDR023W
          Length = 460

 Score = 32.7 bits (73), Expect = 6.6,   Method: Compositional matrix adjust.
 Identities = 32/96 (33%), Positives = 51/96 (53%), Gaps = 7/96 (7%)

Query: 516 LVTESQLLENIKLDLKDKTVGLSEEILKTEKDLEPWNIKLDELKSEIQIKESEKALFEES 575
           L+ +SQ      ++L D+ +   +E +KT  DL+  N KL++L+ EI +K   K    E 
Sbjct: 17  LIRKSQKARGASVELVDEIISDYKEWVKTRFDLDELNKKLNKLQKEIGLKFKSK----ED 72

Query: 576 KNKLKANIEALEKDVNEKSKLTEDRRKEVKNLMTKL 611
            ++L A  E L     EK  LTE  + E K+L +K+
Sbjct: 73  ASELLAEKEKL---TQEKKNLTEREQAEDKDLRSKV 105

>TBLA0F01500 Chr6 (367909..371832) [3924 bp, 1307 aa] {ON} Anc_7.436
           YPR030W
          Length = 1307

 Score = 33.1 bits (74), Expect = 6.8,   Method: Compositional matrix adjust.
 Identities = 21/58 (36%), Positives = 32/58 (55%), Gaps = 2/58 (3%)

Query: 115 ELIQLSPIKNSRSELQKIYS-SKQEEKIERICL-NKLVLHNFKSYAGTQTIGPFHSSF 170
            LIQ+SP+ + RS L  + + S + EKI+   L  K +LH  K++ G      F +SF
Sbjct: 492 PLIQMSPVTSRRSSLSAMSTESDEREKIQSTSLVGKHLLHKVKNHIGGVNTDAFPASF 549

>Kpol_1002.13 s1002 complement(35647..38784) [3138 bp, 1045 aa] {ON}
           complement(35647..38784) [3138 nt, 1046 aa]
          Length = 1045

 Score = 33.1 bits (74), Expect = 6.9,   Method: Compositional matrix adjust.
 Identities = 42/134 (31%), Positives = 63/134 (47%), Gaps = 14/134 (10%)

Query: 465 EQLKNIEKKLKKTAKEIEEDLKTISSSNVRLKNFHDNKKLFETQLIELDNNLVTESQLLE 524
           E LKNI K++      +  ++K+  S    +     N   F+T  ++L+NNL ++  L E
Sbjct: 425 EGLKNIAKRIYGLTTILANEIKSDKSRGQLI-----NTTWFDTLSVKLNNNLTSKDFLKE 479

Query: 525 -----NIKLDLKD-KTVGLSEEILKTEKDLEPWNIKLDELKSEIQIKE--SEKALFEESK 576
                NI L   D KTV LS +   T KD+E    KL   +S   + +  S KA  E   
Sbjct: 480 ALEKYNINLFAVDEKTVSLSIDETTTVKDVEALT-KLFTSESNTSVADFVSSKAELETLP 538

Query: 577 NKLKANIEALEKDV 590
           N    N + L++DV
Sbjct: 539 NGFARNDKFLQQDV 552

>NDAI0A05840 Chr1 complement(1328949..1330325) [1377 bp, 458 aa]
           {ON} Anc_3.251
          Length = 458

 Score = 32.7 bits (73), Expect = 7.0,   Method: Compositional matrix adjust.
 Identities = 33/102 (32%), Positives = 56/102 (54%), Gaps = 11/102 (10%)

Query: 516 LVTESQLLENIKLDLKDKTVGLSEEILKTEKDLEPWNIKLDELKSEIQIKESEKALFEES 575
           L+ +SQ   N  ++L D  +   ++ +KT  +L+  N KL++L+ +I +K   K   E+ 
Sbjct: 17  LIRQSQKARNASVELVDDIIADYKDWVKTRFELDELNKKLNKLQKDIGLKFKNK---EDP 73

Query: 576 KNKLKANIEALEKDV--NEKSKLTEDRRKEVKNLMTKLENVS 615
           K  L      +EKD+   EK+KLTE  +K+ K+L  K+  V 
Sbjct: 74  KELL------VEKDILTAEKAKLTEREQKDDKDLKEKVFQVG 109

>YDL058W Chr4 (345665..351037) [5373 bp, 1790 aa] {ON}  USO1Essential
            protein involved in the vesicle-mediated ER to Golgi
            transport step of secretion; binds membranes and
            functions during vesicle docking to the Golgi; required
            for assembly of the ER-to-Golgi SNARE complex
          Length = 1790

 Score = 32.7 bits (73), Expect = 8.8,   Method: Compositional matrix adjust.
 Identities = 33/116 (28%), Positives = 62/116 (53%), Gaps = 12/116 (10%)

Query: 402  EKITKLEDEYNQEKNKNTELKNKIDELRKLYTKNQDELQALLKDEKELVNAKRS-LDSDN 460
            E+I++L DE    + +N  +K K DEL       + E++A+    +E  N K+S +D+ N
Sbjct: 1177 EEISQLNDEITSTQQENESIKKKNDEL-------EGEVKAMKSTSEEQSNLKKSEIDALN 1229

Query: 461  VSNTEQLKNIEKKLKKTAKEIEEDLKTISSSNVRLKNFHDNKKLFETQLIELDNNL 516
            +    Q+K ++KK +     + E +K++ S  V++K   D     E ++ EL++ L
Sbjct: 1230 L----QIKELKKKNETNEASLLESIKSVESETVKIKELQDECNFKEKEVSELEDKL 1281

>Kwal_55.19808 s55 (136074..138551) [2478 bp, 825 aa] {ON} YBL047C
           (EDE1) - EH domain protein involved in endocytosis
           [contig 159] FULL
          Length = 825

 Score = 32.7 bits (73), Expect = 9.1,   Method: Compositional matrix adjust.
 Identities = 18/62 (29%), Positives = 37/62 (59%)

Query: 841 VMEIEKELSIREKNYQNAYNTVQEMEIELRNLKESEPKIELEISKLNFEIDSLENECSLK 900
           V E+++EL+I E NY     ++ E + +L   +++  +++ +I  LN    SL+NE + K
Sbjct: 667 VEELKRELAIAEANYHAVQGSLAETQHQLEESEQTNSQLKEKIGNLNAMTASLQNELNEK 726

Query: 901 RK 902
           ++
Sbjct: 727 QQ 728

>TDEL0B02260 Chr2 (408913..410901) [1989 bp, 662 aa] {ON} Anc_5.696
           YIL144W
          Length = 662

 Score = 32.3 bits (72), Expect = 9.8,   Method: Compositional matrix adjust.
 Identities = 25/78 (32%), Positives = 45/78 (57%), Gaps = 7/78 (8%)

Query: 533 KTVGLSEEILKTEKDLEPWNIKLDELKS--EIQIKESEKALFEESKNKLKANIEALEKDV 590
           K V L  EI +    +E   ++L + KS  E++++E+E +L  +     K  IE LEK +
Sbjct: 533 KVVDLQREIREKTNAIERLELQLSDAKSNYELKLQENESSLLSQ-----KIEIEKLEKKI 587

Query: 591 NEKSKLTEDRRKEVKNLM 608
           ++ S+LT++R  E + L+
Sbjct: 588 SDSSRLTKERLAEAEQLV 605

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.312    0.131    0.348 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 135,246,746
Number of extensions: 6212824
Number of successful extensions: 48024
Number of sequences better than 10.0: 2678
Number of HSP's gapped: 44348
Number of HSP's successfully gapped: 5300
Length of query: 1393
Length of database: 53,481,399
Length adjustment: 122
Effective length of query: 1271
Effective length of database: 39,492,147
Effective search space: 50194518837
Effective search space used: 50194518837
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.9 bits)
S2: 72 (32.3 bits)