Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
TPHA0J005106.46ON43743720980.0
Kpol_1037.116.46ON4014336131e-74
YML043C (RRN11)6.46ON5074565626e-66
KAFR0L004206.46ON4603725482e-64
NDAI0D008906.46ON5394815507e-64
Suva_13.1176.46ON5134625442e-63
Smik_13.1066.46ON5064625408e-63
ZYRO0C07172g6.46ON4504515314e-62
NCAS0H009006.46ON4954465292e-61
KLTH0C10582g6.46ON4814515283e-61
Skud_13.1056.46ON5124625251e-60
SAKL0E01980g6.46ON4653745124e-59
CAGL0J11792g6.46ON5104824936e-56
KLLA0C05852g6.46ON4823744822e-54
TDEL0G042406.46ON4444504731e-53
KNAG0E009106.46ON4863904733e-53
Kwal_56.225276.46ON4814524542e-50
TBLA0B005706.46ON5174744291e-46
ACL020W6.46ON5394454142e-44
Ecym_30496.46ON5014523991e-42
TPHA0L016608.539ON547148850.063
TPHA0E006807.426ON496102695.8
TDEL0H040307.48ON29885679.8
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= TPHA0J00510
         (437 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

TPHA0J00510 Chr10 complement(114098..115411) [1314 bp, 437 aa] {...   812   0.0  
Kpol_1037.11 s1037 (23974..25179) [1206 bp, 401 aa] {ON} (23974....   240   1e-74
YML043C Chr13 complement(190244..191767) [1524 bp, 507 aa] {ON} ...   221   6e-66
KAFR0L00420 Chr12 (77468..78850) [1383 bp, 460 aa] {ON} Anc_6.46...   215   2e-64
NDAI0D00890 Chr4 (203085..204704) [1620 bp, 539 aa] {ON} Anc_6.4...   216   7e-64
Suva_13.117 Chr13 complement(186472..188013) [1542 bp, 513 aa] {...   214   2e-63
Smik_13.106 Chr13 complement(183859..185379) [1521 bp, 506 aa] {...   212   8e-63
ZYRO0C07172g Chr3 (541070..542422) [1353 bp, 450 aa] {ON} weakly...   209   4e-62
NCAS0H00900 Chr8 (167875..169362) [1488 bp, 495 aa] {ON} Anc_6.4...   208   2e-61
KLTH0C10582g Chr3 (877398..878843) [1446 bp, 481 aa] {ON} simila...   207   3e-61
Skud_13.105 Chr13 complement(181845..183383) [1539 bp, 512 aa] {...   206   1e-60
SAKL0E01980g Chr5 complement(150830..152227) [1398 bp, 465 aa] {...   201   4e-59
CAGL0J11792g Chr10 complement(1150752..1152284) [1533 bp, 510 aa...   194   6e-56
KLLA0C05852g Chr3 (518508..519956) [1449 bp, 482 aa] {ON} weakly...   190   2e-54
TDEL0G04240 Chr7 (770798..772132) [1335 bp, 444 aa] {ON} Anc_6.4...   186   1e-53
KNAG0E00910 Chr5 complement(171075..172535) [1461 bp, 486 aa] {O...   186   3e-53
Kwal_56.22527 s56 complement(168165..169610) [1446 bp, 481 aa] {...   179   2e-50
TBLA0B00570 Chr2 complement(113646..115199) [1554 bp, 517 aa] {O...   169   1e-46
ACL020W Chr3 (326268..327887) [1620 bp, 539 aa] {ON} Non-synteni...   164   2e-44
Ecym_3049 Chr3 complement(93199..94704) [1506 bp, 501 aa] {ON} s...   158   1e-42
TPHA0L01660 Chr12 complement(348715..350358) [1644 bp, 547 aa] {...    37   0.063
TPHA0E00680 Chr5 (129553..131043) [1491 bp, 496 aa] {ON} Anc_7.4...    31   5.8  
TDEL0H04030 Chr8 complement(690438..691334) [897 bp, 298 aa] {ON...    30   9.8  

>TPHA0J00510 Chr10 complement(114098..115411) [1314 bp, 437 aa] {ON}
           Anc_6.46 YML043C
          Length = 437

 Score =  812 bits (2098), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 401/437 (91%), Positives = 401/437 (91%)

Query: 1   MFELPVSSNITINAFNLKKLRYQYINDINAKHNELSKNELPTPVTSENDTGGEDLDGDSE 60
           MFELPVSSNITINAFNLKKLRYQYINDINAKHNELSKNELPTPVTSENDTGGEDLDGDSE
Sbjct: 1   MFELPVSSNITINAFNLKKLRYQYINDINAKHNELSKNELPTPVTSENDTGGEDLDGDSE 60

Query: 61  HNLTSEDAEVAQERRIRRWKSIMGEAIXXXXXXXXXXXXXXXXXXXXGPTDEEKKYFLRY 120
           HNLTSEDAEVAQERRIRRWKSIMGEAI                    GPTDEEKKYFLRY
Sbjct: 61  HNLTSEDAEVAQERRIRRWKSIMGEAIDDDEDDNNHDDDVDNEFEDNGPTDEEKKYFLRY 120

Query: 121 DKPQESFEKWESNNLKRQRHVNKNFITYYRFKKTRKQIDKKYKVKTMHLNKNVKNNFELM 180
           DKPQESFEKWESNNLKRQRHVNKNFITYYRFKKTRKQIDKKYKVKTMHLNKNVKNNFELM
Sbjct: 121 DKPQESFEKWESNNLKRQRHVNKNFITYYRFKKTRKQIDKKYKVKTMHLNKNVKNNFELM 180

Query: 181 IDGFEPINDNNISRNRNLQNYNKHHLSLLTDLMYSNIFKQKWDIAYKCFTFLLRIPDVDI 240
           IDGFEPINDNNISRNRNLQNYNKHHLSLLTDLMYSNIFKQKWDIAYKCFTFLLRIPDVDI
Sbjct: 181 IDGFEPINDNNISRNRNLQNYNKHHLSLLTDLMYSNIFKQKWDIAYKCFTFLLRIPDVDI 240

Query: 241 RRVWNLGSIILQNIDTTKLIDFLQWLSNVYSNKNRSFVQGINYRNDQTNFNGGSRRLTPL 300
           RRVWNLGSIILQNIDTTKLIDFLQWLSNVYSNKNRSFVQGINYRNDQTNFNGGSRRLTPL
Sbjct: 241 RRVWNLGSIILQNIDTTKLIDFLQWLSNVYSNKNRSFVQGINYRNDQTNFNGGSRRLTPL 300

Query: 301 YTKTLLWHKLTLSSDSETCESEIDSLIEQIAEMVVIPPYSEDNEIWYIFALCHLVKADNL 360
           YTKTLLWHKLTLSSDSETCESEIDSLIEQIAEMVVIPPYSEDNEIWYIFALCHLVKADNL
Sbjct: 301 YTKTLLWHKLTLSSDSETCESEIDSLIEQIAEMVVIPPYSEDNEIWYIFALCHLVKADNL 360

Query: 361 SEKLYFMSRRNPEVDEMDTYPYDTEXXXXXXXXXXXXXXXXLRKATQDKNFDYPARTIET 420
           SEKLYFMSRRNPEVDEMDTYPYDTE                LRKATQDKNFDYPARTIET
Sbjct: 361 SEKLYFMSRRNPEVDEMDTYPYDTEIYNNKITICINNCKKYLRKATQDKNFDYPARTIET 420

Query: 421 KLKTIETRTFDFESMPE 437
           KLKTIETRTFDFESMPE
Sbjct: 421 KLKTIETRTFDFESMPE 437

>Kpol_1037.11 s1037 (23974..25179) [1206 bp, 401 aa] {ON}
           (23974..25179) [1206 nt, 402 aa]
          Length = 401

 Score =  240 bits (613), Expect = 1e-74,   Method: Compositional matrix adjust.
 Identities = 163/433 (37%), Positives = 241/433 (55%), Gaps = 40/433 (9%)

Query: 1   MFELPVSSNITINAFNLKKLRYQYINDINAKHNELSKNE--LPTPVTSENDTGGEDLDGD 58
           MFE+P   +   +  N KKLRYQY+N +  + N  +KN   LPTPV+SEN+         
Sbjct: 1   MFEVPTIDSTKRSVVNFKKLRYQYMNHM-YERNRYNKNGQGLPTPVSSENEMNA------ 53

Query: 59  SEHNLTSEDAEVAQERRIRRWKSIMGEAIXXXXXXXXXXXXXXXXXXXXGPTDEEKKYFL 118
                 SED EV+ +R  +RW+ I+GE+                        DEEKKYF 
Sbjct: 54  ------SED-EVSHKRVRKRWRRIVGES-----VSSDEEEEEEEEDEQEQEGDEEKKYFS 101

Query: 119 RYDKPQESFEKWESNNLKRQRHVNKNFITYYRFKKTRKQIDKKYKVKTMHLNKNVKNNFE 178
           RYDKP++SFE+W SN  K ++ +N+  ++Y ++ K  K   KK +V  +  N+ ++ NF 
Sbjct: 102 RYDKPEDSFERWASNT-KHRKSINRKMMSYKKYNKLTKYSRKKIQVPLIRSNRKLQENFL 160

Query: 179 LMIDGFEPINDN-NISRNRNLQNYNKHHLSLLTDLMYSNIFKQKWDIAYKCFTFLLRIPD 237
            +IDG+E I+DN N+  N  + N     + LLTDLMY +IFK+ W IAY+CFT L+R+P 
Sbjct: 161 SVIDGYELIDDNINLKENFTMVN-----VKLLTDLMYESIFKENWKIAYRCFTLLIRLPK 215

Query: 238 VDIRRVWNLGSIILQNID-TTKLIDFLQWLSNVYSN-KNRSFVQGINYRNDQTNFNGGSR 295
             IR++WNLGS+I++N++   K I+FL+  +N++S  K + F Q +NYR +   FN GSR
Sbjct: 216 TSIRKIWNLGSMIIENLEGINKTIEFLKLFNNIHSRYKKKIFNQTVNYR-EAPVFNDGSR 274

Query: 296 RLTPLYTKTLLWHKLTLSSDSETCESEIDSLIEQIAEMVVIPPYSEDNEIWYIFALCHLV 355
             TP+Y KTLLW ++T +S S    S  + LIE ++E+ +IPP+ ED+EIWYI+ + HL 
Sbjct: 275 NKTPIYIKTLLWKEITTTSTSSRTSSNYNELIEYLSELTLIPPFMEDSEIWYIYGIVHLQ 334

Query: 356 KADNLSEKLYFMSRRNPEVDEMDTYPYDTEXXXXXXXXXXXXXXXXLRKATQDKNFDYPA 415
           +A+ LS  L            +D      +                L+KA +    + P 
Sbjct: 335 RANELSMNLEHY---------IDNSSSSKDIANNEVVQNIKLAQKFLKKAKELSKIEVPE 385

Query: 416 RTIETKLKTIETR 428
           R I   +K IE R
Sbjct: 386 RQITLMIKNIEGR 398

>YML043C Chr13 complement(190244..191767) [1524 bp, 507 aa] {ON}
           RRN11Component of the core factor (CF) rDNA
           transcription factor complex; CF is required for
           transcription of 35S rRNA genes by RNA polymerase I and
           is composed of Rrn6p, Rrn7p, and Rrn11p
          Length = 507

 Score =  221 bits (562), Expect = 6e-66,   Method: Compositional matrix adjust.
 Identities = 143/456 (31%), Positives = 232/456 (50%), Gaps = 39/456 (8%)

Query: 1   MFELPVSSNITINAF-NLKKLRYQYINDINAKHNELSK-----NELPTPVTSENDTGGED 54
           MFE+P++  +T   F   +KL+YQYIN I+ + + +SK     + LPTP  S  +   E+
Sbjct: 1   MFEVPIT--LTNRKFAQRRKLKYQYINYISRRFDRISKKSTTTDSLPTPENSAAENNDEE 58

Query: 55  LDGDSEHNLTSEDA-EVAQERRIRRWKSIMGEAIXXXXXXXXXXXXXXXXXXXXGP---- 109
              +SE         +  + RR R W+S++GE                            
Sbjct: 59  EGQNSEAGTYRRSVLQQKKRRRERHWRSVVGEIYSTTESETDSQEEETEEGGEHDTGIDK 118

Query: 110 --TDEEKKYFLRYDKPQESFEKWESNNLKRQRHVNKNFITYYRFKKTRKQIDKKYKVKTM 167
             +DEE+K++ +Y+KP++SFE W + + + ++ +NK  +TY+ FKK  K   +K ++  +
Sbjct: 119 EDSDEERKFWKKYEKPEKSFEIWRTVSSQNKQPINKQKMTYHNFKKIEKIPLRKMEIPLL 178

Query: 168 HLNKNVKNNFELMIDGFEPINDNNISRNRNLQNYNKHHLSLLTDLMYSNIFKQKWDIAYK 227
           H  K  K  F+ +  G EP+     +    ++NY   H+  LTDL++ N+ +  W +AYK
Sbjct: 179 HCTKENKLYFQSISRGLEPLK----TSTSEVRNYRTRHIVTLTDLLHLNVSRHNWSLAYK 234

Query: 228 CFTFLLRIPDVDIRRVWNLGSIILQNI-DTTKLIDFLQWLSNVYSNKNRSFVQGINYRND 286
            F  L+RIP V I+ +W +G  IL N+ +++  +DFLQW+  +YS+K+R FVQ INYR+ 
Sbjct: 235 IFATLIRIPGVQIKSLWGIGVEILDNLSNSSSGLDFLQWMCQIYSSKSR-FVQNINYRSI 293

Query: 287 QTNFNGGSRRLTPLYTKTLLWHKL-----TLSSDSETCESEIDS-------LIEQIAEMV 334
              F  GSR  T  +  T LW  L     ++   S   +   D+       LI++I+E V
Sbjct: 294 VPPFQTGSRTHTAKFAITYLWSSLINCQKSMEPSSNIIDKPFDTENDLLQELIDKISEWV 353

Query: 335 VIPPYSEDNEIWYIFALCHLVKADNLSEKLYFMSRRNPEVDEMDTYPYDTEXXXXXXXXX 394
           + PP+ ED E+W+I+A CHL+KAD LS +    ++ N      D    D +         
Sbjct: 354 LTPPFMEDAEVWFIYASCHLLKADTLSRQFVNDNKNN------DLIGLDRDIKINQVIKH 407

Query: 395 XXXXXXXLRKATQDKNFDYPARTIETKLKTIETRTF 430
                  L+       F  P+R IE +LK+ E+R +
Sbjct: 408 IHYVRTFLKICLDKGGFAVPSRLIENQLKSFESRLY 443

>KAFR0L00420 Chr12 (77468..78850) [1383 bp, 460 aa] {ON} Anc_6.46
           YML043C
          Length = 460

 Score =  215 bits (548), Expect = 2e-64,   Method: Compositional matrix adjust.
 Identities = 128/372 (34%), Positives = 206/372 (55%), Gaps = 38/372 (10%)

Query: 1   MFELPVSSNITINAFNLKKLRYQYINDINAK-HNELSKNELPTPVTSENDTGGEDLDGDS 59
           MFE+PV+ N +    N +KLRY+YIN    +   +  +N + TP TSE++          
Sbjct: 1   MFEIPVNVN-SKTLSNERKLRYRYINQFTRRFERKDDRNGMITPETSEDE---------- 49

Query: 60  EHNLTSEDAEVAQERRIRRWKSIMGEAIXXXXXXXXXXXXXXXXXXXXGPT-----DEEK 114
                       Q+R+ R W  ++GE                              +EE+
Sbjct: 50  -----------LQQRKKRDWLHVIGEYGSDDDERSGGQQDDEEEEEEVIDEDYNLNNEER 98

Query: 115 KYFLRYDKPQESFEKWESNNLKRQRHVNKNFITYYRFKKTRKQIDKKYKVKTMHLNKNVK 174
           K+F + DKPQE++E W S+  +++  + ++ +TY+R+ K  + +++K     +H++   +
Sbjct: 99  KFFKKIDKPQETYEHWPSH--RKKTRIQRDILTYHRYNKVSRYVERKMANSLVHVSSKNR 156

Query: 175 NNFELMIDGFEPINDNNISRNRNLQNYNKHHLSLLTDLMYSNIFKQKWDIAYKCFTFLLR 234
            +F+  IDG E +       ++   N+    +  LT+L+Y N+ +  W+IAYK F  L+R
Sbjct: 157 YHFKCKIDGMEIVE----PLHKGATNFQLKQIETLTNLLYLNVNRGNWEIAYKIFAMLIR 212

Query: 235 IPDVDIRRVWNLGSIILQNIDTTKLIDFLQWLSNVYSNKNRSFVQGINYRNDQTNFNGGS 294
           IP VDIR VWN+G+ IL   D  + ++FL+W+S+VYS +  +F+QGINYR D   F  GS
Sbjct: 213 IPKVDIRSVWNVGNRILYEKDKLRSLEFLEWMSSVYSTR-VTFIQGINYRFDPV-FRSGS 270

Query: 295 RRLTPLYTKTLLWHKLTLSSDS--ETCESEIDSLIEQIAEMVVIPPYSEDNEIWYIFALC 352
           +  TP YT   LW+ L   ++   E  +  ID LI++IAEMV+IPP+ +D EIW+I+++C
Sbjct: 271 KNHTPKYTLQWLWNSLLEYTEQLFENDDENIDKLIDKIAEMVLIPPFMDDPEIWFIYSMC 330

Query: 353 HLVKADNLSEKL 364
           H+VKAD LS K 
Sbjct: 331 HMVKADFLSSKF 342

>NDAI0D00890 Chr4 (203085..204704) [1620 bp, 539 aa] {ON} Anc_6.46
           YML043C
          Length = 539

 Score =  216 bits (550), Expect = 7e-64,   Method: Compositional matrix adjust.
 Identities = 161/481 (33%), Positives = 244/481 (50%), Gaps = 81/481 (16%)

Query: 1   MFELPVSSNITINAFNLKKLRYQYINDINAKHNELSKNE---------LPTPVTSENDTG 51
           MFELP+  N    A   +K+RY YIN ++ K+N               LPTP +S  ++ 
Sbjct: 1   MFELPIIYNNKRTATE-RKIRYTYINQLSKKYNRTQNRHNNNNNNNGILPTPESSATESH 59

Query: 52  GEDLDGDSEHNLTSEDAEVAQERRIRRWKSIMGEAIXXXXXXXXXXXXXXXXXXXXGPT- 110
                   + + T+ D  + ++R  RRWKS++GEA                         
Sbjct: 60  -------DDDDATTSDDLIKRKRLRRRWKSVIGEAYSDTDLDDDDDDEEEEEDVDVEDEM 112

Query: 111 ------------DEEKKYFLRYDKPQESFEKWESNNLKRQRHVNKNFITYYRFKKTRKQI 158
                       +EE+K+F +Y+KPQE+FE W++NNLKR   +NK+ ITY + KK  KQ 
Sbjct: 113 SDHHESAHHIHENEERKFFKKYEKPQETFEIWQTNNLKRVP-INKSMITYTKLKKIEKQA 171

Query: 159 DKKYKVKTMHLNKNVKNNFELMIDGFEPINDNNISRNRNLQNYNKHHLSLLTDLMYSNIF 218
            +K  V  +H +K  K  FE M +G E +     +    ++N++  H+  LT L+Y N+ 
Sbjct: 172 KRKITVPLLHASKINKLCFEAMSEGLELV-----TPLVTIENFSLQHIEKLTTLLYLNVS 226

Query: 219 KQKWDIAYKCFTFLLRIPDVDIRRVWNLGSIILQNIDTTKLIDFLQWLSNVYSNKNRSFV 278
           ++ WDIAY+ FT L+RI  +DIR +W +G  IL     TK +DFL W+++VYS++  +F+
Sbjct: 227 RENWDIAYRIFTLLIRIKKLDIRSIWGIGVRILSEKSPTKTLDFLNWMNSVYSSR-LNFI 285

Query: 279 QGINYRNDQTNFNGGSRRLTPLYTKTLLWHKLTLSS----------------DSETCESE 322
           QGINYR D   F  GSR  TP YT T LW  L   S                D  + E +
Sbjct: 286 QGINYRMDPV-FKSGSRTHTPKYTLTWLWKSLIQYSTKKIISGNNNSNESLEDGSSSELD 344

Query: 323 ID---------SLIEQIAEMVVIPPYSEDNEIWYIFALCHLVKADNLSEKLYFM----SR 369
           ID          LIE+I+EMV+IPP+ ED+E+W+I++LCH+V AD+LS K   +    SR
Sbjct: 345 IDINIDRNNLLDLIEKISEMVLIPPFMEDSEVWFIYSLCHMVLADDLSSKFNPLISNGSR 404

Query: 370 RNPEVDEMDTYPYDTEXXXXXXXXXXXXXXXXLRKATQDKNFDYPARTIETKLKTIETRT 429
            + E +++  +   T+                L+ +    +F+YP + I  +L   E R 
Sbjct: 405 GDIERNQVIQHIQKTK--------------SYLQTSMNKGDFEYPEKYILKQLSIYEQRL 450

Query: 430 F 430
           +
Sbjct: 451 Y 451

>Suva_13.117 Chr13 complement(186472..188013) [1542 bp, 513 aa] {ON}
           YML043C (REAL)
          Length = 513

 Score =  214 bits (544), Expect = 2e-63,   Method: Compositional matrix adjust.
 Identities = 150/462 (32%), Positives = 231/462 (50%), Gaps = 45/462 (9%)

Query: 1   MFELPVSSNITINAF-NLKKLRYQYINDINAKHNELSK-----NELPTPVTSENDTGGED 54
           MFE+P++  +T   F   +KL+YQYIN I+ + + ++K     + LPTP  S  +   ED
Sbjct: 1   MFEVPIT--LTNKKFAQRRKLKYQYINHISRRFDRITKKSNTTDSLPTPENSAAENNDED 58

Query: 55  LDGDSEHNLTSEDA------EVAQERRIRRWKSIMGEAIXXXXXXXXXX--------XXX 100
            D D E      DA      +  + RR R WKS++GE                       
Sbjct: 59  YDDDEEERNYESDAGESSIRQQTKRRRERHWKSVIGELYSSTETESDSQEEDDQEGDQVE 118

Query: 101 XXXXXXXGPTDEEKKYFLRYDKPQESFEKWESNNLKRQRHVNKNFITYYRFKKTRKQIDK 160
                    TDEE+K++ +Y+KP++SFE W++ +   +  +NK  ITY+ +KK  K   +
Sbjct: 119 HETRLKEEDTDEERKFWKKYEKPEKSFEVWQTVSSHNKSPINKQKITYHNYKKIEKNSLR 178

Query: 161 KYKVKTMHLNKNVKNNFELMIDGFEPINDNNISRNRNLQNYNKHHLSLLTDLMYSNIFKQ 220
           K ++  +H  K  K  F+L+  G EP+     S     +NY   H+  LT+L++ N+ + 
Sbjct: 179 KMEIPLLHCTKENKLYFQLLAKGLEPLQ----SPTSAARNYQTRHIITLTNLLHLNVSRH 234

Query: 221 KWDIAYKCFTFLLRIPDVDIRRVWNLGSIILQNI-DTTKLIDFLQWLSNVYSNKNRSFVQ 279
            W +AYK F  L+RIP+V I+ +W +G  IL N  + +  +DFLQW+  VYS+K+R FVQ
Sbjct: 235 NWPLAYKIFATLIRIPNVQIKSIWGIGVKILDNSPNLSSSLDFLQWMCQVYSSKSR-FVQ 293

Query: 280 GINYRNDQTNFNGGSRRLTPLYTKTLLWHKLTLSSDS-----------ETCESEIDSLIE 328
            +NYR+    F  GSR  T  +  T LW  L     S           +   S ++ LI+
Sbjct: 294 NVNYRSVVPPFQTGSRTHTSKFAITYLWSCLISCQKSIESSNATDNQYDMENSRLEELID 353

Query: 329 QIAEMVVIPPYSEDNEIWYIFALCHLVKADNLSEKLYFMSRRNPEVDEMDTYPYDTEXXX 388
           QI+E V+IPP+ ED E+++I+A CHL+KAD LS +    +R N      D    + +   
Sbjct: 354 QISEWVLIPPFMEDAEVYFIYASCHLLKADLLSRQFVNDNRNN------DLVGLNKDIKI 407

Query: 389 XXXXXXXXXXXXXLRKATQDKNFDYPARTIETKLKTIETRTF 430
                        L+       F  P R IE +LK+ E+R +
Sbjct: 408 NQVIKNIHYVKVFLQTCLDKGGFTIPNRLIENQLKSFESRLY 449

>Smik_13.106 Chr13 complement(183859..185379) [1521 bp, 506 aa] {ON}
           YML043C (REAL)
          Length = 506

 Score =  212 bits (540), Expect = 8e-63,   Method: Compositional matrix adjust.
 Identities = 143/462 (30%), Positives = 226/462 (48%), Gaps = 52/462 (11%)

Query: 1   MFELPVSSNITINAF-NLKKLRYQYINDINAKHNELSKNE-----LPTPVTSENDTGGED 54
           MFE+P++  +T   F   +KL+YQYIN  + +  ++ K       LPTP  S  +   ED
Sbjct: 1   MFEVPIT--LTNKKFAQRRKLKYQYINHTSRRFEKIVKKSTTALSLPTPENSAAENNEED 58

Query: 55  LDGDSEHNLTSEDAEVAQERRIRR---WKSIMGEAIXXXXXXXXXXXXXXX-----XXXX 106
            DG+      +    + Q+R+ RR   WKS++GE                          
Sbjct: 59  -DGERNGEGGAYRRLILQQRKRRRERHWKSVVGEIYSSTETESDSQEDAEEDEECNTEGK 117

Query: 107 XGPTDEEKKYFLRYDKPQESFEKWESNNLKRQRHVNKNFITYYRFKKTRKQIDKKYKVKT 166
               DEE+K++ +Y+KP+ESFE W + + + +  +NK  +TY+ FKK  K   +K +V  
Sbjct: 118 EEDIDEERKFWKKYEKPEESFEVWRTVSSQNKSPINKQKMTYHTFKKIEKNSLRKMEVPL 177

Query: 167 MHLNKNVKNNFELMIDGFEPINDNNISRNRNLQNYNKHHLSLLTDLMYSNIFKQKWDIAY 226
           +H  K  K +F+ +  G EP+  +       ++NY   H+  LT+L++ N+ +  W +AY
Sbjct: 178 LHCTKESKLHFQSLSKGLEPLQPS----TSEVRNYRTKHIITLTNLLHLNVSRHNWSLAY 233

Query: 227 KCFTFLLRIPDVDIRRVWNLGSIILQNI-DTTKLIDFLQWLSNVYSNKNRSFVQGINYRN 285
           K F  L+RIP V I+ +W +G  IL N  + +  +DFLQW+  +YS+K R FVQ  NYR+
Sbjct: 234 KIFATLIRIPGVQIKSIWGIGVEILNNSPNLSTSLDFLQWMCQIYSSKLR-FVQSTNYRS 292

Query: 286 DQTNFNGGSRRLTPLYTKTLLWHKLTLSSDSETCESEID-----------------SLIE 328
               F  GSR  T  +  T LW  L       TC+  ++                  LI+
Sbjct: 293 IVPPFQTGSRTHTSKFATTYLWSSLI------TCQKSMELPDINDKRYDMENDLLQDLID 346

Query: 329 QIAEMVVIPPYSEDNEIWYIFALCHLVKADNLSEKLYFMSRRNPEVDEMDTYPYDTEXXX 388
           +I+E V+ PP+ ED E+W+I+A CHL+KAD LS +    ++ +      D    D +   
Sbjct: 347 RISEWVLTPPFMEDAEVWFIYASCHLLKADILSRQFANDNKTS------DLIGLDRDIKI 400

Query: 389 XXXXXXXXXXXXXLRKATQDKNFDYPARTIETKLKTIETRTF 430
                        L+  +    F  P R IE++LK  E+R +
Sbjct: 401 NQVIKHIHYVKVFLQTCSDKGGFTVPNRLIESQLKGFESRLY 442

>ZYRO0C07172g Chr3 (541070..542422) [1353 bp, 450 aa] {ON} weakly
           similar to uniprot|Q04712 Saccharomyces cerevisiae
           YML043C RRN11 rDNA transcription factor CF component
           which also contains Rrn6p and Rrn7p which is required
           for rDNA transcription by RNA polymerase I component of
           rDNA transcription factor
          Length = 450

 Score =  209 bits (531), Expect = 4e-62,   Method: Compositional matrix adjust.
 Identities = 144/451 (31%), Positives = 228/451 (50%), Gaps = 67/451 (14%)

Query: 1   MFELP--VSSNITINAFNLKKLRYQYINDINAKHNEL-----SKNELPTPVTSENDTGGE 53
           MFELP  ++S  T  +   +KL+YQYIN+++ K++ +      + ELPTP  S  +T   
Sbjct: 1   MFELPLVITSKRTRTS---RKLKYQYINNLSKKYDGINGISNGQTELPTPENSATET--- 54

Query: 54  DLDGDSEHNLTSEDAEVAQERRIRRWK---SIMGEAIXXXXXXXXXXXXXXXXXXXXGPT 110
                      SE+ EV Q++R R  K   SI+GE+                        
Sbjct: 55  -----------SENEEVGQQKRRRIRKRLKSIIGESYSDLESDEEQPVEEVD-------- 95

Query: 111 DEEKKYFLRYDKPQESFEKWESNNLKRQRHVNKNFITYYRFKKTRKQIDKKYKVKTMHLN 170
           +EE+K++ +Y+KPQ +FEKW+ +  KR   + +N I Y R  + ++   ++ +      +
Sbjct: 96  NEERKFYRKYEKPQLTFEKWQCDPRKRT-PIQRNRINYNRMNRIQRHGLRRMETSLAVAS 154

Query: 171 KNVKNNFELMIDGFEPINDNNISRNRNLQNYNKHHLSLLTDLMYSNIFKQKWDIAYKCFT 230
           +  K  F     G++ + D    R    Q     H+  LT L++ N+ K+KW++AYKCF 
Sbjct: 155 RTNKTFFHATTQGYQ-LFDPTYGRANTFQ---LKHIGTLTSLLHINVLKRKWELAYKCFA 210

Query: 231 FLLRIPDVDIRRVWNLGSIILQNIDTTKLIDFLQWLSNVYSNKNRSFVQGINYRNDQTNF 290
            L+RIP VD+R +W LG  IL     T+ ++FLQW+S+VYS K   F   +NYR     F
Sbjct: 211 LLIRIPGVDVRTLWGLGERILAERQPTRSLEFLQWMSSVYSTK-LPFADDVNYRMAPV-F 268

Query: 291 NGGSRRLTPLYTKTLLWHKLT--------LSSDSETCESEIDSLIEQIAEMVVIPPYSED 342
             GS+  TP YT T LW  L         L  DS++      SL+++I+EMV+ PPY +D
Sbjct: 269 TKGSKTHTPKYTTTWLWECLIRYANGLEDLEMDSKSAAENFQSLMDRISEMVLGPPYMDD 328

Query: 343 NEIWYIFALCHLVKADNLSEKL---YFMSRRNPEVDEMDTYPYDTEXXXXXXXXXXXXXX 399
            E+W+I+ALCH+VKAD LS++       S R+   +++  +  +T+              
Sbjct: 329 PEVWFIYALCHMVKADTLSQQFDPRLTGSARDIASNQVIQHIQNTK-------------- 374

Query: 400 XXLRKATQDKNFDYPARTIETKLKTIETRTF 430
             L++ +    F +P R I  +L   E R +
Sbjct: 375 SHLQQCSSKGGFTFPKRYIARQLAAFEARLY 405

>NCAS0H00900 Chr8 (167875..169362) [1488 bp, 495 aa] {ON} Anc_6.46
           YML043C
          Length = 495

 Score =  208 bits (529), Expect = 2e-61,   Method: Compositional matrix adjust.
 Identities = 144/446 (32%), Positives = 233/446 (52%), Gaps = 52/446 (11%)

Query: 1   MFELPVS-SNITINAFNLKKLRYQYINDINAKHN--ELSKNELPTPVTSENDTGGEDLDG 57
           MF+LP   SN  I   N +K+RY YIN ++ K+N  +   + LPTP  S +++       
Sbjct: 1   MFDLPTQISNKRIA--NERKIRYTYINQLSRKYNRQDAESSSLPTPENSASES------- 51

Query: 58  DSEHNLTSEDAEVAQERRIRRWKSIMGEAIXXXXXXXXXXXXXXXXXXXXGPTDEEKKYF 117
              H  T ED EV + R  RRWK+++GEA+                       ++E+++F
Sbjct: 52  ---HESTGEDEEVRRRRLKRRWKNVIGEAVSDTDEDEDGEEEREDEGP----ENQERRFF 104

Query: 118 LRYDKPQESFEKWESNNLKRQRHVNKNFITYYRFKKTRKQIDKKYKVKTMHLNKNVKNNF 177
             ++KPQES+E W ++N KR   + K FI++ +  K  K   ++ +   +H +K     F
Sbjct: 105 KTHEKPQESYEIWSTDNNKRMP-LQKKFISFSKLNKIEKSTKRRMQGSLLHSSKFNNICF 163

Query: 178 ELMIDGFEPINDNNISRNRNLQNYNKHHLSLLTDLMYSNIFKQKWDIAYKCFTFLLRIPD 237
           E +  G E +   +   +  L+     H+  LT+L++ N+ K KW++AYK F  ++RIP 
Sbjct: 164 ESISQGQELVTPLHTPESFTLK-----HIENLTNLLHINVMKGKWEVAYKIFALMVRIPK 218

Query: 238 VDIRRVWNLGSIILQNIDTTKLIDFLQWLSNVYSNKNRSFVQGINYRNDQTNFNGGSRRL 297
           VDIR +W +G  IL     T  +DFL W+++VYS++  +++QG+ +R D   F  GS+  
Sbjct: 219 VDIRSIWGIGVKILSQRAATTTLDFLVWMNSVYSSR-INYIQGMTHRVDPV-FRSGSKTH 276

Query: 298 TPLYTKTLLWHKLTLSSDSETCESEIDS------------LIEQIAEMVVIPPYSEDNEI 345
           +  +T T LW  L   +D++  E +IDS            LIE+++E+V+IPP+ ED E+
Sbjct: 277 SSKFTITWLWKSLIYCTDTDNDE-DIDSDYGGFGRDKLQILIEKVSELVLIPPFMEDAEV 335

Query: 346 WYIFALCHLVKADNLSEKLYF-MSRRNPEVDEMDTYPYDTEXXXXXXXXXXXXXXXXLRK 404
           W+I+ALCH+VKAD LS  L F +++ N    ++                        L+ 
Sbjct: 336 WFIYALCHMVKADQLS--LNFNLNQSNGSARDI---------ARNEVIQNIQLVKTFLQT 384

Query: 405 ATQDKNFDYPARTIETKLKTIETRTF 430
           A    +F+YP R I  +L T E R +
Sbjct: 385 AMSKGHFEYPERFITRQLNTFEERLY 410

>KLTH0C10582g Chr3 (877398..878843) [1446 bp, 481 aa] {ON} similar
           to uniprot|Q04712 Saccharomyces cerevisiae YML043C RRN11
           rDNA transcription factor CF component which also
           contains Rrn6p and Rrn7p which is required for rDNA
           transcription by RNA polymerase I component of rDNA
           transcription factor
          Length = 481

 Score =  207 bits (528), Expect = 3e-61,   Method: Compositional matrix adjust.
 Identities = 144/451 (31%), Positives = 224/451 (49%), Gaps = 52/451 (11%)

Query: 1   MFELPVSSNITINAFNLKKLRYQYINDINAKHNEL-----SKNELPTPVTSENDTGGEDL 55
           MFELP+  N T     ++KLRYQYIN +  ++ ++     + + LPTP   EN    E  
Sbjct: 1   MFELPLVRN-TKRVRTVRKLRYQYINTLYQEYRKVQSFANANSTLPTP---ENSAAEEAS 56

Query: 56  DGDSEHNLTSEDAEVAQERRIRRWKSIMGEAIXXXXXXXXXXXXXXXXXXXXGPTDEEKK 115
           DGD  HN  S DA   + RR RR  S++G A                        D EK+
Sbjct: 57  DGD--HN--SADATSRRRRRKRRLLSVLGHA---ETDTELSDMEAEEGSHEADQADSEKE 109

Query: 116 YFLRYDKPQESFEKWESNNLKRQRHV--NKNFITYYRFKKTRKQIDKKYKVKTMHLNKNV 173
           +F R++KPQE+FE W   N  RQ+ V  N   ++Y   K+  K   K+      H++KN 
Sbjct: 110 FFTRHEKPQETFEVW---NTDRQKAVPMNTATLSYDTCKQIEKHAQKRVSAGMAHISKNA 166

Query: 174 KNNFELMIDGFEPINDNNISRNRNLQNYNKHHLSLLTDLMYSNIFKQKWDIAYKCFTFLL 233
             +F+ M DG+E + +         ++++  H++ L +L+++NI K KWD AY+CF+ L+
Sbjct: 167 NFHFQAMKDGYETVAETP-------ESHHLVHIAQLNELLHTNIMKGKWDTAYRCFSLLI 219

Query: 234 RIPDVDIRRVWNLGSIILQNIDT-----TKLIDFLQWLSNVYSNKNRSFVQGINYRNDQT 288
           R+P +DIR VW  G+ IL+ + +         +FL WLS ++S+++ +F Q +N+  D  
Sbjct: 220 RLPGIDIRSVWGPGARILRELASNDKGLGTSEEFLGWLSGIFSSRS-NFNQTMNFLMDPV 278

Query: 289 NFNGGSRRLTPLYTKTLLWHKLTLS--------SDSETCESEIDSLIEQIAEMVVIPPYS 340
            F  GS+     +    LW  L  S        S  +    ++  L+E+++EMV+IPPY 
Sbjct: 279 -FRCGSKTHAAKFVVAWLWELLFASCPDGTEHPSAEDASNRKLSHLLERLSEMVLIPPYM 337

Query: 341 EDNEIWYIFALCHLVKADNLSEKLYFMSRRNPEVDEMDTYPYDTEXXXXXXXXXXXXXXX 400
           ED E+W+IFA+CHLV AD LS++      R  E++         +               
Sbjct: 338 EDPEVWFIFAVCHLVSADQLSQRFISTKLRTSELER--------DISRNQVTQHITNAHM 389

Query: 401 XLRKATQDK-NFDYPARTIETKLKTIETRTF 430
            +R     K  F +P R IE +L   E R +
Sbjct: 390 CIRTCEAKKEEFSFPRRIIEEQLACFEKRLY 420

>Skud_13.105 Chr13 complement(181845..183383) [1539 bp, 512 aa] {ON}
           YML043C (REAL)
          Length = 512

 Score =  206 bits (525), Expect = 1e-60,   Method: Compositional matrix adjust.
 Identities = 140/462 (30%), Positives = 233/462 (50%), Gaps = 46/462 (9%)

Query: 1   MFELPVSSNITINAF-NLKKLRYQYINDINAKHNELSK-----NELPTPVTSENDTGGED 54
           MFE+P++  +T   F   +KL+YQYIN ++ + ++++K     + LPTP  S  +   +D
Sbjct: 1   MFEVPIT--LTNKKFAQRRKLKYQYINHLSRRFDKVAKTTNTTDSLPTPENSAVENNDDD 58

Query: 55  LDGDSEHNLTSEDAEV--------AQERRIRRWKSIMGEAIXXXXXXXXXXXXXXX---- 102
            D D +     E A+V         + RR R WKS++GE                     
Sbjct: 59  YDYDEDEEQIDE-ADVYRRSILQQTKRRRERHWKSVVGELYSSTETESDSQQEEIQENDG 117

Query: 103 --XXXXXGPTDEEKKYFLRYDKPQESFEKWESNNLKRQRHVNKNFITYYRFKKTRKQIDK 160
                  G TDEE+K++ +++KP+ SFE W++ +L+ +  +N+  +TY++F+K +K   +
Sbjct: 118 RETGRKNGDTDEERKFWKKHEKPERSFEIWQTASLQNKGPINRRKMTYHKFQKIQKNSLR 177

Query: 161 KYKVKTMHLNKNVKNNFELMIDGFEPINDNNISRNRNLQNYNKHHLSLLTDLMYSNIFKQ 220
           K ++  +H  K  +  F  +  G EP+     +    ++NY   H+  LT+L++ N+ + 
Sbjct: 178 KVQIPLLHCTKENRLYFRSLSKGLEPLQ----TPTSTIRNYQTRHIITLTNLLHINVSRH 233

Query: 221 KWDIAYKCFTFLLRIPDVDIRRVWNLGSIILQNI-DTTKLIDFLQWLSNVYSNKNRSFVQ 279
            W +AY+ F  L+RIP+V ++ +W  G  IL N+ D++  +DFLQW+  +YS+K R FVQ
Sbjct: 234 NWSLAYRIFATLIRIPEVQMKSIWGFGVKILDNLPDSSSSLDFLQWMCQIYSSKAR-FVQ 292

Query: 280 GINYRNDQTNFNGGSRRLTPLYTKTLLWHKL----------TLSSDSETCESE-IDSLIE 328
            IN+R+    F  GSR  T  +  T LW  L          T++      E++ +  LI+
Sbjct: 293 NINHRSIVPPFQTGSRTHTAKFATTYLWASLINCQKSIEPSTINDKHYDMENDRLQELID 352

Query: 329 QIAEMVVIPPYSEDNEIWYIFALCHLVKADNLSEKLYFMSRRNPEVDEMDTYPYDTEXXX 388
           +I+E V+ PP+ ED E+W+I+A CHL+KAD LS +      +       D    D +   
Sbjct: 353 KISEWVLTPPFMEDAEVWFIYASCHLLKADILSRQFVNDGTKG------DLIGLDRDIKI 406

Query: 389 XXXXXXXXXXXXXLRKATQDKNFDYPARTIETKLKTIETRTF 430
                        L+       F  P R IE +LK  E R +
Sbjct: 407 NQVIKHIHYVKVFLQTCLDKGGFTIPNRLIEIQLKNFELRLY 448

>SAKL0E01980g Chr5 complement(150830..152227) [1398 bp, 465 aa] {ON}
           similar to uniprot|Q04712 Saccharomyces cerevisiae
           YML043C RRN11 rDNA transcription factor CF component
           which also contains Rrn6p and Rrn7p which is required
           for rDNA transcription by RNA polymerase I component of
           rDNA transcription factor
          Length = 465

 Score =  201 bits (512), Expect = 4e-59,   Method: Compositional matrix adjust.
 Identities = 130/374 (34%), Positives = 199/374 (53%), Gaps = 32/374 (8%)

Query: 1   MFELPV-SSNITINAFNLKKLRYQYINDINAKHNELSKNE----LPTPVTSENDTGGEDL 55
           MFELPV  +N  I +   +KLRYQYIN +N KH +L+  +    LPTP +S  +T   D 
Sbjct: 1   MFELPVVRTNKKIRS--KRKLRYQYINTLNKKHEQLNPKKQTVGLPTPESSAAETSDTDE 58

Query: 56  DGDSEHNLTSEDAEVAQERRIRRWKSIMGEAIXXXXXXXXXXXXXXXXXXXXGPTDEEKK 115
             DS+   T       Q        SI+G A+                       D EK 
Sbjct: 59  LEDSQSKRTKRRKRRLQ--------SILGHAVSSSDEDDISEEENDNDYEE---CDYEKH 107

Query: 116 YFLRYDKPQESFEKWESNNLKRQRHVNKNFITYYRFKKTRKQIDKKYKVKTMHLNKNVKN 175
              +Y KPQE++E W +    R   +N   +TY ++KK  K   ++      + +KN   
Sbjct: 108 VKNKYYKPQETYELWTTGPENRVP-LNTTSMTYKQYKKIHKAAHRRVTRTLSYSSKNSAA 166

Query: 176 NFELMIDGFEPINDNNISRNRNLQNYNKHHLSLLTDLMYSNIFKQKWDIAYKCFTFLLRI 235
            F  + +G+EP           L+NY   H+  LT+L++ N+ +Q W+IAY+CF+ L+R+
Sbjct: 167 FFSAIYNGYEPY------ETSQLENYQTTHIRNLTNLLHVNVMEQNWEIAYRCFSILIRL 220

Query: 236 PDVDIRRVWNLGSIILQNIDTTKLIDFLQWLSNVYSNKNRSFVQGINYRNDQTNFNGGSR 295
           P VDIR +W +G  IL+ ID  +  +FL+W+S+V+S KN +F QG N+  D   F  GS+
Sbjct: 221 PGVDIRSIWGIGVRILKEIDRKRSEEFLEWMSSVFSTKN-NFNQGTNHAMDPV-FRSGSK 278

Query: 296 RLTPLYTKTLLWHKL--TLSSDSETCESEIDS---LIEQIAEMVVIPPYSEDNEIWYIFA 350
             TP +  + LW  L    S D      +++    L E+I+E+V+ PPY +D +IW+I+A
Sbjct: 279 THTPKFVTSWLWETLMGCTSKDENNGNRDVNKLQFLTEKISELVLTPPYMDDPKIWFIYA 338

Query: 351 LCHLVKADNLSEKL 364
           LCH+V+AD+LS++ 
Sbjct: 339 LCHIVEADHLSQQF 352

>CAGL0J11792g Chr10 complement(1150752..1152284) [1533 bp, 510 aa]
           {ON} similar to uniprot|Q04712 Saccharomyces cerevisiae
           YML043c RRN11 RNA polymerase I specific transcription
           initiation factor
          Length = 510

 Score =  194 bits (493), Expect = 6e-56,   Method: Compositional matrix adjust.
 Identities = 144/482 (29%), Positives = 239/482 (49%), Gaps = 86/482 (17%)

Query: 1   MFELPVSSNITINAFNL-KKLRYQYINDINAKHNELSK-------NELPTPVTS--ENDT 50
           MFE+P++ N      N+ +++RYQYIN ++ K++   +       N LPTP  S  END 
Sbjct: 1   MFEVPITYNC--RRLNVERRVRYQYINILSRKYHAKRRSKRRRQANSLPTPENSAVEND- 57

Query: 51  GGEDLDGDSEHNLTSEDAEVAQERRIRRWKSIMGEAIXXXXXXXXXXXXXXXXXXXXGPT 110
                   SE  L S +       +I+  K  +GE                         
Sbjct: 58  -------QSESQLPSRE-------QIKEKKMKLGEDYSDSEAETSSEGEDTTKDDNEFAN 103

Query: 111 DE---EKKYFLRYDKPQESFEKW---ESNNLKRQRHVNKNFITYYRFKKTRKQIDKKYKV 164
           D    EK ++ +Y+KP+ SFE W    S N K++  + K  I Y R  +  +   K+ + 
Sbjct: 104 DMNKFEKLFYRKYEKPEHSFEVWYDGNSVNTKKKHELKKTHIHYTRLNRVERIAKKRVEK 163

Query: 165 KTMHLNKNVKNNFELMIDGFE---PINDNNISRNRNLQNYNKHHLSLLTDLMYSNIFKQK 221
             +H+    K  F++  +G+E   P+ D        + +Y   H+ +LT +++S++ +  
Sbjct: 164 NVVHMPLVNKRYFDIKSEGYEVLEPLVD--------IDSYLLKHIEILTQILFSSVSQGN 215

Query: 222 WDIAYKCFTFLLRIPDVDIRRVWNLGS-IILQNIDTTKLIDFLQWLSNVYSNKNRSFVQG 280
           WDIAY+ F+ L+RIP+VDIR +W LG+ I+++   TT+ ++FL+W+S VYS+K ++FVQ 
Sbjct: 216 WDIAYRTFSLLIRIPEVDIRNIWGLGTRILMERGQTTRSLEFLKWMSTVYSSK-QNFVQS 274

Query: 281 INYRNDQTNFNGGSRRLTPLYTKTLLWHKLTLSSDSETCESE------------------ 322
             +R     F  GSR  TP Y  T LW+ L   ++  + E E                  
Sbjct: 275 HCHRKAPV-FRSGSRTHTPKYALTWLWNCLIKVTELISIEEEKGVNTNEEENDNGSKQSA 333

Query: 323 ---IDSLIEQIAEMVVIPPYSEDNEIWYIFALCHLVKADNLSEKLYFM----SRRNPEVD 375
              +  LI++I+EMV++PPY +D EIW+I+++CH+V AD LS K        SRR+   +
Sbjct: 334 MDKLTELIDKISEMVLVPPYLDDPEIWFIYSMCHMVHADYLSGKFNCQRLSGSRRDIARN 393

Query: 376 EMDTYPYDTEXXXXXXXXXXXXXXXXLRKATQDKNFDYPARTIETKLKTIETRTFDFESM 435
           ++  + +                   L+  +Q  NF+YP + I+++L+  E R ++ ES 
Sbjct: 394 QVTQHIH--------------YVKTYLQNCSQKGNFEYPKQFIQSRLEEFEKRMYEDESK 439

Query: 436 PE 437
           PE
Sbjct: 440 PE 441

>KLLA0C05852g Chr3 (518508..519956) [1449 bp, 482 aa] {ON} weakly
           similar to uniprot|Q04712 Saccharomyces cerevisiae
           YML043C RRN11 rDNA transcription factor CF component
           which also contains Rrn6p and Rrn7p which is required
           for rDNA transcription by RNA polymerase I component of
           rDNA transcription factor
          Length = 482

 Score =  190 bits (482), Expect = 2e-54,   Method: Compositional matrix adjust.
 Identities = 128/374 (34%), Positives = 199/374 (53%), Gaps = 30/374 (8%)

Query: 1   MFELPVSSNITINAFNLKKLRYQYINDINAKHNELSKNELPTPVTSEND--TGGEDLDGD 58
           MF+LPV  + +      +K+RYQYIN +  K+++L+ N+    V+SE D  T G     +
Sbjct: 1   MFQLPVI-DRSSRNRKRRKIRYQYINSLKRKYDQLNYNQSEASVSSEADNVTNGILTPEN 59

Query: 59  SEHNLTSEDAEVA----QERRIRRWKSIMGEAIXXXXXXXXXXXXXXXXXXXXGPTDEEK 114
           SE    S +AE A    + RR RR +S++G A+                       D E 
Sbjct: 60  SE----SSEAEAADLEKKHRRKRRLQSVLGNALDSSDEELDGDEDGTDE------NDPET 109

Query: 115 KYFLRYDKPQESFEKWESNNLKRQRHVNKNFITYYRFKKTRKQIDKKYKVKTMHLNKNVK 174
           +++  + KPQ +FE W  N   R   + +  ITY   KK  K   K    K  +  K + 
Sbjct: 110 QFYESHIKPQHTFEVWNVNTALRTP-IQRKKITYNAVKKLEKAATKSVTKKLNYQTKKLN 168

Query: 175 NNFELMIDGFEPINDNNISRNRNLQNYNKHHLSLLTDLMYSNIFKQKWDIAYKCFTFLLR 234
             F+ +  GF+      +S+ + +      HL+ L  L+Y+N+  Q W+IAY+CF+ L+R
Sbjct: 169 MYFQALKFGFDVYPKPQLSKQKTM------HLAHLNQLLYTNVLNQNWEIAYRCFSILIR 222

Query: 235 IPDVDIRRVWNLGSIILQNI-DTTKLIDFLQWLSNVYSNKNRSFVQGINYRNDQTNFNGG 293
           + DVD+R +W++GS IL ++ DT     +L+WL++V+ ++ + F QG NY  D   F  G
Sbjct: 223 LEDVDVRSLWSIGSEILNSLGDTQSNEAYLEWLAHVFPSRVQ-FNQGTNYSLDPV-FRCG 280

Query: 294 SRRLTPLYTKTLLWHKLTLSSDSETC---ESEIDSLIEQIAEMVVIPPYSEDNEIWYIFA 350
           SR  TP +  T LW +L +++   +    E  + SLI+++ EMV+ PPY +D+EIWYIF 
Sbjct: 281 SRTHTPTFVLTWLWTRLFIATSGSSAVDKEKFLQSLIDRLDEMVLSPPYMDDSEIWYIFG 340

Query: 351 LCHLVKADNLSEKL 364
           L HLV A  LS K 
Sbjct: 341 LTHLVMASELSSKF 354

>TDEL0G04240 Chr7 (770798..772132) [1335 bp, 444 aa] {ON} Anc_6.46
           YML043C
          Length = 444

 Score =  186 bits (473), Expect = 1e-53,   Method: Compositional matrix adjust.
 Identities = 136/450 (30%), Positives = 225/450 (50%), Gaps = 44/450 (9%)

Query: 1   MFELPVSSNITINAFNLKKLRYQYINDINAKHNELSK----NELPTPVTSENDTGGEDLD 56
           MFE PV+   T    N KKLRYQY+N+++AK N L +    N LPTP  S          
Sbjct: 1   MFEQPVALT-TRRLRNAKKLRYQYVNNLSAKFNRLERITNTNGLPTPENSA--------- 50

Query: 57  GDSEHNLTSEDAEVAQERRIRRWKSIMGEAIXXXXXXXXXXXXXXXXXXXXGPTDEEKKY 116
             +E +   E  +  ++R  RR KS  GE+                        D+E+K+
Sbjct: 51  --AESSENEEALQRKKKRIRRRLKSAAGESYSDSESDEVDNNHDNEVVEDEE-EDQERKF 107

Query: 117 FLRYDKPQESFEKWESNNLKRQRHVNKNFITYYRFKKTRKQIDKKYKVKTMHLNKNVKNN 176
              Y+ PQESFEKW+ +  KR   + ++ I++ ++++ R+   +K        +K  K  
Sbjct: 108 LNNYELPQESFEKWQDDPSKRV-PIQRSKISFTKYQRLRRHAKRKMNTSIDLASKRNKIY 166

Query: 177 FELMIDGFEPINDNNISRNRNLQNYNKHHLSLLTDLMYSNIFKQKWDIAYKCFTFLLRIP 236
            + + +GFE ++  +   +     +   H+S+LT L++ ++ +++WD AY CF  L+R+P
Sbjct: 167 MDTISEGFEMVDPVDGKPD----TFQMKHISILTTLLHLHVSRREWDAAYTCFALLIRVP 222

Query: 237 DVDIRRVWNLGSIILQNIDTTKLIDFLQWLSNVYSNKNRSFVQGINYRNDQTNFNGGSRR 296
            VDIR +W +G +IL+  +  K ++FL W+S+VYS+++ +F + +N+R     F  GS+ 
Sbjct: 223 KVDIRNIWGIGDLILREREPIKSLEFLSWMSSVYSSRS-AFAEDVNHRTPPV-FTKGSKT 280

Query: 297 LTPLYTKTLLWHKLTLSSDS--ETCESE-------IDSLIEQIAEMVVIPPYSEDNEIWY 347
             P +  T +W  L   + +  ET E E       +  LIE+I+EMV+ PPY + +E+W+
Sbjct: 281 HVPKFATTWMWESLIQCTKNSLETGELEQIESNDGLQDLIERISEMVLAPPYMDASEVWF 340

Query: 348 IFALCHLVKADNLSEKLYFMSRRNPEVDEMDTYPYDTEXXXXXXXXXXXXXXXXLRKATQ 407
           I+ LCHL+KAD LS +  F  R      ++ +                      L+    
Sbjct: 341 IYGLCHLIKADILSNQ--FDGRLAGSARDIAS---------NQVIQHIQRTKSCLQTCLS 389

Query: 408 DKNFDYPARTIETKLKTIETRTFDFESMPE 437
             +F YP R IE +L+  E R    E  P+
Sbjct: 390 KGDFKYPKRYIERQLEEFEKRLDRQEDTPD 419

>KNAG0E00910 Chr5 complement(171075..172535) [1461 bp, 486 aa] {ON}
           Anc_6.46 YML043C
          Length = 486

 Score =  186 bits (473), Expect = 3e-53,   Method: Compositional matrix adjust.
 Identities = 119/390 (30%), Positives = 193/390 (49%), Gaps = 56/390 (14%)

Query: 1   MFELPV--SSNITINAFNLKKLRYQYINDIN------------------AKHNELSKNEL 40
           MFELPV   S     +   KKLRY+Y N+I                   + H EL  +E 
Sbjct: 1   MFELPVLLGSFSESQSLVRKKLRYRYRNEIKNQYKRIKIHDENGQLTPESSHTELDDHES 60

Query: 41  PTPVTSENDTGGEDLDGDSEHNLTSEDAEVAQERRIRRWKSIMGEAIXXXXXXXXXXXXX 100
            + V         DL    EH   S+ +E   E         +G+               
Sbjct: 61  RSRVCRGRKRRLYDLRDREEHGFESDSSEAQDE---------VGD--------------- 96

Query: 101 XXXXXXXGPTDEEKKYFLRYDKPQESFEKWESNNLKRQRHVNKNFITYYRFKKTRKQIDK 160
                      EE+KYF  ++KP++ +E W     +R+  + + F++Y R +   ++  +
Sbjct: 97  LPEKEEEEIGHEERKYFKNHEKPEDLYEVWHVATERRKVPIQRQFVSYNRLQTIERRAKR 156

Query: 161 KYKVKTMHLNKNVKNNFELMIDGFEPINDNNISRNRNLQNYNKHHLSLLTDLMYSNIFKQ 220
           K +V  +H+++   + F   IDG+     + +SR     ++   H+ LL  L++ +I  +
Sbjct: 157 KMEVPLLHVSRVRSSEFSAEIDGY-----DVVSRGDETTHFENKHIQLLVTLLHRHISTE 211

Query: 221 KWDIAYKCFTFLLRIPDVDIRRVWNLGSIILQNIDTTKLIDFLQWLSNVYSNKNRSFVQG 280
            W++AYK F  L+R+P VDIR VWNLG  IL   D+T  IDFL+W+ +VYSNK+R F+Q 
Sbjct: 212 NWNLAYKVFALLIRMPRVDIRAVWNLGVAILARRDSTTAIDFLEWMHSVYSNKHR-FIQN 270

Query: 281 INYRNDQTNFNGGSRRLTPLYTKTLLWHKLTLSSD-----SETCESEIDSLIEQIAEMVV 335
           +N+R     F  GSR  T  YT T LW  L  +++     + T    ++ L ++ +E+++
Sbjct: 271 VNHRLPPA-FRSGSRTHTAQYTTTWLWLSLRAATEQAQEGAPTTLEPLELLTDKTSELLL 329

Query: 336 IPPYSEDNEIWYIFALCHLVKADNLSEKLY 365
            PPY +D+E+W+I+  C+ VKAD LS  ++
Sbjct: 330 TPPYMDDSEVWFIYCSCYFVKADILSRNIH 359

>Kwal_56.22527 s56 complement(168165..169610) [1446 bp, 481 aa] {ON}
           YML043C (RRN11) - component of rDNA transcription factor
           [contig 185] FULL
          Length = 481

 Score =  179 bits (454), Expect = 2e-50,   Method: Compositional matrix adjust.
 Identities = 131/452 (28%), Positives = 221/452 (48%), Gaps = 51/452 (11%)

Query: 1   MFELPVSSNITINAFNLKKLRYQYINDINAKHNEL-----SKNELPTPVTSENDTGGEDL 55
           MFELP++ N +     ++KLRYQYIN ++ +H  +     +   LPTP   EN    +  
Sbjct: 1   MFELPLARN-SNRVRTVRKLRYQYINSLSQEHRRIQDSAAAHATLPTP---ENSAAEDAS 56

Query: 56  DGDSEHNLTSEDAEVAQERRIRRWKSIMGEAIXXXXXXXXXXXXXXXXXXXXGPTDEEKK 115
           DGD +    SEDA   + RR RR  S++G                          + EK+
Sbjct: 57  DGDQD----SEDAGSRRRRRKRRILSVLGHIDSESELSDVDMSTESHHSELQ---ESEKE 109

Query: 116 YFLRYDKPQESFEKWESNNLKRQRHVNKNFIT--YYRFKKTRKQIDKKYKVKTMHLNKNV 173
           +F  ++KPQ+++E W   N  R++ V+    T  Y   K    +  ++   +  H ++  
Sbjct: 110 FFSHHEKPQDTYETW---NTDRRKAVSMTTATLSYAENKLIEARAQRRVIERIGHFSRIA 166

Query: 174 KNNFELMIDGFEPINDNNISRNRNLQNYNKHHLSLLTDLMYSNIFKQKWDIAYKCFTFLL 233
           +++F  +  G+E  +       R  Q +   H++ L +L++ N+ + +W+ A++CF+ L+
Sbjct: 167 RSHFNSIKRGYEIYS-------RPSQVHQTTHITHLNELLHINVMEGQWETAFRCFSILI 219

Query: 234 RIPDVDIRRVWNLGSIILQNIDTT-----KLIDFLQWLSNVYSNKNRSFVQGINYRNDQT 288
           R+P VDIR +W LG  IL+ + +T        +FL WLS +Y++++ +F   +N+  D  
Sbjct: 220 RLPGVDIRSMWGLGVRILRELSSTDKNVASSDEFLGWLSGIYTSRS-NFNHTMNFLMDPV 278

Query: 289 NFNGGSRRLTPLYTKTLLWHKLTLSSDSETCESEID---------SLIEQIAEMVVIPPY 339
            F  GS++ T  +    LW  L  +   +  E + D          L+E+++EMV+IPPY
Sbjct: 279 -FRTGSKKHTAKFVSAWLWEMLFAACPDKLEERQADNGSGNRKLIQLLEKLSEMVLIPPY 337

Query: 340 SEDNEIWYIFALCHLVKADNLSEKLYFMSRRNPEVDEMDTYPYDTEXXXXXXXXXXXXXX 399
            ED EIW+I+ALCHLV AD LS++  F    + E++       D                
Sbjct: 338 MEDPEIWFIYALCHLVSADELSQRFTFTYSESTELER------DISRNQVTQHITNAHNC 391

Query: 400 XXLRKATQDKNFDYPARTIETKLKTIETRTFD 431
               +A  D +F +P R IE +L   E R ++
Sbjct: 392 IRTCEAKGD-DFFFPRRIIEEQLAFFERRLYE 422

>TBLA0B00570 Chr2 complement(113646..115199) [1554 bp, 517 aa] {ON}
           Anc_6.46 YML043C
          Length = 517

 Score =  169 bits (429), Expect = 1e-46,   Method: Compositional matrix adjust.
 Identities = 127/474 (26%), Positives = 224/474 (47%), Gaps = 73/474 (15%)

Query: 1   MFELPVSSNITINAFNLKKLRYQYINDINAKHNELSKNELP----------TPVTSENDT 50
           MFE P++ +  + A N +K+RYQYIN    ++++L  + +P          TP+T     
Sbjct: 1   MFEAPLNIHSKVLA-NERKIRYQYINTFTKRYSQLYGDTIPSSSLESNRSRTPITLPTPE 59

Query: 51  GGEDLDGDSEHNLTSEDAEVAQERRIRRWKSIMGEAIXXXXXXXXXXXXXXXXXXXXGPT 110
                  DS  N   +   ++    +                               G T
Sbjct: 60  ASAHEHSDSNTNYNDDSDSISNTNTL---------------------SDDEYNSDSTGTT 98

Query: 111 DEEKKYFLRYDKPQESFEKWESN--------NLKRQRHV--NKNFITYYRFKKTRKQIDK 160
           +EE K+F RYD+PQESFE W ++         LK    +  N+N I++ R  + +K  +K
Sbjct: 99  NEETKFFNRYDRPQESFEVWNTSIDTLNSKTKLKSNGRIPINRNKISFNRLNRVKKFTNK 158

Query: 161 KYKVKTMHLNKNVKNNFELMIDGFEPINDNNISRNRNLQNYNKHHLSLLTDLMYSNIFKQ 220
           K + +  H  K +K + + + +G+E        R++   ++N  H+  L +L+Y NI ++
Sbjct: 159 KLEARLQHCTKRLKTHIKAISEGYETS-----YRDKQTTSFNNIHIENLINLLYYNICEK 213

Query: 221 KWDIAYKCFTFLLRIPDVDIRRVWNLGSII-LQNIDTTKLIDFLQWLSNVYSNKNRSFVQ 279
            ++ AY  F+ ++R+P++DIR  WNLGSII L+ +   + ++FL W+ ++YS+ N+ +  
Sbjct: 214 NFNQAYHIFSLIIRLPNIDIRNFWNLGSIILLKKVSIQESLNFLNWIHSIYSS-NQKYNN 272

Query: 280 GINYRNDQTNFNGGSRRLTPLYTKTLLWHKLTL---------SSDSETCESEID------ 324
            INY+     F   SR  T  +T + LW  L+L         S + +    E++      
Sbjct: 273 SINYKTAPA-FTQSSRNHTGKFTTSFLWMTLSLIHTKFSDLTSRNIKEIVEELNYLKKKL 331

Query: 325 -SLIEQIAEMVVIPPYSEDNEIWYIFALCHLVKADNLSEKLYFMSRRNPEVDEMDTYPYD 383
              +E+++EMV+ PP+ ED+EIWYI++L HL+ A     ++     RN ++ +       
Sbjct: 332 KKFVEKLSEMVLAPPFIEDSEIWYIYSLSHLILA-----RMLMFETRNNDISQTSVEKDI 386

Query: 384 TEXXXXXXXXXXXXXXXXLRKATQDKNFDYPARTIETKLKTIETRTFDFESMPE 437
           T+                +R+   D NF +  + IE +LK +E + +D  S  E
Sbjct: 387 TKNEIISNIQHCKSHLQKVRENQNDYNFKF--QKIEIELKDMEKKLYDTSSDEE 438

>ACL020W Chr3 (326268..327887) [1620 bp, 539 aa] {ON} Non-syntenic
           homolog of Saccharomyces cerevisiae YML043C (RRN11)
          Length = 539

 Score =  164 bits (414), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 120/445 (26%), Positives = 205/445 (46%), Gaps = 38/445 (8%)

Query: 1   MFELPVSSNITINAFNLKKLRYQYINDINAKH---NELSKNE---------LPTPVTSEN 48
           MFE P+ S  +  +   + L+Y+Y++ +  K+   N LS ++          PTP  S  
Sbjct: 46  MFESPIVS-YSKRSKQQRALKYKYVSCVRRKYEQLNGLSDSDKQAHIDSACFPTPDNSAA 104

Query: 49  DTG-GEDLDGDSEHNLTSEDAEVAQERRIRRWKSIMGEAIXXXXXXXXXXXXXXXXXXXX 107
           +   G+ L+GD +       A    +R+  R +SI+G A                     
Sbjct: 105 EASDGDALEGDVD------TAARRLKRKRLRLQSILGHATLDAEEGDLGSEEEDDLNGGS 158

Query: 108 GPTDEEKKYFLRYDKPQESFEKWESNNLKRQRHVNKNFITYYRFKKTRKQIDKKYKVKTM 167
              D EK++F RY KP+ ++E W ++  K +  + +  ++Y  FK+     +++ K    
Sbjct: 159 TAKDYEKQFFARYYKPEYTYELWATSP-KNRVPIRRKMLSYQAFKQIENYSNQRMKATLS 217

Query: 168 HLNKNVKNNFELMIDGFEPINDNNISRNRNLQNYNKHHLSLLTDLMYSNIFKQKWDIAYK 227
              K      E+M  G+E      ++      NY K HL+ L  L+YSNI  + W  AY+
Sbjct: 218 LSTKKAAAYHEVMRLGYETCPKEEVT------NYQKLHLNHLVGLLYSNIISENWGTAYR 271

Query: 228 CFTFLLRIPDVDIRRVWNLGSIILQNIDTTKLIDFLQWLSNVYSNKNRSFVQGINYRNDQ 287
           CF  L+R+  VD+R +WNLGS IL +++      FL+W+  V+++ +      +N  +  
Sbjct: 272 CFALLIRMKSVDLRSIWNLGSHILSHLNFDMHEKFLEWMGTVFTSHSVFSQNKVNLID-- 329

Query: 288 TNFNGGSRRLTPLYTKTLLWHKLTLSSDSETCES--EIDSLIEQIAEMVVIPPYSEDNEI 345
             F  GSR  TP +    LW  L  ++  E  +S   +  L+E+++E+V+ PPY +D EI
Sbjct: 330 PVFRSGSRAHTPNFMLAWLWLVLRGATADEVLDSTRSMAWLLEKVSELVLRPPYMDDAEI 389

Query: 346 WYIFALCHLVKADNLSEKLYFMSRRNPEVDEMDTYPYDTEXXXXXXXXXXXXXXXXLRKA 405
           W+++A+C+ ++AD LS +L           ++D                       L   
Sbjct: 390 WFLYAMCYFIQADKLSAQLASHEGIKLHGSKLDI-------AKTQVTQYICSVKNCLESC 442

Query: 406 TQDKNFDYPARTIETKLKTIETRTF 430
            +  NF YP R I+ +L   E R +
Sbjct: 443 REKGNFTYPERIIQEQLLEFERRLY 467

>Ecym_3049 Chr3 complement(93199..94704) [1506 bp, 501 aa] {ON}
           similar to Ashbya gossypii ACL020W
          Length = 501

 Score =  158 bits (399), Expect = 1e-42,   Method: Compositional matrix adjust.
 Identities = 130/452 (28%), Positives = 214/452 (47%), Gaps = 46/452 (10%)

Query: 1   MFELPVSSNITINAFNLK--KLRYQYINDINAKHNELSKNE------------LPTPVTS 46
           MFE P+   I+ N+ + K  KL+Y+YIN +  K+  L   +            LPTP   
Sbjct: 1   MFESPI---ISYNSKDRKRRKLKYKYINSLKRKYEHLVGTQGGSKGSTKDTSGLPTP--- 54

Query: 47  ENDTGGEDLDGDSEHNLTSEDAEVAQERRIRRWKSIMGEAIXXXXXXXXXXXXXXXX--- 103
             ++  E  DGD       E + + + +R  R +SI+G A                    
Sbjct: 55  -GNSAAEASDGDGREE--DELSRLRRRKRRIRLQSILGHAADEDEDEAEAEGAVGSEDDD 111

Query: 104 XXXXGPTDE---EKKYFLRYDKPQESFEKWESNNLKRQRHVNKNFITYYRFKKTRKQIDK 160
               G  DE   EK ++ +Y  P+E++E W + ++  +  + +  ++Y+ F+   K   K
Sbjct: 112 GYEDGYLDEKDPEKIFYSKYYVPEETYEVW-TTSINNRIPIQRRSMSYHVFRTIEKYAHK 170

Query: 161 KYKVKTMHLNKNVKNNFELMIDGFEPINDNNISRNRNLQNYNKHHLSLLTDLMYSNIFKQ 220
           K        +K +   FE++  G+E        R R + NY K HL  L DL+Y NI + 
Sbjct: 171 KVAASLALSSKKLTGFFEVIRSGYE-----TCPRER-ITNYQKVHLHHLVDLLYINILRG 224

Query: 221 KWDIAYKCFTFLLRIPDVDIRRVWNLGSIILQNIDTTKLIDFLQWLSNVYSNKNRSFVQG 280
            +D AY+CF+ L+R+  VD+R +WNLGS IL++ +      FL+W+S V ++ N +F Q 
Sbjct: 225 DFDTAYRCFSLLIRMNFVDLRSMWNLGSKILEHYNLDDQERFLEWMSTVLTS-NSAFPQN 283

Query: 281 INYRNDQTNFNGGSRRLTPLYTKTLLWHKLTLSSDSETCES--EIDSLIEQIAEMVVIPP 338
              + D   F  GSR   P +  + LW  L  +       S  +I+ L+++I+E+V+ PP
Sbjct: 284 SKNQLDPV-FRSGSRTHIPNFVLSWLWLVLENAVKERVFSSGHDINWLLDKISELVLRPP 342

Query: 339 YSEDNEIWYIFALCHLVKADNLSEKLYFMSRRNPEVDEMDTYPYDTEXXXXXXXXXXXXX 398
           Y +D E+W+I+A+C+ +KAD LS +L    ++   ++ +     D               
Sbjct: 343 YMDDAEVWFIYAMCYFIKADKLSLQL----KQEGSLNGLKGSQLDI--ARNQVIENIHHV 396

Query: 399 XXXLRKATQDKNFDYPARTIETKLKTIETRTF 430
              LR   +   F YP R IE +L   E R +
Sbjct: 397 KNHLRICEEKGGFQYPKRVIEAQLVEFEKRLY 428

>TPHA0L01660 Chr12 complement(348715..350358) [1644 bp, 547 aa] {ON}
           Anc_8.539 YBR200W
          Length = 547

 Score = 37.4 bits (85), Expect = 0.063,   Method: Compositional matrix adjust.
 Identities = 38/148 (25%), Positives = 61/148 (41%), Gaps = 22/148 (14%)

Query: 238 VDIRRVWNLGSIILQNIDTTKLIDFLQWLSNVYSNKNRSFVQGINYRNDQTNFNGGSRRL 297
           +DI   +  G+ I  +I    L    +W SNV   KN +   G    N Q+NF G     
Sbjct: 206 IDISTGFATGNKIKDDIIAANLPTVKEWKSNVTKYKNSNIALGSVDHNQQSNFGG----- 260

Query: 298 TPLYTKTLLWHKLTLSSDSETCESEI-DSLIEQIAEMVVIPPYSEDNEIWYIFALCHLVK 356
                          + D E  ES I DS  E + +  V+    ED++ W+   +C L  
Sbjct: 261 -------------VGNIDEEYIESPIFDS--EVVKKASVVSYLLEDDKYWFTL-ICELSN 304

Query: 357 ADNLSEKLYFMSRRNPEVDEMDTYPYDT 384
             +   K Y+    + +V  +DT+P ++
Sbjct: 305 GKSRKLKRYYQDFYDLQVKLLDTFPSES 332

>TPHA0E00680 Chr5 (129553..131043) [1491 bp, 496 aa] {ON} Anc_7.426
           YER122C
          Length = 496

 Score = 31.2 bits (69), Expect = 5.8,   Method: Compositional matrix adjust.
 Identities = 32/102 (31%), Positives = 41/102 (40%), Gaps = 25/102 (24%)

Query: 125 ESFEKWESNNLKRQRHVNKNFITYYRFKKTRKQ----------------IDKKYKVKTMH 168
            + +KW  NNL+R +H        Y  K   KQ                I KKYK    H
Sbjct: 71  STLDKWTINNLRRFKHGGNLKAREYFLKNNGKQYLNTSNVDARVKYTSSIAKKYK---EH 127

Query: 169 LNKNVKNNFEL------MIDGFEPINDNNISRNRNLQNYNKH 204
           L K VK + EL      + DG E   DN  S N +  + NK+
Sbjct: 128 LEKAVKKDMELYPSELVLTDGQEADFDNLSSANASADSLNKN 169

>TDEL0H04030 Chr8 complement(690438..691334) [897 bp, 298 aa] {ON}
           Anc_7.48 YAL037W
          Length = 298

 Score = 30.4 bits (67), Expect = 9.8,   Method: Compositional matrix adjust.
 Identities = 24/85 (28%), Positives = 37/85 (43%), Gaps = 11/85 (12%)

Query: 178 ELMIDGFEPINDNN--ISRNRNLQNYNKHH---LSLLTDLMYSNIFKQKWDIAYKCFTFL 232
           E ++  F+P  D    IS N   Q Y+ H+   L LL D    + F      +Y+C T  
Sbjct: 73  EFLMVNFDPTFDQATLISANHVTQQYHYHNSSLLRLLIDHFIKDSFSAAQSDSYRCLTPT 132

Query: 233 LRIPDV------DIRRVWNLGSIIL 251
              PDV      +  R +N G++ +
Sbjct: 133 PETPDVNQLLYGEPERYYNGGNVCV 157

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.317    0.133    0.393 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 49,829,443
Number of extensions: 2383788
Number of successful extensions: 11048
Number of sequences better than 10.0: 84
Number of HSP's gapped: 11401
Number of HSP's successfully gapped: 88
Length of query: 437
Length of database: 53,481,399
Length adjustment: 113
Effective length of query: 324
Effective length of database: 40,524,141
Effective search space: 13129821684
Effective search space used: 13129821684
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 67 (30.4 bits)